2YNCC

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
370
Chain Sequence
b'DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFLYKVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 370
sequence length 384
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
C PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncC00
2WUUA 2YNCA 3IU2A 5G1ZA 4B12A 4B14A 4CAEA 4C7IA 4CYNA 3IU1A 4UFWA 4CYQA 4CGOA 4C2XA 4A31A 5G20A 4CGPA 4B10A 3H5ZA 4CGLA 5AG4A 4CGMA 4A2ZA 4CAFA 4UFXA 5G22A 4B11A 2YNCC 4UFVA 2YNDA 2YNEA 5AG5A 4CYOA 4UCPA 4CYPA 4BBHA 2WSAA 4C68A 5G21A 4UCNA 4C2YA 4A33A 5AGEA 4A32A 5AG7A 4B13A 5A28A 5AG6A 3IWEA 4C7HA 4A30A 4A95A 4CGNA 5A27A 3JTKA 4C2ZA 4UCMA
chains in the Genus database with same CATH superfamily
4WJBA 1ARMA 3RZAA 1CPSA 4LQGA 2VZZA 4MMOA 4NGRA 1ZLIA 2ZOGA 4OC5A 5GCNA 4NXYA 3TO6A 1LAMA 1Y0RA 4WWVA 1ZO0A 3H5ZA 4OP4A 4R87A 4QBJA 4B11A 1BLLE 2B4BA 3CZXA 4CYOA 4O23A 5LYFA 3QAHA 5IB0A 2Q04A 4KZTA 4IAVA 1KUYA 5BWAB 1LCPA 1M4IA 1PYTB 2G0BA 4F8ZA 5I0CA 1L0CA 4XNHC 5D29A 3B7IA 1YX0A 5A28A 5AG6A 2GE3A 3NE8A 4AXVA 1Z8TA 4NJRA 3PRTA 4MFKA 1KUXA 4MY3A 2J8RA 2PC1A 2Q7SA 3D4UA 4A38A 1F2PA 2AFSA 2DF5A 2PR1A 3ISZA 4ZX9A 4L89A 4CYQA 4KVME 3FEEA 2ATRA 1GYTA 3N7ZA 4M6IA 3JVNA 4MHDA 3F5BA 4XPKA 4ZX8A 4B5PA 5LYLA 3DDDA 2DPSA 3FJUA 3PB8X 5LYDA 1YK3A 2I3CA 5J8CA 3LACA 4GXHA 4UEFA 3IGRA 3P2HA 3S9MA 1XIXA 2P6EA 3OWCA 2KCWA 2O4HA 3FB3A 4IUSA 3V8IA 2G3TA 4H6ZA 3WABA 3TOBA 2DPTA 3PFOA 4E8OA 4A33A 4R8FA 2QMLA 5HVFA 2C6CA 2ZEMA 4MFJA 3QB8A 1VIXA 4M6GA 1TKFA 5H86A 1XRYA 1Y9KA 2OH1A 2QECA 2CY2A 2ZEFA 2YNCA 4PK3A 4Y49B 4B12A 2BL1A 1R57A 1CM0A 2AFZA 3IO1A 2AFOA 2FVGA 2AFWA 4MFZA 1S7NA 2PJBA 2V8VA 1P4NA 1MJBA 3TO7A 4KOTA 5AG4A 5I4MA 4KS9A 1M4DA 3H8EA 3SJXA 2Z3NA 1HDUA 4NSQA 4HPSA 5IX3A 1ELLP 4R57A 5F49A 4JJXA 1WWZA 3D7FA 4UEEA 3JRUA 3CXSA 3VH9A 3PBEA 1PCAA 3I3GA 4Y49C 4CAVA 2IQ6A 5ELYA 4HKFA 4NEXA 3TT2A 4KOSA 3NE7A 2ZW5A 3TO9A 2C6GA 4KVXA 3S6FA 4A30A 3T8WA 4CGNA 2Q43A 4F0YA 1KWMA 4UCMA 2GANA 1BPMA 1S3ZA 4B14A 4CAEA 4C7IA 4MHNA 1QSRA 6CPAA 3NH5A 1UFHA 4TNUA 4BMHA 4MRIA 1ZG7A 4MFLA 2C27A 5G20A 4CGMA 2FE7A 3KHZA 4CRYB 3KHXA 3K2KA 4LX9A 4Q36A 4YU9A 7CPAA 2HV2A 4KLVA 4QC6A 1IIDA 2PJ3A 2Q44A 2OZGA 3SI2A 4NGMA 3QAYA 1QSTA 3B3WA 4K30A 3IC1A 2BSWA 2O53A 2I79A 4OC3A 2Y0MA 4P6YA 2VEZA 5AGEA 3WC5A 4A32A 2XEIA 1CP7A 3CT9A 4C2ZA 3SHPA 4AVAA 2DXQA 1SQHA 4KUBA 2QYVA 4F9VA 1NMTA 3FXTA 2EK9A 1M4LA 2HQYA 2GLJA 4YWYA 5ISVA 4A39A 4OLLA 1XBUA 3R9GA 5HVHA 4JLYA 2AJ6A 2Z3LA 1YR0A 4R3LA 4F6AA 2EVNA 3ZJ0A 3S6KA 3ZZIA 1M44A 4LQ6A 5LRGA 2FSRA 2Q4ZA 4CPAA 4ZY1A 2X7BA 4PXDA 1Z5RA 4PSXA 2OB0A 3EO4A 2HC9A 5JPHA 4X5KA 1QMUA 4KOXA 4R7MA 2OOTA 2BUEA 4RS2A 2V8HA 4MHYA 1FT7A 4R3KA 3B3CA 2GREA 4KOUA 2VZYA 5J8FA 2GLFA 4P4IA 5JH9A 2FIWA 4JWPA 4UFWA 4CYNA 4KORA 3WR7A 3PFEA 4XNHB 3RYOA 4MFPA 4PXCA 1Q7LA 2D4PA 3B3TA 4CAFA 3WT4A 3D2PA 2JDCA 4EWTA 1XFOA 2Z3OA 1ELMP 2CNMA 3FNCA 3VARA 4HNYB 2FXFA 4W9YA 3R1KA 2PJ9A 1X12A 1CX8A 1I21A 3A9LA 1TKHA 4NGPA 3L2NA 3DLJA 4P4DA 3PZJA 4AG9A 2RC4A 3GLJA 4OC4A 5A27A 1DE4C 3D7GA 1YQEA 2FS5A 5C88A 1S7FA 2K5TA 4KLWA 2WUUA 3PGPA 1Q2CA 5HVGA 4YFJA 1IY7A 4MCSA 3D7DA 2PJ4A 3KKWA 4FAIA 3PB7X 3PBBA 4UBRA 4DNCA 5F09A 1MK4A 3EXNA 4AVCA 3I9SA 5G22A 3BI0A 2OU2A 3F8KA 