2YNCC

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
370
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFLYKVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 370
sequence length 384
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
C PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncC00
4B10A 4CYPA 3IU2A 4CYOA 2YNDA 4C2YA 5G22A 2YNCC 4UFVA 4C2XA 4A32A 4UCMA 4CGPA 5A28A 5AG4A 3H5ZA 4A31A 4B11A 4CAFA 4A33A 4CYQA 4CGOA 4B12A 5G21A 3IU1A 4B14A 2YNEA 4CGNA 2YNCA 4A30A 4C7IA 3JTKA 4UFWA 4C68A 4CGMA 5AGEA 4CGLA 2WUUA 4C2ZA 5AG6A 4C7HA 5G20A 5G1ZA 5AG7A 4CYNA 3IWEA 4A95A 4CAEA 4UCNA 4UCPA 2WSAA 4UFXA 4A2ZA 4BBHA 5AG5A 4B13A 5A27A
chains in the Genus database with same CATH superfamily
4GS4A 4BINA 5C82A 2PDOA 2XEGA 2CTBA 2REEA 2PJBA 4MMOA 3G8WA 2QJ8A 5EBVA 4F0YA 4FAIA 3S6KA 1Z8WA 4CGPA 1F57A 2ZEDA 4RI1A 1XOVA 3LACA 4JWPA 2GLFA 1Y7RA 4A33A 3F8KA 3D66A 5HXDA 2G3AA 3R9FA 4ONUA 4LUAA 2HV2A 2ARHA 3IIBA 1ARMA 4O23A 4ONWA 4YRHA 5LRJA 4A30A 3CXQA 4C7IA 3FNCA 5DS0A 5LRGA 3PB7X 1N71A 4P6YA 5AG6A 4M6IA 4NJRA 1NMTA 3R9EA 1M44A 3N5FA 4A94A 2GANA 1CPSA 2V8DA 1DE4C 3D68A 1FNOA 1AYEA 4UCPA 3KR5A 3R95A 1Y9WA 2J8MA 4R3LA 3TO7A 4B13A 2ANPA 4NF1A 4A37A 3B7IA 3F5BA 4R76A 6CPAA 4RS2A 2POKA 3WC7A 1LOKA 2Q43A 2CNTA 2RC4A 2ZEFA 3B3TA 3IC1A 4UCMA 1QSTA 4U5YA 4EWTA 4OC4A 2CTCA 2Z11A 4CAXA 1M4DA 3P2HA 3RNZA 4A31A 3CPXA 1HDUA 5LYIA 2O28A 4CGOA 1YREA 2P6EA 2WPWA 1CP7A 1MJ9A 3KQXA 4UFWA 4C68A 3WT4A 3B3VA 3JVNA 1NE9A 2Q7BA 4OC3A 2CNSA 4KLWA 1IYKA 1IIDA 5F09A 5J8FA 1QSMA 4UCNA 4A2ZA 4NSQA 1Z8TA 4H6UA 2ZPAA 2CY2A 4MBUA 3S9LA 3NH4A 5K8MA 2JLMA 4XPKA 1L0CA 2AFMA 3CT9A 3MN8A 4OC5A 4TNUA 5G22A 1YX0A 4AVBA 1K4JA 2C6PA 4XPDC 3TX8A 3NH8A 4KSAA 4AG7A 2ABZA 4JLYA 1SQHA 4PXDA 4Y49C 2ZEPA 3L2NA 3LD2A 3SHPA 2C6GA 2P0WA 4MXUA 1Y9KA 4FBEA 2QYVA 2PJ1A 4CGNA 2YNCA 3K9TA 3FVLA 5DWNA 3TOAA 3B3SA 3FXTA 2AFOA 1QMUA 5ISVA 2PJCA 1ZLIA 5HH1A 2GLJA 2PJ8A 3KI9A 3EFAA 3D4UA 4A38A 4MI4A 1ZG7A 4MCQA 4AB7A 4BMHA 4LX9A 2VBQA 4NEXA 4UEZA 2AE6A 4LQ6A 4UF4A 3KASA 2R8VA 2V8VA 2D4PA 1TIQA 3DDDA 4UFVA 2ZW7A 1R43A 4FD5A 3EO4A 1IY7A 1YLEA 1Z4EA 2F5IA 4PQAA 4BD9A 5H84A 3T9YA 2B3VA 2R98A 3B3CA 3B8GA 4XPDB 3FEDA 2C27A 2Q51A 2XEIA 4GXHA 2PR1A 4Y49B 3QNVA 4UIAA 2BUEA 2P6FA 4MHDA 5HVGA 2JDCA 2FIAA 3FJUA 4PXEA 2ZXVA 3IWWA 4CGLA 3FBUA 4Z65A 4MRIA 3B2YA 3TTHA 2V8GA 3GYAA 1TXRA 3GKRA 2PC1A 4Q38A 1NSAA 3UY5A 3KL9A 1A2ZA 3DSBA 3HLPA 4IK2A 3CXSA 5D8NA 3TE4A 3PBEA 1QSNA 3I9SA 2G9DA 2BCOA 4UA3A 4CYPA 5DWMA 3G3SA 2IJZA 2JEWA 3K2KA 4K30A 5IB9A 2QIRA 2ZOFA 2OH1A 2Z3OA 4MFPA 4PSXA 2ZEMA 2HUZA 1XRYA 3KGQA 4MFLA 3S6GA 1PYTB 3H5ZA 3IGRA 7CPAA 1I1DA 3PB6X 3GUXA 5GCNA 1RXTA 3D2MA 4I49A 2XEJA 1M4LA 2PJ7A 3JRUA 4KOTA 4B5PA 3BXMA 2DXQA 2BO9A 2EO8A 1CBXA 4KOWA 2Q7SA 1LFWA 2Z3LA 2ZW6A 4C7HA 3CDXA 4F9UA 2OR4A 4NCZA 3TFYA 5IX3A 3DGVA 4RUHA 2B4DA 2JEVA 4P10A 4IUSA 2H5MA 4Q7AA 2Z3MA 3KQZA 3PRTA 4PV6A 4OC1A 3SI1A 4UEEA 3IJ3A 1WK4A 1XE4A 4A39A 1OZPA 3D7DA 1U6MA 1IU8A 1FT7A 2EWBA 4YU9A 4XNHC 4CS0B 1KWMA 3W6XA 4QUSA 1BAVA 4OADA 1Y0RA 3S9NA 2EK8A 3PB8X 4IHMA 4KUAA 5G21A 3SJXA 4EVYA 2BEIA 3BI0A 2WYRA 3VH9A 1HEEA 3BHXA 4CRZB 3ISXA 3D7HA 2AFZA 1LCPA 1VHSA 2IL4A 5AGEA 4ZY1A 3QB8A 2PJ5A 2PJ6A 3KHXA 4HNYB 4KOSA 2PE3A 2C6CA 