2YNCC

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
370
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFLYKVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 116
structure length 370
sequence length 384
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
C PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncC00
4CYQA 2YNDA 2YNEA 2WUUA 3H5ZA 3IWEA 4UFVA 4BBHA 4CGMA 5G21A 4B14A 4C2ZA 4CYPA 5A28A 2WSAA 4UCPA 4C68A 5AG7A 3IU1A 4UCNA 5G20A 4CYNA 4B11A 4A31A 4UFXA 4CGLA 4B10A 4B13A 4CGOA 4A2ZA 4CAEA 4C7IA 4A32A 5AG4A 4CYOA 2YNCA 5A27A 5G1ZA 4C2YA 4CAFA 4UFWA 5AG5A 5AG6A 3IU2A 4C2XA 4CGNA 4UCMA 4A30A 5G22A 5AGEA 4A33A 4C7HA 4CGPA 4A95A 4B12A 2YNCC 3JTKA
chains in the Genus database with same CATH superfamily
3BHXA 4FD4A 1Y0RA 2FL4A 2PJBA 3W6SA 4H89A 1CM0A 3F5BA 4GS4A 1YVOA 4RI1A 1ELLP 3BXMA 2C1CA 1Z4EA 2D4PA 3F0AA 3NFZA 4MY0A 1M4IA 4R57A 5KTCA 2PJ6A 4Z65A 3CT9A 5GCNA 4LX9A 2PJ0A 1OBRA 2ZW6A 2WYRA 2OH1A 2NYQA 3HLPA 2XEIA 2D4OA 1RTQA 3FEEA 1EE3P 4Y49C 1IY7A 1ZO0A 4FD6A 4TNUA 4Q7AA 3S6KA 2GFQA 1IGBA 1AUGA 2ARHA 3GB0A 4DJLA 4FAIA 5CPAA 2EK9A 3KI9A 5H86A 2REEA 3S9NA 2G3TA 2DF5A 4AVAA 4PXDA 1BPNA 4XPDC 3KHXA 4DUKA 2OB0A 2Q4ZA 2QVPA 3CXPA 2DPTA 3S6GA 4MFQA 2P6GA 3SXOA 5HVHA 3CPXA 3I3GA 4XPKA 4U5YA 3P2FA 5AG4A 5CBMA 3LMSA 5G1ZA 1V0CA 3T90A 5LRKA 4RN7A 3NA6A 4NGQA 5HVFA 3MGDA 2V8DA 2PJ9A 3FNCA 3R9FA 1YW4A 1JWQA 4A33A 4CGPA 3DNSA 1Y9WA 2XEFA 2ZOFA 2CIJA 5H84A 4KLVA 5BWAB 3TO6A 1QSNA 3IWEA 5EMIA 4PQAA 1QSTA 2FT0A 5KTAA 3CPAA 4CYNA 2VZYA 1IOIA 2CTCA 5LYIA 3IFEA 1XF8A 4P4FA 4BMHA 5K8OA 3WABA 1YX0A 3SHPA 4JXRA 1NE9A 3W6XA 4KUBA 3KHZA 3BI0A 3D7FA 1KUYA 1CG2A 3GLJA 4MFPA 1AMPA 3PBEA 2DPSA 3QNVA 3H8FA 4FWUA 2PRBA 4R76A 1XOVA 4PSXA 4NXYA 2B58A 2QJ8A 1M4LA 4MY3A 5HXDA 4OP4A 1NMTA 1Y0YA 3R9GA 3WT4A 1UWYA 1SQHA 2AFZA 2WPWA 2Z10A 2WUUA 2BO9A 2BUEA 2K5TA 4NJRA 4Q38A 3W91A 3ZJ0A 4B5PA 4C2ZA 4FBEA 2G3AA 4P4JA 2Z11A 5DS0A 3ZZIA 3EC4A 2Z0ZA 4OIDA 1YLOA 3FBUA 1M4GA 3TOBA 5CNPA 3OWCA 3TO7A 1KZFA 4B13A 2REFA 2GE3A 3S9LA 3R96A 1Q2YA 3RNZA 2VI7A 4ZY2A 1BOBA 2Q7SA 4B5PB 1X12A 2ATRA 2YNCA 2O4HA 1WK4A 3QAHA 3T9YA 2AE6A 4AVCA 4CAXA 1XIXA 3D67A 4IAVA 4JZ0A 1GYTA 4PXEA 3S6FA 2KCWA 1L0CA 3PBBA 3GUXA 4MCSA 4UEZA 3IU2A 1MJ9A 4MMOA 5J8CA 4UCMA 2CTBA 2PJ5A 2OU2A 4P6YA 3TTHA 1F2PA 4A39A 2P0WA 2AFWA 2HUZA 4CS0B 1LAPA 3LACA 4EMEA 5EBVA 1R3NA 2CNSA 1YR0A 3PGPA 2Q51A 1YGHA 4GXHA 3IIBA 3D8PA 4MHNA 1WWZA 5K8PA 2GREA 3VH9A 8CPAA 2RFHA 4R8FA 3SI1A 6CPAA 5AG7A 4CAVA 5JM6A 1KUVA 2PR1A 2Z3OA 3KASA 2PRQA 4F9VA 2ZEMA 3LODA 1ZG9A 1IYKA 2J8RA 3HUVA 3NE8A 3PFEA 1XRYA 2Z3KA 5I4MA 1HEEA 2CXAA 4ZY0A 4ONWA 4EWTA 3TC8A 4AG9A 3BLNA 4UBRA 2FSRA 1M1DA 1CX8A 4PXCA 3EFAA 5G22A 2GANA 3PFOA 1F2OA 1P4NA 2YNCC 2IL4A 4X5KA 2G0BA 4MXUA 4CYQA 1R57A 2YNDA 1Y7RA 3B3WA 3H5ZA 4IK2A 4LUAA 4OKOA 2WPXA 5D29A 1TIQA 1XMBA 2VL1A 4K3NA 4ZYQA 2POKA 4NSQA 4C68A 2ZEEA 4P45A 4MHPA 2B5GA 3FF3A 4NGRA 4P10A 4B11A 3B3TA 3N5FA 5HH1A 2EVNA 4OC0A 3D7DA 2I79A 2R8VA 1VHSA 3IWGA 4UWIA 4CAFA 2V8GA 4P4BA 2GLFA 3WR7A 4CAWA 5HMNA 3SXNA 3WC7A 3B3CA 2Q4YA 4YU9A 1BPMA 3H8EA 5F46A 2ZEOA 3FJUA 4KOUA 3WC5A 4A95A 4DYOA 2JEVA 5LYFA 1ON0A 1TKFA 3B3VA 2PIYA 2R1IA 2Q4VA 2I3CA 2PC1A 4H2KA 3E0KA 2JEWA 1ZLHA 3FXTA 2OOTA 2O28A 1IIDA 