2YNDA

Plasmodium vivax n-myristoyltransferase in complex with a pyrazole sulphonamide inhibitor.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
385
structure length
385
Chain Sequence
IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 113
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yndA00
4A30A 5A27A 4UCMA 5G1ZA 4C2XA 5G21A 4A33A 4A32A 3IU1A 4CGLA 4CYQA 2YNDA 5G22A 4C7HA 4CGOA 4C2YA 4C7IA 2WUUA 4UCPA 2YNEA 5AG7A 3IU2A 4UFVA 4UCNA 4C2ZA 4UFWA 4CGNA 4C68A 5A28A 3H5ZA 4CGMA 4B11A 5G20A 4A31A 2YNCA 4A95A 4B14A 4BBHA 4CGPA 4CYNA 5AG6A 5AG4A 3IWEA 5AGEA 2WSAA 4B13A 4CAEA 4B10A 4B12A 2YNCC 4CYPA 5AG5A 4CAFA 4A2ZA 4CYOA 3JTKA 4UFXA
chains in the Genus database with same CATH superfamily
4MMOA 2F5IA 3NA6A 4MHNA 2GFQA 2Q04A 4KVME 4UWIA 5G21A 4C2XA 2EBJA 3S9LA 4XPKA 3LACA 1U6MA 4P4EA 1PUAA 1YGHA 2OU2A 1S7LA 3S6HA 1XMBA 4MFJA 3SI0A 2REEA 3IEHA 3P2FA 4HNXB 2AFMA 2VQYA 1Y7EA 2CNTA 4MFZA 4KOXA 1R57A 3IC1A 2ZEFA 1XF8A 3I3GA 3R9FA 2C6GA 3I1UA 1Z9UA 2R98A 3FMCA 3TO7A 5G20A 1IICA 1QSRA 1MJBA 3PP9A 3MGDA 5H84A 4PXCA 2RB7A 2VZZA 4O23A 5AG6A 1YK3A 4Z65A 1A2ZA 1XRYA 3B3CA 4P4JA 1YR0A 3MRUA 3D8PA 5ELYA 4R57A 4CAFA 4UFXA 4CAVA 4A30A 4ZY0A 4GS4A 5J8CA 3NH8A 2CY2A 3FJUA 3QAHA 5I0CA 1LFWA 3BHXA 4KLVA 1R43A 4MFPA 1XMTA 4MCSA 5E96A 2ZW7A 2VEZA 4OAEA 5FVJA 4P6YA 2AFUA 4NGQA 3TE4A 3KL9A 4C7IA 4WJBA 4U9ZA 3PB6X 3CXSA 5LRJA 5LYFA 3VARA 2PIYA 4OIDA 3DNSA 2GLFA 2F8HA 3FYNA 3KASA 3ZZIA 2CNSA 3JRUA 2J8MA 4XPDB 3QB8A 4NGPA 2PJ7A 3PFEA 4KVXA 1JWQA 3NE7A 4NJRA 1UWYA 1KZFA 4LX9A 4Q36A 4OADA 2ZOGA 4QUSA 4HKFA 3RO0A 3KKWA 3SJGA 4B5PA 4ZY1A 1TF8A 2OB0A 4B12A 1Z4RA 2FVGA 4MFKA 2EWBA 3GKRA 1NSAA 2WPWA 3VATA 2QMLA 3H5ZA 1H8LA 1IY7A 5J1QA 5A27A 4JYWA 4UCMA 2D4OA 4W9YA 4M6GA 2R1IA 2R7HA 4RN7A 3R9EA 2P0WA 1TKHA 4UBRA 3GYAA 3RAMA 3TCVA 4B6ZA 2J8RA 1Z8LA 3LMSA 5HXDA 4DNCA 5KTCA 4PSXA 1N71A 1F2OA 1ARLA 2Q43A 4Q7AA 1F57A 3FNCA 1XOVA 2VBQA 4ZGYB 1MK4A 2PJ0A 5CNPA 3D66A 2HQYA 3PZJA 2G9DA 2NYQA 2PJ9A 4F9VA 2EO8A 2ABZA 3B35A 3PB4X 4KORA 2C6PA 2AE6A 1YW4A 1YVKA 4MXUA 1YQEA 4OC4A 4K30A 4NGRA 1R3NA 1ON0A 2P6EA 3DR6A 2G0BA 4HPSA 2R8VA 2IMOA 1QSOA 2CTBA 2K5TA 4MHPA 2VI7A 4BD9A 1YMEA 2ZEPA 3IGRA 2ZEOA 5CPAA 2RFHA 5THWA 2BSWA 4RI1A 4EMEA 4EWTA 4ZX8A 4JZ0A 4MHZA 5K8OA 2ZEDA 3ISZA 4HNYB 4LQ6A 2HUZA 4F9UA 4PK2A 4X2TA 4YFJA 2QECA 1M4DA 4ZX9A 2AJ6A 4C2ZA 2PSWA 1HEEA 2J8NA 5EMIA 3G3SA 3CZXA 5EBVA 4R8FA 1QSNA 2GLJA 4X5KA 4KVOE 4P4DA 4QVTA 3KI9A 2Z3OA 5K8PA 1LOKA 3A9LA 3D7DA 4NSQA 3LD2A 4OC2A 3FB3A 3SI1A 4G1PA 3V38A 5IV0A 4QC6A 4CRYB 4UIAA 2REFA 1Q2DA 3UY5A 1S7FA 3R95A 3W6SA 4XPDC 3C26A 4PXEA 3H8EA 4UWJA 3CT9A 1X12A 4H89A 2CF4A 1VHOA 3EFAA 4M6HA 4MCPA 5JPHA 5K8NA 2Q7SA 2Z10A 2Z3KA 4B5OA 2FT0A 4UFVA 1IOFA 1AYEA 2VZYA 3CDXA 2B4DB 2V8VA 4YU9A 1Z2LA 1ELMP 3EXNA 1Z8WA 4R7MA 4ZY2A 2FS5A 5F47A 2YNCA 4AXVA 3CPAA 4F6AA 2HC9A 3BI0A 1ZG9A 2WYRA 4OP4A 3PBBA 3V7ZA 4RS2A 3PRTA 1I1DA 2JBKA 1KWMA 4ONUA 2CNMA 1VIXA 2YNCC 4DUKA 2AFWA 1Z8TA 2J9AA 3JTKA 2NMTA 3DDDA 2ZEMA 3D7HA 4ZBGA 2PJCA 4E8OA 3WABA 3B3TA 2DF5A 3VWDA 3RYOA 1I21A 1BAVA 2Q4YA 5DWNA 4YWYA 2Z11A 1ARMA 2ZW6A 4ONWA 2D4PA 1XEBA 2Q4ZA 3BXMA 4UFWA 4TWEA 2BEIA 4CAWA 4KSAA 1M4IA 2Z3NA 2PDOA 