3OWCA 2XEFA 2WSAA 3PB4X 3IWGA 1BPMA 1ZG8A 2OZGA 3NFZA 1S7NA 2WZNA 4K3NA 4PPZA 2FIWA 1YLOA 4AVCA 1S7FA 2CXAA 3FMCA 3PBBA 3SXNA 4OMEA 4B5PB 2AJ6A 3R9GA 1YVOA 1VGYA 4CAFA 4CYQA 4XNHB 3PZJA 1IYLA 2ZEOA 3IU1A 1TKFA 1YQEA 2ATRA 1X12A 4KOUA 4OIDA 3N7ZA 5BWAB 1R57A 3JTKA 3B35A 4KLVA 1R3NA 3D7FA 1QQ9A 4CYNA 8CPAA 2DEAA 2F8HA 2PJ4A 3IFEA 4JXQA 3H4QA 4KUBA 1KUYA 2FE7A 3S6FA 1J4JA 2KCWA 4PSWA 4DJLA 4GM5A 4NGMA 4CYOA 4QB9A 3IO1A 2Z3NA 4KOYA 1PUAA 4R57A 4ZX8A 3T90A 1PCAA 4B6ZA 4JD6A 3GY9A 4AXVA 4C2XA 2DF5A 5EMIA 2VL1A 2ZELA 2K5TA 1S3ZA 4HPSA 1ON0A 3DLJA 1VHOA 4J3GA 3SJFA 2X7BA 3B3WA 2Z3PA 1QSRA 4LQGA 3SJEA 3F0AA 3FRMA 3RBUA 1P0HA 4P4EA 1TKHA 2V8HA 1CJWA 5F47A 5FVJA 4NXYA 4YWYA 4RN7A 4F0XA 4ZYQA 1ZLHA 2OZHA 4H89A 4JJXA 2EUIA 3PEIA 4PXBA 5K8NA 2PQ8A 1PU9A 4ZI6A 2CIJA 2ZENA 5F46A 4H6ZA 3KZWA 1BLLE 2YNCC 4HNXB 1YW4A 2OZUA 3S6HA 1BPNA 2PSWA 3KKWA 3TOBA 1I12A 4OC0A 3RYOA 4ZGYB 3K9UA 5I0CA 2Q4VA 5EC4A 4EFDA 4MHNA 4DUKA 5JPHA 1Q7LA 4UBRA 2YNEA 1F2OA 5LYFA 4KSFA 2ZOGA 4UWJA 1YW6A 3BLNA 3PGPA 2ZEEA 1TF8A 5J8CA 3V8IA 2Q04A 3NE8A 2GE3A 2B58A 3WC5A 2GREA 5IB0A 2B5GA 2I79A 2PRBA 4M85A 2FS5A 4CPAA 5JM6A 4OAEA 3FX6A 5J1QA 5LYDA 4FUUA 2PVWA 4MFZA 1Q2DA 1B87A 3IU2A 3SXOA 1LRZA 2BOAA 3TT2A 3ZZIA 3W91A 4C2YA 5KTDA 1QSOA 2JBJA 4MY0A 4NGSA 2PIYA 3D8PA 2HC9A 2PJ9A 3H8FA 1LANA 4A32A 3H8EA 3KHZA 4JXRA 1JQGA 3NE7A 4G1PA 4R6TA 5AG4A 4NGPA 4FD6A 1TF9A 3LMSA 3BI1A 3H8GA 4YFJA 4R9MA 4B14A 3CPAA 4X8IA 3SJGA 3D67A 3GB0A 5JGFA 1LAPA 1DTDA 1KUXA 3T8WA 2AFSA 3E0KA 4L89A 4CGMA 5CBMA 2BL1A 4NGRA 3TO9A 1BO4A 2I00A 4P4FA 1ELMP 3R1KA 2ODFA 1YMEA 4CRYB 4CAEA 4UFXA 1XF8A 2B4BA 2ZW5A 3GLJA 3TCVA 3WC6A 1JWQA 5I4MA 4MJ8A 1Z2LA 4MFKA 4KORA 1HDQA 1XBUA 1ZO0A 4OC2A 2EBJA 2DPTA 2QVPA 5C88A 1RO5A 1EE3P 3KR4A 4X3RA 5CPAA 4MCPA 5K8OA 4L8AA 1YR0A 5D29A 3ZJ0A 4Q36A 2VQYA 4PK2A 1AUGA 3PB9X 5F48A 3EXNA 4P45A 3V38A 3JUWA 4OIWA 1WWZA 2B5GB 2AFXA 2G3TA 2YGWA 5CNPA 1VIXA 2ZEHA 4NGNA 3MGDA 3W6SA 4BBHA 1Z8LA 1IOIA 3CXPA 2HQYA 3I1UA 3TC8A 1P4NA 2QECA 2V77A 4B10A 1F2PA 3A9LA 3ISZA 2NYQA 2F7VA 1B6BA 4KVOE 1Z5RA 4KOXA 4KS9A 2JBKA 1CM0A 2B3UA 1GHEA 2FXFA 3DNSA 3FB3A 4OLLA 5E96A 4ZBGA 4M6HA 1CPXA 4B12A 3TO6A 1M4IA 2BSWA 3VARA 1NSLA 4CAVA 2B4DB 1YGHA 4P4DA 2Z3KA 5AG7A 1Z9UA 4WWVA 4A95A 2C1CA 2R7HA 5HMNA 4P4JA 1V0CA 5KTCA 1IOFA 3LODA 4FD7A 2YNDA 1S60A 1S5KA 3NA6A 3NH5A 4NJQA 3S9MA 3SI0A 1Q2CA 1XFOA 2ZW4A 5LYLA 4NGTA 4TWEA 1Z4RA 4OKOA 2PCUA 3BJ8A 4JZ0A 5A28A 3VWEA 4QC6A 2FSRA 2IQ6A 1YVKA 4NGQA 4PXCA 2J8RA 4MFQA 5IV0A 1TKJA 4XPLA 4R87A 4P44A 2VZYA 2PJ2A 4B5OA 1X10A 4UIBA 2OOTA 2PJ3A 2FT0A 1UWYA 4F8ZA 4R7MA 4ORFA 2VI7A 1XMBA 2ZEGA 3D3SA 1UFHA 2O4HA 3VATA 2Z0ZA 2PJAA 4WJBA 4UWIA 1MJAA 2R1IA 2P6GA 3V7ZA 2FVGA 3MRUA 1XEBA 4MHPA 3WR7A 1LAMA 4AG9A 1S7KA 2NMTA 1CG2A 1FY7A 4UEFA 2REFA 4F6AA 4X5KA 2PR8A 2WPXA 3D2PA 2OU2A 2Q44A 3DR6A 3SI2A 3FEEA 4R3KA 1CP6A 4B11A 3EC4A 4U9YA 4MY3A 1XIXA 3VWDA 1CX8A 4ZX9A 2PRQA 2Q4YA 1Z8XA 2RFHA 2CF4A 3D7GA 3BJ7A 1YSJA 2AFWA 3IEHA 2AFUA 1OBRA 2DPSA 2O53A 5JH9A 1XJOA 2Y0MA 3WABA 2Z10A 4C2ZA 2VZZA 3EY5A 5G20A 3FH4A 3PP9A 4F9VA 4PK3A 4E2AA 4DYOA 4QBJA 2HB6A 2RB7A 5F49A 2JDDA 4P4IA 3P2FA 1KZFA 4P4BA 2J8NA 4KSIA 4M6GA 4AVAA 1Y0YA 2VXKA 1XMTA 4MCSA 1ZG9A 3PFEA 2NSMA 4MHZA 2GU2A 3FF3A 4W9YA 4E8OA 4ZY0A 