4U9YA 4UF4A 5IX3A 2FCKA 4F9UA 4MCRA 3DSBA 2ANPA 4UFXA 3KZWA 1TF8A 2IQ6A 3V8IA 2QECA 4HNYB 2QYVA 2EWBA 1HDUA 2Q0YA 4KLWA 4UWJA 4OIWA 4KORA 4KOWA 3VWEA 1M44A 1S7FA 5D8NA 4C2YA 4UFWA 7CPAA 1YVKA 2FVGA 2PJ7A 4Y49B 2EUIA 2VBQA 4NJQA 3K9UA 1I12A 1A2ZA 2PVVA 4G1PA 5KTDA 3FVLA 1LOKA 1PU9A 3F8KA 1I21A 3I9SA 4AVBA 3QB8A 1Z8TA 4K30A 4CRZB 4QB9A 3B2YA 2YNEA 2AFXA 4DNCA 2EO8A 2XEGA 5A28A 1Z8LA 3GIUA 2BSWA 3BI1A 3KQXA 3B7IA 4R6TA 2GLJA 4M6HA 2HV2A 1YMEA 4EFDA 4AXVA 1FT7A 4MHDA 4MI4A 4P4DA 4A94A 4R7MA 4CYOA 5I0CA 4FD7A 2PVWA 2J8NA 3D2MA 4KUAA 4EVYA 4YRHA 2PJ2A 3N7ZA 2Z3NA 1IYLA 3TX8A 1CPXA 3SJEA 2JLMA 4KSAA 1QSRA 2PJ4A 3I1UA 2PR8A 4IF5A 4MRIA 4X8IA 4KOVA 3R1KA 1QMUA 2Z3PA 3H4QA 3VARA 2V77A 2GU2A 5FVJA 3KR4A 2PJAA 3B35A 3CDXA 3R95A 4B12A 5K8MA 3MN8A 2ZW7A 5F48A 2J9AA 4CPAA 1S3ZA 1Z9UA 3PB8X 1PYTB 2ODFA 2Q44A 3LWUA 4LQGA 4XNHC 5G21A 4CGMA 2WSAA 4E8OA 1Z4RA 2QIRA 3WC6A 4NGNA 1VKCA 1YLEA 4J3GA 3D68A 1MK4A 4CGLA 4OC3A 2HC9A 2DEAA 2P6FA 3FB3A 4M3SA 1UFHA 4L89A 4MFKA 4X2TA 1ZLIA 5F09A 4UIAA 2FXFA 1VHEA 2F8HA 5AG5A 2OZUA 3DR6A 1ARLA 4NEXA 4GM5A 5JGFA 2R7HA 2ZXVA 2JDCA 3H8GA 2RB7A 5JH9A 4O23A 4NGTA 3FMCA 2V8HA 2FIAA 3L2NA 1KWMA 3V7ZA 2VZZA 4BBHA 4CYPA 2JBKA 1MJBA 4UCPA 1YQEA 1YW6A 2VEZA 2Y0MA 4A38A 4E0AA 2ZEFA 2ZEHA 3S6HA 1I1DA 3FEDA 3P2HA 4PSWA 4B10A 3KL9A 3KR5A 4KSFA 1KUXA 4CGOA 2BOAA 2CF4A 4R3LA 4A32A 4F6AA 2NSMA 4OADA 4UA3A 4X3RA 3SI0A 4NGSA 5F49A 4B5OA 4YWYA 5ELYA 2AJ6A 1MJAA 2IJZA 1N71A 4MHYA 1BAVA 2AFOA 3DLJA 1ZG8A 4OLLA 3PB7X 2EBJA 1QSMA 4WWVA 1NSAA 2JBJA 4RS2A 3ISZA 3KKWA 2C27A 2C6CA 3V38A 2I00A 1Q7LA 5DWMA 3IC1A 4ZX9A 5LRGA 5JPHA 2Q04A 1YSJA 5G20A 5C88A 4II9A 1IU8A 3FYNA 1PCAA 1OZPA 2OZGA 4L8AA 2V8VA 3FRMA 3D66A 3NH5A 1VHOA 4ZI6A 3BJ7A 3G3SA 2B3VA 1H8LA 1R43A 2AFSA 3EY5A 1Z8XA 3EO4A 1X10A 2FS5A 2BCOA 2FIWA 4IHMA 3B8GA 4R3KA 5LRJA 3TCVA 2PDOA 2ZEDA 3FH4A 1DTDA 4A37A 4KVOE 3TO9A 3JUWA 4ZY1A 4NCZA 3TE4A 3C26A 1LFWA 3PEIA 4B6ZA 4R87A 3A9LA 2AFUA 2HQYA 2Q7BA 2F7VA 3RZAA 5ISVA 1TKHA 2EK8A 4XPDB 4MFLA 1Z8WA 2R98A 2ZPAA 2YGWA 3CXSA 2ZEPA 1IICA 1TKJA 3LD2A 1ELMP 3CXQA 4W9YA 1LAMA 3UY5A 4P4EA 4A31A 2BL1A 1XEBA 2Q43A 3DDDA 4RUHA 4JWPA 5IB9A 1YREA 3IWWA 1Y7EA 4OAEA 3FX6A 3D7HA 3GY9A 3B3SA 3DGVA 1QQ9A 2AFMA 1P0HA 3IGRA 4YGOA 1B6BA 4MCPA 2C6PA 2QMLA 4XPLA 4NGMA 2GIVA 4MBUA 4BINA 5AG6A 4OC4A 4OC2A 1LCPA 4OC1A 2P6EA 2CNTA 4WJBA 4HKFA 1BLLE 4JD6A 4KS9A 4CRYB 1ARMA 1TF9A 1QSOA 4IUSA 3JTKA 4KOXA 4UEFA 4KOTA 3G8WA 4M85A 2HB6A 4XNHB 3IJ3A 5DWNA 4OC5A 3PB4X 4P44A 2ZW4A 2X7BA 3NE7A 4LQ6A 1B87A 1FNOA 1VIXA 2WZNA 4HNXB 1Z5RA 2B5GB 4BD9A 3PZJA 4A2ZA 4AG7A 1XMTA 3EXNA 3NH4A 4MJ8A 2ZELA 5LYLA 5JQ4A 2PCUA 3ISXA 1ZG7A 4ZBGA 5F47A 1BO4A 4FUUA 5E96A 3RBUA 4HPSA 1CP6A 4NGPA 4HNWB 4JXQA 4MHZA 4I49A 4PK2A 5AGEA 3TFYA 4U9ZA 2FE7A 4C7HA 2VXKA 3RAMA 2JDDA 1Y9KA 3D3SA 4JJXA 3JRUA 2CY2A 4UEEA 3RYOA 5EC4A 2PSWA 2PJ3A 3GKRA 5IV0A 4ORFA 3IU1A 2B4DB 4ONUA 1NSLA 4KVXA 4FD5A 1IOFA 1YK3A 3SJXA 4F0XA 3K2KA 3R9EA 1CJWA 1S7NA 2VQYA 3IEHA 5C82A 3JVNA 4KVME 2PQ8A 5A27A 3IO1A 4PV6A 3PB6X 1CBXA 3RO0A 2ZOGA 3SJFA 1JQGA 3GYAA 4E2AA 2PJ1A 3TT2A 4CGNA 4YFJA 1CP7A 4A30A 2B4DA 1PUAA 2Z3LA 3T8WA 4F0YA 3NH8A 4ZGYB 1S7LA 4QUSA 2IMOA 2ABZA 2G9DA 2A4NA 1FY7A 5HVGA 1VGYA 4UFVA 4KOYA 1F57A 4H6UA 4NF1A 1DE4C 2C6GA 