2YNDA 3KR4A 5K8OA 1J4JA 1IOIA 1BO4A 3TC8A 3FMCA 3KL9A 4H6UA 3GB0A 1LAPA 4U9YA 4BD9A 1BAVA 4R76A 1TKJA 1IYLA 1I12A 4Z65A 3FBUA 3TX8A 4F0XA 4YRHA 5JM6A 4KOWA 4R9MA 3GY9A 3TCVA 1XJOA 2PVVA 2EO8A 4L8AA 5LRKA 1IYKA 4X2TA 4GM5A 3UY5A 3V38A 3FECA 4CYPA 2WZNA 2JEVA 3CXQA 3KGQA 5HXDA 2PJ0A 2NYQA 2G9DA 3GYAA 2OZUA 1LOKA 2ODFA 4M85A 2PJ2A 2C1CA 4JYWA 2REEA 2FL4A 4KOYA 3MN8A 2POKA 5K8MA 2VQYA 1JQGA 4AVBA 2DEAA 3RO0A 1S60A 2HUZA 4XPDB 4I49A 4TWEA 4GS4A 1X10A 2EK8A 3D2MA 2CTBA 4C2YA 2GFQA 4P44A 4X8IA 1ZG8A 4Q7AA 2JDDA 3NH8A 3NH4A 1LRZA 1YVKA 3R95A 2Z3MA 2ZW6A 4H89A 3IWEA 3IWWA 4FWUA 3G8WA 3BLNA 2ZEDA 4A94A 3D67A 4PSWA 5FVJA 2J8MA 3EC4A 1IB1E 1R3NA 4B6ZA 3KZWA 2FT0A 1ZLHA 2ZEOA 1Z8LA 3QNVA 4XPDC 4EVYA 2F5IA 1IGBA 2PCUA 3I1UA 3PB9X 4KSFA 1PUAA 2XEJA 4EFDA 1R43A 3FYNA 3TE4A 2B3VA 4AB7A 2YNEA 3G3SA 3SJGA 2ARHA 2B4DB 4ONWA 3P2FA 4PV6A 1YLEA 1QSMA 2IL4A 1YMEA 4FD5A 4ONUA 2WPWA 4UCNA 3FF3A 2YGWA 2ZENA 3DNSA 2PRQA 3EY5A 3H8GA 4PXEA 3SI0A 2QJ8A 4J3GA 4A95A 1YLOA 1VHOA 2ZEPA 3IU2A 4NFRA 3BHXA 4CAXA 1Q2YA 1OZPA 4B5PB 2G3AA 4IF5A 4CRZB 2Z11A 5KTDA 4FD7A 3FIXA 1P0HA 2GU2A 2Z0ZA 5F48A 2EUIA 4NGNA 3DR8A 4UFVA 1VHSA 1NSAA 2R8VA 3S9NA 2R98A 3B35A 3FEDA 2AFMA 1M1DA 1Y7EA 2OR4A 4LUAA 2IJZA 3PB6X 3KQXA 2WYRA 3F0AA 4MBUA 4PK2A 3BXMA 2O28A 1HEEA 5THWA 2C6PA 3LODA 2NMTA 1FY7A 3B2YA 2PR8A 1KUVA 3MRUA 1A2ZA 3FH4A 2Q0YA 2PRBA 3IFEA 3SJFA 4HNWB 1UWYA 4NGTA 5JGFA 4FD4A 2CTCA 4JZ0A 2PQ8A 2BEIA 4CS0B 4P4BA 1LANA 2ZXVA 2AFUA 3D7HA 4NF1A 2P6GA 1M4GA 2VXKA 4NGSA 1B6BA 2PJ6A 3V7ZA 4H2KA 4A31A 3R96A 1YGHA 3NA6A 4A2ZA 3RAMA 3H4QA 2ZEHA 2CIJA 4UA3A 4OADA 2JLMA 2YNCC 3BJ8A 8CPAA 5CPAA 3T90A 5HMNA 1MJ9A 1ON0A 1Y9WA 4OAEA 5EC4A 3NFZA 4OKOA 3TOAA 1Z4RA 1IICA 4QUSA 2PJ7A 2ZOFA 3KI9A 1ARLA 2B5GB 2RFHA 4Q38A 2BOAA 2PIZA 1S7LA 2BCOA 3D66A 2ABZA 2ZW7A 4UWIA 4MHZA 2PIYA 2A4NA 2J8NA 4JXRA 1YVOA 1VKCA 5H84A 3DGVA 3RNZA 3B3VA 1IOFA 3IU1A 4MJ8A 2AE6A 2PJ1A 2B3UA 3LMSA 5DS0A 2ZELA 2Q4VA 1TXRA 5J1QA 4CGLA 3LWUA 4OC2A 2PSWA 3GIUA 1IU8A 4OC1A 4B5OA 5HH1A 1XEBA 2CNSA 4MCQA 1TIQA 5AG5A 3S6HA 4BBHA 1CG2A 2R1IA 3B3SA 3C26A 4OIDA 4IHMA 3ISXA 4UIAA 2B58A 3BJ7A 2B4DA 4QB9A 4A37A 1Z8XA 2VI7A 4OMEA 4PPZA 5AG7A 5LYIA 1FNOA 4KSIA 3W6SA 4EMEA 4FD6A 4K3NA 4FBEA 2QIRA 2V77A 3KQZA 1ZG9A 4MFQA 2I00A 3D8PA 4KOVA 4RI1A 4U5YA 5G1ZA 1VGYA 5F47A 4JD6A 1YW6A 3VWDA 1Y7RA 2P0WA 4ZI6A 3KR5A 2WPXA 4BINA 4CGOA 2GIVA 4C2XA 4P10A 5K8NA 1AMPA 1NE9A 2F8HA 4II9A 2ZEEA 3R9EA 4RN7A 1EE3P 2OZHA 1TF9A 1XF8A 1XE4A 3EFAA 4P4FA 4R6TA 1Z8WA 2WSAA 2Q7BA 3GKRA 3D3SA 3PEIA 1LFWA 3SXNA 1DTDA 2FIAA 5CNPA 1F57A 4KUAA 3SJEA 2CF4A 2XEGA 3LD2A 2V8GA 3T9YA 3DR6A 4G1PA 1S7KA 3JTKA 4XPLA 4DJLA 4ZBGA 5IB9A 3DSBA 2EWBA 1Y0YA 2Z3KA 3IWGA 1MJAA 3TTHA 1QQ9A 2PDOA 2ZPAA 2V8DA 3PB4X 5KTAA 4CGPA 5EMIA 3FX6A 3WC6A 1YSJA 4ZYQA 4MXUA 2PJ5A 4UFXA 1YW4A 1CP6A 4NJQA 3R9FA 1XMTA 5D8NA 4UCPA 4X3RA 2QVPA 2NSMA 1I1DA 3PP9A 4ORFA 3RBUA 1XMBA 3W6XA 4C68A 5G21A 3S9LA 4IK2A 1RO5A 1NSLA 1AYEA 3S6GA 5KTCA 2FCKA 4PXBA 4ZGYB 3TFYA 1OBRA 4MHPA 3VWEA 3FVLA 5EBVA 3BI1A 2B5GA 4U9ZA 3VATA 2F7VA 3W91A 4FUUA 2EBJA 3MGDA 1Q2DA 1CBXA 4UIBA 1RXTA 2PJCA 4UF4A 2R7HA 2VBQA 4F9UA 3IJ3A 1CPXA 1Z2LA 1PU9A 4YGOA 4B10A 4AG7A 5CBMA 2Q4YA 5E96A 2VL1A 4MCPA 1XOVA 4DYOA 2PVWA 3KASA 3K9TA 3JUWA 