5I4MA 4MY3A 3SJEA 2PJ3A 4IF5A 4H6UA 3TO9A 2JEVA 1F2PA 1VHSA 4YRHA 4ZI6A 1KUYA 1LCPA 4OC5A 4A94A 4MJ8A 2WPXA 1PYTB 4KOYA 5LRKA 4GM5A 1TKJA 2AFSA 2OH1A 2Q0YA 3K9UA 3FBUA 4KUAA 2PRBA 5JH9A 1CJWA 4A32A 5BWAB 2CTCA 4UEEA 3DGVA 3SHPA 2PJ4A 4P10A 2PVWA 1BPMA 3D68A 4X8IA 4CAXA 4ORFA 2GIVA 3BJ8A 3FRMA 1Z4EA 4P4FA 1YLOA 4R87A 4C2YA 5C88A 1BO4A 1M1DA 1RO5A 3IO1A 4RUHA 4OC1A 3B8GA 4PXBA 1CP7A 3L2NA 1YVOA 4UF4A 3KZWA 1Y7RA 2FXFA 2CXAA 3BJ7A 2B4DA 2IL4A 4IHMA 4FD4A 2IJZA 4NGNA 3D7GA 4PV6A 2PR8A 4KSFA 3KR4A 2V77A 4R9MA 1BLLE 1HDQA 1MJ9A 3GB0A 4MY0A 5H86A 2FCKA 2B5GB 4AG7A 1WWZA 4LUAA 2QJ8A 2ZOFA 1YW6A 5HVFA 1IYKA 1Y0YA 1RTQA 1XBUA 2F7VA 2ZW4A 3T8WA 1YLEA 2FIAA 2ODFA 2Z3LA 3HLPA 3RBUA 4CRZB 1IGBA 2I3CA 4MCRA 4KUBA 3W91A 3N5FA 4U9YA 4CYQA 3SJFA 1Y0RA 3IU2A 2JDCA 2EK8A 5F46A 4MHYA 3NH5A 3HUVA 3CXPA 2PIZA 1LANA 5J8FA 2PRQA 1YSJA 1TKFA 2PQ8A 2PJ8A 1DTDA 4MFLA 4KOTA 4XPLA 1LAPA 2PC1A 2PJ1A 3TT2A 4FAIA 4JXRA 1FT7A 4NJQA 4R6TA 2ARHA 1IYLA 4OKOA 3QNVA 3RZAA 4CYPA 2BUEA 2Z0ZA 2O28A 3SJXA 3N7ZA 1CPSA 3IWGA 4BINA 4NEXA 4PK3A 1IB1E 1Q2YA 4MCQA 1XFOA 4IK2A 1Q7LA 4KOSA 2POKA 2WUUA 2YNEA 3PB9X 2WZNA 4OC0A 5F09A 4CYNA 4UEFA 1TIQA 2XEIA 2FL4A 5AG4A 5IX3A 4PXDA 1Z8XA 2B3UA 4EFDA 1Q2CA 4R3LA 2JLMA 2B5GA 3H4QA 1SQHA 2XEJA 4NGMA 4A38A 4H6ZA 3R1KA 1PCAA 5G1ZA 4JWPA 4F0YA 3LWUA 3GIUA 3B3VA 2PJ2A 2G3AA 3T90A 2ZXVA 4MBUA 1LRZA 3TFYA 5F48A 3FVLA 3NFZA 3TX8A 4KLWA 5A28A 3S6KA 4PSWA 2AFXA 2Q44A 4A31A 4A95A 4BBHA 1J4JA 1WK4A 2HB6A 1JQGA 3BLNA 4DJLA 3RNZA 4EVYA 4A39A 4PQAA 4DYOA 1ZG8A 3S6GA 5JM6A 3MN8A 1QSTA 4A2ZA 5DWMA 2PVVA 3KHXA 1B87A 3PB7X 2JBJA 1I12A 3H8GA 3B7IA 4P4IA 3GY9A 2ZEHA 1AMPA 2YNDA 5F49A 4NFRA 1IOIA 4KOUA 2OZHA 1S3ZA 1NE9A 4AB7A 2X7BA 4P4BA 4Y49B 2PJAA 3BI1A 4C68A 4AVCA 3S9MA 4CGMA 4KZTA 1BPNA 2ZELA 4TNUA 3B3SA 3VWEA 4KSIA 3IFEA 2AFOA 2EUIA 1KUXA 1CX8A 2BL1A 2Z3MA 4IUSA 2HV2A 3W6XA 1S7KA 4OIWA 3ZJ0A 3IWEA 3IJ3A 4GXHA 2WSAA 5HVHA 1PU9A 1S7NA 1L0CA 2C27A 3V8IA 2PJ6A 2FE7A 2BOAA 2GE3A 2OOTA 2Q4VA 4CYOA 4OLLA 3TO6A 3GUXA 4F8ZA 3CXQA 4OC3A 3TOBA 1Y9WA 3EC4A 3PBEA 1OBRA 1S60A 4FD6A 4A33A 3SI2A 4CS0B 1TF9A 3S6FA 5JGFA 2OZUA 4XNHB 3TC8A 1M4GA 1VKCA 4FWUA 3KQZA 4KOVA 4FD5A 2XEGA 4NCZA 2V8GA 2V8HA 3R96A 1K4JA 5GCNA 3WC7A 4UCNA 3F5BA 8CPAA 2FSRA 2DPTA 6CPAA 3PGPA 2B58A 4Q38A 2GANA 2ZEEA 3PB8X 5EC4A 4HNWB 3EY5A 4R76A 2ZPAA 3FEDA 3T9YA 2OR4A 2GU2A 1MJAA 2PCUA 2Q7BA 2QYVA 1NSLA 4A37A 2C6CA 2AFZA 4MFQA 5AGEA 4B13A 2BO9A 3NH4A 4M6IA 4PPZA 1QQ9A 2Y0MA 4FD7A 1QMUA 3FXTA 5AG5A 3FH4A 2NSMA 2Q51A 2GREA 2DEAA 2CIJA 5CBMA 2PR1A 4UIBA 2PE3A 2EK9A 1S5KA 1CP6A 4CGLA 4U5YA 3KHZA 4AVBA 4C7HA 1CBXA 4MHDA 1CM0A 4MI4A 4CGOA 5HVGA 3JVNA 4FUUA 1GYTA 5ISVA 3OWCA 4E2AA 1GHEA 3F0AA 2OZGA 4JJXA 4L8AA 2A4NA 4I49A 4WWVA 3PEIA 3CPXA 2G3TA 2QVPA 3B2YA 3FEEA 4YGOA 5K8MA 1AUGA 1BOBA 1CPXA 1VHEA 1B6BA 4JLYA 3DSBA 4UA3A 3WR7A 4L89A 1CG2A 1FNOA 1V0CA 1EE3P 4UEZA 4M85A 3FF3A 1ZO0A 2QIRA 4Y49C 1KUVA 3ISXA 3SXNA 3KR5A 1FY7A 5IB0A 1RXTA 5LRGA 2DPSA 2I00A 3IU1A 4BMHA 1XIXA 3WT4A 3I9SA 5G22A 4NXYA 2DXQA 1OZPA 4UCPA 4CPAA 3JUWA 4KOWA 1TXRA 4K3NA 2YGWA 1IU8A 2ZW5A 3E0KA 4B11A 2EVNA 4XNHC 2Z3PA 4B14A 5KTAA 3WC5A 2ATRA 2VXKA 4II9A 2BCOA 3LODA 4CAEA 4LQGA 