1S5KA 1TXRA 1LANA 2ZW5A 4R9MA 1Z2LA 2CNMA 4TWEA 5K8NA 3D2PA 2ZENA 4M6IA 3BJ8A 5THWA 3SI2A 1AYEA 4CAEA 4F8ZA 2F5IA 1Q2DA 4ZX8A 3FECA 3CZXA 4P4IA 3VWDA 2RC4A 4Q36A 2Z3MA 1LRZA 3D7GA 3FIXA 4H6ZA 4KOSA 4QBJA 3QAYA 2NMTA 4KSIA 4M6GA 1GHEA 4MFZA 4OMEA 2J8MA 4KZTA 3S9MA 4AB7A 3SJGA 5J8FA 3VATA 4B14A 3MRUA 4PPZA 5IB0A 2XEJA 1S7KA 4JLYA 4QVTA 1RO5A 2BEIA 2H5MA 2PJCA 4JYWA 4UCNA 4QC6A 2PIZA 2OR4A 1M4DA 1CPSA 1J4JA 1XFOA 3PRTA 5LYDA 2OZHA 4C7IA 3PP9A 5J1QA 2B4BA 2PE3A 1RXTA 2B3UA 1XJOA 1Q2CA 1IB1E 3D4UA 2ZEGA 3DR8A 4PK3A 3KQZA 4MCQA 1XE4A 3PB9X 4NFRA 1S60A 3K9TA 4C2XA 4UIBA 3KGQA 1K4JA 2O53A 3TOAA 4MFJA 1U6MA 1XBUA 1HDQA 4PXBA 2DXQA 2PJ8A
chains in the Genus database with same CATH topology
4FD4A 2FL4A 3W6SA 4H89A 1CM0A 3F5BA 4GS4A 1YVOA 4RI1A 1Z4EA 2D4PA 3F0AA 4R57A 4MY0A 1M4IA 5KTCA 5GCNA 4LX9A 2ZW6A 2OH1A 2D4OA 4Y49C 1ZO0A 4FD6A 3S6KA 2ARHA 5H86A 2REEA 2G3TA 4AVAA 4XPDC 2OB0A 3CXPA 2DPTA 3S6GA 4MFQA 2P6GA 3SXOA 3I3GA 4XPKA 4U5YA 3P2FA 5AG4A 5G1ZA 1V0CA 3T90A 3MGDA 3FNCA 3R9FA 4A33A 4CGPA 3DNSA 1Y9WA 5H84A 4KLVA 5BWAB 3TO6A 1QSNA 3IWEA 1QSTA 2FT0A 5KTAA 4CYNA 2VZYA 1XF8A 4BMHA 1YX0A 3SHPA 4JXRA 1NE9A 3W6XA 4KUBA 1KUYA 4MFPA 2DPSA 2PRBA 4PSXA 4NXYA 2B58A 4MY3A 1NMTA 3R9GA 1SQHA 2WPWA 2Z10A 2WUUA 2K5TA 2BUEA 4Q38A 3ZJ0A 3W91A 4B5PA 4C2ZA 2G3AA 2Z11A 3ZZIA 3EC4A 2Z0ZA 3FBUA 1M4GA 3TOBA 5CNPA 3OWCA 3TO7A 1KZFA 4B13A 2REFA 2GE3A 3R96A 1Q2YA 2VI7A 1BOBA 4B5PB 3QAHA 2ATRA 2YNCA 1WK4A 3T9YA 4CAXA 2AE6A 4AVCA 1XIXA 3S6FA 2KCWA 1L0CA 3IU2A 1MJ9A 5J8CA 4UCMA 2OU2A 3TTHA 2P0WA 4CS0B 2HUZA 5EBVA 2CNSA 1YR0A 3PGPA 1YGHA 3D8PA 1WWZA 5AG7A 4CAVA 1KUVA 2PR1A 2Z3OA 3LODA 1IYKA 2J8RA 2Z3KA 2CXAA 4AG9A 3BLNA 4UBRA 2FSRA 1M1DA 3EFAA 5G22A 2GANA 1P4NA 2YNCC 2IL4A 4X5KA 2G0BA 4CYQA 1R57A 2YNDA 1Y7RA 3H5ZA 4LUAA 2WPXA 1TIQA 4NSQA 4C68A 2B5GA 4B11A 5HH1A 2EVNA 2I79A 2R8VA 1VHSA 3IWGA 4UWIA 4CAFA 3WR7A 4CAWA 5HMNA 3SXNA 2Q4YA 5F46A 4A95A 4KOUA 2JEVA 1ON0A 2R1IA 2Q4VA 2PC1A 3E0KA 3FXTA 2O28A 1IIDA 4U9YA 5IX3A 2FCKA 3DSBA 4UFXA 3V8IA 2QECA 4HNYB 3VWEA 2Q0YA 4KLWA 4UWJA 4C2YA 4KORA 4KOWA 1M44A 1S7FA 4UFWA 1YVKA 4Y49B 2EUIA 2VBQA 3K9UA 1I12A 5KTDA 3F8KA 1PU9A 4AVBA 1I21A 3I9SA 3QB8A 4K30A 4CRZB 4QB9A 2YNEA 4DNCA 5A28A 2BSWA 2HV2A 4MHDA 4MI4A 4CYOA 5I0CA 4FD7A 2J8NA 3D2MA 4KUAA 4EVYA 4YRHA 3N7ZA 2Z3NA 1IYLA 2JLMA 4KSAA 1QSRA 4IF5A 2PR8A 4KOVA 3R1KA 2Z3PA 3H4QA 5FVJA 4B12A 3R95A 2ZW7A 5F48A 1S3ZA 1Z9UA 2Q44A 5G21A 4CGMA 4XNHC 2WSAA 4E8OA 1Z4RA 2QIRA 1VKCA 1YLEA 4J3GA 1MK4A 4CGLA 2P6FA 3FB3A 4M3SA 1UFHA 4L89A 4MFKA 2FXFA 5AG5A 2OZUA 3DR6A 4NEXA 2R7HA 2ZXVA 2JDCA 2FIAA 2VZZA 4BBHA 4CYPA 1MJBA 4UCPA 2VEZA 2Y0MA 4E0AA 3S6HA 1I1DA 3P2HA 4PSWA 4B10A 4KSFA 1KUXA 4CGOA 4R3LA 4A32A 4F6AA 4OADA 4UA3A 5F49A 4B5OA 2AJ6A 1MJAA 1N71A 4OLLA 1QSMA 4RS2A 3KKWA 2C27A 2I00A 5DWMA 5JPHA 4II9A 2Q04A 5G20A 5C88A 3FYNA 1OZPA 2OZGA 4L8AA 3FRMA 3BJ7A 3G3SA 2B3VA 3EY5A 3EO4A 2FS5A 4R3KA 3TCVA 2FIWA 3B8GA 2PDOA 4KVOE 3TO9A 3JUWA 4NCZA 3TE4A 3C26A 4R87A 3A9LA 2HQYA 2Q7BA 5ISVA 4XPDB 4MFLA 2R98A 2ZPAA 2YGWA 3CXSA 1IICA 3LD2A 3CXQA 3UY5A 4A31A 2BL1A 1XEBA 3DDDA 4JWPA 1YREA 4OAEA 3GY9A 3IGRA 4YGOA 1P0HA 1B6BA 2QMLA 4XPLA 2GIVA 4MBUA 5AG6A 2P6EA 2CNTA 4HKFA 4JD6A 4KS9A 4CRYB 1QSOA 4IUSA 3JTKA 4KOXA 4KOTA 