2J9AA 2PVVA 1IICA 2Q0YA 1VHEA 3CZXA 5ELYA 1M4GA 2EK9A 3GIUA 1KUVA 4MCRA 1S7LA 3I3GA 3PFOA 1Y7EA 2PJ0A 4DNCA 4OP4A 4U9ZA 1MK4A 2D4OA 4MFJA 1VKCA 2WUUA 1IB1E 1Q2YA 3QAYA 2PIZA 4CAWA 1IGBA 3FYNA 1MJBA 3IWEA 3FIXA 4YGOA 3C26A 1I21A 4IF5A 4HNWB 4KOVA 4KVME 5AG5A 3RAMA 2I3CA 3QAHA 4FD4A 2OB0A 1BOBA 2GIVA 4EMEA 5HVHA 5HVFA 3DR8A 1AMPA 4JYWA 1ARLA 4M3SA 1RTQA 4II9A 2A4NA 2QMLA 4H2KA 3LWUA 2G0BA 4HKFA 2FL4A 3RO0A 4KZTA 5THWA 3R96A 4MHYA 4NFRA 2IMOA 4QVTA 4FWUA 4R8FA 4X2TA 5JQ4A 2GFQA 4IAVA 1H8LA 4E0AA 3HUVA 4KVXA 3RZAA 3FECA 2Q4ZA 5LRKA 2EVNA 1YK3A 2FCKA 5KTAA 5G1ZA 4ZY2A 5K8PA 2VEZA 5H86A 1M1DA 2CNMA 1GYTA 1ELLP 5A27A
chains in the Genus database with same CATH topology
4GS4A 5C82A 2PDOA 2REEA 3G8WA 5EBVA 4F0YA 3S6KA 4CGPA 4RI1A 4JWPA 1Y7RA 4A33A 3F8KA 2G3AA 3R9FA 4ONUA 4LUAA 2HV2A 2ARHA 4YRHA 4A30A 4C7IA 3CXQA 3FNCA 1N71A 5AG6A 3R9EA 1NMTA 1M44A 2GANA 4UCPA 3R95A 3TO7A 1Y9WA 2J8MA 4R3LA 4B13A 4NF1A 3F5BA 4RS2A 2CNTA 2RC4A 4UCMA 1QSTA 4U5YA 4CAXA 2Z11A 1M4DA 3P2HA 4A31A 2O28A 4CGOA 1YREA 2P6EA 2WPWA 1MJ9A 4UFWA 4C68A 3JVNA 1NE9A 2Q7BA 2CNSA 4KLWA 1IYKA 1IIDA 5J8FA 1QSMA 4UCNA 4A2ZA 4NSQA 4H6UA 2ZPAA 2CY2A 4MBUA 2JLMA 4XPKA 1L0CA 5G22A 1YX0A 4AVBA 1K4JA 4XPDC 4KSAA 4AG7A 4JLYA 1SQHA 4Y49C 3SHPA 3LD2A 2P0WA 1Y9KA 4CGNA 2YNCA 5DWNA 3TOAA 3FXTA 5ISVA 5HH1A 3EFAA 4MI4A 4AB7A 4BMHA 4LX9A 2VBQA 4NEXA 2AE6A 2R8VA 2D4PA 1TIQA 3DDDA 4UFVA 2ZW7A 4FD5A 3EO4A 1YLEA 1Z4EA 2F5IA 5H84A 3T9YA 2B3VA 2R98A 4XPDB 3B8GA 2C27A 2PR1A 4Y49B 2BUEA 2P6FA 4MHDA 2JDCA 2FIAA 2ZXVA 4CGLA 3FBUA 3TTHA 3GYAA 3GKRA 2PC1A 4Q38A 3UY5A 3DSBA 3TE4A 3CXSA 1QSNA 3I9SA 4CYPA 4UA3A 5DWMA 3G3SA 4K30A 2QIRA 2OH1A 2Z3OA 4MFPA 4PSXA 2HUZA 4MFLA 3S6GA 3H5ZA 3IGRA 1I1DA 5GCNA 1RXTA 3D2MA 4I49A 4B5PA 4KOTA 2DXQA 4KOWA 2Z3LA 2ZW6A 4C7HA 4NCZA 3TFYA 5IX3A 2B4DA 2JEVA 4IUSA 2H5MA 2Z3MA 4PV6A 1WK4A 1XE4A 1OZPA 1U6MA 4XNHC 4CS0B 3W6XA 4QUSA 4OADA 4KUAA 5G21A 4EVYA 2BEIA 4CRZB 5AGEA 1VHSA 2IL4A 3QB8A 4KOSA 4HNYB 3OWCA 2WSAA 3IWGA 2OZGA 1S7NA 2FIWA 4AVCA 1S7FA 2CXAA 3SXNA 4B5PB 2AJ6A 3R9GA 1YVOA 4CAFA 4CYQA 4XNHB 3PZJA 1IYLA 3IU1A 2ATRA 4KOUA 5BWAB 3N7ZA 1R57A 3JTKA 4KLVA 4CYNA 3S6FA 4KUBA 4JXQA 3H4QA 1KUYA 2FE7A 1J4JA 2KCWA 4PSWA 4CYOA 4QB9A 2Z3NA 4KOYA 1PUAA 4R57A 3T90A 4JD6A 3GY9A 4C2XA 2K5TA 1S3ZA 1ON0A 4J3GA 2X7BA 2Z3PA 1QSRA 3F0AA 3FRMA 1P0HA 1CJWA 5F47A 5FVJA 4NXYA 4F0XA 2OZHA 4H89A 4JJXA 2EUIA 2PQ8A 1PU9A 5F46A 4H6ZA 2YNCC 4HNXB 3S6HA 2OZUA 2PSWA 3KKWA 3TOBA 1I12A 3RYOA 4ZGYB 3K9UA 5I0CA 2Q4VA 5EC4A 5JPHA 4UBRA 2YNEA 4KSFA 4UWJA 3PGPA 3BLNA 5J8CA 3V8IA 2Q04A 2GE3A 2B58A 5IB0A 2B5GA 2I79A 2PRBA 4M85A 2FS5A 4OAEA 4MFZA 1Q2DA 1B87A 3IU2A 3SXOA 1LRZA 3TT2A 3ZZIA 3W91A 4C2YA 5KTDA 1QSOA 4MY0A 3D8PA 4A32A 4JXRA 3NE7A 5AG4A 4FD6A 4YFJA 4R9MA 4B14A 1KUXA 4CGMA 3E0KA 4L89A 2BL1A 3TO9A 1BO4A 2I00A 3R1KA 4CAEA 4UFXA 1XF8A 2B4BA 2ZW5A 3TCVA 4MJ8A 4MFKA 4KORA 1ZO0A 2DPTA 5C88A 1RO5A 4L8AA 1YR0A 3ZJ0A 4Q36A 2VQYA 4PK2A 5F48A 3EXNA 3JUWA 1WWZA 2B5GB 2G3TA 2YGWA 5CNPA 3MGDA 3W6SA 4BBHA 3CXPA 2HQYA 4B10A 1P4NA 2QECA 3A9LA 1B6BA 4KVOE 4KOXA 4KS9A 1CM0A 3DNSA 1GHEA 3FB3A 2B3UA 2FXFA 5E96A 4ZBGA 4B12A 3TO6A 1M4IA 2BSWA 1NSLA 4CAVA 2B4DB 1YGHA 2Z3KA 5AG7A 1Z9UA 4A95A 2R7HA 5HMNA 1V0CA 5KTCA 3LODA 4FD7A 2YNDA 