2YNCC

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
370
Chain Sequence
b'DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFLYKVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 370
sequence length 384
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
C PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncC00
5A28A 4CAFA 4BBHA 2YNCA 4A2ZA 3IU2A 4CYPA 4B11A 4A95A 4A31A 4A30A 4CYOA 5AG6A 4A33A 4C7HA 5G22A 2WSAA 4UCMA 4C2ZA 5G1ZA 4UFWA 5AG5A 4B14A 5AGEA 3H5ZA 2WUUA 3IWEA 4B12A 4C68A 4CGLA 4CGNA 4CYNA 4UFXA 4CAEA 2YNDA 5AG7A 5AG4A 4CGOA 3IU1A 4UCPA 4CYQA 5G20A 4C2YA 4CGMA 5G21A 2YNCC 4C2XA 4CGPA 2YNEA 4B10A 5A27A 3JTKA 4A32A 4UFVA 4UCNA 4B13A 4C7IA
chains in the Genus database with same CATH superfamily
5K8MA 2GIVA 3CPAA 2VL1A 1YVOA 1U6MA 1TXRA 3R1KA 3TFYA 5JM6A 2GU2A 4NFRA 4MY3A 1KUYA 3VH9A 4F8ZA 4KUBA 5HVFA 1Z4RA 1NMTA 3FH4A 1Y7RA 2JEWA 1XRYA 2Z3OA 4KOUA 2Z11A 4UEZA 4XPDC 2O4HA 2JDDA 3D7GA 2REEA 1LFWA 1MJBA 1Y0YA 2AFOA 1DE4C 2F5IA 2PJ7A 3EO4A 4KSFA 4OKOA 4CGOA 1KZFA 4IK2A 4MFQA 1Y9WA 4Q38A 2FXFA 4AVBA 4RS2A 4P10A 2ZENA 1UWYA 1X12A 3QB8A 4FD4A 4R7MA 2EK8A 3D3SA 4U5YA 4KUAA 4C7IA 3R96A 3I9SA 1LANA 3PB6X 4PSWA 2DPSA 4A31A 1TF9A 2RFHA 2REFA 1Q2DA 2GFQA 2Q43A 1LAMA 2PVVA 1F2PA 1FNOA 4OADA 4OIWA 5D29A 4ORFA 4ZX9A 2OZGA 1NE9A 2Q4ZA 3TOBA 3ZJ0A 4A94A 4WJBA 3D8PA 5LYDA 4LX9A 4MFZA 4OIDA 2ZOFA 3PBEA 4C68A 4CGNA 1M4IA 3B3SA 5AG7A 1LCPA 2WPXA 4UCPA 2ZOGA 4MBUA 1M4DA 4MI4A 4CAVA 2A4NA 4ZX8A 5A27A 4DUKA 1YR0A 1K4JA 4MRIA 3VWDA 1TF8A 2CNTA 4YGOA 3S6HA 2PJ1A 4EFDA 3FNCA 3IWWA 1QSRA 2OZHA 2XEFA 4E8OA 1YQEA 4K30A 4UIAA 5LYLA 4KVXA 4OP4A 3MRUA 2PJCA 2ZW4A 1HDUA 1QSMA 4OC5A 2PJAA 2ZW7A 3MN8A 1R57A 3KGQA 4MCQA 4AB7A 4B14A 4OC0A 2PJBA 3FF3A 3PBBA 2JBKA 4UBRA 5DWMA 3VWEA 3GIUA 4NGNA 2B4BA 2F7VA 2CNSA 3R9FA 2WZNA 4MFPA 2EVNA 2BL1A 3MGDA 4CAXA 4KS9A 4H6UA 4CGMA 2YNCC 2ZXVA 4CRYB 3W6XA 3S6KA 4KOYA 4XPDB 1NSLA 1BPMA 4KLVA 1ZG9A 3NE8A 4UCNA 2ZEHA 1CG2A 5HMNA 4ZY0A 4CAFA 4PK2A 2CF4A 2YNCA 3KZWA 4NF1A 4A2ZA 4ZI6A 4B11A 3V7ZA 3IEHA 1TKJA 1Z8TA 2RB7A 4M6GA 2GLFA 4FAIA 4GXHA 2B3UA 3V38A 1YW4A 3B3CA 3P2FA 2ZPAA 1QSOA 1ZLHA 2HV2A 3H4QA 1WK4A 3D7DA 2JDCA 3LWUA 3NFZA 4FWUA 4PSXA 4P4FA 4PXBA 4GM5A 5KTDA 1SQHA 3RNZA 1IICA 1QMUA 2PRQA 1AYEA 2HUZA 3D4UA 3ISXA 1XFOA 3K2KA 3QNVA 1TKFA 3WABA 3WR7A 4QVTA 1TKHA 1F2OA 4QBJA 5K8NA 3DR8A 4KLWA 4U9YA 3KKWA 4AVAA 2YGWA 3D2PA 2PCUA 2PJ5A 1ZG7A 1PYTB 3W91A 1Y7EA 3CXSA 4MHPA 4QB9A 2EWBA 1Q7LA 2Z3MA 2ZEPA 2C6PA 3PRTA 5LYFA 1M44A 3NH8A 2G0BA 3GYAA 4GS4A 4MFJA 5BWAB 3FMCA 3DLJA 4UFWA 3RAMA 2Z3NA 3H5ZA 1Z8XA 2PE3A 4KZTA 4BINA 5H86A 4OC3A 3I1UA 4NGTA 4E0AA 1YSJA 4P44A 3TX8A 4P6YA 4NGRA 2B58A 3LD2A 5JGFA 2D4OA 4BD9A 1PUAA 3VARA 5G20A 2VBQA 4E2AA 2ZW5A 1I1DA 3A9LA 2B5GB 1P4NA 2JEVA 5CNPA 2V8GA 5K8PA 4ONUA 1CJWA 2AFZA 1R3NA 1BOBA 3VATA 1LRZA 5HVGA 2OH1A 1ARMA 2JBJA 4YRHA 4JWPA 1WWZA 2IMOA 4C7HA 4R6TA 3TT2A 2CXAA 5AGEA 3ZZIA 2ANPA 5KTCA 2ZEEA 2XEIA 2EUIA 1IYKA 2OB0A 1Y0RA 4OAEA 4JXRA 2FT0A 2PVWA 3EC4A 4KSIA 3FJUA 4HPSA 2OR4A 1S3ZA 2H5MA 2CNMA 2GE3A 2Q7SA 4MCSA 4MJ8A 1Z4EA 3FECA 1DTDA 1MK4A 2GANA 3PB7X 2J8NA 3LACA 3B7IA 2CIJA 5I4MA 4JD6A 4M85A 5F09A 3IU2A 4FD6A 3TCVA 2DEAA 3IFEA 2POKA 4YFJA 2VEZA 5H84A 1J4JA 1OBRA 3FXTA 1X10A 