2YNDA

Plasmodium vivax n-myristoyltransferase in complex with a pyrazole sulphonamide inhibitor.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
385
structure length
385
Chain Sequence
IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 113
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yndA00
3H5ZA 4UFXA 5G20A 4B12A 4CGLA 4CAFA 4A95A 4UCMA 4C2XA 4A30A 2YNEA 4A33A 5A27A 2WUUA 3JTKA 5AG5A 4A2ZA 5AGEA 4C2YA 4UCNA 2YNDA 5G21A 4UCPA 3IWEA 5G1ZA 4B13A 4CGPA 4CGOA 5AG4A 4C7IA 4CYOA 4CGNA 5AG6A 5AG7A 5G22A 4CGMA 4CYNA 5A28A 4C2ZA 2YNCC 3IU2A 2YNCA 4C7HA 4CAEA 4B14A 4CYQA 2WSAA 4A32A 4B10A 4B11A 4CYPA 4BBHA 4UFWA 4UFVA 4A31A 4C68A 3IU1A
chains in the Genus database with same CATH superfamily
3NH4A 4OC0A 4CGLA 4OMEA 2QMLA 1K4JA 1RTQA 2PVWA 4P4DA 4A38A 4A95A 4OKOA 2FSRA 2YNEA 3EC4A 4JYWA 2Q4ZA 5EMIA 5F49A 2YGWA 1F2PA 1XE4A 4TNUA 4GM5A 4NGPA 2G3AA 4FD4A 4NGRA 4ONUA 2VZYA 2ZEFA 4PK2A 2CIJA 3DR8A 1XF8A 2FXFA 4ZGYB 2A4NA 4MMOA 4P4FA 4UIAA 4YFJA 3BI1A 5CPAA 3EXNA 2QVPA 3E0KA 3UY5A 2AFWA 3BXMA 2ZEDA 4NGSA 4H6UA 1XJOA 1KUXA 4KOVA 3R9EA 5K8MA 1N71A 1XIXA 4ZY0A 2ZEPA 2O53A 2O4HA 3QAHA 4R7MA 3S9NA 4MJ8A 1R43A 3DGVA 2JEVA 4GS4A 3B3VA 4CAWA 2Q04A 2AFZA 2FS5A 1KWMA 4H2KA 3F0AA 2ZPAA 2Q4VA 1Y9KA 4JD6A 4YRHA 4AB7A 4R6TA 3SJGA 1ELLP 4MFQA 4C2ZA 2YNCC 2ZOFA 4EFDA 2KCWA 2PCUA 4CAEA 5F47A 2H5MA 3R9GA 1XRYA 3JVNA 2WPWA 2CTBA 3KHZA 4P6YA 4P4EA 3SJEA 4NXYA 1XFOA 2PJ2A 4MI4A 2BL1A 4UA3A 4B5PA 2RB7A 4OC4A 1S7LA 2OB0A 1TXRA 3PGPA 4R87A 4E8OA 2DEAA 3KL9A 4E2AA 4A33A 1IYLA 4E0AA 2RC4A 1YGHA 3RYOA 2GU2A 3DNSA 2G3TA 5G21A 7CPAA 4FD6A 1TF8A 3IWGA 3B8GA 1P0HA 1TF9A 4L89A 3NA6A 4MHZA 5ISVA 4BINA 2JDDA 4QUSA 3BLNA 5LRKA 3FEDA 4IHMA 4EMEA 2XEJA 1ZO0A 2ZW7A 2IQ6A 2ABZA 3KGQA 3G3SA 4H6ZA 2OH1A 2I00A 3G8WA 4C7HA 5I4MA 1M4DA 1YMEA 2PIYA 3FYNA 2ZOGA 1IYKA 1IB1E 2F7VA 2B5GA 2OZUA 3H4QA 3R9FA 2O28A 4JLYA 2PJ6A 3D7GA 4CAXA 2PC1A 2Z10A 4C68A 3PFEA 2CY2A 4AXVA 3ZJ0A 4PXEA 3DDDA 4Y49C 5HXDA 5K8OA 3KASA 3PZJA 4HKFA 3R95A 5IV0A 2PJ3A 1RXTA 2Z3KA 4BMHA 4XNHC 2RFHA 1B6BA 3KKWA 4XPLA 3D7FA 5E96A 1YW4A 1YX0A 4WJBA 2FIAA 2CTCA 1A2ZA 4NJRA 4MFKA 1JWQA 2GIVA 1M4IA 2YNCA 1PYTB 2Z3OA 4KORA 2PJ4A 3GLJA 1XMTA 5JM6A 2GLJA 3SHPA 2VL1A 1MJAA 5EC4A 2GLFA 4MFJA 1BAVA 1LFWA 2C6PA 3GY9A 3CXQA 4KOWA 4NGTA 3T9YA 2J8MA 2D4PA 2XEFA 2AFMA 2CXAA 2AE6A 2ZEMA 4JXRA 4MY0A 4OC5A 4FBEA 4II9A 2EUIA 2Q51A 1NSLA 2ZELA 2Q7BA 4F9VA 1GHEA 3PFOA 4MFPA 3JUWA 4IK2A 3S9MA 5THWA 4LQGA 3T90A 3SXNA 5EBVA 4MHDA 3BI0A 3JRUA 4F8ZA 2HC9A 2DPTA 1Z4EA 4OLLA 1F2OA 3WC5A 4AVAA 2V8VA 4G1PA 3SI1A 1YLOA 1NE9A 3D8PA 4KOSA 2ZEEA 4KUBA 4R3KA 5DWNA 1X10A 2FT0A 3V7ZA 1NSAA 4ZY1A 1UWYA 5KTAA 1VHSA 4MXUA 4X2TA 4PXBA 1YREA 2PE3A 3KQXA 2REFA 4KSFA 4C2YA 4P45A 3S6HA 3I1UA 2QYVA 4Q7AA 4IAVA 1R3NA 1WWZA 2PVVA 2EVNA 4CGMA 4CYNA 2FL4A 4MRIA 2Z3NA 1S3ZA 4ONWA 4YGOA 1JQGA 3LACA 2F8HA 4NCZA 3S9LA 4NF1A 1BOBA 3B3WA 3FJUA 2PJ9A 4IF5A 3NFZA 3QAYA 2OR4A 3FB3A 4J3GA 2JDCA 4UWJA 4NFRA 5H86A 3FNCA 1QSNA 5K8NA 2VXKA 4OIDA 3RO0A 3CPXA 3IFEA 4UEFA 1LAPA 4UIBA 4B12A 2PRBA 2Z0ZA 1M4LA 2AFXA 3JTKA 4PPZA 3S6GA 2J8RA 4KOUA 2R1IA 3RNZA 5LYDA 2DXQA 3WABA 2PJ0A 2Y0MA 3IWWA 1I1DA 1Y0YA 2EO8A 1Z8TA 1HDQA 1TKJA 2CNSA 3RAMA 3FXTA 3S6KA 3LODA 1X12A 4AVCA 4X8IA 