4P45A 5LYDA 2ZENA 3GLJA 3KQXA 3D3SA 4J3GA 3S9NA 2C1CA 3K9TA 2PJBA 1UFHA 1P4NA 1YREA 3D4UA 3G8WA 3K2KA 2JEWA 1M4LA 1P0HA 3SXOA 3P2HA 2B4BA 2XEFA 4MRIA 4FBEA 4IAVA 3F8KA 3R9GA 1DE4C 4R3KA 4OMEA 1M44A 3FX6A 5AG7A 2FIWA 4ZYQA 4H2KA 3DLJA 1NMTA 4X3RA 5DS0A 1XJOA 4CGNA 5HMNA 2PJ5A 2ZEGA 3B3WA 5D8NA 2I79A 2P6GA 4F0XA 4QB9A 3D7FA 1LAMA 5KTDA 4B10A 3EO4A 5LYIA 4JXQA 3IWWA 3PFOA 3TTHA 5JQ4A 5LYLA 5C82A 1QSMA 1VGYA 7CPAA 3D67A 2V8DA 2P6FA 4M3SA 3DR8A 1Z5RA 1ZG7A 4AVAA 1YX0A 2ANPA 3KGQA 4JD6A 4NGTA 4P44A 3TOAA 2B3VA 4NF1A 3FIXA 2RC4A 2VL1A 4KS9A 3IIBA 1HDUA 2JDDA 2KCWA 5D29A 5IB9A 1XE4A 3D2MA 1IIDA 4NGSA 3H8FA 5HH1A 4CGPA 2O4HA 1ZLIA 1ELLP 4B5PB 4E0AA 3NE8A 2IQ6A 1ZLHA 3FECA 3VH9A 3WC6A 1X10A 3D2PA 1Y9KA 3QAYA 4AG9A 2H5MA 2O53A 4QBJA
chains in the Genus database with same CATH topology
2F5IA 4KVME 2Q04A 4UWIA 5G21A 4C2XA 4XPKA 1U6MA 1PUAA 1YGHA 2OU2A 1S7LA 3S6HA 4MFJA 2REEA 3P2FA 4HNXB 2VQYA 2CNTA 4MFZA 4KOXA 1R57A 3I3GA 1XF8A 3R9FA 1Z9UA 2R98A 3TO7A 5G20A 1IICA 1QSRA 1MJBA 3PP9A 3MGDA 5H84A 2VZZA 5AG6A 1YK3A 1YR0A 3D8PA 4R57A 4CAFA 4UFXA 4CAVA 4A30A 4GS4A 5J8CA 2CY2A 3QAHA 4KLVA 4MFPA 1XMTA 5E96A 2ZW7A 2VEZA 4OAEA 5FVJA 3TE4A 4C7IA 4U9ZA 3CXSA 3DNSA 3FYNA 3ZZIA 2CNSA 2J8MA 4XPDB 3QB8A 4KVXA 3NE7A 4Q36A 4LX9A 1KZFA 4QUSA 4OADA 4B5PA 4HKFA 3KKWA 2OB0A 4B12A 1Z4RA 4MFKA 3GKRA 2WPWA 2QMLA 3H5ZA 5A27A 4UCMA 2D4OA 2R1IA 2R7HA 3R9EA 3TCVA 2P0WA 4UBRA 3GYAA 2J8RA 4DNCA 5KTCA 4PSXA 1N71A 3FNCA 2VBQA 4ZGYB 1MK4A 5CNPA 2HQYA 3PZJA 4KORA 2AE6A 1YVKA 4K30A 1ON0A 2P6EA 3DR6A 2G0BA 2R8VA 1QSOA 2K5TA 2VI7A 3IGRA 2BSWA 4RI1A 4HNYB 2HUZA 4PK2A 4YFJA 2QECA 1M4DA 2AJ6A 4C2ZA 2PSWA 2J8NA 3G3SA 5EBVA 4X5KA 1QSNA 4KVOE 4QVTA 2Z3OA 3A9LA 4NSQA 3LD2A 3FB3A 5IV0A 4QC6A 4CRYB 2REFA 1Q2DA 3UY5A 1S7FA 3R95A 3W6SA 4XPDC 3C26A 4UWJA 4H89A 3EFAA 5JPHA 2Z10A 2Z3KA 4B5OA 2FT0A 4UFVA 2VZYA 2B4DB 3EXNA 2FS5A 5F47A 2YNCA 4F6AA 4RS2A 1I1DA 4ONUA 2CNMA 2YNCC 3JTKA 2NMTA 3DDDA 4ZBGA 4E8OA 3VWDA 3RYOA 1I21A 2Q4YA 5DWNA 2Z11A 2ZW6A 2D4PA 1XEBA 4UFWA 2BEIA 4CAWA 4KSAA 1M4IA 2Z3NA 2PDOA 4MY3A 3TO9A 4IF5A 4H6UA 2JEVA 1VHSA 4YRHA 1KUYA 4MJ8A 2WPXA 4KOYA 2OH1A 3K9UA 2Q0YA 3FBUA 4KUAA 2PRBA 1CJWA 4A32A 5BWAB 3SHPA 4CAXA 4ORFA 2GIVA 3BJ8A 3FRMA 1Z4EA 4C2YA 5C88A 4R87A 1BO4A 1M1DA 1RO5A 3B8GA 1YVOA 1Y7RA 2FXFA 2CXAA 3BJ7A 2B4DA 2IL4A 4PV6A 4FD4A 5IX3A 2PR8A 4KSFA 4R9MA 1MJ9A 4MY0A 5H86A 2FCKA 2B5GB 4AG7A 1WWZA 4LUAA 1IYKA 2ZW4A 1YLEA 2FIAA 2Z3LA 4CRZB 4KUBA 3W91A 4U9YA 4CYQA 3IU2A 2JDCA 5F46A 3CXPA 5J8FA 2PQ8A 4MFLA 4KOTA 4XPLA 2PC1A 3TT2A 4JXRA 2ARHA 1IYLA 4CYPA 2BUEA 2Z0ZA 2O28A 3N7ZA 3IWGA 4NEXA 4PK3A 1IB1E 1Q2YA 4KOSA 2WUUA 2YNEA 4CYNA 1TIQA 2FL4A 5AG4A 2B3UA 1Q2CA 4R3LA 2JLMA 2B5GA 3H4QA 1SQHA 4H6ZA 3R1KA 5G1ZA 4JWPA 4F0YA 2G3AA 3T90A 2ZXVA 4MBUA 1LRZA 3TFYA 5F48A 4KLWA 5A28A 3S6KA 4PSWA 2Q44A 4A31A 4A95A 4BBHA 1J4JA 1WK4A 3BLNA 4EVYA 3S6GA 1QSTA 4A2ZA 5DWMA 1B87A 1I12A 3GY9A 2YNDA 5F49A 4KOUA 1S3ZA 1NE9A 2OZHA 4AB7A 2X7BA 4Y49B 4C68A 4AVCA 4CGMA 4KZTA 3VWEA 2EUIA 1KUXA 2BL1A 2Z3MA 4IUSA 3W6XA 2HV2A 1S7KA 3ZJ0A 3IWEA 2WSAA 1PU9A 1S7NA 1L0CA 2C27A 3V8IA 2FE7A 2GE3A 2Q4VA 4CYOA 4OLLA 3TO6A 3CXQA 3TOBA 1Y9WA 3EC4A 4A33A 1S60A 4FD6A 