4HNXB 2C6CA 2G9DA 3E0KA 3H8EA 2PSWA 4TWEA 5FVJA 3KHZA 2G3TA 5LYIA 1RO5A 2V77A 4CAEA 3RZAA 1L0CA 4IAVA 1JWQA 3FEEA 2X7BA 1Q2CA 4H6ZA 4MY0A 5LRJA 2J8MA 4MCRA 6CPAA 3BXMA 2KCWA 1VIXA 1MJ9A 1AMPA 1N71A 2FL4A 3SI2A 3K9UA 4FUUA 5CPAA 1CBXA 3G3SA 3KR5A 4OC4A 2CTBA 4R87A 5C82A 1VKCA 3D2MA 3JVNA 1IOFA 3K9TA 5G1ZA 4O23A 1XEBA 1ARLA 4KSAA 3CXPA 4QUSA 3N7ZA 2PQ8A 3IIBA 4XPLA 3SI1A 2AJ6A 2NSMA 4X2TA 2V8DA 2GLJA 4JXQA 7CPAA 2QIRA 4A37A 1IY7A 3KR4A 4KORA 4ZYQA 5J8CA 5EMIA 1Z9UA 5JQ4A 1Z2LA 4R3KA 4B6ZA 1YVKA 2ODFA 4Y49B 2R1IA 2PDOA 3TOAA 4CGPA 1JQGA 3CXQA 4WWVA 2B5GA 1IU8A 3JTKA 3EY5A 3BHXA 3KQXA 4AVCA 4PXEA 4IF5A 2ZEDA 3V8IA 3IC1A 3C26A 4HNYB 4BBHA 2CTCA 3FX6A 2ZELA 2ZW6A 3B8GA 1QSNA 4OC2A 2PRBA 1CPXA 4CYOA 5F46A 2P0WA 3R9GA 2PJ0A 4R57A 4P4EA 1HDQA 4JZ0A 3T9YA 1LAPA 4PQAA 1KWMA 3CT9A 4NGMA 5CBMA 2G3AA 1YMEA 2AFMA 2PIYA 3BI0A 1QQ9A 1UFHA 3B3WA 1XIXA 4PV6A 2WPWA 4YU9A 5DS0A 3SXNA 1HEEA 2BEIA 3NH4A 3PB8X 1Z8LA 1S7FA 3QAYA 4LUAA 4M6HA 4B10A 4RUHA 3FYNA 4CAWA 4AG9A 3WT4A 4RI1A 3D66A 3LODA 4YWYA 3DR6A 2Z0ZA 3WC6A 5J8FA 2O28A 4NEXA 4MHZA 3FB3A 4X8IA 3SJXA 4A30A 3FEDA 5G22A 4ZBGA 4FD5A 1YLEA 4P4IA 5JH9A 2PJ6A 2V8HA 1XOVA 1IB1E 3IWGA 4ONWA 4P45A 2AE6A 2C6GA 2R98A 1H8LA 4R76A 4G1PA 2YNDA 2HC9A 4XPKA 2Q04A 4HKFA 5AG4A 2VZZA 3R9EA 1CPSA 4KOSA 3DGVA 1YK3A 2Q7BA 3R95A 5G21A 3GUXA 4C2YA 2HB6A 2B3VA 4P4DA 3BJ8A 1PU9A 4DJLA 3TE4A 4NGSA 4X5KA 4AG7A 2BUEA 1Y9KA 4ZY1A 2Q4VA 4OC1A 3IGRA 4CYPA 4M3SA 5F49A 2DXQA 3PGPA 3BJ7A 3GB0A 4UIBA 2J8RA 4L89A 3ISZA 3UY5A 3FBUA 3PB4X 3GY9A 2NMTA 3LMSA 4B5PA 3DSBA 3JUWA 3T8WA 1M4GA 1ON0A 2WUUA 2BSWA 3IWEA 4MFKA 4Y49C 4B5OA 4UEFA 3EFAA 1MJAA 1Z8WA 2PJ2A 2PJ4A 4MHYA 4CS0B 4EWTA 4QC6A 4Q36A 2NYQA 8CPAA 5DWNA 4KOVA 4C2XA 2OU2A 3NA6A 4NJQA 1EE3P 2CY2A 3SJGA 4JJXA 4CPAA 4EVYA 2ZEMA 2QECA 3D67A 3PB9X 3S6GA 3T90A 2FS5A 4FD7A 1VGYA 1S5KA 2QMLA 2PJ9A 3RYOA 1IGBA 3SHPA 5K8OA 1ZO0A 1V0CA 2O53A 3F8KA 3P2HA 4A95A 4DNCA 4CRZB 1B6BA 1YREA 1A2ZA 2FVGA 2QVPA 4A33A 4EMEA 4IUSA 5KTAA 2QJ8A 2IQ6A 4P4BA 5THWA 2FSRA 3WC5A 4NSQA 1CM0A 5I0CA 1XF8A 1XBUA 2FIWA 4II9A 1CP7A 1I12A 2JLMA 2QYVA 2R8VA 2OZUA 4X3RA 4H2KA 1P0HA 5E96A 4CYNA 4F6AA 2VZYA 4XNHC 4RN7A 1KUVA 1IYLA 3NE7A 4FBEA 2V8VA 4CYQA 3B2YA 4K3NA 2EBJA 3B35A 3JRUA 5IX3A 4NGPA 2IJZA 4H89A 2AFUA 2I79A 1XMBA 1BO4A 4UF4A 2Q44A 2ZEGA 4A39A 4R3LA 1Z5RA 2Z3PA 3SXOA 2AFXA 2ZEOA 1Q2YA 5AG6A 4BMHA 1B87A 1S7NA 3RO0A 4JYWA 2GREA 4A38A 3S9NA 3KHXA 4U9ZA 3SI0A 3TC8A 3SJEA 4J3GA 4B5PB 3TO9A 2PJ3A 1KUXA 2PJ8A 4L8AA 1TIQA 2C1CA 3L2NA 3I3GA 4UFXA 1BLLE 2ARHA 4W9YA 2Z3KA 4I49A 1CP6A 2D4PA 3B3VA 3IU1A 4R8FA 2FIAA 2Z10A 4UEEA 1OZPA 3G8WA 2B4DB 3FVLA 4ZY2A 5EBVA 4TNUA 3D7FA 3FIXA 3BI1A 4MXUA 4UWIA 5HXDA 4B13A 4IHMA 4LQGA 3KQZA 3W6SA 4OMEA 4PXDA 5IV0A 2I00A 5F47A 2IL4A 3CDXA 1AUGA 5JPHA 1YX0A 2VXKA 3PP9A 1PCAA 3GLJA 3SJFA 1I21A 3CZXA 5IB9A 3FRMA 4NJRA 4KVME 3PEIA 2Z3LA 2DPTA 4AXVA 2BOAA 3CPXA 5HVHA 2DF5A 4KOWA 3PFEA 3GKRA 1IIDA 1BAVA 3S9LA 4KOTA 3RBUA 2ABZA 3F5BA 4Q7AA 1ELMP 2EK9A 3NH5A 3DNSA 4P4JA 4ZGYB 2Q4YA 1R43A 2ZEFA 4MMOA 4XNHB 5ELYA 2I3CA 5IB0A 2PC1A 2ATRA 2VI7A 3H8FA 4M6IA 1XE4A 2XEGA 5HH1A 5C88A 3PFOA 2P6GA 3TO6A 3WC7A 1FT7A 2F8HA 4PPZA 1GHEA 3DDDA 4NGQA 3F0AA 4MCPA 3B3TA 1M4LA 4F9VA 2BO9A 3BLNA 3KI9A 4DYOA 3D68A 5D8NA 