3KI9A 1Z9UA 2PJAA 1XBUA 4GXHA 2PRQA 4FUUA 3VWDA 3D2MA 3TCVA 2OZHA 4UWIA 3FF3A 4KSAA 4X3RA 4MCPA 4HNXB 4QBJA 4I49A 4AG9A 2IMOA 4CAVA 3D7DA 3W6SA 1BO4A 3MRUA 3PB7X 1TKHA 2ZEHA 4M3SA 4UCMA 3B35A 2PSWA 3TO7A 4A94A 5GCNA 3BHXA 4B5PB 5C82A 5AG5A 1CG2A 4HNWB 4Q38A 2R8VA 4K30A 1QSOA 3FX6A 1XOVA 2ZXVA 4KS9A 4A37A 1AUGA 1Z5RA 2PJ8A 2V8GA 1Y0RA 3WT4A 1VKCA 3PB8X 1YLEA 2ARHA 1U6MA 1ELMP 5JGFA 3BJ7A 1KZFA 1LOKA 3IU2A 4R76A 3TX8A 5J8CA 2B4DB 2EBJA 4L8AA 3LD2A 3B3SA 3NH8A 2JBKA 5JPHA 2BCOA 2CNMA 4MBUA 2FCKA 3IO1A 5HVHA 4MHPA 4MY3A 1Y7RA 3WC6A 2D4OA 2HV2A 2V8HA 4R8FA 4JZ0A 4CRYB 4UFWA 4KOXA 3DSBA 4MHYA 4R3LA 3VH9A 4CAFA 4KLWA 2AFUA 2ANPA 1DTDA 1KUVA 2B3VA 4A30A 3FVLA 3PRTA 3KHXA 5A27A 4OAEA 2HQYA 5F48A 5AGEA 4UCNA 3IWEA 3GB0A 2B58A 2CF4A 4B13A 2PIZA 4CGOA 3GIUA 4K3NA 4OC1A 1CP6A 1BPMA 2B4BA 2PJBA 4R57A 1EE3P 2PJ1A 2GE3A 3SJFA 4B6ZA 4RUHA 3OWCA 3I3GA 2P6EA 4XPKA 1B87A 1Z2LA 3CXSA 5CNPA 1TKFA 1CX8A 4B14A 2VBQA 4B10A 4CYPA 4P4BA 4OC3A 1LAMA 1Z8XA 2EK8A 4M6GA 5IX3A 2Q7SA 5FVJA 4LQ6A 4FWUA 5H84A 2AFOA 2QIRA 4KVME 3IIBA 3TOBA 8CPAA 1YVOA 6CPAA 1YSJA 3D2PA 2P6GA 4EWTA 1YK3A 2DF5A 4RN7A 1Y9WA 2YNDA 4H89A 4PXDA 4F6AA 4UF4A 4W9YA 3W91A 2WPXA 3IC1A 4OP4A 2C27A 4M6HA 2JLMA 1Q2CA 2NMTA 4XPDB 3A9LA 5ELYA 2XEGA 4AG7A 2HB6A 3VARA 2VEZA 5F46A 1ARLA 2BOAA 2PJCA 5DS0A 4CS0B 4DUKA 3VWEA 5HMNA 3W6XA 3K9UA 3FBUA 4YU9A 4KOTA 1XEBA 4IUSA 4OC2A 4NGMA 1WK4A 4F0YA 4P44A 2R7HA 4MCRA 4CRZB 3P2FA 2FVGA 1QSMA 4FAIA 1UFHA 3SJXA 2VI7A 1NMTA 4JJXA 4P10A 4RI1A 5G20A 3B3TA 3FH4A 4NGNA 1XMBA 3EFAA 3L2NA 4P4IA 2WZNA 2FE7A 2GFQA 1IICA 4PK3A 1BLLE 4QVTA 1FNOA 3PB6X 2I79A 3PBBA 4UCPA 4U9ZA 2Z11A 2ZEOA 4DYOA 3NE7A 1Z8LA 1YR0A 3LMSA 2GANA 3TO6A 3LWUA 3D67A 4CGNA 4WWVA 4KVXA 1ZG7A 3BJ8A 5G22A 5HH1A 1TIQA 5C88A 1VIXA 2QJ8A 3QB8A 4PV6A 3FECA 5LRGA 3ISZA 3T8WA 2EWBA 3EY5A 2K5TA 1KUYA 1ZG8A 4M6IA 4O23A 4R9MA 1ZLIA 1IOFA 4JXQA 4BBHA 1LCPA 3TC8A 1MK4A 1M1DA 2ZW4A 1QSTA 5DWMA 4LUAA 4KSIA 4CPAA 2HUZA 1Q2DA 1QMUA 2R98A 2REEA 4KVOE 2JBJA 3C26A 1F57A 1V0CA 2JEWA 3ISXA 2C6CA 4ZX9A 4F9UA 2P0WA 1QQ9A 4ZY2A 3TT2A 1Q2YA 2C1CA 1VHOA 3F8KA 2BO9A 3MN8A 4RS2A 1Z8WA 5D29A 2OOTA 5HVGA 4QC6A 1S5KA 1ON0A 2ZW6A 1CP7A 2EK9A 4NEXA 4U9YA 2WSAA 4CYQA 3QNVA 5KTCA 3TOAA 3CXPA 3H8GA 4Z65A 4A31A 2XEIA 1OZPA 4NGQA 4OIWA 2PR1A 5LYLA 4UFXA 4MFLA 1H8LA 4MHNA 1IU8A 2BUEA 3V8IA 2IJZA 2Q44A 4YWYA 2DPSA 1ARMA 2BSWA 4HPSA 3P2HA 1Z4RA 3CZXA 3S6FA 3KZWA 2PQ8A 1IGBA 3WC7A 1AMPA 5K8PA 3D68A 3SI2A 4PXCA 4CYOA 3VATA 2NYQA 2PJ5A 2VQYA 2ZW5A 3NH5A 4B5OA 1PUAA 3PBEA 4PQAA 5AG6A 5JQ4A 3FIXA 3TFYA 1Y7EA 3R96A 1HEEA 1P4NA 2Q0YA 3DR6A 1R57A 2G9DA 5BWAB 5I0CA 3B3CA 1IY7A 1BPNA 1MJBA 3IEHA 4NJQA 4NSQA 4A32A 1OBRA 4UFVA 4MFZA 1LANA 3WR7A 3IU1A 3CDXA 3IGRA 3SI0A 4XPDC 2B5GB 5HVFA 4C2XA 1VHEA 3D3SA 3TTHA 5IB9A 2AJ6A 2WUUA 3EO4A 4U5YA 4A2ZA 2AFSA 3B7IA 4JWPA 5CBMA 3MGDA 1FT7A 1PCAA 2V77A 3N5FA 4M85A 4CGPA 2B4DA 4QB9A 1YQEA 2P6FA 1AYEA 3KR4A 4DJLA 1M4GA 3GYAA 5D8NA 4P4JA 2J8NA 5AG7A 4X5KA 5A28A 2F5IA 4ZBGA 5LRJA 4LX9A 2ZEGA 2I3CA 2BEIA 4ZX8A 4EVYA 1ZLHA 2QECA 2Q43A 3K9TA 3PB4X 2OZGA 1MJ9A 1L0CA 1S7KA 3N7ZA 2OU2A 3H8EA 3CT9A 1SQHA 3H5ZA 3K2KA 3GUXA 3PEIA 4MCSA 1S60A 5F09A 4F0XA 5LYFA 3D4UA 4PSWA 1CPXA 2Z3PA 1CBXA 1QSRA 4BD9A 2PDOA 3D7HA 3RBUA 3HUVA 2NSMA 