4CS0B 3S6FA 2OZUA 4XNHB 1M4GA 1VKCA 4KOVA 4FD5A 4NCZA 3R96A 1K4JA 5GCNA 4UCNA 3F5BA 2FSRA 2DPTA 3PGPA 2B58A 4Q38A 2GANA 5EC4A 4HNWB 3EY5A 2ZPAA 3T9YA 1MJAA 2Q7BA 1NSLA 4MFQA 5AGEA 4B13A 2Y0MA 4FD7A 3FXTA 5AG5A 2PR1A 1S5KA 4CGLA 4U5YA 4AVBA 5I0CA 4C7HA 4MHDA 4CGOA 1CM0A 4MI4A 3JVNA 5ISVA 3OWCA 4E2AA 1GHEA 3F0AA 2OZGA 4JJXA 4L8AA 2A4NA 4I49A 4YGOA 2G3TA 1BOBA 4UA3A 1B6BA 4JLYA 3DSBA 3WR7A 4L89A 1V0CA 4M85A 1ZO0A 2QIRA 4Y49C 1KUVA 3SXNA 5IB0A 1FY7A 1RXTA 2DPSA 2I00A 3IU1A 4BMHA 1XIXA 3I9SA 5G22A 4NXYA 2DXQA 1OZPA 4UCPA 3JUWA 4KOWA 2YGWA 2ZW5A 3E0KA 4B11A 2EVNA 4XNHC 2Z3PA 4B14A 5KTAA 2ATRA 2VXKA 4II9A 3LODA 4CAEA 3D3SA 4J3GA 1UFHA 1P4NA 1YREA 3G8WA 1P0HA 3SXOA 3P2HA 2B4BA 3F8KA 3R9GA 4R3KA 1M44A 5AG7A 2FIWA 1NMTA 4CGNA 5HMNA 2I79A 2P6GA 4F0XA 4QB9A 5KTDA 4B10A 3EO4A 4JXQA 5JQ4A 3TTHA 5C82A 1QSMA 2P6FA 4M3SA 3DR8A 4AVAA 1YX0A 4JD6A 3TOAA 2B3VA 4NF1A 3FIXA 2RC4A 4KS9A 2JDDA 2KCWA 1XE4A 3D2MA 1IIDA 4CGPA 5HH1A 4E0AA 4B5PB 3D2PA 1Y9KA 4AG9A 2H5MA 4QBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A30 A;  5A27 A;  4UCM A;  5G1Z A;  4C2X A;  5G21 A;  4A33 A;  4A32 A;  3IU1 A;  4CGL A;  4CYQ A;  2YND A;  5G22 A;  4C7H A;  4CGO A;  4C2Y A;  4C7I A;  2WUU A;  4UCP A;  2YNE A;  5AG7 A;  3IU2 A;  4UFV A;  4UCN A;  4C2Z A;  4UFW A;  4CGN A;  4C68 A;  5A28 A;  3H5Z A;  4CGM A;  4B11 A;  5G20 A;  4A31 A;  2YNC A;  4A95 A;  4B14 A;  4BBH A;  4CGP A;  4CYN A;  5AG6 A;  5AG4 A;  3IWE A;  5AGE A;  2WSA A;  4B13 A;  4CAE A;  4B10 A;  4B12 A;  2YNC C;  4CYP A;  5AG5 A;  4CAF A;  4A2Z A;  4CYO A;  3JTK A;  4UFX A; 
#chains in the Genus database with same CATH topology
 4MMO A;  2F5I A;  3NA6 A;  4MHN A;  2GFQ A;  2Q04 A;  4KVM E;  4UWI A;  5G21 A;  4C2X A;  2EBJ A;  3S9L A;  4XPK A;  3LAC A;  1U6M A;  4P4E A;  1PUA A;  1YGH A;  2OU2 A;  1S7L A;  3S6H A;  1XMB A;  4MFJ A;  3SI0 A;  2REE A;  3IEH A;  3P2F A;  4HNX B;  2AFM A;  2VQY A;  1Y7E A;  2CNT A;  4MFZ A;  4KOX A;  1R57 A;  3IC1 A;  2ZEF A;  1XF8 A;  3I3G A;  3R9F A;  2C6G A;  3I1U A;  1Z9U A;  2R98 A;  3FMC A;  3TO7 A;  5G20 A;  1IIC A;  1QSR A;  1MJB A;  3PP9 A;  3MGD A;  5H84 A;  4PXC A;  2RB7 A;  2VZZ A;  4O23 A;  5AG6 A;  1YK3 A;  4Z65 A;  1A2Z A;  1XRY A;  3B3C A;  4P4J A;  1YR0 A;  3MRU A;  3D8P A;  5ELY A;  4R57 A;  4CAF A;  4UFX A;  4CAV A;  4A30 A;  4ZY0 A;  4GS4 A;  5J8C A;  3NH8 A;  2CY2 A;  3FJU A;  3QAH A;  5I0C A;  1LFW A;  3BHX A;  4KLV A;  1R43 A;  4MFP A;  1XMT A;  4MCS A;  5E96 A;  2ZW7 A;  2VEZ A;  4OAE A;  5FVJ A;  4P6Y A;  2AFU A;  4NGQ A;  3TE4 A;  3KL9 A;  4C7I A;  4WJB A;  4U9Z A;  3PB6 X;  3CXS A;  5LRJ A;  5LYF A;  3VAR A;  2PIY A;  4OID A;  3DNS A;  2GLF A;  2F8H A;  3FYN A;  3KAS A;  3ZZI A;  2CNS A;  3JRU A;  2J8M A;  4XPD B;  3QB8 A;  4NGP A;  2PJ7 A;  3PFE A;  4KVX A;  1JWQ A;  3NE7 A;  4NJR A;  1UWY A;  1KZF A;  4LX9 A;  4Q36 A;  4OAD A;  2ZOG A;  4QUS A;  4HKF A;  3RO0 A;  3KKW A;  3SJG A;  4B5P A;  4ZY1 A;  1TF8 A;  2OB0 A;  4B12 A;  1Z4R A;  2FVG A;  4MFK A;  2EWB A;  3GKR A;  1NSA A;  2WPW A;  3VAT A;  2QML A;  3H5Z A;  1H8L A;  1IY7 A;  5J1Q A;  5A27 A;  4JYW A;  4UCM A;  2D4O A;  4W9Y A;  4M6G A;  2R1I