3G8WA 4M85A 5DWNA 4XNHB 2ZW4A 2X7BA 3NE7A 1B87A 4HNXB 2B5GB 3PZJA 4A2ZA 4AG7A 1XMTA 3EXNA 4MJ8A 5JQ4A 4ZBGA 5F47A 1BO4A 5E96A 4HNWB 4JXQA 4I49A 4PK2A 5AGEA 3TFYA 4U9ZA 2FE7A 4C7HA 2VXKA 2JDDA 1Y9KA 3D3SA 4JJXA 2CY2A 3RYOA 5EC4A 2PSWA 3GKRA 5IV0A 4ORFA 3IU1A 2B4DB 4ONUA 1NSLA 4KVXA 4FD5A 1YK3A 4F0XA 3R9EA 1CJWA 1S7NA 2VQYA 5C82A 3JVNA 4KVME 2PQ8A 5A27A 4PV6A 3GYAA 4E2AA 3TT2A 4CGNA 4YFJA 4A30A 2B4DA 1PUAA 2Z3LA 4F0YA 4ZGYB 1S7LA 4QUSA 2A4NA 1FY7A 4UFVA 4KOYA 4H6UA 4NF1A 1S5KA 4R9MA 2ZW5A 2CNMA 3D2PA 3BJ8A 4CAEA 2F5IA 1Q2DA 3VWDA 2RC4A 4Q36A 2Z3MA 1LRZA 3FIXA 4H6ZA 4KOSA 4QBJA 2NMTA 1GHEA 4MFZA 2J8MA 4KZTA 4AB7A 5J8FA 4B14A 5IB0A 1S7KA 4JLYA 4QVTA 1RO5A 2BEIA 2H5MA 4UCNA 4QC6A 1M4DA 1J4JA 2OZHA 4C7IA 3PP9A 2B4BA 1RXTA 2B3UA 3DR8A 1Q2CA 1IB1E 4PK3A 1XE4A 1S60A 4C2XA 1K4JA 3TOAA 4MFJA 1U6MA 2DXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYQ A;  2YND A;  2YNE A;  2WUU A;  3H5Z A;  3IWE A;  4UFV A;  4BBH A;  4CGM A;  5G21 A;  4B14 A;  4C2Z A;  4CYP A;  5A28 A;  2WSA A;  4UCP A;  4C68 A;  5AG7 A;  3IU1 A;  4UCN A;  5G20 A;  4CYN A;  4B11 A;  4A31 A;  4UFX A;  4CGL A;  4B10 A;  4B13 A;  4CGO A;  4A2Z A;  4CAE A;  4C7I A;  4A32 A;  5AG4 A;  4CYO A;  2YNC A;  5A27 A;  5G1Z A;  4C2Y A;  4CAF A;  4UFW A;  5AG5 A;  5AG6 A;  3IU2 A;  4C2X A;  4CGN A;  4UCM A;  4A30 A;  5G22 A;  5AGE A;  4A33 A;  4C7H A;  4CGP A;  4A95 A;  4B12 A;  2YNC C;  3JTK A; 
#chains in the Genus database with same CATH topology
 3BHX A;  4FD4 A;  1Y0R A;  2FL4 A;  2PJB A;  3W6S A;  4H89 A;  1CM0 A;  3F5B A;  4GS4 A;  1YVO A;  4RI1 A;  1ELL P;  3BXM A;  2C1C A;  1Z4E A;  2D4P A;  3F0A A;  3NFZ A;  4MY0 A;  1M4I A;  4R57 A;  5KTC A;  2PJ6 A;  4Z65 A;  3CT9 A;  5GCN A;  4LX9 A;  2PJ0 A;  1OBR A;  2ZW6 A;  2WYR A;  2OH1 A;  2NYQ A;  3HLP A;  2XEI A;  2D4O A;  1RTQ A;  3FEE A;  1EE3 P;  4Y49 C;  1IY7 A;  1ZO0 A;  4FD6 A;  4TNU A;  4Q7A A;  3S6K A;  2GFQ A;  1IGB A;  1AUG A;  2ARH A;  3GB0 A;  4DJL A;  4FAI A;  5CPA A;  2EK9 A;  3KI9 A;  5H86 A;  2REE A;  3S9N A;  2G3T A;  2DF5 A;  4AVA A;  4PXD A;  1BPN A;  4XPD C;  3KHX A;  4DUK A;  2OB0 A;  2Q4Z A;  2QVP A;  3CXP A;  2DPT A;  3S6G A;  4MFQ A;  2P6G A;  3SXO A;  5HVH A;  3CPX A;  3I3G A;  4XPK A;  4U5Y A;  3P2F A;  5AG4 A;  5CBM A;  3LMS A;  5G1Z A;  1V0C A;  3T90 A;  5LRK A;  4RN7 A;  3NA6 A;  4NGQ A;  5HVF A;  3MGD A;  2V8D A;  2PJ9 A;  3FNC A;  3R9F A;  1YW4 A;  1JWQ A;  4A33 A;  4CGP A;  3DNS A;  1Y9W A;  2XEF A;  2ZOF A;  2CIJ A;  5H84 A;  4KLV A;  5BWA B;  3TO6 A;  1QSN A;  3IWE A;  5EMI A;  4PQA A;  1QST A;  2FT0 A;  5KTA A;  3CPA A;  4CYN A;  2VZY A;  1IOI A;  2CTC A;  5LYI A;  3IFE A;  1XF8 A;  4P4F A;  4BMH A;  5K8O A;  3WAB A;  1YX0 A;  3SHP A;  4JXR A;  1NE9 A;  3W6X A;  4KUB A;  3KHZ A;  3BI0 A;  3D7F A;  1KUY A;  1CG2 A;  3GLJ A;  4MFP A;  1AMP A;  3PBE A;  2DPS A;  3QNV A;  3H8F A;  4FWU A;  2PRB A;  4R76 A;  1XOV A;  4PSX A;  4NXY A;  2B58 A;  2QJ8 A;  1M4L A;  4MY3 A;  5HXD A;  4OP4 A;  1NMT A;  1Y0Y A;  3R9G A;  3WT4 A;  1UWY A;  1SQH A;  2AFZ A;  2WPW A;  2Z10 A;  2WUU A;  2BO9 A;  2BUE A;  2K5T A;  4NJR A;  4Q38 A;  3W91 A;  3ZJ0 A;  4B5P A;  4C2Z A;  4FBE A;  2G3A A;  4P4J A;  2Z11 A;  5DS0 A;  3ZZI