4F0XA 2EO8A 5GCNA 4F0YA 2Q51A 4UA3A 2PIZA 2HQYA 5LRGA 3EXNA 3S9MA 1ELLP 3HLPA 1YW6A 2P6EA 4MFLA 2WYRA 1CX8A 1FY7A 1XMTA 1LOKA 4Z65A 5LRKA 2Q0YA 2OOTA 2YNEA 3N5FA 1M1DA 3D7HA 1VHOA 4LQ6A 4PK3A 2PR1A 4KOXA 2R7HA 2Y0MA 4A32A 1VHSA 5A28A 1NSAA 2K5TA 1F57A 2P6FA 4KVOE 5F48A 1IOIA 5EC4A 2C27A 4UWJA 2J9AA 4PXCA 1RTQA 1QSTA 2XEJA 3TO7A 3S6FA 4C2ZA 2VQYA 2WSAA 4UCMA 3QAHA 1XJOA 1YLOA 5AG5A 3HUVA 4MHNA 3PZJA 4OLLA 1S7KA 1ZLIA 1YGHA 4B12A 3TTHA 2FE7A 4R9MA 4MHDA 4CGLA 4JLYA 1VHEA 3H8GA 1BPNA 1ZG8A 1S60A 2PR8A 4F9UA 4NCZA 2AFSA 2RC4A 3OWCA 5ISVA 2B4DA 1S7LA 1RXTA 3IO1A 1GYTA 3KL9A 2FCKA 4NXYA 2BCOA 4HNWB 3KASA 3IJ3A 4UFVA 5J1QA 2AFWA
chains in the Genus database with same CATH topology
2GIVA 1YVOA 1U6MA 3R1KA 3TFYA 4MY3A 1KUYA 4KUBA 1Z4RA 1NMTA 1Y7RA 2Z3OA 4KOUA 2Z11A 4XPDC 2JDDA 2REEA 1MJBA 3EO4A 2F5IA 4KSFA 4CGOA 1KZFA 4MFQA 1Y9WA 4Q38A 2FXFA 4AVBA 4RS2A 3QB8A 4FD4A 3D3SA 4U5YA 4KUAA 4C7IA 3R96A 3I9SA 4PSWA 2DPSA 4A31A 2REFA 1Q2DA 3TE4A 4OADA 3RYOA 3ZJ0A 3TOBA 4ORFA 2OZGA 1NE9A 4C68A 3D8PA 4LX9A 4MFZA 4CGNA 1M4IA 5AG7A 2WPXA 4UCPA 4MBUA 1M4DA 4MI4A 4CAVA 2A4NA 5A27A 1YR0A 1K4JA 3VWDA 2CNTA 4YGOA 3S6HA 3FNCA 1QSRA 2OZHA 4E8OA 4K30A 4KVXA 2ZW4A 1QSMA 2ZW7A 1R57A 4AB7A 4B14A 5DWMA 4UBRA 3VWEA 2B4BA 2CNSA 3R9FA 4MFPA 2EVNA 2BL1A 3MGDA 4CAXA 4KS9A 4H6UA 4CGMA 2YNCC 2ZXVA 4CRYB 3W6XA 3S6KA 4KOYA 4XPDB 1NSLA 4KLVA 4UCNA 5HMNA 4CAFA 4PK2A 2YNCA 4A2ZA 4NF1A 4B11A 2B3UA 3P2FA 2ZPAA 1QSOA 2HV2A 3H4QA 1WK4A 2JDCA 4PSXA 5KTDA 1SQHA 1IICA 2HUZA 3WR7A 4QBJA 4QVTA 3DR8A 4KLWA 4U9YA 3KKWA 4AVAA 2YGWA 3D2PA 3W91A 3CXSA 4QB9A 2Z3MA 1M44A 2G0BA 3GYAA 4GS4A 4MFJA 5BWAB 4UFWA 2Z3NA 3H5ZA 4KZTA 5H86A 4E0AA 2B58A 3LD2A 2D4OA 1PUAA 5G20A 2VBQA 4E2AA 2ZW5A 1I1DA 3A9LA 2B5GB 1P4NA 2JEVA 5CNPA 4ONUA 1CJWA 1BOBA 1LRZA 2OH1A 4YRHA 4JWPA 1WWZA 4C7HA 3TT2A 2CXAA 5AGEA 3ZZIA 5KTCA 2EUIA 1IYKA 2OB0A 4OAEA 4JXRA 2FT0A 3EC4A 1S3ZA 2H5MA 2CNMA 2GE3A 4MJ8A 1Z4EA 1MK4A 2GANA 2J8NA 4JD6A 4M85A 3IU2A 4FD6A 3TCVA 4YFJA 2VEZA 5H84A 1J4JA 3FXTA 4HNXB 3E0KA 2PSWA 5FVJA 2G3TA 1RO5A 4CAEA 1L0CA 2X7BA 1Q2CA 4H6ZA 4MY0A 2J8MA 2KCWA 1MJ9A 1N71A 2FL4A 3K9UA 3G3SA 4R87A 5C82A 1VKCA 3D2MA 3JVNA 5G1ZA 1XEBA 4KSAA 4QUSA 3CXPA 3N7ZA 2PQ8A 4XPLA 2AJ6A 4JXQA 2QIRA 4KORA 5J8CA 5JQ4A 1Z9UA 4R3KA 1YVKA 4Y49B 2R1IA 2PDOA 3TOAA 4CGPA 3CXQA 2B5GA 3JTKA 3EY5A 4AVCA 4IF5A 3V8IA 4HNYB 3C26A 4BBHA 2ZW6A 3B8GA 1QSNA 4CYOA 2PRBA 5F46A 2P0WA 3R9GA 4R57A 3T9YA 2G3AA 1UFHA 4PV6A 1XIXA 2WPWA 3SXNA 2BEIA 1S7FA 4LUAA 4B10A 3FYNA 4CAWA 4AG9A 4RI1A 3LODA 5J8FA 3DR6A 2Z0ZA 2O28A 4NEXA 4A30A 3FB3A 5G22A 4ZBGA 4FD5A 1YLEA 3IWGA 1IB1E 2AE6A 2R98A 2YNDA 4XPKA 2Q04A 4HKFA 5AG4A 2VZZA 3R9EA 4KOSA 2Q7BA 1YK3A 3R95A 4C2YA 5G21A 2B3VA 3BJ8A 1PU9A 4X5KA 4AG7A 2BUEA 1Y9KA 2Q4VA 3IGRA 4CYPA 4M3SA 5F49A 2DXQA 3PGPA 3BJ7A 2J8RA 4L89A 3UY5A 3FBUA 3GY9A 2NMTA 4B5PA 3DSBA 3JUWA 1M4GA 1ON0A 2WUUA 2BSWA 3IWEA 4MFKA 4Y49C 4B5OA 3EFAA 1MJAA 4CS0B 4QC6A 4Q36A 5DWNA 4KOVA 4C2XA 2OU2A 2CY2A 4JJXA 4EVYA 2QECA 3S6GA 3T90A 2FS5A 4FD7A 1S5KA 2QMLA 3SHPA 1ZO0A 1V0CA 3F8KA 3P2HA 4A95A 4DNCA 4CRZB 1B6BA 1YREA 4A33A 4IUSA 5KTAA 2FSRA 4NSQA 1CM0A 5I0CA 1XF8A 2FIWA 4II9A 1I12A 2JLMA 2R8VA 2OZUA 1P0HA 5E96A 4CYNA 4F6AA 2VZYA 4XNHC 1KUVA 1IYLA 3NE7A 4CYQA 