A;  2R7H A;  4RN7 A;  3R9E A;  2P0W A;  1TKH A;  4UBR A;  3GYA A;  3RAM A;  3TCV A;  4B6Z A;  2J8R A;  1Z8L A;  3LMS A;  5HXD A;  4DNC A;  5KTC A;  4PSX A;  1N71 A;  1F2O A;  1ARL A;  2Q43 A;  4Q7A A;  1F57 A;  3FNC A;  1XOV A;  2VBQ A;  4ZGY B;  1MK4 A;  2PJ0 A;  5CNP A;  3D66 A;  2HQY A;  3PZJ A;  2G9D A;  2NYQ A;  2PJ9 A;  4F9V A;  2EO8 A;  2ABZ A;  3B35 A;  3PB4 X;  4KOR A;  2C6P A;  2AE6 A;  1YW4 A;  1YVK A;  4MXU A;  1YQE A;  4OC4 A;  4K30 A;  4NGR A;  1R3N A;  1ON0 A;  2P6E A;  3DR6 A;  2G0B A;  4HPS A;  2R8V A;  2IMO A;  1QSO A;  2CTB A;  2K5T A;  4MHP A;  2VI7 A;  4BD9 A;  1YME A;  2ZEP A;  3IGR A;  2ZEO A;  5CPA A;  2RFH A;  5THW A;  2BSW A;  4RI1 A;  4EME A;  4EWT A;  4ZX8 A;  4JZ0 A;  4MHZ A;  5K8O A;  2ZED A;  3ISZ A;  4HNY B;  4LQ6 A;  2HUZ A;  4F9U A;  4PK2 A;  4X2T A;  4YFJ A;  2QEC A;  1M4D A;  4ZX9 A;  2AJ6 A;  4C2Z A;  2PSW A;  1HEE A;  2J8N A;  5EMI A;  3G3S A;  3CZX A;  5EBV A;  4R8F A;  1QSN A;  2GLJ A;  4X5K A;  4KVO E;  4P4D A;  4QVT A;  3KI9 A;  2Z3O A;  5K8P A;  1LOK A;  3A9L A;  3D7D A;  4NSQ A;  3LD2 A;  4OC2 A;  3FB3 A;  3SI1 A;  4G1P A;  3V38 A;  5IV0 A;  4QC6 A;  4CRY B;  4UIA A;  2REF A;  1Q2D A;  3UY5 A;  1S7F A;  3R95 A;  3W6S A;  4XPD C;  3C26 A;  4PXE A;  3H8E A;  4UWJ A;  3CT9 A;  1X12 A;  4H89 A;  2CF4 A;  1VHO A;  3EFA A;  4M6H A;  4MCP A;  5JPH A;  5K8N A;  2Q7S A;  2Z10 A;  2Z3K A;  4B5O A;  2FT0 A;  4UFV A;  1IOF A;  1AYE A;  2VZY A;  3CDX A;  2B4D B;  2V8V A;  4YU9 A;  1Z2L A;  1ELM P;  3EXN A;  1Z8W A;  4R7M A;  4ZY2 A;  2FS5 A;  5F47 A;  2YNC A;  4AXV A;  3CPA A;  4F6A A;  2HC9 A;  3BI0 A;  1ZG9 A;  2WYR A;  4OP4 A;  3PBB A;  3V7Z A;  4RS2 A;  3PRT A;  1I1D A;  2JBK A;  1KWM A;  4ONU A;  2CNM A;  1VIX A;  2YNC C;  4DUK A;  2AFW A;  1Z8T A;  2J9A A;  3JTK A;  2NMT A;  3DDD A;  2ZEM A;  3D7H A;  4ZBG A;  2PJC A;  4E8O A;  3WAB A;  3B3T A;  2DF5 A;  3VWD A;  3RYO A;  1I21 A;  1BAV A;  2Q4Y A;  5DWN A;  4YWY A;  2Z11 A;  1ARM A;  2ZW6 A;  4ONW A;  2D4P A;  1XEB A;  2Q4Z A;  3BXM A;  4UFW A;  4TWE A;  2BEI A;  4CAW A;  4KSA A;  1M4I A;  2Z3N A;  2PDO A;  5I4M A;  4MY3 A;  3SJE A;  2PJ3 A;  4IF5 A;  4H6U A;  3TO9 A;  2JEV A;  1F2P A;  1VHS A;  4YRH A;  4ZI6 A;  1KUY A;  1LCP A;  4OC5 A;  4A94 A;  4MJ8 A;  2WPX A;  1PYT B;  4KOY A;  5LRK A;  4GM5 A;  1TKJ A;  2AFS A;  2OH1 A;  2Q0Y A;  3K9U A;  3FBU A;  4KUA A;  2PRB A;  5JH9 A;  1CJW A;  4A32 A;  5BWA B;  2CTC A;  4UEE A;  3DGV A;  3SHP A;  2PJ4 A;  4P10 A;  2PVW A;  1BPM A;  3D68 A;  4X8I A;  4CAX A;  4ORF A;  2GIV A;  3BJ8 A;  3FRM A;  1Z4E A;  4P4F A;  1YLO A;  4R87 A;  4C2Y A;  5C88 A;  1BO4 A;  1M1D A;  1RO5 A;  3IO1 A;  4RUH A;  4OC1 A;  3B8G A;  4PXB A;  1CP7 A;  3L2N A;  1YVO A;  4UF4 A;  3KZW A;  1Y7R A;  2FXF A;  2CXA A;  3BJ7 A;  2B4D A;  2IL4 A;  4IHM A;  4FD4 A;  2IJZ A;  4NGN A;  3D7G A;  4PV6 A;  2PR8 A;  4KSF A;  3KR4 A;  2V77 A;  4R9M A;  1BLL E;  1HDQ A;  1MJ9 A;  3GB0 A;  4MY0 A;  5H86 A;  2FCK A;  2B5G B;  4AG7 A;  1WWZ A;  4LUA A;  2QJ8 A;  2ZOF A;  1YW6 A;  5HVF A;  1IYK A;  1Y0Y A;  1RTQ A;  1XBU A;  2F7V A;  2ZW4 A;  3T8W A;  1YLE A;  2FIA A;  2ODF A;  2Z3L A;  