1S60A 1S5KA 1Q2CA 2ZW4A 1Z4RA 3BJ8A 5A28A 3VWEA 4QC6A 2FSRA 1YVKA 2J8RA 4MFQA 5IV0A 4XPLA 4R87A 2VZYA 4B5OA 2FT0A 4ORFA 2VI7A 3D3SA 1UFHA 2Z0ZA 4UWIA 1MJAA 2R1IA 2P6GA 4AG9A 3WR7A 4CRYB 1XEBA 1S7KA 2NMTA 1FY7A 2REFA 4F6AA 4X5KA 2PR8A 2WPXA 3D2PA 2OU2A 2Q44A 3DR6A 4R3KA 4B11A 3EC4A 4U9YA 4MY3A 1XIXA 3VWDA 2Q4YA 3BJ7A 2DPSA 2Y0MA 4C2ZA 2Z10A 2VZZA 3EY5A 5G20A 3PP9A 4PK3A 4E2AA 4QBJA 5F49A 2JDDA 3P2FA 1KZFA 4AVAA 2J8NA 2VXKA 1XMTA 4E8OA 1IICA 2Q0YA 1M4GA 1KUVA 1S7LA 3I3GA 4DNCA 4U9ZA 1MK4A 2D4OA 4MFJA 1VKCA 2WUUA 1IB1E 1Q2YA 4CAWA 3FYNA 1MJBA 3IWEA 3FIXA 4YGOA 3C26A 1I21A 4IF5A 4HNWB 4KOVA 4KVME 5AG5A 3QAHA 4FD4A 2OB0A 1BOBA 2GIVA 3DR8A 4M3SA 4II9A 2A4NA 2QMLA 2G0BA 4HKFA 2FL4A 4KZTA 3R96A 4QVTA 5JQ4A 4E0AA 4KVXA 2EVNA 1YK3A 2FCKA 5KTAA 5G1ZA 2VEZA 5H86A 1M1DA 2CNMA 4OLLA 5A27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B10 A;  4CYP A;  3IU2 A;  4CYO A;  2YND A;  4C2Y A;  5G22 A;  2YNC C;  4UFV A;  4C2X A;  4A32 A;  4UCM A;  4CGP A;  5A28 A;  5AG4 A;  3H5Z A;  4A31 A;  4B11 A;  4CAF A;  4A33 A;  4CYQ A;  4CGO A;  4B12 A;  5G21 A;  3IU1 A;  4B14 A;  2YNE A;  4CGN A;  2YNC A;  4A30 A;  4C7I A;  3JTK A;  4UFW A;  4C68 A;  4CGM A;  5AGE A;  4CGL A;  2WUU A;  4C2Z A;  5AG6 A;  4C7H A;  5G20 A;  5G1Z A;  5AG7 A;  4CYN A;  3IWE A;  4A95 A;  4CAE A;  4UCN A;  4UCP A;  2WSA A;  4UFX A;  4A2Z A;  4BBH A;  5AG5 A;  4B13 A;  5A27 A; 
#chains in the Genus database with same CATH topology
 4GS4 A;  4BIN A;  5C82 A;  2PDO A;  2XEG A;  2CTB A;  2REE A;  2PJB A;  4MMO A;  3G8W A;  2QJ8 A;  5EBV A;  4F0Y A;  4FAI A;  3S6K A;  1Z8W A;  4CGP A;  1F57 A;  2ZED A;  4RI1 A;  1XOV A;  3LAC A;  4JWP A;  2GLF A;  1Y7R A;  4A33 A;  3F8K A;  3D66 A;  5HXD A;  2G3A A;  3R9F A;  4ONU A;  4LUA A;  2HV2 A;  2ARH A;  3IIB A;  1ARM A;  4O23 A;  4ONW A;  4YRH A;  5LRJ A;  4A30 A;  3CXQ A;  4C7I A;  3FNC A;  5DS0 A;  5LRG A;  3PB7 X;  1N71 A;  4P6Y A;  5AG6 A;  4M6I A;  4NJR A;  1NMT A;  3R9E A;  1M44 A;  3N5F A;  4A94 A;  2GAN A;  1CPS A;  2V8D A;  1DE4 C;  3D68 A;  1FNO A;  1AYE A;  4UCP A;  3KR5 A;  3R95 A;  1Y9W A;  2J8M A;  4R3L A;  3TO7 A;  4B13 A;  2ANP A;  4NF1 A;  4A37 A;  3B7I A;  3F5B A;  4R76 A;  6CPA A;  4RS2 A;  2POK A;  3WC7 A;  1LOK A;  2Q43 A;  2CNT A;  2RC4 A;  2ZEF A;  3B3T A;  3IC1 A;  4UCM A;  1QST A;  4U5Y A;  4EWT A;  4OC4 A;  2CTC A;  2Z11 A;  4CAX A;  1M4D A;  3P2H A;  3RNZ A;  4A31 A;  3CPX A;  1HDU A;  5LYI A;  2O28 A;  4CGO A;  1YRE A;  2P6E A;  2WPW A;  1CP7 A;  1MJ9 A;  3KQX A;  4UFW A;  4C68 A;  3WT4 A;  3B3V A;  3JVN A;  1NE9 A;  2Q7B A;  4OC3 A;  2CNS A;  4KLW A;  1IYK A;  1IID A;  5F09 A;  5J8F A;  1QSM A;  4UCN A;  4A2Z A;  4NSQ A;  1Z8T A;  4H6U A;  2ZPA A;  2CY2 A;  4MBU A;  3S9L A;  3NH4 A;  5K8M A;  2JLM A;  4XPK A;  1L0C A;  2AFM A;  3CT9 A;  3MN8 A;  4OC5 A;  4TNU A;  5G22 A;  1YX0 A;  4AVB A;  1K4J A;  2C6P A;  4XPD C;  3TX8 A;  3NH8 A;  4KSA A;  4AG7 A;  2ABZ A;  4JLY A;  1SQH A;  4PXD A;  4Y49 C;  2ZEP A;  3L2N A;  3LD2 A;  3SHP A;  2C6G A;  2P0W A;  4MXU A;  1Y9K A;  4FBE A;  2QYV A;  2PJ1 A;  4CGN A;  2YNC A;  3K9T A;  3FVL A;  5DWN A;  3TOA A;  3B3S A;  3FXT A;  2AFO A;  1QMU A;  5ISV A;  2PJC A;  1ZLI A;  5HH1 