5IX3A 4H89A 2I79A 1BO4A 2Q44A 4R3LA 2Z3PA 3SXOA 1Q2YA 5AG6A 4BMHA 1B87A 1S7NA 4U9ZA 4J3GA 4B5PB 3TO9A 1KUXA 4L8AA 1TIQA 3I3GA 4UFXA 2ARHA 2Z3KA 4I49A 2D4PA 3IU1A 2FIAA 2Z10A 1OZPA 3G8WA 2B4DB 5EBVA 3FIXA 4UWIA 4B13A 3W6SA 5IV0A 2I00A 5F47A 2IL4A 5JPHA 1YX0A 2VXKA 3PP9A 1I21A 3FRMA 4KVME 2Z3LA 2DPTA 4KOWA 3GKRA 1IIDA 4KOTA 3F5BA 3DNSA 4ZGYB 2Q4YA 4XNHB 5IB0A 2PC1A 2ATRA 2VI7A 1XE4A 5HH1A 5C88A 2P6GA 3TO6A 1GHEA 3DDDA 3F0AA 3BLNA 4F0XA 4F0YA 5GCNA 4UA3A 2HQYA 3EXNA 2P6EA 4MFLA 1FY7A 1XMTA 2Q0YA 2YNEA 4PK3A 1M1DA 2PR1A 4KOXA 2R7HA 2Y0MA 4A32A 1VHSA 5A28A 2K5TA 2P6FA 4KVOE 5F48A 5EC4A 2C27A 4UWJA 1QSTA 3TO7A 3S6FA 4C2ZA 2VQYA 2WSAA 4UCMA 3QAHA 5AG5A 3PZJA 4OLLA 1S7KA 1YGHA 4B12A 3TTHA 2FE7A 4R9MA 4MHDA 4CGLA 4JLYA 1S60A 2PR8A 4NCZA 2RC4A 5ISVA 3OWCA 2B4DA 1S7LA 1RXTA 2FCKA 4NXYA 4HNWB 4UFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A28 A;  4CAF A;  4BBH A;  2YNC A;  4A2Z A;  3IU2 A;  4CYP A;  4B11 A;  4A95 A;  4A31 A;  4A30 A;  4CYO A;  5AG6 A;  4A33 A;  4C7H A;  5G22 A;  2WSA A;  4UCM A;  4C2Z A;  5G1Z A;  4UFW A;  5AG5 A;  4B14 A;  5AGE A;  3H5Z A;  2WUU A;  3IWE A;  4B12 A;  4C68 A;  4CGL A;  4CGN A;  4CYN A;  4UFX A;  4CAE A;  2YND A;  5AG7 A;  5AG4 A;  4CGO A;  3IU1 A;  4UCP A;  4CYQ A;  5G20 A;  4C2Y A;  4CGM A;  5G21 A;  2YNC C;  4C2X A;  4CGP A;  2YNE A;  4B10 A;  5A27 A;  3JTK A;  4A32 A;  4UFV A;  4UCN A;  4B13 A;  4C7I A; 
#chains in the Genus database with same CATH topology
 5K8M A;  2GIV A;  3CPA A;  2VL1 A;  1YVO A;  1U6M A;  1TXR A;  3R1K A;  3TFY A;  5JM6 A;  2GU2 A;  4NFR A;  4MY3 A;  1KUY A;  3VH9 A;  4F8Z A;  4KUB A;  5HVF A;  1Z4R A;  1NMT A;  3FH4 A;  1Y7R A;  2JEW A;  1XRY A;  2Z3O A;  4KOU A;  2Z11 A;  4UEZ A;  4XPD C;  2O4H A;  2JDD A;  3D7G A;  2REE A;  1LFW A;  1MJB A;  1Y0Y A;  2AFO A;  1DE4 C;  2F5I A;  2PJ7 A;  3EO4 A;  4KSF A;  4OKO A;  4CGO A;  1KZF A;  4IK2 A;  4MFQ A;  1Y9W A;  4Q38 A;  2FXF A;  4AVB A;  4RS2 A;  4P10 A;  2ZEN A;  1UWY A;  1X12 A;  3QB8 A;  4FD4 A;  4R7M A;  2EK8 A;  3D3S A;  4U5Y A;  4KUA A;  4C7I A;  3R96 A;  3I9S A;  1LAN A;  3PB6 X;  4PSW A;  2DPS A;  4A31 A;  1TF9 A;  2RFH A;  2REF A;  1Q2D A;  2GFQ A;  2Q43 A;  1LAM A;  2PVV A;  1F2P A;  1FNO A;  4OAD A;  4OIW A;  5D29 A;  4ORF A;  4ZX9 A;  2OZG A;  1NE9 A;  2Q4Z A;  3TOB A;  3ZJ0 A;  4A94 A;  4WJB A;  3D8P A;  5LYD A;  4LX9 A;  4MFZ A;  4OID A;  2ZOF A;  3PBE A;  4C68 A;  4CGN A;  1M4I A;  3B3S A;  5AG7 A;  1LCP A;  2WPX A;  4UCP A;  2ZOG A;  4MBU A;  1M4D A;  4MI4 A;  4CAV A;  2A4N A;  4ZX8 A;  5A27 A;  4DUK A;  1YR0 A;  1K4J A;  4MRI A;  3VWD A;  1TF8 A;  2CNT A;  4YGO A;  3S6H A;  2PJ1 A;  4EFD A;  3FNC A;  3IWW A;  1QSR A;  2OZH A;  2XEF A;  4E8O A;  1YQE A;  4K30 A;  4UIA A;  5LYL A;  4KVX A;  4OP4 A;  3MRU A;  2PJC A;  2ZW4 A;  1HDU A;  1QSM A;  4OC5 A;  2PJA A;  2ZW7 A;  3MN8 A;  1R57 A;  3KGQ A;  4MCQ A;  4AB7 A;  4B14 A;  4OC0 A;  2PJB A;  3FF3 A;  3PBB A;  2JBK A;  4UBR A;  5DWM A;  3VWE A;  3GIU A;  4NGN A;  2B4B A;  2F7V A;  2CNS A;  3R9F A;  2WZN A;  4MFP A;  2EVN A;  2BL1 A;  3MGD A;  4CAX A;  4KS9 A;  4H6U A;  4CGM A;  2YNC C;  2ZXV A;  4CRY B;  3W6X A;  3S6K A;  4KOY A;  4XPD B;  1NSL A;  1BPM A;  4KLV