2Z3LA 1YVKA 2ATRA 1Q7LA 4Q36A 1IIDA 1S7NA 4OADA 1CJWA 1RO5A 5JH9A 2ZENA 3IJ3A 2WYRA 5IB0A 4B11A 4FD5A 4MCQA 2Z3MA 2CNTA 4ZYQA 5KTDA 4ORFA 2V8DA 4ZI6A 3PB9X 3DLJA 4TWEA 2G0BA 2Q4YA 3KR5A 4UEZA 3GKRA 1S7FA 1CM0A 4AVBA 2GREA 1HDUA 1IOIA 4UEEA 4A39A 3NE8A 1M44A 4KZTA 5G1ZA 1GYTA 2IL4A 4UBRA 3RZAA 1YW6A 2FIWA 1PU9A 4C7IA 5AG4A 4Y49B 2J9AA 1FY7A 3I9SA 2B3UA 2PJ7A 3D66A 3TE4A 3B2YA 1LRZA 2VZZA 3FEEA 3ZZIA 3HLPA 1CPSA 4PSXA 3SXOA 2ODFA 4XNHB 3PP9A 3TO9A 1I12A 1ZG9A 1I21A 2C6GA 3H8FA 2PR8A 4FD7A 5LYIA 1DE4C 3KQZA 3R1KA 4HNYB 5J1QA 2POKA 1J4JA 1VGYA 3FRMA 3CPAA 3F5BA 4KOYA 4KUAA 5J8FA 4KLVA 4DNCA 3V38A 3FMCA 2X7BA
chains in the Genus database with same CATH topology
4CGLA 2QMLA 1K4JA 4A95A 2FSRA 2YNEA 3EC4A 5F49A 2YGWA 1XE4A 2G3AA 4FD4A 4ONUA 2VZYA 4PK2A 3DR8A 1XF8A 2FXFA 4ZGYB 2A4NA 4YFJA 3EXNA 3E0KA 3UY5A 4H6UA 1KUXA 4KOVA 3R9EA 1N71A 1XIXA 3QAHA 4MJ8A 2JEVA 4GS4A 4CAWA 2Q04A 2FS5A 3F0AA 2ZPAA 2Q4VA 1Y9KA 4JD6A 4YRHA 4AB7A 4MFQA 4C2ZA 2YNCC 2KCWA 4CAEA 5F47A 2H5MA 3R9GA 3JVNA 2WPWA 4NXYA 4MI4A 2BL1A 4UA3A 4B5PA 4R87A 1S7LA 2OB0A 3PGPA 4E8OA 4E2AA 4A33A 1IYLA 4E0AA 2RC4A 1YGHA 3RYOA 3DNSA 2G3TA 5G21A 4FD6A 3IWGA 3B8GA 1P0HA 4L89A 5ISVA 2JDDA 4QUSA 3BLNA 2ZW7A 1ZO0A 3G3SA 4H6ZA 2OH1A 2I00A 3G8WA 4C7HA 1M4DA 3FYNA 1IYKA 1IB1E 2B5GA 2OZUA 3H4QA 3R9FA 2O28A 4JLYA 4CAXA 2PC1A 2Z10A 4C68A 2CY2A 3ZJ0A 3DDDA 4Y49C 3PZJA 4HKFA 3R95A 5IV0A 1RXTA 2Z3KA 4BMHA 4XNHC 1B6BA 3KKWA 4XPLA 5E96A 1YX0A 2FIAA 4MFKA 2GIVA 1M4IA 2YNCA 4KORA 2Z3OA 1XMTA 3SHPA 1MJAA 5EC4A 4MFJA 3GY9A 3CXQA 4KOWA 3T9YA 2J8MA 2D4PA 4JXRA 4II9A 2CXAA 2AE6A 4MY0A 2EUIA 1NSLA 2Q7BA 1GHEA 4MFPA 3JUWA 3T90A 3SXNA 5EBVA 4MHDA 2DPTA 1Z4EA 4OLLA 4AVAA 1NE9A 3D8PA 4KOSA 4R3KA 4KUBA 5DWNA 2FT0A 5KTAA 1VHSA 1YREA 2REFA 4KSFA 4C2YA 3S6HA 1WWZA 2EVNA 4CGMA 4CYNA 2FL4A 2Z3NA 1S3ZA 4YGOA 4NCZA 4NF1A 1BOBA 4IF5A 4J3GA 5H86A 3FB3A 4UWJA 2JDCA 3FNCA 1QSNA 2VXKA 4B12A 2PRBA 2Z0ZA 3JTKA 3S6GA 2J8RA 4KOUA 2R1IA 2DXQA 2Y0MA 1I1DA 2CNSA 3FXTA 3S6KA 3LODA 4AVCA 1Z9UA 3VWDA 3D2MA 3TCVA 2OZHA 4UWIA 4KSAA 4QBJA 4HNXB 4I49A 4AG9A 4CAVA 3W6SA 1BO4A 4M3SA 4UCMA 2PSWA 3TO7A 5GCNA 5C82A 4B5PB 5AG5A 4Q38A 4HNWB 2R8VA 4K30A 1QSOA 2ZXVA 4KS9A 1VKCA 1YLEA 2ARHA 1U6MA 3BJ7A 1KZFA 3IU2A 5J8CA 2B4DB 4L8AA 3LD2A 5JPHA 4MBUA 2CNMA 2FCKA 4MY3A 1Y7RA 2D4OA 2HV2A 4CRYB 4UFWA 4KOXA 3DSBA 4R3LA 4CAFA 4KLWA 1KUVA 2B3VA 4A30A 5A27A 4OAEA 2HQYA 5F48A 5AGEA 4UCNA 3IWEA 2B58A 4B13A 4CGOA 2B4BA 4R57A 2GE3A 3OWCA 3I3GA 2P6EA 4XPKA 1B87A 3CXSA 5CNPA 4B14A 2VBQA 4B10A 4CYPA 5IX3A 5FVJA 5H84A 3TOBA 2QIRA 4KVME 1YVOA 3D2PA 2P6GA 1YK3A 1Y9WA 2YNDA 4H89A 4F6AA 3W91A 2WPXA 2C27A 2JLMA 1Q2CA 2NMTA 4XPDB 3A9LA 4AG7A 2VEZA 5F46A 4CS0B 5HMNA 3VWEA 3W6XA 3K9UA 3FBUA 4KOTA 1XEBA 4IUSA 1WK4A 4F0YA 2R7HA 4CRZB 3P2FA 1QSMA 1UFHA 2VI7A 1NMTA 4JJXA 5G20A 4RI1A 3EFAA 2FE7A 4PK3A 1IICA 4QVTA 2I79A 4UCPA 4U9ZA 2Z11A 3NE7A 1YR0A 2GANA 3TO6A 4CGNA 4KVXA 3BJ8A 5G22A 5HH1A 1TIQA 5C88A 3QB8A 4PV6A 3EY5A 2K5TA 1KUYA 4R9MA 4JXQA 4BBHA 1MK4A 1M1DA 2ZW4A 1QSTA 5DWMA 4LUAA 2HUZA 1Q2DA 2R98A 2REEA 4KVOE 3C26A 1V0CA 2P0WA 3TT2A 1Q2YA 3F8KA 4RS2A 4QC6A 1S5KA 1ON0A 2ZW6A 4U9YA 4NEXA 4CYQA 5KTCA 2WSAA 3TOAA 3CXPA 4A31A 1OZPA 2PR1A 4UFXA 4MFLA 3V8IA 2BUEA 2Q44A 2DPSA 