A;  2GLJ A;  2PJ8 A;  3KI9 A;  3EFA A;  3D4U A;  4A38 A;  4MI4 A;  1ZG7 A;  4MCQ A;  4AB7 A;  4BMH A;  4LX9 A;  2VBQ A;  4NEX A;  4UEZ A;  2AE6 A;  4LQ6 A;  4UF4 A;  3KAS A;  2R8V A;  2V8V A;  2D4P A;  1TIQ A;  3DDD A;  4UFV A;  2ZW7 A;  1R43 A;  4FD5 A;  3EO4 A;  1IY7 A;  1YLE A;  1Z4E A;  2F5I A;  4PQA A;  4BD9 A;  5H84 A;  3T9Y A;  2B3V A;  2R98 A;  3B3C A;  3B8G A;  4XPD B;  3FED A;  2C27 A;  2Q51 A;  2XEI A;  4GXH A;  2PR1 A;  4Y49 B;  3QNV A;  4UIA A;  2BUE A;  2P6F A;  4MHD A;  5HVG A;  2JDC A;  2FIA A;  3FJU A;  4PXE A;  2ZXV A;  3IWW A;  4CGL A;  3FBU A;  4Z65 A;  4MRI A;  3B2Y A;  3TTH A;  2V8G A;  3GYA A;  1TXR A;  3GKR A;  2PC1 A;  4Q38 A;  1NSA A;  3UY5 A;  3KL9 A;  1A2Z A;  3DSB A;  3HLP A;  4IK2 A;  3CXS A;  5D8N A;  3TE4 A;  3PBE A;  1QSN A;  3I9S A;  2G9D A;  2BCO A;  4UA3 A;  4CYP A;  5DWM A;  3G3S A;  2IJZ A;  2JEW A;  3K2K A;  4K30 A;  5IB9 A;  2QIR A;  2ZOF A;  2OH1 A;  2Z3O A;  4MFP A;  4PSX A;  2ZEM A;  2HUZ A;  1XRY A;  3KGQ A;  4MFL A;  3S6G A;  1PYT B;  3H5Z A;  3IGR A;  7CPA A;  1I1D A;  3PB6 X;  3GUX A;  5GCN A;  1RXT A;  3D2M A;  4I49 A;  2XEJ A;  1M4L A;  2PJ7 A;  3JRU A;  4KOT A;  4B5P A;  3BXM A;  2DXQ A;  2BO9 A;  2EO8 A;  1CBX A;  4KOW A;  2Q7S A;  1LFW A;  2Z3L A;  2ZW6 A;  4C7H A;  3CDX A;  4F9U A;  2OR4 A;  4NCZ A;  3TFY A;  5IX3 A;  3DGV A;  4RUH A;  2B4D A;  2JEV A;  4P10 A;  4IUS A;  2H5M A;  4Q7A A;  2Z3M A;  3KQZ A;  3PRT A;  4PV6 A;  4OC1 A;  3SI1 A;  4UEE A;  3IJ3 A;  1WK4 A;  1XE4 A;  4A39 A;  1OZP A;  3D7D A;  1U6M A;  1IU8 A;  1FT7 A;  2EWB A;  4YU9 A;  4XNH C;  4CS0 B;  1KWM A;  3W6X A;  4QUS A;  1BAV A;  4OAD A;  1Y0R A;  3S9N A;  2EK8 A;  3PB8 X;  4IHM A;  4KUA A;  5G21 A;  3SJX A;  4EVY A;  2BEI A;  3BI0 A;  2WYR A;  3VH9 A;  1HEE A;  3BHX A;  4CRZ B;  3ISX A;  3D7H A;  2AFZ A;  1LCP A;  1VHS A;  2IL4 A;  5AGE A;  4ZY1 A;  3QB8 A;  2PJ5 A;  2PJ6 A;  3KHX A;  4HNY B;  4KOS A;  2PE3 A;  2C6C A;  3OWC A;  2XEF A;  2WSA A;  3PB4 X;  3IWG A;  1BPM A;  1ZG8 A;  2OZG A;  3NFZ A;  1S7N A;  2WZN A;  4K3N A;  4PPZ A;  2FIW A;  1YLO A;  4AVC A;  1S7F A;  2CXA A;  3FMC A;  3PBB A;  3SXN A;  4OME A;  4B5P B;  2AJ6 A;  3R9G A;  1YVO A;  1VGY A;  4CAF A;  4CYQ A;  4XNH B;  3PZJ A;  1IYL A;  2ZEO A;  3IU1 A;  1TKF A;  1YQE A;  2ATR A;  1X12 A;  4KOU A;  4OID A;  3N7Z A;  5BWA B;  1R57 A;  3JTK A;  3B35 A;  4KLV A;  1R3N A;  3D7F A;  1QQ9 A;  4CYN A;  8CPA A;  2DEA A;  2F8H A;  2PJ4 A;  3IFE A;  4JXQ A;  3H4Q A;  4KUB A;  1KUY A;  2FE7 A;  3S6F A;  1J4J A;  2KCW A;  4PSW A;  4DJL A;  4GM5 A;  4NGM A;  4CYO A;  4QB9 A;  3IO1 A;  2Z3N A;  4KOY A;  1PUA A;  4R57 A;  4ZX8 A;  3T90 A;  1PCA A;  4B6Z A;  4JD6 A;  3GY9 A;  4AXV A;  4C2X A;  2DF5 A;  5EMI A;  2VL1 A;  2ZEL A;  2K5T A;  1S3Z A;  4HPS A;  1ON0 A;  3DLJ A;  1VHO A;  4J3G A;  3SJF A;  2X7B A;  3B3W A;  2Z3P A;  1QSR A;  4LQG A;  3SJE A;  3F0A A;  3FRM A;  3RBU A;  1P0H A;  4P4E A;  1TKH A;  2V8H A;  1CJW A;  5F47 A;  5FVJ A;  4NXY A;  4YWY A;  4RN7 A;  4F0X A;  4ZYQ A;  1ZLH A;  2OZH A;  4H89 A;  4JJX A;  2EUI A;  3PEI A;  4PXB A;  5K8N A;  2PQ8 A;  1PU9 A;  4ZI6 A;  2CIJ A;  2ZEN A;  5F46 A;  4H6Z A;  3KZW A;  1BLL E;  2YNC C;  4HNX B;  1YW4 