A;  1ZG9 A;  3NE8 A;  4UCN A;  2ZEH A;  1CG2 A;  5HMN A;  4ZY0 A;  4CAF A;  4PK2 A;  2CF4 A;  2YNC A;  3KZW A;  4NF1 A;  4A2Z A;  4ZI6 A;  4B11 A;  3V7Z A;  3IEH A;  1TKJ A;  1Z8T A;  2RB7 A;  4M6G A;  2GLF A;  4FAI A;  4GXH A;  2B3U A;  3V38 A;  1YW4 A;  3B3C A;  3P2F A;  2ZPA A;  1QSO A;  1ZLH A;  2HV2 A;  3H4Q A;  1WK4 A;  3D7D A;  2JDC A;  3LWU A;  3NFZ A;  4FWU A;  4PSX A;  4P4F A;  4PXB A;  4GM5 A;  5KTD A;  1SQH A;  3RNZ A;  1IIC A;  1QMU A;  2PRQ A;  1AYE A;  2HUZ A;  3D4U A;  3ISX A;  1XFO A;  3K2K A;  3QNV A;  1TKF A;  3WAB A;  3WR7 A;  4QVT A;  1TKH A;  1F2O A;  4QBJ A;  5K8N A;  3DR8 A;  4KLW A;  4U9Y A;  3KKW A;  4AVA A;  2YGW A;  3D2P A;  2PCU A;  2PJ5 A;  1ZG7 A;  1PYT B;  3W91 A;  1Y7E A;  3CXS A;  4MHP A;  4QB9 A;  2EWB A;  1Q7L A;  2Z3M A;  2ZEP A;  2C6P A;  3PRT A;  5LYF A;  1M44 A;  3NH8 A;  2G0B A;  3GYA A;  4GS4 A;  4MFJ A;  5BWA B;  3FMC A;  3DLJ A;  4UFW A;  3RAM A;  2Z3N A;  3H5Z A;  1Z8X A;  2PE3 A;  4KZT A;  4BIN A;  5H86 A;  4OC3 A;  3I1U A;  4NGT A;  4E0A A;  1YSJ A;  4P44 A;  3TX8 A;  4P6Y A;  4NGR A;  2B58 A;  3LD2 A;  5JGF A;  2D4O A;  4BD9 A;  1PUA A;  3VAR A;  5G20 A;  2VBQ A;  4E2A A;  2ZW5 A;  1I1D A;  3A9L A;  2B5G B;  1P4N A;  2JEV A;  5CNP A;  2V8G A;  5K8P A;  4ONU A;  1CJW A;  2AFZ A;  1R3N A;  1BOB A;  3VAT A;  1LRZ A;  5HVG A;  2OH1 A;  1ARM A;  2JBJ A;  4YRH A;  4JWP A;  1WWZ A;  2IMO A;  4C7H A;  4R6T A;  3TT2 A;  2CXA A;  5AGE A;  3ZZI A;  2ANP A;  5KTC A;  2ZEE A;  2XEI A;  2EUI A;  1IYK A;  2OB0 A;  1Y0R A;  4OAE A;  4JXR A;  2FT0 A;  2PVW A;  3EC4 A;  4KSI A;  3FJU A;  4HPS A;  2OR4 A;  1S3Z A;  2H5M A;  2CNM A;  2GE3 A;  2Q7S A;  4MCS A;  4MJ8 A;  1Z4E A;  3FEC A;  1DTD A;  1MK4 A;  2GAN A;  3PB7 X;  2J8N A;  3LAC A;  3B7I A;  2CIJ A;  5I4M A;  4JD6 A;  4M85 A;  5F09 A;  3IU2 A;  4FD6 A;  3TCV A;  2DEA A;  3IFE A;  2POK A;  4YFJ A;  2VEZ A;  5H84 A;  1J4J A;  1OBR A;  3FXT A;  1X10 A;  4HNX B;  2C6C A;  2G9D A;  3E0K A;  3H8E A;  2PSW A;  4TWE A;  5FVJ A;  3KHZ A;  2G3T A;  5LYI A;  1RO5 A;  2V77 A;  4CAE A;  3RZA A;  1L0C A;  4IAV A;  1JWQ A;  3FEE A;  2X7B A;  1Q2C A;  4H6Z A;  4MY0 A;  5LRJ A;  2J8M A;  4MCR A;  6CPA A;  3BXM A;  2KCW A;  1VIX A;  1MJ9 A;  1AMP A;  1N71 A;  2FL4 A;  3SI2 A;  3K9U A;  4FUU A;  5CPA A;  1CBX A;  3G3S A;  3KR5 A;  4OC4 A;  2CTB A;  4R87 A;  5C82 A;  1VKC A;  3D2M A;  3JVN A;  1IOF A;  3K9T A;  5G1Z A;  4O23 A;  1XEB A;  1ARL A;  4KSA A;  3CXP A;  4QUS A;  3N7Z A;  2PQ8 A;  3IIB A;  4XPL A;  3SI1 A;  2AJ6 A;  2NSM A;  4X2T A;  2V8D A;  2GLJ A;  4JXQ A;  7CPA A;  2QIR A;  4A37 A;  1IY7 A;  3KR4 A;  4KOR A;  4ZYQ A;  5J8C A;  5EMI A;  1Z9U A;  5JQ4 A;  1Z2L A;  4R3K A;  4B6Z A;  1YVK A;  2ODF A;  4Y49 B;  2R1I A;  2PDO A;  3TOA A;  4CGP A;  1JQG A;  3CXQ A;  4WWV A;  2B5G A;  1IU8 A;  3JTK A;  3EY5 A;  3BHX A;  3KQX A;  4AVC A;  4PXE A;  4IF5 A;  2ZED A;  3V8I A;  3IC1 A;  3C26 A;  4HNY B;  4BBH A;  2CTC A;  3FX6 A;  2ZEL A;  2ZW6 A;  3B8G A;  1QSN A;  4OC2 A;  2PRB A;  1CPX A;  4CYO A;  5F46 A;  2P0W A;  3R9G A;  2PJ0 A;  4R57 A;  4P4E A;  1HDQ A;  4JZ0 A;  3T9Y A;  1LAP A;  4PQA A;  1KWM A;  3CT9 A;  4NGM A;  5CBM A;  2G3A A;  1YME A;  2AFM A;  2PIY A;  