2BSWA 3P2HA 1Z4RA 3S6FA 2PQ8A 4CYOA 4B5OA 2VQYA 2ZW5A 1PUAA 5AG6A 5JQ4A 3FIXA 3TFYA 3R96A 1P4NA 2Q0YA 3DR6A 1R57A 5BWAB 5I0CA 1MJBA 4A32A 4NSQA 4UFVA 4MFZA 3WR7A 3IU1A 3IGRA 4XPDC 2B5GB 4C2XA 3D3SA 3TTHA 2AJ6A 2WUUA 3EO4A 4U5YA 4A2ZA 4JWPA 3MGDA 4M85A 4CGPA 2B4DA 4QB9A 2P6FA 1M4GA 3GYAA 5AG7A 2J8NA 4X5KA 5A28A 2F5IA 4ZBGA 4LX9A 2BEIA 4EVYA 2QECA 2OZGA 1MJ9A 1L0CA 1S7KA 3N7ZA 2OU2A 1SQHA 3H5ZA 1S60A 4F0XA 4PSWA 2Z3PA 1QSRA 2PDOA 2Z3LA 1YVKA 2ATRA 4Q36A 1S7NA 1IIDA 4OADA 1CJWA 1RO5A 5IB0A 4B11A 4FD5A 2Z3MA 2CNTA 5KTDA 4ORFA 2G0BA 2Q4YA 4AVBA 3GKRA 1S7FA 1CM0A 1M44A 4KZTA 5G1ZA 2IL4A 4UBRA 5AG4A 2FIWA 1PU9A 4C7IA 3TE4A 4Y49B 1FY7A 3I9SA 2B3UA 1LRZA 2VZZA 3ZZIA 4PSXA 3SXOA 4XNHB 3PP9A 3TO9A 1I12A 1I21A 4FD7A 2PR8A 3R1KA 4HNYB 1J4JA 4KOYA 3FRMA 3F5BA 4KUAA 5J8FA 4KLVA 4DNCA 2X7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H5Z A;  4UFX A;  5G20 A;  4B12 A;  4CGL A;  4CAF A;  4A95 A;  4UCM A;  4C2X A;  4A30 A;  2YNE A;  4A33 A;  5A27 A;  2WUU A;  3JTK A;  5AG5 A;  4A2Z A;  5AGE A;  4C2Y A;  4UCN A;  2YND A;  5G21 A;  4UCP A;  3IWE A;  5G1Z A;  4B13 A;  4CGP A;  4CGO A;  5AG4 A;  4C7I A;  4CYO A;  4CGN A;  5AG6 A;  5AG7 A;  5G22 A;  4CGM A;  4CYN A;  5A28 A;  4C2Z A;  2YNC C;  3IU2 A;  2YNC A;  4C7H A;  4CAE A;  4B14 A;  4CYQ A;  2WSA A;  4A32 A;  4B10 A;  4B11 A;  4CYP A;  4BBH A;  4UFW A;  4UFV A;  4A31 A;  4C68 A;  3IU1 A; 
#chains in the Genus database with same CATH topology
 3NH4 A;  4OC0 A;  4CGL A;  4OME A;  2QML A;  1K4J A;  1RTQ A;  2PVW A;  4P4D A;  4A38 A;  4A95 A;  4OKO A;  2FSR A;  2YNE A;  3EC4 A;  4JYW A;  2Q4Z A;  5EMI A;  5F49 A;  2YGW A;  1F2P A;  1XE4 A;  4TNU A;  4GM5 A;  4NGP A;  2G3A A;  4FD4 A;  4NGR A;  4ONU A;  2VZY A;  2ZEF A;  4PK2 A;  2CIJ A;  3DR8 A;  1XF8 A;  2FXF A;  4ZGY B;  2A4N A;  4MMO A;  4P4F A;  4UIA A;  4YFJ A;  3BI1 A;  5CPA A;  3EXN A;  2QVP A;  3E0K A;  3UY5 A;  2AFW A;  3BXM A;  2ZED A;  4NGS A;  4H6U A;  1XJO A;  1KUX A;  4KOV A;  3R9E A;  5K8M A;  1N71 A;  1XIX A;  4ZY0 A;  2ZEP A;  2O53 A;  2O4H A;  3QAH A;  4R7M A;  3S9N A;  4MJ8 A;  1R43 A;  3DGV A;  2JEV A;  4GS4 A;  3B3V A;  4CAW A;  2Q04 A;  2AFZ A;  2FS5 A;  1KWM A;  4H2K A;  3F0A A;  2ZPA A;  2Q4V A;  1Y9K A;  4JD6 A;  4YRH A;  4AB7 A;  4R6T A;  3SJG A;  1ELL P;  4MFQ A;  4C2Z A;  2YNC C;  2ZOF A;  4EFD A;  2KCW A;  2PCU A;  4CAE A;  5F47 A;  2H5M A;  3R9G A;  1XRY A;  3JVN A;  2WPW A;  2CTB A;  3KHZ A;  4P6Y A;  4P4E A;  3SJE A;  4NXY A;  1XFO A;  2PJ2 A;  4MI4 A;  2BL1 A;  4UA3 A;  4B5P A;  2RB7 A;  4OC4 A;  1S7L A;  2OB0 A;  1TXR A;  3PGP A;  4R87 A;  4E8O A;  2DEA A;  3KL9 A;  4E2A A;  4A33 A;  1IYL A;  4E0A A;  2RC4 A;  1YGH A;  3RYO A;  2GU2 A;  3DNS A;  2G3T A;  5G21 A;  7CPA A;  4FD6 A;  1TF8 A;  3IWG A;  3B8G A;  1P0H A;  1TF9 A;  4L89 A;  3NA6 A;  4MHZ A;  5ISV A;  4BIN A;  2JDD A;  4QUS A;  3BLN A;  5LRK A;  3FED A;  4IHM A;  4EME A;  2XEJ A;  1ZO0 A;  2ZW7 A;  2IQ6 A;  2ABZ A;  3KGQ A;  3G3S A;  4H6Z A;  2OH1 A;  2I00 A;  3G8W A;  4C7H A;  5I4M A;  1M4D A;  1YME A;  2PIY A;  3FYN A;  2ZOG A;  1IYK A;  1IB1 E;  2F7V A;  2B5G A;  2OZU A;  3H4Q A;  3R9F A;  2O28 A;  4JLY A;  2PJ6 A;  3D7G A;  4CAX A;  2PC1 A;  2Z10 A;  