A;  2OZU A;  3S6H A;  1BPN A;  2PSW A;  3KKW A;  3TOB A;  1I12 A;  4OC0 A;  3RYO A;  4ZGY B;  3K9U A;  5I0C A;  2Q4V A;  5EC4 A;  4EFD A;  4MHN A;  4DUK A;  5JPH A;  1Q7L A;  4UBR A;  2YNE A;  1F2O A;  5LYF A;  4KSF A;  2ZOG A;  4UWJ A;  1YW6 A;  3BLN A;  3PGP A;  2ZEE A;  1TF8 A;  5J8C A;  3V8I A;  2Q04 A;  3NE8 A;  2GE3 A;  2B58 A;  3WC5 A;  2GRE A;  5IB0 A;  2B5G A;  2I79 A;  2PRB A;  4M85 A;  2FS5 A;  4CPA A;  5JM6 A;  4OAE A;  3FX6 A;  5J1Q A;  5LYD A;  4FUU A;  2PVW A;  4MFZ A;  1Q2D A;  1B87 A;  3IU2 A;  3SXO A;  1LRZ A;  2BOA A;  3TT2 A;  3ZZI A;  3W91 A;  4C2Y A;  5KTD A;  1QSO A;  2JBJ A;  4MY0 A;  4NGS A;  2PIY A;  3D8P A;  2HC9 A;  2PJ9 A;  3H8F A;  1LAN A;  4A32 A;  3H8E A;  3KHZ A;  4JXR A;  1JQG A;  3NE7 A;  4G1P A;  4R6T A;  5AG4 A;  4NGP A;  4FD6 A;  1TF9 A;  3LMS A;  3BI1 A;  3H8G A;  4YFJ A;  4R9M A;  4B14 A;  3CPA A;  4X8I A;  3SJG A;  3D67 A;  3GB0 A;  5JGF A;  1LAP A;  1DTD A;  1KUX A;  3T8W A;  2AFS A;  3E0K A;  4L89 A;  4CGM A;  5CBM A;  2BL1 A;  4NGR A;  3TO9 A;  1BO4 A;  2I00 A;  4P4F A;  1ELM P;  3R1K A;  2ODF A;  1YME A;  4CRY B;  4CAE A;  4UFX A;  1XF8 A;  2B4B A;  2ZW5 A;  3GLJ A;  3TCV A;  3WC6 A;  1JWQ A;  5I4M A;  4MJ8 A;  1Z2L A;  4MFK A;  4KOR A;  1HDQ A;  1XBU A;  1ZO0 A;  4OC2 A;  2EBJ A;  2DPT A;  2QVP A;  5C88 A;  1RO5 A;  1EE3 P;  3KR4 A;  4X3R A;  5CPA A;  4MCP A;  5K8O A;  4L8A A;  1YR0 A;  5D29 A;  3ZJ0 A;  4Q36 A;  2VQY A;  4PK2 A;  1AUG A;  3PB9 X;  5F48 A;  3EXN A;  4P45 A;  3V38 A;  3JUW A;  4OIW A;  1WWZ A;  2B5G B;  2AFX A;  2G3T A;  2YGW A;  5CNP A;  1VIX A;  2ZEH A;  4NGN A;  3MGD A;  3W6S A;  4BBH A;  1Z8L A;  1IOI A;  3CXP A;  2HQY A;  3I1U A;  3TC8 A;  1P4N A;  2QEC A;  2V77 A;  4B10 A;  1F2P A;  3A9L A;  3ISZ A;  2NYQ A;  2F7V A;  1B6B A;  4KVO E;  1Z5R A;  4KOX A;  4KS9 A;  2JBK A;  1CM0 A;  2B3U A;  1GHE A;  2FXF A;  3DNS A;  3FB3 A;  4OLL A;  5E96 A;  4ZBG A;  4M6H A;  1CPX A;  4B12 A;  3TO6 A;  1M4I A;  2BSW A;  3VAR A;  1NSL A;  4CAV A;  2B4D B;  1YGH A;  4P4D A;  2Z3K A;  5AG7 A;  1Z9U A;  4WWV A;  4A95 A;  2C1C A;  2R7H A;  5HMN A;  4P4J A;  1V0C A;  5KTC A;  1IOF A;  3LOD A;  4FD7 A;  2YND A;  1S60 A;  1S5K A;  3NA6 A;  3NH5 A;  4NJQ A;  3S9M A;  3SI0 A;  1Q2C A;  1XFO A;  2ZW4 A;  5LYL A;  4NGT A;  4TWE A;  1Z4R A;  4OKO A;  2PCU A;  3BJ8 A;  4JZ0 A;  5A28 A;  3VWE A;  4QC6 A;  2FSR A;  2IQ6 A;  1YVK A;  4NGQ A;  4PXC A;  2J8R A;  4MFQ A;  5IV0 A;  1TKJ A;  4XPL A;  4R87 A;  4P44 A;  2VZY A;  2PJ2 A;  4B5O A;  1X10 A;  4UIB A;  2OOT A;  2PJ3 A;  2FT0 A;  1UWY A;  4F8Z A;  4R7M A;  4ORF A;  2VI7 A;  1XMB A;  2ZEG A;  3D3S A;  1UFH A;  2O4H A;  3VAT A;  2Z0Z A;  2PJA A;  4WJB A;  4UWI A;  1MJA A;  2R1I A;  2P6G A;  3V7Z A;  2FVG A;  3MRU A;  1XEB A;  4MHP A;  3WR7 A;  1LAM A;  4AG9 A;  1S7K A;  2NMT A;  1CG2 A;  1FY7 A;  4UEF A;  2REF A;  4F6A A;  4X5K A;  2PR8 A;  2WPX A;  3D2P A;  2OU2 A;  2Q44 A;  3DR6 A;  3SI2 A;  3FEE A;  4R3K A;  1CP6 A;  4B11 A;  3EC4 A;  4U9Y A;  4MY3 A;  1XIX A;  3VWD A;  1CX8 A;  4ZX9 A;  2PRQ A;  2Q4Y A;  1Z8X A;  2RFH A;  2CF4 A;  3D7G A;  3BJ7 A;  1YSJ A;  2AFW A;  3IEH A;  2AFU A;  1OBR A;  2DPS A;  2O53 A;  5JH9 A;  1XJO A;  2Y0M A;  3WAB