3SI1A 2JEWA 1U6MA 3E0KA 2P6FA 1Z9UA 2Z10A 3FRMA 4P4EA 2PJ8A 4MCRA 4OIWA 5K8PA 1QSOA 1RTQA 2J9AA 1Z4EA 1AUGA 5DWMA 2CXAA 1V0CA 2JBKA 1BOBA 4MY0A 4QVTA 4ZY2A 2REFA 4E0AA 5F46A 5JQ4A 5LRJA 4E2AA 2Z3PA 4ZY0A 2AFXA 2JBJA 2ANPA 2BO9A 4DUKA 3IIBA 1GHEA 2H5MA 4M3SA 2D4OA 4OC0A 4UEZA 3WC7A 4P4JA 2ZW4A 4M6HA 2HB6A 3GUXA 1K4JA 3HLPA 4JXQA 4KVOE 1B87A 3CPXA 4UWJA 3HUVA 3H8FA 4HNXB 3IEHA 1HDQA 4NGQA 3CDXA 1QSNA 1JWQA 1YREA 3K9UA 2Q51A 3CXPA 1WK4A 4KSAA 3CPAA 1CJWA 4NCZA 1F2OA 1TF8A 2PE3A 3N5FA 5C82A 5IV0A 1KZFA 4MI4A 3SXOA 1BPNA 4RUHA 2IMOA 2XEFA 1H8LA 1S5KA 2CNTA 2PJAA 3D68A 4PQAA 1N71A 2ZEGA 5DWNA 4B13A 4CAWA 4C7HA 1VHEA 4P45A 3B8GA 2RB7A
chains in the Genus database with same CATH topology
2VZZA 5GCNA 4NXYA 3TO6A 1ZO0A 3H5ZA 4QBJA 4R87A 4B11A 2B4BA 4CYOA 3QAHA 5IB0A 2Q04A 4KZTA 1KUYA 5BWAB 1M4IA 2G0BA 5I0CA 1L0CA 4XNHC 1YX0A 5A28A 5AG6A 2GE3A 4MFKA 1KUXA 4MY3A 2J8RA 2PC1A 2PR1A 4CYQA 4L89A 4KVME 4MHDA 2ATRA 3N7ZA 3JVNA 4XPKA 3F5BA 4B5PA 3DDDA 2DPSA 1YK3A 5J8CA 3IGRA 3P2HA 1XIXA 2P6EA 3OWCA 2KCWA 3FB3A 3V8IA 4IUSA 2G3TA 4H6ZA 3TOBA 2DPTA 4E8OA 4A33A 2QMLA 4MFJA 3QB8A 5H86A 1Y9KA 2OH1A 2QECA 2CY2A 2YNCA 4PK3A 4Y49B 4B12A 2BL1A 1R57A 1CM0A 4MFZA 1S7NA 3TO7A 5AG4A 1P4NA 1MJBA 4KOTA 4KS9A 1M4DA 2Z3NA 4NSQA 5IX3A 4R57A 5F49A 4JJXA 1WWZA 3CXSA 4CAVA 3I3GA 4Y49C 4HKFA 4NEXA 3TT2A 4KOSA 3NE7A 2ZW5A 3TO9A 4KVXA 3S6FA 4A30A 4CGNA 4F0YA 4UCMA 2GANA 1S3ZA 4B14A 4CAEA 4C7IA 1QSRA 1UFHA 4BMHA 4MFLA 2C27A 5G20A 4CGMA 2FE7A 4CRYB 4Q36A 4LX9A 2HV2A 4KLVA 4QC6A 1IIDA 2Q44A 2OZGA 1QSTA 4K30A 2BSWA 2I79A 2Y0MA 5AGEA 2VEZA 4A32A 4C2ZA 3SHPA 4AVAA 2DXQA 1SQHA 4KUBA 5ISVA 1NMTA 3FXTA 2HQYA 4OLLA 3R9GA 4JLYA 2AJ6A 2Z3LA 1YR0A 4R3LA 4F6AA 2EVNA 3ZJ0A 3S6KA 3ZZIA 1M44A 2FSRA 2X7BA 4PSXA 2OB0A 3EO4A 5JPHA 4X5KA 4KOXA 2BUEA 4RS2A 4R3KA 4KOUA 2VZYA 5J8FA 2FIWA 4JWPA 4UFWA 4CYNA 4KORA 3WR7A 4XNHB 3RYOA 4MFPA 2D4PA 4CAFA 3D2PA 2JDCA 2Z3OA 2CNMA 3FNCA 4HNYB 2FXFA 3R1KA 1I21A 3A9LA 3PZJA 4AG9A 2RC4A 5A27A 5C88A 2FS5A 1S7FA 2K5TA 4KLWA 2WUUA 3PGPA 1Q2CA 4YFJA 3KKWA 4DNCA 4UBRA 1MK4A 3EXNA 4AVCA 3I9SA 5G22A 2OU2A 3F8KA 2YNDA 1J4JA 1BO4A 4H6UA 4U9YA 1I12A 1IYLA 3FBUA 4F0XA 4YRHA 4KOWA 4R9MA 3GY9A 3TCVA 4L8AA 1IYKA 3UY5A 4CYPA 3CXQA 2JEVA 3GYAA 2OZUA 4M85A 2REEA 2FL4A 4KOYA 2VQYA 4AVBA 1S60A 2HUZA 4XPDB 4I49A 4GS4A 3D2MA 4C2YA 2JDDA 1LRZA 1YVKA 3R95A 2Z3MA 2ZW6A 4H89A 3IWEA 3G8WA 3BLNA 4PSWA 5FVJA 2J8MA 3EC4A 1IB1E 2FT0A 4XPDC 4EVYA 2F5IA 4KSFA 1PUAA 3TE4A 3FYNA 2B3VA 4AB7A 2YNEA 3G3SA 2ARHA 2B4DB 3P2FA 4PV6A 1YLEA 1QSMA 2IL4A 4FD5A 4ONUA 2WPWA 4UCNA 2YGWA 3DNSA 3EY5A 4J3GA 4A95A 3IU2A 4CAXA 1Q2YA 1OZPA 4B5PB 2G3AA 4IF5A 4CRZB 2Z11A 5KTDA 4FD7A 3FIXA 1P0HA 2Z0ZA 5F48A 2EUIA 3DR8A 4UFVA 1VHSA 2R8VA 2R98A 4LUAA 1M1DA 4PK2A 4MBUA 3F0AA 2O28A 3LODA 2NMTA 1FY7A 2PR8A 1KUVA 2Q0YA 2PRBA 4HNWB 4FD4A 2PQ8A 2BEIA 4CS0B 2ZXVA 4NF1A 2P6GA 1M4GA 2VXKA 1B6BA 4A31A 3R96A 1YGHA 4A2ZA 3H4QA 4UA3A 4OADA 2JLMA 2YNCC 3BJ8A 5HMNA 3T90A 1MJ9A 1ON0A 1Y9WA 4OAEA 5EC4A 3TOAA 1Z4RA 1IICA 4QUSA 2B5GB 4Q38A 1S7LA 2ZW7A 4UWIA 2A4NA 2J8NA 4JXRA 1YVOA 1VKCA 5H84A 3IU1A 4MJ8A 2AE6A 2B3UA 2Q4VA 4CGLA 2PSWA 4B5OA 5HH1A 1XEBA 2CNSA 3S6HA 1TIQA 5AG5A 4BBHA 2R1IA 3C26A 2B58A 3BJ7A 2B4DA 4QB9A 2VI7A 5AG7A 3W6SA 4FD6A 