4C68 A;  3PFE A;  2CY2 A;  4AXV A;  3ZJ0 A;  4PXE A;  3DDD A;  4Y49 C;  5HXD A;  5K8O A;  3KAS A;  3PZJ A;  4HKF A;  3R95 A;  5IV0 A;  2PJ3 A;  1RXT A;  2Z3K A;  4BMH A;  4XNH C;  2RFH A;  1B6B A;  3KKW A;  4XPL A;  3D7F A;  5E96 A;  1YW4 A;  1YX0 A;  4WJB A;  2FIA A;  2CTC A;  1A2Z A;  4NJR A;  4MFK A;  1JWQ A;  2GIV A;  1M4I A;  2YNC A;  1PYT B;  2Z3O A;  4KOR A;  2PJ4 A;  3GLJ A;  1XMT A;  5JM6 A;  2GLJ A;  3SHP A;  2VL1 A;  1MJA A;  5EC4 A;  2GLF A;  4MFJ A;  1BAV A;  1LFW A;  2C6P A;  3GY9 A;  3CXQ A;  4KOW A;  4NGT A;  3T9Y A;  2J8M A;  2D4P A;  2XEF A;  2AFM A;  2CXA A;  2AE6 A;  2ZEM A;  4JXR A;  4MY0 A;  4OC5 A;  4FBE A;  4II9 A;  2EUI A;  2Q51 A;  1NSL A;  2ZEL A;  2Q7B A;  4F9V A;  1GHE A;  3PFO A;  4MFP A;  3JUW A;  4IK2 A;  3S9M A;  5THW A;  4LQG A;  3T90 A;  3SXN A;  5EBV A;  4MHD A;  3BI0 A;  3JRU A;  4F8Z A;  2HC9 A;  2DPT A;  1Z4E A;  4OLL A;  1F2O A;  3WC5 A;  4AVA A;  2V8V A;  4G1P A;  3SI1 A;  1YLO A;  1NE9 A;  3D8P A;  4KOS A;  2ZEE A;  4KUB A;  4R3K A;  5DWN A;  1X10 A;  2FT0 A;  3V7Z A;  1NSA A;  4ZY1 A;  1UWY A;  5KTA A;  1VHS A;  4MXU A;  4X2T A;  4PXB A;  1YRE A;  2PE3 A;  3KQX A;  2REF A;  4KSF A;  4C2Y A;  4P45 A;  3S6H A;  3I1U A;  2QYV A;  4Q7A A;  4IAV A;  1R3N A;  1WWZ A;  2PVV A;  2EVN A;  4CGM A;  4CYN A;  2FL4 A;  4MRI A;  2Z3N A;  1S3Z A;  4ONW A;  4YGO A;  1JQG A;  3LAC A;  2F8H A;  4NCZ A;  3S9L A;  4NF1 A;  1BOB A;  3B3W A;  3FJU A;  2PJ9 A;  4IF5 A;  3NFZ A;  3QAY A;  2OR4 A;  3FB3 A;  4J3G A;  2JDC A;  4UWJ A;  4NFR A;  5H86 A;  3FNC A;  1QSN A;  5K8N A;  2VXK A;  4OID A;  3RO0 A;  3CPX A;  3IFE A;  4UEF A;  1LAP A;  4UIB A;  4B12 A;  2PRB A;  2Z0Z A;  1M4L A;  2AFX A;  3JTK A;  4PPZ A;  3S6G A;  2J8R A;  4KOU A;  2R1I A;  3RNZ A;  5LYD A;  2DXQ A;  3WAB A;  2PJ0 A;  2Y0M A;  3IWW A;  1I1D A;  1Y0Y A;  2EO8 A;  1Z8T A;  1HDQ A;  1TKJ A;  2CNS A;  3RAM A;  3FXT A;  3S6K A;  3LOD A;  1X12 A;  4AVC A;  4X8I A;  3KI9 A;  1Z9U A;  2PJA A;  1XBU A;  4GXH A;  2PRQ A;  4FUU A;  3VWD A;  3D2M A;  3TCV A;  2OZH A;  4UWI A;  3FF3 A;  4KSA A;  4X3R A;  4MCP A;  4HNX B;  4QBJ A;  4I49 A;  4AG9 A;  2IMO A;  4CAV A;  3D7D A;  3W6S A;  1BO4 A;  3MRU A;  3PB7 X;  1TKH A;  2ZEH A;  4M3S A;  4UCM A;  3B35 A;  2PSW A;  3TO7 A;  4A94 A;  5GCN A;  3BHX A;  4B5P B;  5C82 A;  5AG5 A;  1CG2 A;  4HNW B;  4Q38 A;  2R8V A;  4K30 A;  1QSO A;  3FX6 A;  1XOV A;  2ZXV A;  4KS9 A;  4A37 A;  1AUG A;  1Z5R A;  2PJ8 A;  2V8G A;  1Y0R A;  3WT4 A;  1VKC A;  3PB8 X;  1YLE A;  2ARH A;  1U6M A;  1ELM P;  5JGF A;  3BJ7 A;  1KZF A;  1LOK A;  3IU2 A;  4R76 A;  3TX8 A;  5J8C A;  2B4D B;  2EBJ A;  4L8A A;  3LD2 A;  3B3S A;  3NH8 A;  2JBK A;  5JPH A;  2BCO A;  2CNM A;  4MBU A;  2FCK A;  3IO1 A;  5HVH A;  4MHP A;  4MY3 A;  1Y7R A;  3WC6 A;  2D4O A;  2HV2 A;  2V8H A;  4R8F A;  4JZ0 A;  4CRY B;  4UFW A;  4KOX A;  3DSB A;  4MHY A;  4R3L A;  3VH9 A;  4CAF A;  4KLW A;  2AFU A;  2ANP A;  1DTD A;  1KUV A;  2B3V A;  4A30 A;  3FVL A;  3PRT A;  3KHX A;  5A27 A;  4OAE A;  2HQY A;  5F48 A;  5AGE A;  4UCN A;  3IWE A;  3GB0 A;  2B58 A;  2CF4 A;  4B13 A;  2PIZ A;  4CGO A;  3GIU A;  4K3N A;  4OC1 A;  1CP6 A;  1BPM A;  2B4B A;  2PJB A;  4R57 A;  1EE3 P;  