A;  2Z10 A;  4C2Z A;  2VZZ A;  3EY5 A;  5G20 A;  3FH4 A;  3PP9 A;  4F9V A;  4PK3 A;  4E2A A;  4DYO A;  4QBJ A;  2HB6 A;  2RB7 A;  5F49 A;  2JDD A;  4P4I A;  3P2F A;  1KZF A;  4P4B A;  2J8N A;  4KSI A;  4M6G A;  4AVA A;  1Y0Y A;  2VXK A;  1XMT A;  4MCS A;  1ZG9 A;  3PFE A;  2NSM A;  4MHZ A;  2GU2 A;  3FF3 A;  4W9Y A;  4E8O A;  4ZY0 A;  2J9A A;  2PVV A;  1IIC A;  2Q0Y A;  1VHE A;  3CZX A;  5ELY A;  1M4G A;  2EK9 A;  3GIU A;  1KUV A;  4MCR A;  1S7L A;  3I3G A;  3PFO A;  1Y7E A;  2PJ0 A;  4DNC A;  4OP4 A;  4U9Z A;  1MK4 A;  2D4O A;  4MFJ A;  1VKC A;  2WUU A;  1IB1 E;  1Q2Y A;  3QAY A;  2PIZ A;  4CAW A;  1IGB A;  3FYN A;  1MJB A;  3IWE A;  3FIX A;  4YGO A;  3C26 A;  1I21 A;  4IF5 A;  4HNW B;  4KOV A;  4KVM E;  5AG5 A;  3RAM A;  2I3C A;  3QAH A;  4FD4 A;  2OB0 A;  1BOB A;  2GIV A;  4EME A;  5HVH A;  5HVF A;  3DR8 A;  1AMP A;  4JYW A;  1ARL A;  4M3S A;  1RTQ A;  4II9 A;  2A4N A;  2QML A;  4H2K A;  3LWU A;  2G0B A;  4HKF A;  2FL4 A;  3RO0 A;  4KZT A;  5THW A;  3R96 A;  4MHY A;  4NFR A;  2IMO A;  4QVT A;  4FWU A;  4R8F A;  4X2T A;  5JQ4 A;  2GFQ A;  4IAV A;  1H8L A;  4E0A A;  3HUV A;  4KVX A;  3RZA A;  3FEC A;  2Q4Z A;  5LRK A;  2EVN A;  1YK3 A;  2FCK A;  5KTA A;  5G1Z A;  4ZY2 A;  5K8P A;  2VEZ A;  5H86 A;  1M1D A;  2CNM A;  1GYT A;  1ELL P;  5A27 A; 
#chains in the Genus database with same CATH homology
 4GS4 A;  5C82 A;  2PDO A;  2REE A;  3G8W A;  5EBV A;  4F0Y A;  3S6K A;  4CGP A;  4RI1 A;  4JWP A;  1Y7R A;  4A33 A;  3F8K A;  2G3A A;  3R9F A;  4ONU A;  4LUA A;  2HV2 A;  2ARH A;  4YRH A;  4A30 A;  4C7I A;  3CXQ A;  3FNC A;  1N71 A;  5AG6 A;  3R9E A;  1NMT A;  1M44 A;  2GAN A;  4UCP A;  3R95 A;  3TO7 A;  1Y9W A;  2J8M A;  4R3L A;  4B13 A;  4NF1 A;  3F5B A;  4RS2 A;  2CNT A;  2RC4 A;  4UCM A;  1QST A;  4U5Y A;  4CAX A;  2Z11 A;  1M4D A;  3P2H A;  4A31 A;  2O28 A;  4CGO A;  1YRE A;  2P6E A;  2WPW A;  1MJ9 A;  4UFW A;  4C68 A;  3JVN A;  1NE9 A;  2Q7B A;  2CNS A;  4KLW A;  1IYK A;  1IID A;  5J8F A;  1QSM A;  4UCN A;  4A2Z A;  4NSQ A;  4H6U A;  2ZPA A;  2CY2 A;  4MBU A;  2JLM A;  4XPK A;  1L0C A;  5G22 A;  1YX0 A;  4AVB A;  1K4J A;  4XPD C;  4KSA A;  4AG7 A;  4JLY A;  1SQH A;  4Y49 C;  3SHP A;  3LD2 A;  2P0W A;  1Y9K A;  4CGN A;  2YNC A;  5DWN A;  3TOA A;  3FXT A;  5ISV A;  5HH1 A;  3EFA A;  4MI4 A;  4AB7 A;  4BMH A;  4LX9 A;  2VBQ A;  4NEX A;  2AE6 A;  2R8V A;  2D4P A;  1TIQ A;  3DDD A;  4UFV A;  2ZW7 A;  4FD5 A;  3EO4 A;  1YLE A;  1Z4E A;  2F5I A;  5H84 A;  3T9Y A;  2B3V A;  2R98 A;  4XPD B;  3B8G A;  2C27 A;  2PR1 A;  4Y49 B;  2BUE A;  2P6F A;  4MHD A;  2JDC A;  2FIA A;  2ZXV A;  4CGL A;  3FBU A;  3TTH A;  3GYA A;  3GKR A;  2PC1 A;  4Q38 A;  3UY5 A;  3DSB A;  3TE4 A;  3CXS A;  1QSN A;  3I9S A;  4CYP A;  4UA3 A;  5DWM A;  3G3S A;  4K30 A;  2QIR A;  2OH1 A;  2Z3O A;  4MFP A;  4PSX A;  2HUZ A;  4MFL A;  3S6G A;  3H5Z A;  3IGR A;  1I1D A;  5GCN A;  1RXT A;  3D2M A;  4I49 A;  4B5P A;  4KOT A;  2DXQ A;  4KOW A;  2Z3L A;  2ZW6 A;  4C7H A;  4NCZ A;  3TFY A;  5IX3 A;  2B4D A;  2JEV A;  4IUS A;  2H5M A;  2Z3M A;  4PV6 A;  1WK4 A;  1XE4 A;  1OZP A;  1U6M A;  4XNH C;  4CS0 B;  3W6X A;  4QUS A;  4OAD A;  4KUA A;  5G21 A;  4EVY A;  2BEI A;  4CRZ B;  5AGE