3HLP A;  3RBU A;  4CRZ B;  1IGB A;  2I3C A;  4MCR A;  4KUB A;  3W91 A;  3N5F A;  4U9Y A;  4CYQ A;  3SJF A;  1Y0R A;  3IU2 A;  2JDC A;  2EK8 A;  5F46 A;  4MHY A;  3NH5 A;  3HUV A;  3CXP A;  2PIZ A;  1LAN A;  5J8F A;  2PRQ A;  1YSJ A;  1TKF A;  2PQ8 A;  2PJ8 A;  1DTD A;  4MFL A;  4KOT A;  4XPL A;  1LAP A;  2PC1 A;  2PJ1 A;  3TT2 A;  4FAI A;  4JXR A;  1FT7 A;  4NJQ A;  4R6T A;  2ARH A;  1IYL A;  4OKO A;  3QNV A;  3RZA A;  4CYP A;  2BUE A;  2Z0Z A;  2O28 A;  3SJX A;  3N7Z A;  1CPS A;  3IWG A;  4BIN A;  4NEX A;  4PK3 A;  1IB1 E;  1Q2Y A;  4MCQ A;  1XFO A;  4IK2 A;  1Q7L A;  4KOS A;  2POK A;  2WUU A;  2YNE A;  3PB9 X;  2WZN A;  4OC0 A;  5F09 A;  4CYN A;  4UEF A;  1TIQ A;  2XEI A;  2FL4 A;  5AG4 A;  5IX3 A;  4PXD A;  1Z8X A;  2B3U A;  4EFD A;  1Q2C A;  4R3L A;  2JLM A;  2B5G A;  3H4Q A;  1SQH A;  2XEJ A;  4NGM A;  4A38 A;  4H6Z A;  3R1K A;  1PCA A;  5G1Z A;  4JWP A;  4F0Y A;  3LWU A;  3GIU A;  3B3V A;  2PJ2 A;  2G3A A;  3T90 A;  2ZXV A;  4MBU A;  1LRZ A;  3TFY A;  5F48 A;  3FVL A;  3NFZ A;  3TX8 A;  4KLW A;  5A28 A;  3S6K A;  4PSW A;  2AFX A;  2Q44 A;  4A31 A;  4A95 A;  4BBH A;  1J4J A;  1WK4 A;  2HB6 A;  1JQG A;  3BLN A;  4DJL A;  3RNZ A;  4EVY A;  4A39 A;  4PQA A;  4DYO A;  1ZG8 A;  3S6G A;  5JM6 A;  3MN8 A;  1QST A;  4A2Z A;  5DWM A;  2PVV A;  3KHX A;  1B87 A;  3PB7 X;  2JBJ A;  1I12 A;  3H8G A;  3B7I A;  4P4I A;  3GY9 A;  2ZEH A;  1AMP A;  2YND A;  5F49 A;  4NFR A;  1IOI A;  4KOU A;  2OZH A;  1S3Z A;  1NE9 A;  4AB7 A;  2X7B A;  4P4B A;  4Y49 B;  2PJA A;  3BI1 A;  4C68 A;  4AVC A;  3S9M A;  4CGM A;  4KZT A;  1BPN A;  2ZEL A;  4TNU A;  3B3S A;  3VWE A;  4KSI A;  3IFE A;  2AFO A;  2EUI A;  1KUX A;  1CX8 A;  2BL1 A;  2Z3M A;  4IUS A;  2HV2 A;  3W6X A;  1S7K A;  4OIW A;  3ZJ0 A;  3IWE A;  3IJ3 A;  4GXH A;  2WSA A;  5HVH A;  1PU9 A;  1S7N A;  1L0C A;  2C27 A;  3V8I A;  2PJ6 A;  2FE7 A;  2BOA A;  2GE3 A;  2OOT A;  2Q4V A;  4CYO A;  4OLL A;  3TO6 A;  3GUX A;  4F8Z A;  3CXQ A;  4OC3 A;  3TOB A;  1Y9W A;  3EC4 A;  3PBE A;  1OBR A;  1S60 A;  4FD6 A;  4A33 A;  3SI2 A;  4CS0 B;  1TF9 A;  3S6F A;  5JGF A;  2OZU A;  4XNH B;  3TC8 A;  1M4G A;  1VKC A;  4FWU A;  3KQZ A;  4KOV A;  4FD5 A;  2XEG A;  4NCZ A;  2V8G A;  2V8H A;  3R96 A;  1K4J A;  5GCN A;  3WC7 A;  4UCN A;  3F5B A;  8CPA A;  2FSR A;  2DPT A;  6CPA A;  3PGP A;  2B58 A;  4Q38 A;  2GAN A;  2ZEE A;  3PB8 X;  5EC4 A;  4HNW B;  3EY5 A;  4R76 A;  2ZPA A;  3FED A;  3T9Y A;  2OR4 A;  2GU2 A;  1MJA A;  2PCU A;  2Q7B A;  2QYV A;  1NSL A;  4A37 A;  2C6C A;  2AFZ A;  4MFQ A;  5AGE A;  4B13 A;  2BO9 A;  3NH4 A;  4M6I A;  4PPZ A;  1QQ9 A;  2Y0M A;  4FD7 A;  1QMU A;  3FXT A;  5AG5 A;  3FH4 A;  2NSM A;  2Q51 A;  2GRE A;  2DEA A;  2CIJ A;  5CBM A;  2PR1 A;  4UIB A;  2PE3 A;  2EK9 A;  1S5K A;  1CP6 A;  4CGL A;  4U5Y A;  3KHZ A;  4AVB A;  4C7H A;  1CBX A;  4MHD A;  1CM0 A;  4MI4 A;  4CGO A;  5HVG A;  3JVN A;  4FUU A;  1GYT A;  5ISV A;  3OWC A;  4E2A A;  1GHE A;  3F0A A;  2OZG A;  4JJX A;  4L8A A;  2A4N A;  4I49 A;  4WWV A;  3PEI A;  3CPX A;  2G3T A;  2QVP A;  3B2Y A;  3FEE A;  4YGO A;  5K8M A;  1AUG A;  1BOB A;  1CPX A;  1VHE A;  1B6B A;  4JLY A;  3DSB