2PJ1 A;  2GE3 A;  3SJF A;  4B6Z A;  4RUH A;  3OWC A;  3I3G A;  2P6E A;  4XPK A;  1B87 A;  1Z2L A;  3CXS A;  5CNP A;  1TKF A;  1CX8 A;  4B14 A;  2VBQ A;  4B10 A;  4CYP A;  4P4B A;  4OC3 A;  1LAM A;  1Z8X A;  2EK8 A;  4M6G A;  5IX3 A;  2Q7S A;  5FVJ A;  4LQ6 A;  4FWU A;  5H84 A;  2AFO A;  2QIR A;  4KVM E;  3IIB A;  3TOB A;  8CPA A;  1YVO A;  6CPA A;  1YSJ A;  3D2P A;  2P6G A;  4EWT A;  1YK3 A;  2DF5 A;  4RN7 A;  1Y9W A;  2YND A;  4H89 A;  4PXD A;  4F6A A;  4UF4 A;  4W9Y A;  3W91 A;  2WPX A;  3IC1 A;  4OP4 A;  2C27 A;  4M6H A;  2JLM A;  1Q2C A;  2NMT A;  4XPD B;  3A9L A;  5ELY A;  2XEG A;  4AG7 A;  2HB6 A;  3VAR A;  2VEZ A;  5F46 A;  1ARL A;  2BOA A;  2PJC A;  5DS0 A;  4CS0 B;  4DUK A;  3VWE A;  5HMN A;  3W6X A;  3K9U A;  3FBU A;  4YU9 A;  4KOT A;  1XEB A;  4IUS A;  4OC2 A;  4NGM A;  1WK4 A;  4F0Y A;  4P44 A;  2R7H A;  4MCR A;  4CRZ B;  3P2F A;  2FVG A;  1QSM A;  4FAI A;  1UFH A;  3SJX A;  2VI7 A;  1NMT A;  4JJX A;  4P10 A;  4RI1 A;  5G20 A;  3B3T A;  3FH4 A;  4NGN A;  1XMB A;  3EFA A;  3L2N A;  4P4I A;  2WZN A;  2FE7 A;  2GFQ A;  1IIC A;  4PK3 A;  1BLL E;  4QVT A;  1FNO A;  3PB6 X;  2I79 A;  3PBB A;  4UCP A;  4U9Z A;  2Z11 A;  2ZEO A;  4DYO A;  3NE7 A;  1Z8L A;  1YR0 A;  3LMS A;  2GAN A;  3TO6 A;  3LWU A;  3D67 A;  4CGN A;  4WWV A;  4KVX A;  1ZG7 A;  3BJ8 A;  5G22 A;  5HH1 A;  1TIQ A;  5C88 A;  1VIX A;  2QJ8 A;  3QB8 A;  4PV6 A;  3FEC A;  5LRG A;  3ISZ A;  3T8W A;  2EWB A;  3EY5 A;  2K5T A;  1KUY A;  1ZG8 A;  4M6I A;  4O23 A;  4R9M A;  1ZLI A;  1IOF A;  4JXQ A;  4BBH A;  1LCP A;  3TC8 A;  1MK4 A;  1M1D A;  2ZW4 A;  1QST A;  5DWM A;  4LUA A;  4KSI A;  4CPA A;  2HUZ A;  1Q2D A;  1QMU A;  2R98 A;  2REE A;  4KVO E;  2JBJ A;  3C26 A;  1F57 A;  1V0C A;  2JEW A;  3ISX A;  2C6C A;  4ZX9 A;  4F9U A;  2P0W A;  1QQ9 A;  4ZY2 A;  3TT2 A;  1Q2Y A;  2C1C A;  1VHO A;  3F8K A;  2BO9 A;  3MN8 A;  4RS2 A;  1Z8W A;  5D29 A;  2OOT A;  5HVG A;  4QC6 A;  1S5K A;  1ON0 A;  2ZW6 A;  1CP7 A;  2EK9 A;  4NEX A;  4U9Y A;  2WSA A;  4CYQ A;  3QNV A;  5KTC A;  3TOA A;  3CXP A;  3H8G A;  4Z65 A;  4A31 A;  2XEI A;  1OZP A;  4NGQ A;  4OIW A;  2PR1 A;  5LYL A;  4UFX A;  4MFL A;  1H8L A;  4MHN A;  1IU8 A;  2BUE A;  3V8I A;  2IJZ A;  2Q44 A;  4YWY A;  2DPS A;  1ARM A;  2BSW A;  4HPS A;  3P2H A;  1Z4R A;  3CZX A;  3S6F A;  3KZW A;  2PQ8 A;  1IGB A;  3WC7 A;  1AMP A;  5K8P A;  3D68 A;  3SI2 A;  4PXC A;  4CYO A;  3VAT A;  2NYQ A;  2PJ5 A;  2VQY A;  2ZW5 A;  3NH5 A;  4B5O A;  1PUA A;  3PBE A;  4PQA A;  5AG6 A;  5JQ4 A;  3FIX A;  3TFY A;  1Y7E A;  3R96 A;  1HEE A;  1P4N A;  2Q0Y A;  3DR6 A;  1R57 A;  2G9D A;  5BWA B;  5I0C A;  3B3C A;  1IY7 A;  1BPN A;  1MJB A;  3IEH A;  4NJQ A;  4NSQ A;  4A32 A;  1OBR A;  4UFV A;  4MFZ A;  1LAN A;  3WR7 A;  3IU1 A;  3CDX A;  3IGR A;  3SI0 A;  4XPD C;  2B5G B;  5HVF A;  4C2X A;  1VHE A;  3D3S A;  3TTH A;  5IB9 A;  2AJ6 A;  2WUU A;  3EO4 A;  4U5Y A;  4A2Z A;  2AFS A;  3B7I A;  4JWP A;  5CBM A;  3MGD A;  1FT7 A;  1PCA A;  2V77 A;  3N5F A;  4M85 A;  4CGP A;  2B4D A;  4QB9 A;  1YQE A;  2P6F A;  1AYE A;  3KR4 A;  4DJL A;  1M4G A;  3GYA A;  5D8N A;  4P4J A;  2J8N A;  5AG7 A;  4X5K A;  5A28 A;  2F5I A;  4ZBG A;  5LRJ A;  4LX9 A;  2ZEG A;  2I3C A;  