3BI0 A;  1QQ9 A;  1UFH A;  3B3W A;  1XIX A;  4PV6 A;  2WPW A;  4YU9 A;  5DS0 A;  3SXN A;  1HEE A;  2BEI A;  3NH4 A;  3PB8 X;  1Z8L A;  1S7F A;  3QAY A;  4LUA A;  4M6H A;  4B10 A;  4RUH A;  3FYN A;  4CAW A;  4AG9 A;  3WT4 A;  4RI1 A;  3D66 A;  3LOD A;  4YWY A;  3DR6 A;  2Z0Z A;  3WC6 A;  5J8F A;  2O28 A;  4NEX A;  4MHZ A;  3FB3 A;  4X8I A;  3SJX A;  4A30 A;  3FED A;  5G22 A;  4ZBG A;  4FD5 A;  1YLE A;  4P4I A;  5JH9 A;  2PJ6 A;  2V8H A;  1XOV A;  1IB1 E;  3IWG A;  4ONW A;  4P45 A;  2AE6 A;  2C6G A;  2R98 A;  1H8L A;  4R76 A;  4G1P A;  2YND A;  2HC9 A;  4XPK A;  2Q04 A;  4HKF A;  5AG4 A;  2VZZ A;  3R9E A;  1CPS A;  4KOS A;  3DGV A;  1YK3 A;  2Q7B A;  3R95 A;  5G21 A;  3GUX A;  4C2Y A;  2HB6 A;  2B3V A;  4P4D A;  3BJ8 A;  1PU9 A;  4DJL A;  3TE4 A;  4NGS A;  4X5K A;  4AG7 A;  2BUE A;  1Y9K A;  4ZY1 A;  2Q4V A;  4OC1 A;  3IGR A;  4CYP A;  4M3S A;  5F49 A;  2DXQ A;  3PGP A;  3BJ7 A;  3GB0 A;  4UIB A;  2J8R A;  4L89 A;  3ISZ A;  3UY5 A;  3FBU A;  3PB4 X;  3GY9 A;  2NMT A;  3LMS A;  4B5P A;  3DSB A;  3JUW A;  3T8W A;  1M4G A;  1ON0 A;  2WUU A;  2BSW A;  3IWE A;  4MFK A;  4Y49 C;  4B5O A;  4UEF A;  3EFA A;  1MJA A;  1Z8W A;  2PJ2 A;  2PJ4 A;  4MHY A;  4CS0 B;  4EWT A;  4QC6 A;  4Q36 A;  2NYQ A;  8CPA A;  5DWN A;  4KOV A;  4C2X A;  2OU2 A;  3NA6 A;  4NJQ A;  1EE3 P;  2CY2 A;  3SJG A;  4JJX A;  4CPA A;  4EVY A;  2ZEM A;  2QEC A;  3D67 A;  3PB9 X;  3S6G A;  3T90 A;  2FS5 A;  4FD7 A;  1VGY A;  1S5K A;  2QML A;  2PJ9 A;  3RYO A;  1IGB A;  3SHP A;  5K8O A;  1ZO0 A;  1V0C A;  2O53 A;  3F8K A;  3P2H A;  4A95 A;  4DNC A;  4CRZ B;  1B6B A;  1YRE A;  1A2Z A;  2FVG A;  2QVP A;  4A33 A;  4EME A;  4IUS A;  5KTA A;  2QJ8 A;  2IQ6 A;  4P4B A;  5THW A;  2FSR A;  3WC5 A;  4NSQ A;  1CM0 A;  5I0C A;  1XF8 A;  1XBU A;  2FIW A;  4II9 A;  1CP7 A;  1I12 A;  2JLM A;  2QYV A;  2R8V A;  2OZU A;  4X3R A;  4H2K A;  1P0H A;  5E96 A;  4CYN A;  4F6A A;  2VZY A;  4XNH C;  4RN7 A;  1KUV A;  1IYL A;  3NE7 A;  4FBE A;  2V8V A;  4CYQ A;  3B2Y A;  4K3N A;  2EBJ A;  3B35 A;  3JRU A;  5IX3 A;  4NGP A;  2IJZ A;  4H89 A;  2AFU A;  2I79 A;  1XMB A;  1BO4 A;  4UF4 A;  2Q44 A;  2ZEG A;  4A39 A;  4R3L A;  1Z5R A;  2Z3P A;  3SXO A;  2AFX A;  2ZEO A;  1Q2Y A;  5AG6 A;  4BMH A;  1B87 A;  1S7N A;  3RO0 A;  4JYW A;  2GRE A;  4A38 A;  3S9N A;  3KHX A;  4U9Z A;  3SI0 A;  3TC8 A;  3SJE A;  4J3G A;  4B5P B;  3TO9 A;  2PJ3 A;  1KUX A;  2PJ8 A;  4L8A A;  1TIQ A;  2C1C A;  3L2N A;  3I3G A;  4UFX A;  1BLL E;  2ARH A;  4W9Y A;  2Z3K A;  4I49 A;  1CP6 A;  2D4P A;  3B3V A;  3IU1 A;  4R8F A;  2FIA A;  2Z10 A;  4UEE A;  1OZP A;  3G8W A;  2B4D B;  3FVL A;  4ZY2 A;  5EBV A;  4TNU A;  3D7F A;  3FIX A;  3BI1 A;  4MXU A;  4UWI A;  5HXD A;  4B13 A;  4IHM A;  4LQG A;  3KQZ A;  3W6S A;  4OME A;  4PXD A;  5IV0 A;  2I00 A;  5F47 A;  2IL4 A;  3CDX A;  1AUG A;  5JPH A;  1YX0 A;  2VXK A;  3PP9 A;  1PCA A;  3GLJ A;  3SJF A;  1I21 A;  3CZX A;  5IB9 A;  3FRM A;  4NJR A;  4KVM E;  3PEI A;  2Z3L A;  2DPT A;  4AXV A;  2BOA A;  3CPX A;  5HVH A;  2DF5 A;  4KOW A;  3PFE A;  3GKR A;  1IID A;  1BAV A;  3S9L A;  4KOT A;  3RBU A;  2ABZ A;  3F5B A;  4Q7A A;  1ELM P;  2EK9 A;  3NH5 A;  3DNS A;  4P4J A;  4ZGY B;  2Q4Y A;  1R43 A;  