A;  4UA3 A;  3WR7 A;  4L89 A;  1CG2 A;  1FNO A;  1V0C A;  1EE3 P;  4UEZ A;  4M85 A;  3FF3 A;  1ZO0 A;  2QIR A;  4Y49 C;  1KUV A;  3ISX A;  3SXN A;  3KR5 A;  1FY7 A;  5IB0 A;  1RXT A;  5LRG A;  2DPS A;  2I00 A;  3IU1 A;  4BMH A;  1XIX A;  3WT4 A;  3I9S A;  5G22 A;  4NXY A;  2DXQ A;  1OZP A;  4UCP A;  4CPA A;  3JUW A;  4KOW A;  1TXR A;  4K3N A;  2YGW A;  1IU8 A;  2ZW5 A;  3E0K A;  4B11 A;  2EVN A;  4XNH C;  2Z3P A;  4B14 A;  5KTA A;  3WC5 A;  2ATR A;  2VXK A;  4II9 A;  2BCO A;  3LOD A;  4CAE A;  4LQG A;  4P45 A;  5LYD A;  2ZEN A;  3GLJ A;  3KQX A;  3D3S A;  4J3G A;  3S9N A;  2C1C A;  3K9T A;  2PJB A;  1UFH A;  1P4N A;  1YRE A;  3D4U A;  3G8W A;  3K2K A;  2JEW A;  1M4L A;  1P0H A;  3SXO A;  3P2H A;  2B4B A;  2XEF A;  4MRI A;  4FBE A;  4IAV A;  3F8K A;  3R9G A;  1DE4 C;  4R3K A;  4OME A;  1M44 A;  3FX6 A;  5AG7 A;  2FIW A;  4ZYQ A;  4H2K A;  3DLJ A;  1NMT A;  4X3R A;  5DS0 A;  1XJO A;  4CGN A;  5HMN A;  2PJ5 A;  2ZEG A;  3B3W A;  5D8N A;  2I79 A;  2P6G A;  4F0X A;  4QB9 A;  3D7F A;  1LAM A;  5KTD A;  4B10 A;  3EO4 A;  5LYI A;  4JXQ A;  3IWW A;  3PFO A;  3TTH A;  5JQ4 A;  5LYL A;  5C82 A;  1QSM A;  1VGY A;  7CPA A;  3D67 A;  2V8D A;  2P6F A;  4M3S A;  3DR8 A;  1Z5R A;  1ZG7 A;  4AVA A;  1YX0 A;  2ANP A;  3KGQ A;  4JD6 A;  4NGT A;  4P44 A;  3TOA A;  2B3V A;  4NF1 A;  3FIX A;  2RC4 A;  2VL1 A;  4KS9 A;  3IIB A;  1HDU A;  2JDD A;  2KCW A;  5D29 A;  5IB9 A;  1XE4 A;  3D2M A;  1IID A;  4NGS A;  3H8F A;  5HH1 A;  4CGP A;  2O4H A;  1ZLI A;  1ELL P;  4B5P B;  4E0A A;  3NE8 A;  2IQ6 A;  1ZLH A;  3FEC A;  3VH9 A;  3WC6 A;  1X10 A;  3D2P A;  1Y9K A;  3QAY A;  4AG9 A;  2H5M A;  2O53 A;  4QBJ A; 
#chains in the Genus database with same CATH homology
 2F5I A;  4KVM E;  2Q04 A;  4UWI A;  5G21 A;  4C2X A;  4XPK A;  1U6M A;  1PUA A;  1YGH A;  2OU2 A;  1S7L A;  3S6H A;  4MFJ A;  2REE A;  3P2F A;  4HNX B;  2VQY A;  2CNT A;  4MFZ A;  4KOX A;  1R57 A;  3I3G A;  1XF8 A;  3R9F A;  1Z9U A;  2R98 A;  3TO7 A;  5G20 A;  1IIC A;  1QSR A;  1MJB A;  3PP9 A;  3MGD A;  5H84 A;  2VZZ A;  5AG6 A;  1YK3 A;  1YR0 A;  3D8P A;  4R57 A;  4CAF A;  4UFX A;  4CAV A;  4A30 A;  4GS4 A;  5J8C A;  2CY2 A;  3QAH A;  4KLV A;  4MFP A;  1XMT A;  5E96 A;  2ZW7 A;  2VEZ A;  4OAE A;  5FVJ A;  3TE4 A;  4C7I A;  4U9Z A;  3CXS A;  3DNS A;  3FYN A;  3ZZI A;  2CNS A;  2J8M A;  4XPD B;  3QB8 A;  4KVX A;  3NE7 A;  4Q36 A;  4LX9 A;  1KZF A;  4QUS A;  4OAD A;  4B5P A;  4HKF A;  3KKW A;  2OB0 A;  4B12 A;  1Z4R A;  4MFK A;  3GKR A;  2WPW A;  2QML A;  3H5Z A;  5A27 A;  4UCM A;  2D4O A;  2R1I A;  2R7H A;  3R9E A;  3TCV A;  2P0W A;  4UBR A;  3GYA A;  2J8R A;  4DNC A;  5KTC A;  4PSX A;  1N71 A;  3FNC A;  2VBQ A;  4ZGY B;  1MK4 A;  5CNP A;  2HQY A;  3PZJ A;  4KOR A;  2AE6 A;  1YVK A;  4K30 A;  1ON0 A;  2P6E A;  3DR6 A;  2G0B A;  2R8V A;  1QSO A;  2K5T A;  2VI7 A;  3IGR A;  2BSW A;  4RI1 A;  4HNY B;  2HUZ A;  4PK2 A;  4YFJ A;  2QEC A;  1M4D A;  2AJ6 A;  4C2Z A;  2PSW A;  2J8N A;  3G3S A;  5EBV A;  4X5K A;  1QSN A;  4KVO E;  4QVT A;  2Z3O A;  3A9L A;  4NSQ A;  3LD2 A;  3FB3 A;  5IV0 A;  4QC6 A;  4CRY B;  2REF A;  1Q2D A;  3UY5 A;  1S7F A;  3R95 