2BEI A;  4ZX8 A;  4EVY A;  1ZLH A;  2QEC A;  2Q43 A;  3K9T A;  3PB4 X;  2OZG A;  1MJ9 A;  1L0C A;  1S7K A;  3N7Z A;  2OU2 A;  3H8E A;  3CT9 A;  1SQH A;  3H5Z A;  3K2K A;  3GUX A;  3PEI A;  4MCS A;  1S60 A;  5F09 A;  4F0X A;  5LYF A;  3D4U A;  4PSW A;  1CPX A;  2Z3P A;  1CBX A;  1QSR A;  4BD9 A;  2PDO A;  3D7H A;  3RBU A;  3HUV A;  2NSM A;  2Z3L A;  1YVK A;  2ATR A;  1Q7L A;  4Q36 A;  1IID A;  1S7N A;  4OAD A;  1CJW A;  1RO5 A;  5JH9 A;  2ZEN A;  3IJ3 A;  2WYR A;  5IB0 A;  4B11 A;  4FD5 A;  4MCQ A;  2Z3M A;  2CNT A;  4ZYQ A;  5KTD A;  4ORF A;  2V8D A;  4ZI6 A;  3PB9 X;  3DLJ A;  4TWE A;  2G0B A;  2Q4Y A;  3KR5 A;  4UEZ A;  3GKR A;  1S7F A;  1CM0 A;  4AVB A;  2GRE A;  1HDU A;  1IOI A;  4UEE A;  4A39 A;  3NE8 A;  1M44 A;  4KZT A;  5G1Z A;  1GYT A;  2IL4 A;  4UBR A;  3RZA A;  1YW6 A;  2FIW A;  1PU9 A;  4C7I A;  5AG4 A;  4Y49 B;  2J9A A;  1FY7 A;  3I9S A;  2B3U A;  2PJ7 A;  3D66 A;  3TE4 A;  3B2Y A;  1LRZ A;  2VZZ A;  3FEE A;  3ZZI A;  3HLP A;  1CPS A;  4PSX A;  3SXO A;  2ODF A;  4XNH B;  3PP9 A;  3TO9 A;  1I12 A;  1ZG9 A;  1I21 A;  2C6G A;  3H8F A;  2PR8 A;  4FD7 A;  5LYI A;  1DE4 C;  3KQZ A;  3R1K A;  4HNY B;  5J1Q A;  2POK A;  1J4J A;  1VGY A;  3FRM A;  3CPA A;  3F5B A;  4KOY A;  4KUA A;  5J8F A;  4KLV A;  4DNC A;  3V38 A;  3FMC A;  2X7B A; 
#chains in the Genus database with same CATH homology
 4CGL A;  2QML A;  1K4J A;  4A95 A;  2FSR A;  2YNE A;  3EC4 A;  5F49 A;  2YGW A;  1XE4 A;  2G3A A;  4FD4 A;  4ONU A;  2VZY A;  4PK2 A;  3DR8 A;  1XF8 A;  2FXF A;  4ZGY B;  2A4N A;  4YFJ A;  3EXN A;  3E0K A;  3UY5 A;  4H6U A;  1KUX A;  4KOV A;  3R9E A;  1N71 A;  1XIX A;  3QAH A;  4MJ8 A;  2JEV A;  4GS4 A;  4CAW A;  2Q04 A;  2FS5 A;  3F0A A;  2ZPA A;  2Q4V A;  1Y9K A;  4JD6 A;  4YRH A;  4AB7 A;  4MFQ A;  4C2Z A;  2YNC C;  2KCW A;  4CAE A;  5F47 A;  2H5M A;  3R9G A;  3JVN A;  2WPW A;  4NXY A;  4MI4 A;  2BL1 A;  4UA3 A;  4B5P A;  4R87 A;  1S7L A;  2OB0 A;  3PGP A;  4E8O A;  4E2A A;  4A33 A;  1IYL A;  4E0A A;  2RC4 A;  1YGH A;  3RYO A;  3DNS A;  2G3T A;  5G21 A;  4FD6 A;  3IWG A;  3B8G A;  1P0H A;  4L89 A;  5ISV A;  2JDD A;  4QUS A;  3BLN A;  2ZW7 A;  1ZO0 A;  3G3S A;  4H6Z A;  2OH1 A;  2I00 A;  3G8W A;  4C7H A;  1M4D A;  3FYN A;  1IYK A;  1IB1 E;  2B5G A;  2OZU A;  3H4Q A;  3R9F A;  2O28 A;  4JLY A;  4CAX A;  2PC1 A;  2Z10 A;  4C68 A;  2CY2 A;  3ZJ0 A;  3DDD A;  4Y49 C;  3PZJ A;  4HKF A;  3R95 A;  5IV0 A;  1RXT A;  2Z3K A;  4BMH A;  4XNH C;  1B6B A;  3KKW A;  4XPL A;  5E96 A;  1YX0 A;  2FIA A;  4MFK A;  2GIV A;  1M4I A;  2YNC A;  4KOR A;  2Z3O A;  1XMT A;  3SHP A;  1MJA A;  5EC4 A;  4MFJ A;  3GY9 A;  3CXQ A;  4KOW A;  3T9Y A;  2J8M A;  2D4P A;  4JXR A;  4II9 A;  2CXA A;  2AE6 A;  4MY0 A;  2EUI A;  1NSL A;  2Q7B A;  1GHE A;  4MFP A;  3JUW A;  3T90 A;  3SXN A;  5EBV A;  4MHD A;  2DPT A;  1Z4E A;  4OLL A;  4AVA A;  1NE9 A;  3D8P A;  4KOS A;  4R3K A;  4KUB A;  5DWN A;  2FT0 A;  5KTA A;  1VHS A;  1YRE A;  2REF A;  4KSF A;  4C2Y A;  3S6H A;  1WWZ A;  2EVN A;  4CGM A;  4CYN A;  2FL4 A;  2Z3N A;  1S3Z A;  4YGO A;  4NCZ A;  4NF1 A;  1BOB A;  4IF5 A;  4J3G A;  5H86 A;  3FB3 A;  4UWJ A;  2JDC A;  3FNC A;  1QSN A;  2VXK A;  4B12 A;  2PRB A;  2Z0Z A;  3JTK