A;  3EC4 A;  2Z0Z A;  4OID A;  1YLO A;  3FBU A;  1M4G A;  3TOB A;  5CNP A;  3OWC A;  3TO7 A;  1KZF A;  4B13 A;  2REF A;  2GE3 A;  3S9L A;  3R96 A;  1Q2Y A;  3RNZ A;  2VI7 A;  4ZY2 A;  1BOB A;  2Q7S A;  4B5P B;  1X12 A;  2ATR A;  2YNC A;  2O4H A;  1WK4 A;  3QAH A;  3T9Y A;  2AE6 A;  4AVC A;  4CAX A;  1XIX A;  3D67 A;  4IAV A;  4JZ0 A;  1GYT A;  4PXE A;  3S6F A;  2KCW A;  1L0C A;  3PBB A;  3GUX A;  4MCS A;  4UEZ A;  3IU2 A;  1MJ9 A;  4MMO A;  5J8C A;  4UCM A;  2CTB A;  2PJ5 A;  2OU2 A;  4P6Y A;  3TTH A;  1F2P A;  4A39 A;  2P0W A;  2AFW A;  2HUZ A;  4CS0 B;  1LAP A;  3LAC A;  4EME A;  5EBV A;  1R3N A;  2CNS A;  1YR0 A;  3PGP A;  2Q51 A;  1YGH A;  4GXH A;  3IIB A;  3D8P A;  4MHN A;  1WWZ A;  5K8P A;  2GRE A;  3VH9 A;  8CPA A;  2RFH A;  4R8F A;  3SI1 A;  6CPA A;  5AG7 A;  4CAV A;  5JM6 A;  1KUV A;  2PR1 A;  2Z3O A;  3KAS A;  2PRQ A;  4F9V A;  2ZEM A;  3LOD A;  1ZG9 A;  1IYK A;  2J8R A;  3HUV A;  3NE8 A;  3PFE A;  1XRY A;  2Z3K A;  5I4M A;  1HEE A;  2CXA A;  4ZY0 A;  4ONW A;  4EWT A;  3TC8 A;  4AG9 A;  3BLN A;  4UBR A;  2FSR A;  1M1D A;  1CX8 A;  4PXC A;  3EFA A;  5G22 A;  2GAN A;  3PFO A;  1F2O A;  1P4N A;  2YNC C;  2IL4 A;  4X5K A;  2G0B A;  4MXU A;  4CYQ A;  1R57 A;  2YND A;  1Y7R A;  3B3W A;  3H5Z A;  4IK2 A;  4LUA A;  4OKO A;  2WPX A;  5D29 A;  1TIQ A;  1XMB A;  2VL1 A;  4K3N A;  4ZYQ A;  2POK A;  4NSQ A;  4C68 A;  2ZEE A;  4P45 A;  4MHP A;  2B5G A;  3FF3 A;  4NGR A;  4P10 A;  4B11 A;  3B3T A;  3N5F A;  5HH1 A;  2EVN A;  4OC0 A;  3D7D A;  2I79 A;  2R8V A;  1VHS A;  3IWG A;  4UWI A;  4CAF A;  2V8G A;  4P4B A;  2GLF A;  3WR7 A;  4CAW A;  5HMN A;  3SXN A;  3WC7 A;  3B3C A;  2Q4Y A;  4YU9 A;  1BPM A;  3H8E A;  5F46 A;  2ZEO A;  3FJU A;  4KOU A;  3WC5 A;  4A95 A;  4DYO A;  2JEV A;  5LYF A;  1ON0 A;  1TKF A;  3B3V A;  2PIY A;  2R1I A;  2Q4V A;  2I3C A;  2PC1 A;  4H2K A;  3E0K A;  2JEW A;  1ZLH A;  3FXT A;  2OOT A;  2O28 A;  1IID A;  4U9Y A;  4UF4 A;  5IX3 A;  2FCK A;  4F9U A;  4MCR A;  3DSB A;  2ANP A;  4UFX A;  3KZW A;  1TF8 A;  2IQ6 A;  3V8I A;  2QEC A;  4HNY B;  2QYV A;  2EWB A;  1HDU A;  2Q0Y A;  4KLW A;  4UWJ A;  4OIW A;  4KOR A;  4KOW A;  3VWE A;  1M44 A;  1S7F A;  5D8N A;  4C2Y A;  4UFW A;  7CPA A;  1YVK A;  2FVG A;  2PJ7 A;  4Y49 B;  2EUI A;  2VBQ A;  4NJQ A;  3K9U A;  1I12 A;  1A2Z A;  2PVV A;  4G1P A;  5KTD A;  3FVL A;  1LOK A;  1PU9 A;  3F8K A;  1I21 A;  3I9S A;  4AVB A;  3QB8 A;  1Z8T A;  4K30 A;  4CRZ B;  4QB9 A;  3B2Y A;  2YNE A;  2AFX A;  4DNC A;  2EO8 A;  2XEG A;  5A28 A;  1Z8L A;  3GIU A;  2BSW A;  3BI1 A;  3KQX A;  3B7I A;  4R6T A;  2GLJ A;  4M6H A;  2HV2 A;  1YME A;  4EFD A;  4AXV A;  1FT7 A;  4MHD A;  4MI4 A;  4P4D A;  4A94 A;  4R7M A;  4CYO A;  5I0C A;  4FD7 A;  2PVW A;  2J8N A;  3D2M A;  4KUA A;  4EVY A;  4YRH A;  2PJ2 A;  3N7Z A;  2Z3N A;  1IYL A;  3TX8 A;  1CPX A;  3SJE A;  2JLM A;  4KSA A;  1QSR A;  2PJ4 A;  3I1U A;  2PR8 A;  4IF5 A;  4MRI A;  4X8I A;  4KOV A;  3R1K A;  1QMU A;  2Z3P A;  3H4Q A;  3VAR A;  2V77 A;  2GU2 A;  5FVJ A;  3KR4 A;  2PJA A;  3B35 A;  3CDX A;  3R95 A;  4B12 A;  5K8M A;  3MN8 A;  2ZW7 A;  5F48 A;  2J9A A;  4CPA A;  1S3Z A;  1Z9U A;  3PB8 X;  1PYT B;  2ODF A;  2Q44 A;  3LWU A;  4LQG A;  4XNH C;  