2ZEF A;  4MMO A;  4XNH B;  5ELY A;  2I3C A;  5IB0 A;  2PC1 A;  2ATR A;  2VI7 A;  3H8F A;  4M6I A;  1XE4 A;  2XEG A;  5HH1 A;  5C88 A;  3PFO A;  2P6G A;  3TO6 A;  3WC7 A;  1FT7 A;  2F8H A;  4PPZ A;  1GHE A;  3DDD A;  4NGQ A;  3F0A A;  4MCP A;  3B3T A;  1M4L A;  4F9V A;  2BO9 A;  3BLN A;  3KI9 A;  4DYO A;  3D68 A;  5D8N A;  4F0X A;  2EO8 A;  5GCN A;  4F0Y A;  2Q51 A;  4UA3 A;  2PIZ A;  2HQY A;  5LRG A;  3EXN A;  3S9M A;  1ELL P;  3HLP A;  1YW6 A;  2P6E A;  4MFL A;  2WYR A;  1CX8 A;  1FY7 A;  1XMT A;  1LOK A;  4Z65 A;  5LRK A;  2Q0Y A;  2OOT A;  2YNE A;  3N5F A;  1M1D A;  3D7H A;  1VHO A;  4LQ6 A;  4PK3 A;  2PR1 A;  4KOX A;  2R7H A;  2Y0M A;  4A32 A;  1VHS A;  5A28 A;  1NSA A;  2K5T A;  1F57 A;  2P6F A;  4KVO E;  5F48 A;  1IOI A;  5EC4 A;  2C27 A;  4UWJ A;  2J9A A;  4PXC A;  1RTQ A;  1QST A;  2XEJ A;  3TO7 A;  3S6F A;  4C2Z A;  2VQY A;  2WSA A;  4UCM A;  3QAH A;  1XJO A;  1YLO A;  5AG5 A;  3HUV A;  4MHN A;  3PZJ A;  4OLL A;  1S7K A;  1ZLI A;  1YGH A;  4B12 A;  3TTH A;  2FE7 A;  4R9M A;  4MHD A;  4CGL A;  4JLY A;  1VHE A;  3H8G A;  1BPN A;  1ZG8 A;  1S60 A;  2PR8 A;  4F9U A;  4NCZ A;  2AFS A;  2RC4 A;  3OWC A;  5ISV A;  2B4D A;  1S7L A;  1RXT A;  3IO1 A;  1GYT A;  3KL9 A;  2FCK A;  4NXY A;  2BCO A;  4HNW B;  3KAS A;  3IJ3 A;  4UFV A;  5J1Q A;  2AFW A; 
#chains in the Genus database with same CATH homology
 2GIV A;  1YVO A;  1U6M A;  3R1K A;  3TFY A;  4MY3 A;  1KUY A;  4KUB A;  1Z4R A;  1NMT A;  1Y7R A;  2Z3O A;  4KOU A;  2Z11 A;  4XPD C;  2JDD A;  2REE A;  1MJB A;  3EO4 A;  2F5I A;  4KSF A;  4CGO A;  1KZF A;  4MFQ A;  1Y9W A;  4Q38 A;  2FXF A;  4AVB A;  4RS2 A;  3QB8 A;  4FD4 A;  3D3S A;  4U5Y A;  4KUA A;  4C7I A;  3R96 A;  3I9S A;  4PSW A;  2DPS A;  4A31 A;  2REF A;  1Q2D A;  3TE4 A;  4OAD A;  3RYO A;  3ZJ0 A;  3TOB A;  4ORF A;  2OZG A;  1NE9 A;  4C68 A;  3D8P A;  4LX9 A;  4MFZ A;  4CGN A;  1M4I A;  5AG7 A;  2WPX A;  4UCP A;  4MBU A;  1M4D A;  4MI4 A;  4CAV A;  2A4N A;  5A27 A;  1YR0 A;  1K4J A;  3VWD A;  2CNT A;  4YGO A;  3S6H A;  3FNC A;  1QSR A;  2OZH A;  4E8O A;  4K30 A;  4KVX A;  2ZW4 A;  1QSM A;  2ZW7 A;  1R57 A;  4AB7 A;  4B14 A;  5DWM A;  4UBR A;  3VWE A;  2B4B A;  2CNS A;  3R9F A;  4MFP A;  2EVN A;  2BL1 A;  3MGD A;  4CAX A;  4KS9 A;  4H6U A;  4CGM A;  2YNC C;  2ZXV A;  4CRY B;  3W6X A;  3S6K A;  4KOY A;  4XPD B;  1NSL A;  4KLV A;  4UCN A;  5HMN A;  4CAF A;  4PK2 A;  2YNC A;  4A2Z A;  4NF1 A;  4B11 A;  2B3U A;  3P2F A;  2ZPA A;  1QSO A;  2HV2 A;  3H4Q A;  1WK4 A;  2JDC A;  4PSX A;  5KTD A;  1SQH A;  1IIC A;  2HUZ A;  3WR7 A;  4QBJ A;  4QVT A;  3DR8 A;  4KLW A;  4U9Y A;  3KKW A;  4AVA A;  2YGW A;  3D2P A;  3W91 A;  3CXS A;  4QB9 A;  2Z3M A;  1M44 A;  2G0B A;  3GYA A;  4GS4 A;  4MFJ A;  5BWA B;  4UFW A;  2Z3N A;  3H5Z A;  4KZT A;  5H86 A;  4E0A A;  2B58 A;  3LD2 A;  2D4O A;  1PUA A;  5G20 A;  2VBQ A;  4E2A A;  2ZW5 A;  1I1D A;  3A9L A;  2B5G B;  1P4N A;  2JEV A;  5CNP A;  4ONU A;  1CJW A;  1BOB A;  1LRZ A;  2OH1 A;  4YRH A;  4JWP A;  1WWZ A;  4C7H A;  3TT2 A;  2CXA A;  5AGE A;  3ZZI A;  5KTC A;  2EUI A;  1IYK A;  2OB0 A;  4OAE A;  4JXR A;  2FT0 A;  3EC4 A;  1S3Z A;  2H5M A;  2CNM A;  2GE3 A;  4MJ8 A;  1Z4E A;  1MK4 A;  2GAN A;  2J8N