2QIRA 4MFQA 3D8PA 2I00A 4KOVA 4RI1A 4U5YA 5G1ZA 5F47A 4JD6A 3VWDA 1Y7RA 2P0WA 2WPXA 4CGOA 2GIVA 4C2XA 1NE9A 4II9A 2OZHA 1XF8A 1XE4A 3EFAA 2WSAA 2Q7BA 3GKRA 3D3SA 3SXNA 2FIAA 5CNPA 4KUAA 3LD2A 3T9YA 3DR6A 4XPLA 1S7KA 3JTKA 4ZBGA 3DSBA 2Z3KA 3IWGA 1MJAA 3TTHA 2PDOA 2ZPAA 5KTAA 4CGPA 4UFXA 3R9FA 1XMTA 4UCPA 3W6XA 4ORFA 1I1DA 3PP9A 4C68A 5G21A 1RO5A 1NSLA 3S6GA 5KTCA 2FCKA 4ZGYB 3TFYA 3VWEA 5EBVA 2B5GA 4U9ZA 3W91A 3MGDA 1Q2DA 1RXTA 2R7HA 2VBQA 1PU9A 4YGOA 4B10A 4AG7A 2Q4YA 5E96A 3JUWA 1U6MA 3E0KA 2P6FA 1Z9UA 2Z10A 3FRMA 1QSOA 1Z4EA 5DWMA 2CXAA 1V0CA 4MY0A 1BOBA 4QVTA 4E0AA 5F46A 2REFA 5JQ4A 4E2AA 2Z3PA 4M3SA 1GHEA 2H5MA 2D4OA 2ZW4A 4JXQA 4KVOE 1K4JA 3R9EA 1B87A 4UWJA 4HNXB 1QSNA 1YREA 3K9UA 3CXPA 1WK4A 4KSAA 1CJWA 4NCZA 5C82A 5IV0A 1KZFA 4MI4A 3SXOA 2CNTA 1S5KA 5DWNA 4B13A 4CAWA 1N71A 4C7HA 3B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUU A;  2YNC A;  3IU2 A;  5G1Z A;  4B12 A;  4B14 A;  4CAE A;  4C7I A;  4CYN A;  3IU1 A;  4UFW A;  4CYQ A;  4CGO A;  4C2X A;  4A31 A;  5G20 A;  4CGP A;  4B10 A;  3H5Z A;  4CGL A;  5AG4 A;  4CGM A;  4A2Z A;  4CAF A;  4UFX A;  5G22 A;  4B11 A;  2YNC C;  4UFV A;  2YND A;  2YNE A;  5AG5 A;  4CYO A;  4UCP A;  4CYP A;  4BBH A;  2WSA A;  4C68 A;  5G21 A;  4UCN A;  4C2Y A;  4A33 A;  5AGE A;  4A32 A;  5AG7 A;  4B13 A;  5A28 A;  5AG6 A;  3IWE A;  4C7H A;  4A30 A;  4A95 A;  4CGN A;  5A27 A;  3JTK A;  4C2Z A;  4UCM A; 
#chains in the Genus database with same CATH topology
 4WJB A;  1ARM A;  3RZA A;  1CPS A;  4LQG A;  2VZZ A;  4MMO A;  4NGR A;  1ZLI A;  2ZOG A;  4OC5 A;  5GCN A;  4NXY A;  3TO6 A;  1LAM A;  1Y0R A;  4WWV A;  1ZO0 A;  3H5Z A;  4OP4 A;  4R87 A;  4QBJ A;  4B11 A;  1BLL E;  2B4B A;  3CZX A;  4CYO A;  4O23 A;  5LYF A;  3QAH A;  5IB0 A;  2Q04 A;  4KZT A;  4IAV A;  1KUY A;  5BWA B;  1LCP A;  1M4I A;  1PYT B;  2G0B A;  4F8Z A;  5I0C A;  1L0C A;  4XNH C;  5D29 A;  3B7I A;  1YX0 A;  5A28 A;  5AG6 A;  2GE3 A;  3NE8 A;  4AXV A;  1Z8T A;  4NJR A;  3PRT A;  4MFK A;  1KUX A;  4MY3 A;  2J8R A;  2PC1 A;  2Q7S A;  3D4U A;  4A38 A;  1F2P A;  2AFS A;  2DF5 A;  2PR1 A;  3ISZ A;  4ZX9 A;  4L89 A;  4CYQ A;  4KVM E;  3FEE A;  2ATR A;  1GYT A;  3N7Z A;  4M6I A;  3JVN A;  4MHD A;  3F5B A;  4XPK A;  4ZX8 A;  4B5P A;  5LYL A;  3DDD A;  2DPS A;  3FJU A;  3PB8 X;  5LYD A;  1YK3 A;  2I3C A;  5J8C A;  3LAC A;  4GXH A;  4UEF A;  3IGR A;  3P2H A;  3S9M A;  1XIX A;  2P6E A;  3OWC A;  2KCW A;  2O4H A;  3FB3 A;  4IUS A;  3V8I A;  2G3T A;  4H6Z A;  3WAB A;  3TOB A;  2DPT A;  3PFO A;  4E8O A;  4A33 A;  4R8F A;  2QML A;  5HVF A;  2C6C A;  2ZEM A;  4MFJ A;  3QB8 A;  1VIX A;  4M6G A;  1TKF A;  5H86 A;  1XRY A;  1Y9K A;  2OH1 A;  2QEC A;  2CY2 A;  2ZEF A;  2YNC A;  4PK3 A;  4Y49 B;  4B12 A;  2BL1 A;  1R57 A;  1CM0 A;  2AFZ A;  3IO1 A;  2AFO A;  2FVG A;  2AFW A;  4MFZ A;  1S7N A;  2PJB A;  2V8V A;  1P4N A;  1MJB A;  3TO7 A;  4KOT A;  5AG4 A;  5I4M A;  4KS9 A;  1M4D A;  3H8E A;  3SJX A;  2Z3N A;  1HDU A;  4NSQ A;  4HPS A;  5IX3 A;  1ELL P;  4R57 A;  5F49 A;  4JJX A;  1WWZ A;  3D7F A;  4UEE A;  3JRU A;  3CXS A;  3VH9 A;  3PBE A;  1PCA A;  3I3G A;  4Y49 C;  4CAV A;  2IQ6 A;  5ELY A;  4HKF A;  4NEX A;  3TT2 A;  4KOS A;  3NE7 A;  2ZW5 A;  3TO9 