5G21 A;  4CGM A;  2WSA A;  4E8O A;  1Z4R A;  2QIR A;  3WC6 A;  4NGN A;  1VKC A;  1YLE A;  4J3G A;  3D68 A;  1MK4 A;  4CGL A;  4OC3 A;  2HC9 A;  2DEA A;  2P6F A;  3FB3 A;  4M3S A;  1UFH A;  4L89 A;  4MFK A;  4X2T A;  1ZLI A;  5F09 A;  4UIA A;  2FXF A;  1VHE A;  2F8H A;  5AG5 A;  2OZU A;  3DR6 A;  1ARL A;  4NEX A;  4GM5 A;  5JGF A;  2R7H A;  2ZXV A;  2JDC A;  3H8G A;  2RB7 A;  5JH9 A;  4O23 A;  4NGT A;  3FMC A;  2V8H A;  2FIA A;  3L2N A;  1KWM A;  3V7Z A;  2VZZ A;  4BBH A;  4CYP A;  2JBK A;  1MJB A;  4UCP A;  1YQE A;  1YW6 A;  2VEZ A;  2Y0M A;  4A38 A;  4E0A A;  2ZEF A;  2ZEH A;  3S6H A;  1I1D A;  3FED A;  3P2H A;  4PSW A;  4B10 A;  3KL9 A;  3KR5 A;  4KSF A;  1KUX A;  4CGO A;  2BOA A;  2CF4 A;  4R3L A;  4A32 A;  4F6A A;  2NSM A;  4OAD A;  4UA3 A;  4X3R A;  3SI0 A;  4NGS A;  5F49 A;  4B5O A;  4YWY A;  5ELY A;  2AJ6 A;  1MJA A;  2IJZ A;  1N71 A;  4MHY A;  1BAV A;  2AFO A;  3DLJ A;  1ZG8 A;  4OLL A;  3PB7 X;  2EBJ A;  1QSM A;  4WWV A;  1NSA A;  2JBJ A;  4RS2 A;  3ISZ A;  3KKW A;  2C27 A;  2C6C A;  3V38 A;  2I00 A;  1Q7L A;  5DWM A;  3IC1 A;  4ZX9 A;  5LRG A;  5JPH A;  2Q04 A;  1YSJ A;  5G20 A;  5C88 A;  4II9 A;  1IU8 A;  3FYN A;  1PCA A;  1OZP A;  2OZG A;  4L8A A;  2V8V A;  3FRM A;  3D66 A;  3NH5 A;  1VHO A;  4ZI6 A;  3BJ7 A;  3G3S A;  2B3V A;  1H8L A;  1R43 A;  2AFS A;  3EY5 A;  1Z8X A;  3EO4 A;  1X10 A;  2FS5 A;  2BCO A;  2FIW A;  4IHM A;  3B8G A;  4R3K A;  5LRJ A;  3TCV A;  2PDO A;  2ZED A;  3FH4 A;  1DTD A;  4A37 A;  4KVO E;  3TO9 A;  3JUW A;  4ZY1 A;  4NCZ A;  3TE4 A;  3C26 A;  1LFW A;  3PEI A;  4B6Z A;  4R87 A;  3A9L A;  2AFU A;  2HQY A;  2Q7B A;  2F7V A;  3RZA A;  5ISV A;  1TKH A;  2EK8 A;  4XPD B;  4MFL A;  1Z8W A;  2R98 A;  2ZPA A;  2YGW A;  3CXS A;  2ZEP A;  1IIC A;  1TKJ A;  3LD2 A;  1ELM P;  3CXQ A;  4W9Y A;  1LAM A;  3UY5 A;  4P4E A;  4A31 A;  2BL1 A;  1XEB A;  2Q43 A;  3DDD A;  4RUH A;  4JWP A;  5IB9 A;  1YRE A;  3IWW A;  1Y7E A;  4OAE A;  3FX6 A;  3D7H A;  3GY9 A;  3B3S A;  3DGV A;  1QQ9 A;  2AFM A;  1P0H A;  3IGR A;  4YGO A;  1B6B A;  4MCP A;  2C6P A;  2QML A;  4XPL A;  4NGM A;  2GIV A;  4MBU A;  4BIN A;  5AG6 A;  4OC4 A;  4OC2 A;  1LCP A;  4OC1 A;  2P6E A;  2CNT A;  4WJB A;  4HKF A;  1BLL E;  4JD6 A;  4KS9 A;  4CRY B;  1ARM A;  1TF9 A;  1QSO A;  4IUS A;  3JTK A;  4KOX A;  4UEF A;  4KOT A;  3G8W A;  4M85 A;  2HB6 A;  4XNH B;  3IJ3 A;  5DWN A;  4OC5 A;  3PB4 X;  4P44 A;  2ZW4 A;  2X7B A;  3NE7 A;  4LQ6 A;  1B87 A;  1FNO A;  1VIX A;  2WZN A;  4HNX B;  1Z5R A;  2B5G B;  4BD9 A;  3PZJ A;  4A2Z A;  4AG7 A;  1XMT A;  3EXN A;  3NH4 A;  4MJ8 A;  2ZEL A;  5LYL A;  5JQ4 A;  2PCU A;  3ISX A;  1ZG7 A;  4ZBG A;  5F47 A;  1BO4 A;  4FUU A;  5E96 A;  3RBU A;  4HPS A;  1CP6 A;  4NGP A;  4HNW B;  4JXQ A;  4MHZ A;  4I49 A;  4PK2 A;  5AGE A;  3TFY A;  4U9Z A;  2FE7 A;  4C7H A;  2VXK A;  3RAM A;  2JDD A;  1Y9K A;  3D3S A;  4JJX A;  3JRU A;  2CY2 A;  4UEE A;  3RYO A;  5EC4 A;  2PSW A;  2PJ3 A;  3GKR A;  5IV0 A;  4ORF A;  3IU1 A;  2B4D B;  4ONU A;  1NSL A;  4KVX A;  4FD5 A;  1IOF A;  1YK3 A;  3SJX A;  4F0X A;  3K2K A;  3R9E A;  1CJW A;  1S7N A;  2VQY A;  3IEH A;  5C82 A;  3JVN A;  4KVM E;  2PQ8 A;  5A27 A;  3IO1 A;  4PV6 A;  3PB6 X;  1CBX A;  