A;  3S6G A;  2J8R A;  4KOU A;  2R1I A;  2DXQ A;  2Y0M A;  1I1D A;  2CNS A;  3FXT A;  3S6K A;  3LOD A;  4AVC A;  1Z9U A;  3VWD A;  3D2M A;  3TCV A;  2OZH A;  4UWI A;  4KSA A;  4QBJ A;  4HNX B;  4I49 A;  4AG9 A;  4CAV A;  3W6S A;  1BO4 A;  4M3S A;  4UCM A;  2PSW A;  3TO7 A;  5GCN A;  5C82 A;  4B5P B;  5AG5 A;  4Q38 A;  4HNW B;  2R8V A;  4K30 A;  1QSO A;  2ZXV A;  4KS9 A;  1VKC A;  1YLE A;  2ARH A;  1U6M A;  3BJ7 A;  1KZF A;  3IU2 A;  5J8C A;  2B4D B;  4L8A A;  3LD2 A;  5JPH A;  4MBU A;  2CNM A;  2FCK A;  4MY3 A;  1Y7R A;  2D4O A;  2HV2 A;  4CRY B;  4UFW A;  4KOX A;  3DSB A;  4R3L A;  4CAF A;  4KLW A;  1KUV A;  2B3V A;  4A30 A;  5A27 A;  4OAE A;  2HQY A;  5F48 A;  5AGE A;  4UCN A;  3IWE A;  2B58 A;  4B13 A;  4CGO A;  2B4B A;  4R57 A;  2GE3 A;  3OWC A;  3I3G A;  2P6E A;  4XPK A;  1B87 A;  3CXS A;  5CNP A;  4B14 A;  2VBQ A;  4B10 A;  4CYP A;  5IX3 A;  5FVJ A;  5H84 A;  3TOB A;  2QIR A;  4KVM E;  1YVO A;  3D2P A;  2P6G A;  1YK3 A;  1Y9W A;  2YND A;  4H89 A;  4F6A A;  3W91 A;  2WPX A;  2C27 A;  2JLM A;  1Q2C A;  2NMT A;  4XPD B;  3A9L A;  4AG7 A;  2VEZ A;  5F46 A;  4CS0 B;  5HMN A;  3VWE A;  3W6X A;  3K9U A;  3FBU A;  4KOT A;  1XEB A;  4IUS A;  1WK4 A;  4F0Y A;  2R7H A;  4CRZ B;  3P2F A;  1QSM A;  1UFH A;  2VI7 A;  1NMT A;  4JJX A;  5G20 A;  4RI1 A;  3EFA A;  2FE7 A;  4PK3 A;  1IIC A;  4QVT A;  2I79 A;  4UCP A;  4U9Z A;  2Z11 A;  3NE7 A;  1YR0 A;  2GAN A;  3TO6 A;  4CGN A;  4KVX A;  3BJ8 A;  5G22 A;  5HH1 A;  1TIQ A;  5C88 A;  3QB8 A;  4PV6 A;  3EY5 A;  2K5T A;  1KUY A;  4R9M A;  4JXQ A;  4BBH A;  1MK4 A;  1M1D A;  2ZW4 A;  1QST A;  5DWM A;  4LUA A;  2HUZ A;  1Q2D A;  2R98 A;  2REE A;  4KVO E;  3C26 A;  1V0C A;  2P0W A;  3TT2 A;  1Q2Y A;  3F8K A;  4RS2 A;  4QC6 A;  1S5K A;  1ON0 A;  2ZW6 A;  4U9Y A;  4NEX A;  4CYQ A;  5KTC A;  2WSA A;  3TOA A;  3CXP A;  4A31 A;  1OZP A;  2PR1 A;  4UFX A;  4MFL A;  3V8I A;  2BUE A;  2Q44 A;  2DPS A;  2BSW A;  3P2H A;  1Z4R A;  3S6F A;  2PQ8 A;  4CYO A;  4B5O A;  2VQY A;  2ZW5 A;  1PUA A;  5AG6 A;  5JQ4 A;  3FIX A;  3TFY A;  3R96 A;  1P4N A;  2Q0Y A;  3DR6 A;  1R57 A;  5BWA B;  5I0C A;  1MJB A;  4A32 A;  4NSQ A;  4UFV A;  4MFZ A;  3WR7 A;  3IU1 A;  3IGR A;  4XPD C;  2B5G B;  4C2X A;  3D3S A;  3TTH A;  2AJ6 A;  2WUU A;  3EO4 A;  4U5Y A;  4A2Z A;  4JWP A;  3MGD A;  4M85 A;  4CGP A;  2B4D A;  4QB9 A;  2P6F A;  1M4G A;  3GYA A;  5AG7 A;  2J8N A;  4X5K A;  5A28 A;  2F5I A;  4ZBG A;  4LX9 A;  2BEI A;  4EVY A;  2QEC A;  2OZG A;  1MJ9 A;  1L0C A;  1S7K A;  3N7Z A;  2OU2 A;  1SQH A;  3H5Z A;  1S60 A;  4F0X A;  4PSW A;  2Z3P A;  1QSR A;  2PDO A;  2Z3L A;  1YVK A;  2ATR A;  4Q36 A;  1S7N A;  1IID A;  4OAD A;  1CJW A;  1RO5 A;  5IB0 A;  4B11 A;  4FD5 A;  2Z3M A;  2CNT A;  5KTD A;  4ORF A;  2G0B A;  2Q4Y A;  4AVB A;  3GKR A;  1S7F A;  1CM0 A;  1M44 A;  4KZT A;  5G1Z A;  2IL4 A;  4UBR A;  5AG4 A;  2FIW A;  1PU9 A;  4C7I A;  3TE4 A;  4Y49 B;  1FY7 A;  3I9S A;  2B3U A;  1LRZ A;  2VZZ A;  3ZZI A;  4PSX A;  3SXO A;  4XNH B;  3PP9 A;  3TO9 A;  1I12 A;  1I21 A;  4FD7 A;  2PR8 A;  3R1K A;  4HNY B;  1J4J A;  4KOY A;  3FRM A;  3F5B A;  4KUA A;  5J8F A;  4KLV A;  4DNC A;  2X7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...