A;  2C6G A;  4KVX A;  3S6F A;  4A30 A;  3T8W A;  4CGN A;  2Q43 A;  4F0Y A;  1KWM A;  4UCM A;  2GAN A;  1BPM A;  1S3Z A;  4B14 A;  4CAE A;  4C7I A;  4MHN A;  1QSR A;  6CPA A;  3NH5 A;  1UFH A;  4TNU A;  4BMH A;  4MRI A;  1ZG7 A;  4MFL A;  2C27 A;  5G20 A;  4CGM A;  2FE7 A;  3KHZ A;  4CRY B;  3KHX A;  3K2K A;  4LX9 A;  4Q36 A;  4YU9 A;  7CPA A;  2HV2 A;  4KLV A;  4QC6 A;  1IID A;  2PJ3 A;  2Q44 A;  2OZG A;  3SI2 A;  4NGM A;  3QAY A;  1QST A;  3B3W A;  4K30 A;  3IC1 A;  2BSW A;  2O53 A;  2I79 A;  4OC3 A;  2Y0M A;  4P6Y A;  2VEZ A;  5AGE A;  3WC5 A;  4A32 A;  2XEI A;  1CP7 A;  3CT9 A;  4C2Z A;  3SHP A;  4AVA A;  2DXQ A;  1SQH A;  4KUB A;  2QYV A;  4F9V A;  1NMT A;  3FXT A;  2EK9 A;  1M4L A;  2HQY A;  2GLJ A;  4YWY A;  5ISV A;  4A39 A;  4OLL A;  1XBU A;  3R9G A;  5HVH A;  4JLY A;  2AJ6 A;  2Z3L A;  1YR0 A;  4R3L A;  4F6A A;  2EVN A;  3ZJ0 A;  3S6K A;  3ZZI A;  1M44 A;  4LQ6 A;  5LRG A;  2FSR A;  2Q4Z A;  4CPA A;  4ZY1 A;  2X7B A;  4PXD A;  1Z5R A;  4PSX A;  2OB0 A;  3EO4 A;  2HC9 A;  5JPH A;  4X5K A;  1QMU A;  4KOX A;  4R7M A;  2OOT A;  2BUE A;  4RS2 A;  2V8H A;  4MHY A;  1FT7 A;  4R3K A;  3B3C A;  2GRE A;  4KOU A;  2VZY A;  5J8F A;  2GLF A;  4P4I A;  5JH9 A;  2FIW A;  4JWP A;  4UFW A;  4CYN A;  4KOR A;  3WR7 A;  3PFE A;  4XNH B;  3RYO A;  4MFP A;  4PXC A;  1Q7L A;  2D4P A;  3B3T A;  4CAF A;  3WT4 A;  3D2P A;  2JDC A;  4EWT A;  1XFO A;  2Z3O A;  1ELM P;  2CNM A;  3FNC A;  3VAR A;  4HNY B;  2FXF A;  4W9Y A;  3R1K A;  2PJ9 A;  1X12 A;  1CX8 A;  1I21 A;  3A9L A;  1TKH A;  4NGP A;  3L2N A;  3DLJ A;  4P4D A;  3PZJ A;  4AG9 A;  2RC4 A;  3GLJ A;  4OC4 A;  5A27 A;  1DE4 C;  3D7G A;  1YQE A;  2FS5 A;  5C88 A;  1S7F A;  2K5T A;  4KLW A;  2WUU A;  3PGP A;  1Q2C A;  5HVG A;  4YFJ A;  1IY7 A;  4MCS A;  3D7D A;  2PJ4 A;  3KKW A;  4FAI A;  3PB7 X;  3PBB A;  4UBR A;  4DNC A;  5F09 A;  1MK4 A;  3EXN A;  4AVC A;  3I9S A;  5G22 A;  3BI0 A;  2OU2 A;  3F8K A;  2YND A;  3KR4 A;  5K8O A;  1J4J A;  1IOI A;  1BO4 A;  3TC8 A;  3FMC A;  3KL9 A;  4H6U A;  3GB0 A;  1LAP A;  4U9Y A;  4BD9 A;  1BAV A;  4R76 A;  1TKJ A;  1IYL A;  1I12 A;  4Z65 A;  3FBU A;  3TX8 A;  4F0X A;  4YRH A;  5JM6 A;  4KOW A;  4R9M A;  3GY9 A;  3TCV A;  1XJO A;  2PVV A;  2EO8 A;  4L8A A;  5LRK A;  1IYK A;  4X2T A;  4GM5 A;  3UY5 A;  3V38 A;  3FEC A;  4CYP A;  2WZN A;  2JEV A;  3CXQ A;  3KGQ A;  5HXD A;  2PJ0 A;  2NYQ A;  2G9D A;  3GYA A;  2OZU A;  1LOK A;  2ODF A;  4M85 A;  2PJ2 A;  2C1C A;  4JYW A;  2REE A;  2FL4 A;  4KOY A;  3MN8 A;  2POK A;  5K8M A;  2VQY A;  1JQG A;  4AVB A;  2DEA A;  3RO0 A;  1S60 A;  2HUZ A;  4XPD B;  4I49 A;  4TWE A;  4GS4 A;  1X10 A;  2EK8 A;  3D2M A;  2CTB A;  4C2Y A;  2GFQ A;  4P44 A;  4X8I A;  1ZG8 A;  4Q7A A;  2JDD A;  3NH8 A;  3NH4 A;  1LRZ A;  1YVK A;  3R95 A;  2Z3M A;  2ZW6 A;  4H89 A;  3IWE A;  3IWW A;  4FWU A;  3G8W A;  3BLN A;  2ZED A;  4A94 A;  3D67 A;  4PSW A;  5FVJ A;  2J8M A;  3EC4 A;  1IB1 E;  1R3N A;  4B6Z A;  3KZW A;  2FT0 A;  1ZLH A;  2ZEO A;  1Z8L A;  3QNV A;  4XPD C;  4EVY A;  2F5I A;  1IGB A;  2PCU A;  3I1U A;  3PB9 X;  4KSF A;  1PUA A;  2XEJ A;  4EFD A;  1R43 A;  3FYN A;  3TE4 A;  2B3V A;  4AB7 A;  2YNE A;  3G3S A;  3SJG A;  2ARH A;  2B4D B;  4ONW A;  