3RO0 A;  2ZOG A;  3SJF A;  1JQG A;  3GYA A;  4E2A A;  2PJ1 A;  3TT2 A;  4CGN A;  4YFJ A;  1CP7 A;  4A30 A;  2B4D A;  1PUA A;  2Z3L A;  3T8W A;  4F0Y A;  3NH8 A;  4ZGY B;  1S7L A;  4QUS A;  2IMO A;  2ABZ A;  2G9D A;  2A4N A;  1FY7 A;  5HVG A;  1VGY A;  4UFV A;  4KOY A;  1F57 A;  4H6U A;  4NF1 A;  1DE4 C;  2C6G A;  1S5K A;  1TXR A;  1LAN A;  2ZW5 A;  4R9M A;  1Z2L A;  2CNM A;  4TWE A;  5K8N A;  3D2P A;  2ZEN A;  4M6I A;  3BJ8 A;  5THW A;  3SI2 A;  1AYE A;  4CAE A;  4F8Z A;  2F5I A;  1Q2D A;  4ZX8 A;  3FEC A;  3CZX A;  4P4I A;  3VWD A;  2RC4 A;  4Q36 A;  2Z3M A;  1LRZ A;  3D7G A;  3FIX A;  4H6Z A;  4KOS A;  4QBJ A;  3QAY A;  2NMT A;  4KSI A;  4M6G A;  1GHE A;  4MFZ A;  4OME A;  2J8M A;  4KZT A;  3S9M A;  4AB7 A;  3SJG A;  5J8F A;  3VAT A;  4B14 A;  3MRU A;  4PPZ A;  5IB0 A;  2XEJ A;  1S7K A;  4JLY A;  4QVT A;  1RO5 A;  2BEI A;  2H5M A;  2PJC A;  4JYW A;  4UCN A;  4QC6 A;  2PIZ A;  2OR4 A;  1M4D A;  1CPS A;  1J4J A;  1XFO A;  3PRT A;  5LYD A;  2OZH A;  4C7I A;  3PP9 A;  5J1Q A;  2B4B A;  2PE3 A;  1RXT A;  2B3U A;  1XJO A;  1Q2C A;  1IB1 E;  3D4U A;  2ZEG A;  3DR8 A;  4PK3 A;  3KQZ A;  4MCQ A;  1XE4 A;  3PB9 X;  4NFR A;  1S60 A;  3K9T A;  4C2X A;  4UIB A;  3KGQ A;  1K4J A;  2O53 A;  3TOA A;  4MFJ A;  1U6M A;  1XBU A;  1HDQ A;  4PXB A;  2DXQ A;  2PJ8 A; 
#chains in the Genus database with same CATH homology
 4FD4 A;  2FL4 A;  3W6S A;  4H89 A;  1CM0 A;  3F5B A;  4GS4 A;  1YVO A;  4RI1 A;  1Z4E A;  2D4P A;  3F0A A;  4R57 A;  4MY0 A;  1M4I A;  5KTC A;  5GCN A;  4LX9 A;  2ZW6 A;  2OH1 A;  2D4O A;  4Y49 C;  1ZO0 A;  4FD6 A;  3S6K A;  2ARH A;  5H86 A;  2REE A;  2G3T A;  4AVA A;  4XPD C;  2OB0 A;  3CXP A;  2DPT A;  3S6G A;  4MFQ A;  2P6G A;  3SXO A;  3I3G A;  4XPK A;  4U5Y A;  3P2F A;  5AG4 A;  5G1Z A;  1V0C A;  3T90 A;  3MGD A;  3FNC A;  3R9F A;  4A33 A;  4CGP A;  3DNS A;  1Y9W A;  5H84 A;  4KLV A;  5BWA B;  3TO6 A;  1QSN A;  3IWE A;  1QST A;  2FT0 A;  5KTA A;  4CYN A;  2VZY A;  1XF8 A;  4BMH A;  1YX0 A;  3SHP A;  4JXR A;  1NE9 A;  3W6X A;  4KUB A;  1KUY A;  4MFP A;  2DPS A;  2PRB A;  4PSX A;  4NXY A;  2B58 A;  4MY3 A;  1NMT A;  3R9G A;  1SQH A;  2WPW A;  2Z10 A;  2WUU A;  2K5T A;  2BUE A;  4Q38 A;  3ZJ0 A;  3W91 A;  4B5P A;  4C2Z A;  2G3A A;  2Z11 A;  3ZZI A;  3EC4 A;  2Z0Z A;  3FBU A;  1M4G A;  3TOB A;  5CNP A;  3OWC A;  3TO7 A;  1KZF A;  4B13 A;  2REF A;  2GE3 A;  3R96 A;  1Q2Y A;  2VI7 A;  1BOB A;  4B5P B;  3QAH A;  2ATR A;  2YNC A;  1WK4 A;  3T9Y A;  4CAX A;  2AE6 A;  4AVC A;  1XIX A;  3S6F A;  2KCW A;  1L0C A;  3IU2 A;  1MJ9 A;  5J8C A;  4UCM A;  2OU2 A;  3TTH A;  2P0W A;  4CS0 B;  2HUZ A;  5EBV A;  2CNS A;  1YR0 A;  3PGP A;  1YGH A;  3D8P A;  1WWZ A;  5AG7 A;  4CAV A;  1KUV A;  2PR1 A;  2Z3O A;  3LOD A;  1IYK A;  2J8R A;  2Z3K A;  2CXA A;  4AG9 A;  3BLN A;  4UBR A;  2FSR A;  1M1D A;  3EFA A;  5G22 A;  2GAN A;  1P4N A;  2YNC C;  2IL4 A;  4X5K A;  2G0B A;  4CYQ A;  1R57 A;  2YND A;  1Y7R A;  3H5Z A;  4LUA A;  2WPX A;  1TIQ A;  4NSQ A;  4C68 A;  2B5G A;  4B11 A;  5HH1 A;  2EVN A;  2I79 A;  2R8V A;  1VHS A;  3IWG A;  4UWI A;  4CAF A;  3WR7 A;  4CAW A;  5HMN A;  3SXN A;  2Q4Y A;  5F46 A;  4A95 A;  4KOU A;  2JEV A;  1ON0 A;  2R1I A;  2Q4V A;  2PC1 