A;  4JD6 A;  4M85 A;  3IU2 A;  4FD6 A;  3TCV A;  4YFJ A;  2VEZ A;  5H84 A;  1J4J A;  3FXT A;  4HNX B;  3E0K A;  2PSW A;  5FVJ A;  2G3T A;  1RO5 A;  4CAE A;  1L0C A;  2X7B A;  1Q2C A;  4H6Z A;  4MY0 A;  2J8M A;  2KCW A;  1MJ9 A;  1N71 A;  2FL4 A;  3K9U A;  3G3S A;  4R87 A;  5C82 A;  1VKC A;  3D2M A;  3JVN A;  5G1Z A;  1XEB A;  4KSA A;  4QUS A;  3CXP A;  3N7Z A;  2PQ8 A;  4XPL A;  2AJ6 A;  4JXQ A;  2QIR A;  4KOR A;  5J8C A;  5JQ4 A;  1Z9U A;  4R3K A;  1YVK A;  4Y49 B;  2R1I A;  2PDO A;  3TOA A;  4CGP A;  3CXQ A;  2B5G A;  3JTK A;  3EY5 A;  4AVC A;  4IF5 A;  3V8I A;  4HNY B;  3C26 A;  4BBH A;  2ZW6 A;  3B8G A;  1QSN A;  4CYO A;  2PRB A;  5F46 A;  2P0W A;  3R9G A;  4R57 A;  3T9Y A;  2G3A A;  1UFH A;  4PV6 A;  1XIX A;  2WPW A;  3SXN A;  2BEI A;  1S7F A;  4LUA A;  4B10 A;  3FYN A;  4CAW A;  4AG9 A;  4RI1 A;  3LOD A;  5J8F A;  3DR6 A;  2Z0Z A;  2O28 A;  4NEX A;  4A30 A;  3FB3 A;  5G22 A;  4ZBG A;  4FD5 A;  1YLE A;  3IWG A;  1IB1 E;  2AE6 A;  2R98 A;  2YND A;  4XPK A;  2Q04 A;  4HKF A;  5AG4 A;  2VZZ A;  3R9E A;  4KOS A;  2Q7B A;  1YK3 A;  3R95 A;  4C2Y A;  5G21 A;  2B3V A;  3BJ8 A;  1PU9 A;  4X5K A;  4AG7 A;  2BUE A;  1Y9K A;  2Q4V A;  3IGR A;  4CYP A;  4M3S A;  5F49 A;  2DXQ A;  3PGP A;  3BJ7 A;  2J8R A;  4L89 A;  3UY5 A;  3FBU A;  3GY9 A;  2NMT A;  4B5P A;  3DSB A;  3JUW A;  1M4G A;  1ON0 A;  2WUU A;  2BSW A;  3IWE A;  4MFK A;  4Y49 C;  4B5O A;  3EFA A;  1MJA A;  4CS0 B;  4QC6 A;  4Q36 A;  5DWN A;  4KOV A;  4C2X A;  2OU2 A;  2CY2 A;  4JJX A;  4EVY A;  2QEC A;  3S6G A;  3T90 A;  2FS5 A;  4FD7 A;  1S5K A;  2QML A;  3SHP A;  1ZO0 A;  1V0C A;  3F8K A;  3P2H A;  4A95 A;  4DNC A;  4CRZ B;  1B6B A;  1YRE A;  4A33 A;  4IUS A;  5KTA A;  2FSR A;  4NSQ A;  1CM0 A;  5I0C A;  1XF8 A;  2FIW A;  4II9 A;  1I12 A;  2JLM A;  2R8V A;  2OZU A;  1P0H A;  5E96 A;  4CYN A;  4F6A A;  2VZY A;  4XNH C;  1KUV A;  1IYL A;  3NE7 A;  4CYQ A;  5IX3 A;  4H89 A;  2I79 A;  1BO4 A;  2Q44 A;  4R3L A;  2Z3P A;  3SXO A;  1Q2Y A;  5AG6 A;  4BMH A;  1B87 A;  1S7N A;  4U9Z A;  4J3G A;  4B5P B;  3TO9 A;  1KUX A;  4L8A A;  1TIQ A;  3I3G A;  4UFX A;  2ARH A;  2Z3K A;  4I49 A;  2D4P A;  3IU1 A;  2FIA A;  2Z10 A;  1OZP A;  3G8W A;  2B4D B;  5EBV A;  3FIX A;  4UWI A;  4B13 A;  3W6S A;  5IV0 A;  2I00 A;  5F47 A;  2IL4 A;  5JPH A;  1YX0 A;  2VXK A;  3PP9 A;  1I21 A;  3FRM A;  4KVM E;  2Z3L A;  2DPT A;  4KOW A;  3GKR A;  1IID A;  4KOT A;  3F5B A;  3DNS A;  4ZGY B;  2Q4Y A;  4XNH B;  5IB0 A;  2PC1 A;  2ATR A;  2VI7 A;  1XE4 A;  5HH1 A;  5C88 A;  2P6G A;  3TO6 A;  1GHE A;  3DDD A;  3F0A A;  3BLN A;  4F0X A;  4F0Y A;  5GCN A;  4UA3 A;  2HQY A;  3EXN A;  2P6E A;  4MFL A;  1FY7 A;  1XMT A;  2Q0Y A;  2YNE A;  4PK3 A;  1M1D A;  2PR1 A;  4KOX A;  2R7H A;  2Y0M A;  4A32 A;  1VHS A;  5A28 A;  2K5T A;  2P6F A;  4KVO E;  5F48 A;  5EC4 A;  2C27 A;  4UWJ A;  1QST A;  3TO7 A;  3S6F A;  4C2Z A;  2VQY A;  2WSA A;  4UCM A;  3QAH A;  5AG5 A;  3PZJ A;  4OLL A;  1S7K A;  1YGH A;  4B12 A;  3TTH A;  2FE7 A;  4R9M A;  4MHD A;  4CGL A;  4JLY A;  1S60 A;  2PR8 A;  4NCZ A;  2RC4 A;  5ISV A;  3OWC A;  2B4D A;  1S7L A;  1RXT A;  2FCK A;  4NXY A;  4HNW B;  4UFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...