3P2F A;  4PV6 A;  1YLE A;  1QSM A;  2IL4 A;  1YME A;  4FD5 A;  4ONU A;  2WPW A;  4UCN A;  3FF3 A;  2YGW A;  2ZEN A;  3DNS A;  2PRQ A;  3EY5 A;  3H8G A;  4PXE A;  3SI0 A;  2QJ8 A;  4J3G A;  4A95 A;  1YLO A;  1VHO A;  2ZEP A;  3IU2 A;  4NFR A;  3BHX A;  4CAX A;  1Q2Y A;  1OZP A;  4B5P B;  2G3A A;  4IF5 A;  4CRZ B;  2Z11 A;  5KTD A;  4FD7 A;  3FIX A;  1P0H A;  2GU2 A;  2Z0Z A;  5F48 A;  2EUI A;  4NGN A;  3DR8 A;  4UFV A;  1VHS A;  1NSA A;  2R8V A;  3S9N A;  2R98 A;  3B35 A;  3FED A;  2AFM A;  1M1D A;  1Y7E A;  2OR4 A;  4LUA A;  2IJZ A;  3PB6 X;  3KQX A;  2WYR A;  3F0A A;  4MBU A;  4PK2 A;  3BXM A;  2O28 A;  1HEE A;  5THW A;  2C6P A;  3LOD A;  2NMT A;  1FY7 A;  3B2Y A;  2PR8 A;  1KUV A;  3MRU A;  1A2Z A;  3FH4 A;  2Q0Y A;  2PRB A;  3IFE A;  3SJF A;  4HNW B;  1UWY A;  4NGT A;  5JGF A;  4FD4 A;  2CTC A;  4JZ0 A;  2PQ8 A;  2BEI A;  4CS0 B;  4P4B A;  1LAN A;  2ZXV A;  2AFU A;  3D7H A;  4NF1 A;  2P6G A;  1M4G A;  2VXK A;  4NGS A;  1B6B A;  2PJ6 A;  3V7Z A;  4H2K A;  4A31 A;  3R96 A;  1YGH A;  3NA6 A;  4A2Z A;  3RAM A;  3H4Q A;  2ZEH A;  2CIJ A;  4UA3 A;  4OAD A;  2JLM A;  2YNC C;  3BJ8 A;  8CPA A;  5CPA A;  3T90 A;  5HMN A;  1MJ9 A;  1ON0 A;  1Y9W A;  4OAE A;  5EC4 A;  3NFZ A;  4OKO A;  3TOA A;  1Z4R A;  1IIC A;  4QUS A;  2PJ7 A;  2ZOF A;  3KI9 A;  1ARL A;  2B5G B;  2RFH A;  4Q38 A;  2BOA A;  2PIZ A;  1S7L A;  2BCO A;  3D66 A;  2ABZ A;  2ZW7 A;  4UWI A;  4MHZ A;  2PIY A;  2A4N A;  2J8N A;  4JXR A;  1YVO A;  1VKC A;  5H84 A;  3DGV A;  3RNZ A;  3B3V A;  1IOF A;  3IU1 A;  4MJ8 A;  2AE6 A;  2PJ1 A;  2B3U A;  3LMS A;  5DS0 A;  2ZEL A;  2Q4V A;  1TXR A;  5J1Q A;  4CGL A;  3LWU A;  4OC2 A;  2PSW A;  3GIU A;  1IU8 A;  4OC1 A;  4B5O A;  5HH1 A;  1XEB A;  2CNS A;  4MCQ A;  1TIQ A;  5AG5 A;  3S6H A;  4BBH A;  1CG2 A;  2R1I A;  3B3S A;  3C26 A;  4OID A;  4IHM A;  3ISX A;  4UIA A;  2B58 A;  3BJ7 A;  2B4D A;  4QB9 A;  4A37 A;  1Z8X A;  2VI7 A;  4OME A;  4PPZ A;  5AG7 A;  5LYI A;  1FNO A;  4KSI A;  3W6S A;  4EME A;  4FD6 A;  4K3N A;  4FBE A;  2QIR A;  2V77 A;  3KQZ A;  1ZG9 A;  4MFQ A;  2I00 A;  3D8P A;  4KOV A;  4RI1 A;  4U5Y A;  5G1Z A;  1VGY A;  5F47 A;  4JD6 A;  1YW6 A;  3VWD A;  1Y7R A;  2P0W A;  4ZI6 A;  3KR5 A;  2WPX A;  4BIN A;  4CGO A;  2GIV A;  4C2X A;  4P10 A;  5K8N A;  1AMP A;  1NE9 A;  2F8H A;  4II9 A;  2ZEE A;  3R9E A;  4RN7 A;  1EE3 P;  2OZH A;  1TF9 A;  1XF8 A;  1XE4 A;  3EFA A;  4P4F A;  4R6T A;  1Z8W A;  2WSA A;  2Q7B A;  3GKR A;  3D3S A;  3PEI A;  1LFW A;  3SXN A;  1DTD A;  2FIA A;  5CNP A;  1F57 A;  4KUA A;  3SJE A;  2CF4 A;  2XEG A;  3LD2 A;  2V8G A;  3T9Y A;  3DR6 A;  4G1P A;  1S7K A;  3JTK A;  4XPL A;  4DJL A;  4ZBG A;  5IB9 A;  3DSB A;  2EWB A;  1Y0Y A;  2Z3K A;  3IWG A;  1MJA A;  3TTH A;  1QQ9 A;  2PDO A;  2ZPA A;  2V8D A;  3PB4 X;  5KTA A;  4CGP A;  5EMI A;  3FX6 A;  3WC6 A;  1YSJ A;  4ZYQ A;  4MXU A;  2PJ5 A;  4UFX A;  1YW4 A;  1CP6 A;  4NJQ A;  3R9F A;  1XMT A;  5D8N A;  4UCP A;  4X3R A;  2QVP A;  2NSM A;  1I1D A;  3PP9 A;  4ORF A;  3RBU A;  1XMB A;  3W6X A;  4C68 A;  5G21 A;  3S9L A;  4IK2 A;  1RO5 A;  1NSL A;  1AYE A;  3S6G A;  5KTC A;  2FCK A;  4PXB A;  4ZGY B;  3TFY A;  1OBR A;  4MHP A;  3VWE A;  3FVL A;  5EBV A;  3BI1 A;  