A;  1VHS A;  2IL4 A;  3QB8 A;  4KOS A;  4HNY B;  3OWC A;  2WSA A;  3IWG A;  2OZG A;  1S7N A;  2FIW A;  4AVC A;  1S7F A;  2CXA A;  3SXN A;  4B5P B;  2AJ6 A;  3R9G A;  1YVO A;  4CAF A;  4CYQ A;  4XNH B;  3PZJ A;  1IYL A;  3IU1 A;  2ATR A;  4KOU A;  5BWA B;  3N7Z A;  1R57 A;  3JTK A;  4KLV A;  4CYN A;  3S6F A;  4KUB A;  4JXQ A;  3H4Q A;  1KUY A;  2FE7 A;  1J4J A;  2KCW A;  4PSW A;  4CYO A;  4QB9 A;  2Z3N A;  4KOY A;  1PUA A;  4R57 A;  3T90 A;  4JD6 A;  3GY9 A;  4C2X A;  2K5T A;  1S3Z A;  1ON0 A;  4J3G A;  2X7B A;  2Z3P A;  1QSR A;  3F0A A;  3FRM A;  1P0H A;  1CJW A;  5F47 A;  5FVJ A;  4NXY A;  4F0X A;  2OZH A;  4H89 A;  4JJX A;  2EUI A;  2PQ8 A;  1PU9 A;  5F46 A;  4H6Z A;  2YNC C;  4HNX B;  3S6H A;  2OZU A;  2PSW A;  3KKW A;  3TOB A;  1I12 A;  3RYO A;  4ZGY B;  3K9U A;  5I0C A;  2Q4V A;  5EC4 A;  5JPH A;  4UBR A;  2YNE A;  4KSF A;  4UWJ A;  3PGP A;  3BLN A;  5J8C A;  3V8I A;  2Q04 A;  2GE3 A;  2B58 A;  5IB0 A;  2B5G A;  2I79 A;  2PRB A;  4M85 A;  2FS5 A;  4OAE A;  4MFZ A;  1Q2D A;  1B87 A;  3IU2 A;  3SXO A;  1LRZ A;  3TT2 A;  3ZZI A;  3W91 A;  4C2Y A;  5KTD A;  1QSO A;  4MY0 A;  3D8P A;  4A32 A;  4JXR A;  3NE7 A;  5AG4 A;  4FD6 A;  4YFJ A;  4R9M A;  4B14 A;  1KUX A;  4CGM A;  3E0K A;  4L89 A;  2BL1 A;  3TO9 A;  1BO4 A;  2I00 A;  3R1K A;  4CAE A;  4UFX A;  1XF8 A;  2B4B A;  2ZW5 A;  3TCV A;  4MJ8 A;  4MFK A;  4KOR A;  1ZO0 A;  2DPT A;  5C88 A;  1RO5 A;  4L8A A;  1YR0 A;  3ZJ0 A;  4Q36 A;  2VQY A;  4PK2 A;  5F48 A;  3EXN A;  3JUW A;  1WWZ A;  2B5G B;  2G3T A;  2YGW A;  5CNP A;  3MGD A;  3W6S A;  4BBH A;  3CXP A;  2HQY A;  4B10 A;  1P4N A;  2QEC A;  3A9L A;  1B6B A;  4KVO E;  4KOX A;  4KS9 A;  1CM0 A;  3DNS A;  1GHE A;  3FB3 A;  2B3U A;  2FXF A;  5E96 A;  4ZBG A;  4B12 A;  3TO6 A;  1M4I A;  2BSW A;  1NSL A;  4CAV A;  2B4D B;  1YGH A;  2Z3K A;  5AG7 A;  1Z9U A;  4A95 A;  2R7H A;  5HMN A;  1V0C A;  5KTC A;  3LOD A;  4FD7 A;  2YND A;  1S60 A;  1S5K A;  1Q2C A;  2ZW4 A;  1Z4R A;  3BJ8 A;  5A28 A;  3VWE A;  4QC6 A;  2FSR A;  1YVK A;  2J8R A;  4MFQ A;  5IV0 A;  4XPL A;  4R87 A;  2VZY A;  4B5O A;  2FT0 A;  4ORF A;  2VI7 A;  3D3S A;  1UFH A;  2Z0Z A;  4UWI A;  1MJA A;  2R1I A;  2P6G A;  4AG9 A;  3WR7 A;  4CRY B;  1XEB A;  1S7K A;  2NMT A;  1FY7 A;  2REF A;  4F6A A;  4X5K A;  2PR8 A;  2WPX A;  3D2P A;  2OU2 A;  2Q44 A;  3DR6 A;  4R3K A;  4B11 A;  3EC4 A;  4U9Y A;  4MY3 A;  1XIX A;  3VWD A;  2Q4Y A;  3BJ7 A;  2DPS A;  2Y0M A;  4C2Z A;  2Z10 A;  2VZZ A;  3EY5 A;  5G20 A;  3PP9 A;  4PK3 A;  4E2A A;  4QBJ A;  5F49 A;  2JDD A;  3P2F A;  1KZF A;  4AVA A;  2J8N A;  2VXK A;  1XMT A;  4E8O A;  1IIC A;  2Q0Y A;  1M4G A;  1KUV A;  1S7L A;  3I3G A;  4DNC A;  4U9Z A;  1MK4 A;  2D4O A;  4MFJ A;  1VKC A;  2WUU A;  1IB1 E;  1Q2Y A;  4CAW A;  3FYN A;  1MJB A;  3IWE A;  3FIX A;  4YGO A;  3C26 A;  1I21 A;  4IF5 A;  4HNW B;  4KOV A;  4KVM E;  5AG5 A;  3QAH A;  4FD4 A;  2OB0 A;  1BOB A;  2GIV A;  3DR8 A;  4M3S A;  4II9 A;  2A4N A;  2QML A;  2G0B A;  4HKF A;  2FL4 A;  4KZT A;  3R96 A;  4QVT A;  5JQ4 A;  4E0A A;  4KVX A;  2EVN A;  1YK3 A;  2FCK A;  5KTA A;  5G1Z A;  2VEZ A;  5H86 A;  1M1D A;  2CNM A;  4OLL A;  5A27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...