A;  3E0K A;  3FXT A;  2O28 A;  1IID A;  4U9Y A;  5IX3 A;  2FCK A;  3DSB A;  4UFX A;  3V8I A;  2QEC A;  4HNY B;  3VWE A;  2Q0Y A;  4KLW A;  4UWJ A;  4C2Y A;  4KOR A;  4KOW A;  1M44 A;  1S7F A;  4UFW A;  1YVK A;  4Y49 B;  2EUI A;  2VBQ A;  3K9U A;  1I12 A;  5KTD A;  3F8K A;  1PU9 A;  4AVB A;  1I21 A;  3I9S A;  3QB8 A;  4K30 A;  4CRZ B;  4QB9 A;  2YNE A;  4DNC A;  5A28 A;  2BSW A;  2HV2 A;  4MHD A;  4MI4 A;  4CYO A;  5I0C A;  4FD7 A;  2J8N A;  3D2M A;  4KUA A;  4EVY A;  4YRH A;  3N7Z A;  2Z3N A;  1IYL A;  2JLM A;  4KSA A;  1QSR A;  4IF5 A;  2PR8 A;  4KOV A;  3R1K A;  2Z3P A;  3H4Q A;  5FVJ A;  4B12 A;  3R95 A;  2ZW7 A;  5F48 A;  1S3Z A;  1Z9U A;  2Q44 A;  5G21 A;  4CGM A;  4XNH C;  2WSA A;  4E8O A;  1Z4R A;  2QIR A;  1VKC A;  1YLE A;  4J3G A;  1MK4 A;  4CGL A;  2P6F A;  3FB3 A;  4M3S A;  1UFH A;  4L89 A;  4MFK A;  2FXF A;  5AG5 A;  2OZU A;  3DR6 A;  4NEX A;  2R7H A;  2ZXV A;  2JDC A;  2FIA A;  2VZZ A;  4BBH A;  4CYP A;  1MJB A;  4UCP A;  2VEZ A;  2Y0M A;  4E0A A;  3S6H A;  1I1D A;  3P2H A;  4PSW A;  4B10 A;  4KSF A;  1KUX A;  4CGO A;  4R3L A;  4A32 A;  4F6A A;  4OAD A;  4UA3 A;  5F49 A;  4B5O A;  2AJ6 A;  1MJA A;  1N71 A;  4OLL A;  1QSM A;  4RS2 A;  3KKW A;  2C27 A;  2I00 A;  5DWM A;  5JPH A;  4II9 A;  2Q04 A;  5G20 A;  5C88 A;  3FYN A;  1OZP A;  2OZG A;  4L8A A;  3FRM A;  3BJ7 A;  3G3S A;  2B3V A;  3EY5 A;  3EO4 A;  2FS5 A;  4R3K A;  3TCV A;  2FIW A;  3B8G A;  2PDO A;  4KVO E;  3TO9 A;  3JUW A;  4NCZ A;  3TE4 A;  3C26 A;  4R87 A;  3A9L A;  2HQY A;  2Q7B A;  5ISV A;  4XPD B;  4MFL A;  2R98 A;  2ZPA A;  2YGW A;  3CXS A;  1IIC A;  3LD2 A;  3CXQ A;  3UY5 A;  4A31 A;  2BL1 A;  1XEB A;  3DDD A;  4JWP A;  1YRE A;  4OAE A;  3GY9 A;  3IGR A;  4YGO A;  1P0H A;  1B6B A;  2QML A;  4XPL A;  2GIV A;  4MBU A;  5AG6 A;  2P6E A;  2CNT A;  4HKF A;  4JD6 A;  4KS9 A;  4CRY B;  1QSO A;  4IUS A;  3JTK A;  4KOX A;  4KOT A;  3G8W A;  4M85 A;  5DWN A;  4XNH B;  2ZW4 A;  2X7B A;  3NE7 A;  1B87 A;  4HNX B;  2B5G B;  3PZJ A;  4A2Z A;  4AG7 A;  1XMT A;  3EXN A;  4MJ8 A;  5JQ4 A;  4ZBG A;  5F47 A;  1BO4 A;  5E96 A;  4HNW B;  4JXQ A;  4I49 A;  4PK2 A;  5AGE A;  3TFY A;  4U9Z A;  2FE7 A;  4C7H A;  2VXK A;  2JDD A;  1Y9K A;  3D3S A;  4JJX A;  2CY2 A;  3RYO A;  5EC4 A;  2PSW A;  3GKR A;  5IV0 A;  4ORF A;  3IU1 A;  2B4D B;  4ONU A;  1NSL A;  4KVX A;  4FD5 A;  1YK3 A;  4F0X A;  3R9E A;  1CJW A;  1S7N A;  2VQY A;  5C82 A;  3JVN A;  4KVM E;  2PQ8 A;  5A27 A;  4PV6 A;  3GYA A;  4E2A A;  3TT2 A;  4CGN A;  4YFJ A;  4A30 A;  2B4D A;  1PUA A;  2Z3L A;  4F0Y A;  4ZGY B;  1S7L A;  4QUS A;  2A4N A;  1FY7 A;  4UFV A;  4KOY A;  4H6U A;  4NF1 A;  1S5K A;  4R9M A;  2ZW5 A;  2CNM A;  3D2P A;  3BJ8 A;  4CAE A;  2F5I A;  1Q2D A;  3VWD A;  2RC4 A;  4Q36 A;  2Z3M A;  1LRZ A;  3FIX A;  4H6Z A;  4KOS A;  4QBJ A;  2NMT A;  1GHE A;  4MFZ A;  2J8M A;  4KZT A;  4AB7 A;  5J8F A;  4B14 A;  5IB0 A;  1S7K A;  4JLY A;  4QVT A;  1RO5 A;  2BEI A;  2H5M A;  4UCN A;  4QC6 A;  1M4D A;  1J4J A;  2OZH A;  4C7I A;  3PP9 A;  2B4B A;  1RXT A;  2B3U A;  3DR8 A;  1Q2C A;  1IB1 E;  4PK3 A;  1XE4 A;  1S60 A;  4C2X A;  1K4J A;  3TOA A;  4MFJ A;  1U6M A;  2DXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...