2B5G A;  4U9Z A;  3VAT A;  2F7V A;  3W91 A;  4FUU A;  2EBJ A;  3MGD A;  1Q2D A;  1CBX A;  4UIB A;  1RXT A;  2PJC A;  4UF4 A;  2R7H A;  2VBQ A;  4F9U A;  3IJ3 A;  1CPX A;  1Z2L A;  1PU9 A;  4YGO A;  4B10 A;  4AG7 A;  5CBM A;  2Q4Y A;  5E96 A;  2VL1 A;  4MCP A;  1XOV A;  4DYO A;  2PVW A;  3KAS A;  3K9T A;  3JUW A;  3SI1 A;  2JEW A;  1U6M A;  3E0K A;  2P6F A;  1Z9U A;  2Z10 A;  3FRM A;  4P4E A;  2PJ8 A;  4MCR A;  4OIW A;  5K8P A;  1QSO A;  1RTQ A;  2J9A A;  1Z4E A;  1AUG A;  5DWM A;  2CXA A;  1V0C A;  2JBK A;  1BOB A;  4MY0 A;  4QVT A;  4ZY2 A;  2REF A;  4E0A A;  5F46 A;  5JQ4 A;  5LRJ A;  4E2A A;  2Z3P A;  4ZY0 A;  2AFX A;  2JBJ A;  2ANP A;  2BO9 A;  4DUK A;  3IIB A;  1GHE A;  2H5M A;  4M3S A;  2D4O A;  4OC0 A;  4UEZ A;  3WC7 A;  4P4J A;  2ZW4 A;  4M6H A;  2HB6 A;  3GUX A;  1K4J A;  3HLP A;  4JXQ A;  4KVO E;  1B87 A;  3CPX A;  4UWJ A;  3HUV A;  3H8F A;  4HNX B;  3IEH A;  1HDQ A;  4NGQ A;  3CDX A;  1QSN A;  1JWQ A;  1YRE A;  3K9U A;  2Q51 A;  3CXP A;  1WK4 A;  4KSA A;  3CPA A;  1CJW A;  4NCZ A;  1F2O A;  1TF8 A;  2PE3 A;  3N5F A;  5C82 A;  5IV0 A;  1KZF A;  4MI4 A;  3SXO A;  1BPN A;  4RUH A;  2IMO A;  2XEF A;  1H8L A;  1S5K A;  2CNT A;  2PJA A;  3D68 A;  4PQA A;  1N71 A;  2ZEG A;  5DWN A;  4B13 A;  4CAW A;  4C7H A;  1VHE A;  4P45 A;  3B8G A;  2RB7 A; 
#chains in the Genus database with same CATH homology
 2VZZ A;  5GCN A;  4NXY A;  3TO6 A;  1ZO0 A;  3H5Z A;  4QBJ A;  4R87 A;  4B11 A;  2B4B A;  4CYO A;  3QAH A;  5IB0 A;  2Q04 A;  4KZT A;  1KUY A;  5BWA B;  1M4I A;  2G0B A;  5I0C A;  1L0C A;  4XNH C;  1YX0 A;  5A28 A;  5AG6 A;  2GE3 A;  4MFK A;  1KUX A;  4MY3 A;  2J8R A;  2PC1 A;  2PR1 A;  4CYQ A;  4L89 A;  4KVM E;  4MHD A;  2ATR A;  3N7Z A;  3JVN A;  4XPK A;  3F5B A;  4B5P A;  3DDD A;  2DPS A;  1YK3 A;  5J8C A;  3IGR A;  3P2H A;  1XIX A;  2P6E A;  3OWC A;  2KCW A;  3FB3 A;  3V8I A;  4IUS A;  2G3T A;  4H6Z A;  3TOB A;  2DPT A;  4E8O A;  4A33 A;  2QML A;  4MFJ A;  3QB8 A;  5H86 A;  1Y9K A;  2OH1 A;  2QEC A;  2CY2 A;  2YNC A;  4PK3 A;  4Y49 B;  4B12 A;  2BL1 A;  1R57 A;  1CM0 A;  4MFZ A;  1S7N A;  3TO7 A;  5AG4 A;  1P4N A;  1MJB A;  4KOT A;  4KS9 A;  1M4D A;  2Z3N A;  4NSQ A;  5IX3 A;  4R57 A;  5F49 A;  4JJX A;  1WWZ A;  3CXS A;  4CAV A;  3I3G A;  4Y49 C;  4HKF A;  4NEX A;  3TT2 A;  4KOS A;  3NE7 A;  2ZW5 A;  3TO9 A;  4KVX A;  3S6F A;  4A30 A;  4CGN A;  4F0Y A;  4UCM A;  2GAN A;  1S3Z A;  4B14 A;  4CAE A;  4C7I A;  1QSR A;  1UFH A;  4BMH A;  4MFL A;  2C27 A;  5G20 A;  4CGM A;  2FE7 A;  4CRY B;  4Q36 A;  4LX9 A;  2HV2 A;  4KLV A;  4QC6 A;  1IID A;  2Q44 A;  2OZG A;  1QST A;  4K30 A;  2BSW A;  2I79 A;  2Y0M A;  5AGE A;  2VEZ A;  4A32 A;  4C2Z A;  3SHP A;  4AVA A;  2DXQ A;  1SQH A;  4KUB A;  5ISV A;  1NMT A;  3FXT A;  2HQY A;  4OLL A;  3R9G A;  4JLY A;  2AJ6 A;  2Z3L A;  1YR0 A;  4R3L A;  4F6A A;  2EVN A;  3ZJ0 A;  3S6K A;  3ZZI A;  1M44 A;  2FSR A;  2X7B A;  4PSX A;  2OB0 A;  3EO4 A;  5JPH A;  4X5K A;  4KOX A;  2BUE A;  4RS2 A;  4R3K A;  4KOU A;  2VZY A;  5J8F A;  2FIW A;  4JWP A;  4UFW A;  4CYN A;  4KOR A;  3WR7 A;  4XNH B;  3RYO A;  4MFP A;  2D4P A;  4CAF A;  3D2P A;  2JDC A;  2Z3O A;  2CNM A;  3FNC A;  4HNY B;  2FXF A;  3R1K A;  1I21 A;  3A9L A;  3PZJ A;  4AG9 A;  2RC4 A;  5A27 A;  5C88 A;  2FS5 A;  1S7F A;  2K5T A;  4KLW A;  2WUU A;  3PGP A;  1Q2C A;  4YFJ A;  3KKW A;  4DNC A;  4UBR A;  1MK4 A;  3EXN A;  4AVC A;  3I9S A;  5G22 A;  2OU2 A;  3F8K A;  2YND A;  1J4J A;  1BO4 A;  4H6U A;  4U9Y A;  1I12 A;  1IYL A;  3FBU A;  4F0X A;  4YRH A;  4KOW A;  4R9M A;  3GY9 A;  3TCV A;  4L8A A;  1IYK A;  3UY5 A;  4CYP A;  3CXQ A;  2JEV A;  3GYA A;  2OZU A;  4M85 A;  2REE A;  2FL4 A;  4KOY A;  2VQY A;  4AVB A;  1S60 A;  2HUZ A;  4XPD B;  4I49 A;  4GS4 A;  3D2M A;  4C2Y A;  2JDD A;  1LRZ A;  1YVK A;  3R95 A;  2Z3M A;  2ZW6 A;  4H89 A;  3IWE A;  3G8W A;  3BLN A;  4PSW A;  5FVJ A;  2J8M A;  3EC4 A;  1IB1 E;  2FT0 A;  4XPD C;  4EVY A;  2F5I A;  4KSF A;  1PUA A;  3TE4 A;  3FYN A;  2B3V A;  4AB7 A;  2YNE A;  3G3S A;  2ARH A;  2B4D B;  3P2F A;  4PV6 A;  1YLE A;  1QSM A;  2IL4 A;  4FD5 A;  4ONU A;  2WPW A;  4UCN A;  2YGW A;  3DNS A;  3EY5 A;  4J3G A;  4A95 A;  3IU2 A;  4CAX A;  1Q2Y A;  1OZP A;  4B5P B;  2G3A A;  4IF5 A;  4CRZ B;  2Z11 A;  5KTD A;  4FD7 A;  3FIX A;  1P0H A;  2Z0Z A;  5F48 A;  2EUI A;  3DR8 A;  4UFV A;  1VHS A;  2R8V A;  2R98 A;  4LUA A;  1M1D A;  4PK2 A;  4MBU A;  3F0A A;  2O28 A;  3LOD A;  2NMT A;  1FY7 A;  2PR8 A;  1KUV A;  2Q0Y A;  2PRB A;  4HNW B;  4FD4 A;  2PQ8 A;  2BEI A;  4CS0 B;  2ZXV A;  4NF1 A;  2P6G A;  1M4G A;  2VXK A;  1B6B A;  4A31 A;  3R96 A;  1YGH A;  4A2Z A;  3H4Q A;  4UA3 A;  4OAD A;  2JLM A;  2YNC C;  3BJ8 A;  5HMN A;  3T90 A;  1MJ9 A;  1ON0 A;  1Y9W A;  4OAE A;  5EC4 A;  3TOA A;  1Z4R A;  1IIC A;  4QUS A;  2B5G B;  4Q38 A;  1S7L A;  2ZW7 A;  4UWI A;  2A4N A;  2J8N A;  4JXR A;  1YVO A;  1VKC A;  5H84 A;  3IU1 A;  4MJ8 A;  2AE6 A;  2B3U A;  2Q4V A;  4CGL A;  2PSW A;  4B5O A;  5HH1 A;  1XEB A;  2CNS A;  3S6H A;  1TIQ A;  5AG5 A;  4BBH A;  2R1I A;  3C26 A;  2B58 A;  3BJ7 A;  2B4D A;  4QB9 A;  2VI7 A;  5AG7 A;  3W6S A;  4FD6 A;  2QIR A;  4MFQ A;  3D8P A;  2I00 A;  4KOV A;  4RI1 A;  4U5Y A;  5G1Z A;  5F47 A;  4JD6 A;  3VWD A;  1Y7R A;  2P0W A;  2WPX A;  4CGO A;  2GIV A;  4C2X A;  1NE9 A;  4II9 A;  2OZH A;  1XF8 A;  1XE4 A;  3EFA A;  2WSA A;  2Q7B A;  3GKR A;  3D3S A;  3SXN A;  2FIA A;  5CNP A;  4KUA A;  3LD2 A;  3T9Y A;  3DR6 A;  4XPL A;  1S7K A;  3JTK A;  4ZBG A;  3DSB A;  2Z3K A;  3IWG A;  1MJA A;  3TTH A;  2PDO A;  2ZPA A;  5KTA A;  4CGP A;  4UFX A;  3R9F A;  1XMT A;  4UCP A;  3W6X A;  4ORF A;  1I1D A;  3PP9 A;  4C68 A;  5G21 A;  1RO5 A;  1NSL A;  3S6G A;  5KTC A;  2FCK A;  4ZGY B;  3TFY A;  3VWE A;  5EBV A;  2B5G A;  4U9Z A;  3W91 A;  3MGD A;  1Q2D A;  1RXT A;  2R7H A;  2VBQ A;  1PU9 A;  4YGO A;  4B10 A;  4AG7 A;  2Q4Y A;  5E96 A;  3JUW A;  1U6M A;  3E0K A;  2P6F A;  1Z9U A;  2Z10 A;  3FRM A;  1QSO A;  1Z4E A;  5DWM A;  2CXA A;  1V0C A;  4MY0 A;  1BOB A;  4QVT A;  4E0A A;  5F46 A;  2REF A;  5JQ4 A;  4E2A A;  2Z3P A;  4M3S A;  1GHE A;  2H5M A;  2D4O A;  2ZW4 A;  4JXQ A;  4KVO E;  1K4J A;  3R9E A;  1B87 A;  4UWJ A;  4HNX B;  1QSN A;  1YRE A;  3K9U A;  3CXP A;  1WK4 A;  4KSA A;  1CJW A;  4NCZ A;  5C82 A;  5IV0 A;  1KZF A;  4MI4 A;  3SXO A;  2CNT A;  1S5K A;  5DWN A;  4B13 A;  4CAW A;  1N71 A;  4C7H A;  3B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...