A;  3W6S A;  4XPD C;  3C26 A;  4UWJ A;  4H89 A;  3EFA A;  5JPH A;  2Z10 A;  2Z3K A;  4B5O A;  2FT0 A;  4UFV A;  2VZY A;  2B4D B;  3EXN A;  2FS5 A;  5F47 A;  2YNC A;  4F6A A;  4RS2 A;  1I1D A;  4ONU A;  2CNM A;  2YNC C;  3JTK A;  2NMT A;  3DDD A;  4ZBG A;  4E8O A;  3VWD A;  3RYO A;  1I21 A;  2Q4Y A;  5DWN A;  2Z11 A;  2ZW6 A;  2D4P A;  1XEB A;  4UFW A;  2BEI A;  4CAW A;  4KSA A;  1M4I A;  2Z3N A;  2PDO A;  4MY3 A;  3TO9 A;  4IF5 A;  4H6U A;  2JEV A;  1VHS A;  4YRH A;  1KUY A;  4MJ8 A;  2WPX A;  4KOY A;  2OH1 A;  3K9U A;  2Q0Y A;  3FBU A;  4KUA A;  2PRB A;  1CJW A;  4A32 A;  5BWA B;  3SHP A;  4CAX A;  4ORF A;  2GIV A;  3BJ8 A;  3FRM A;  1Z4E A;  4C2Y A;  5C88 A;  4R87 A;  1BO4 A;  1M1D A;  1RO5 A;  3B8G A;  1YVO A;  1Y7R A;  2FXF A;  2CXA A;  3BJ7 A;  2B4D A;  2IL4 A;  4PV6 A;  4FD4 A;  5IX3 A;  2PR8 A;  4KSF A;  4R9M A;  1MJ9 A;  4MY0 A;  5H86 A;  2FCK A;  2B5G B;  4AG7 A;  1WWZ A;  4LUA A;  1IYK A;  2ZW4 A;  1YLE A;  2FIA A;  2Z3L A;  4CRZ B;  4KUB A;  3W91 A;  4U9Y A;  4CYQ A;  3IU2 A;  2JDC A;  5F46 A;  3CXP A;  5J8F A;  2PQ8 A;  4MFL A;  4KOT A;  4XPL A;  2PC1 A;  3TT2 A;  4JXR A;  2ARH A;  1IYL A;  4CYP A;  2BUE A;  2Z0Z A;  2O28 A;  3N7Z A;  3IWG A;  4NEX A;  4PK3 A;  1IB1 E;  1Q2Y A;  4KOS A;  2WUU A;  2YNE A;  4CYN A;  1TIQ A;  2FL4 A;  5AG4 A;  2B3U A;  1Q2C A;  4R3L A;  2JLM A;  2B5G A;  3H4Q A;  1SQH A;  4H6Z A;  3R1K A;  5G1Z A;  4JWP A;  4F0Y A;  2G3A A;  3T90 A;  2ZXV A;  4MBU A;  1LRZ A;  3TFY A;  5F48 A;  4KLW A;  5A28 A;  3S6K A;  4PSW A;  2Q44 A;  4A31 A;  4A95 A;  4BBH A;  1J4J A;  1WK4 A;  3BLN A;  4EVY A;  3S6G A;  1QST A;  4A2Z A;  5DWM A;  1B87 A;  1I12 A;  3GY9 A;  2YND A;  5F49 A;  4KOU A;  1S3Z A;  1NE9 A;  2OZH A;  4AB7 A;  2X7B A;  4Y49 B;  4C68 A;  4AVC A;  4CGM A;  4KZT A;  3VWE A;  2EUI A;  1KUX A;  2BL1 A;  2Z3M A;  4IUS A;  3W6X A;  2HV2 A;  1S7K A;  3ZJ0 A;  3IWE A;  2WSA A;  1PU9 A;  1S7N A;  1L0C A;  2C27 A;  3V8I A;  2FE7 A;  2GE3 A;  2Q4V A;  4CYO A;  4OLL A;  3TO6 A;  3CXQ A;  3TOB A;  1Y9W A;  3EC4 A;  4A33 A;  1S60 A;  4FD6 A;  4CS0 B;  3S6F A;  2OZU A;  4XNH B;  1M4G A;  1VKC A;  4KOV A;  4FD5 A;  4NCZ A;  3R96 A;  1K4J A;  5GCN A;  4UCN A;  3F5B A;  2FSR A;  2DPT A;  3PGP A;  2B58 A;  4Q38 A;  2GAN A;  5EC4 A;  4HNW B;  3EY5 A;  2ZPA A;  3T9Y A;  1MJA A;  2Q7B A;  1NSL A;  4MFQ A;  5AGE A;  4B13 A;  2Y0M A;  4FD7 A;  3FXT A;  5AG5 A;  2PR1 A;  1S5K A;  4CGL A;  4U5Y A;  4AVB A;  5I0C A;  4C7H A;  4MHD A;  4CGO A;  1CM0 A;  4MI4 A;  3JVN A;  5ISV A;  3OWC A;  4E2A A;  1GHE A;  3F0A A;  2OZG A;  4JJX A;  4L8A A;  2A4N A;  4I49 A;  4YGO A;  2G3T A;  1BOB A;  4UA3 A;  1B6B A;  4JLY A;  3DSB A;  3WR7 A;  4L89 A;  1V0C A;  4M85 A;  1ZO0 A;  2QIR A;  4Y49 C;  1KUV A;  3SXN A;  5IB0 A;  1FY7 A;  1RXT A;  2DPS A;  2I00 A;  3IU1 A;  4BMH A;  1XIX A;  3I9S A;  5G22 A;  4NXY A;  2DXQ A;  1OZP A;  4UCP A;  3JUW A;  4KOW A;  2YGW A;  2ZW5 A;  3E0K A;  4B11 A;  2EVN A;  4XNH C;  2Z3P A;  4B14 A;  5KTA A;  2ATR A;  2VXK A;  4II9 A;  3LOD A;  4CAE A;  3D3S A;  4J3G A;  1UFH A;  1P4N A;  1YRE A;  3G8W A;  1P0H A;  3SXO A;  3P2H A;  2B4B A;  3F8K A;  3R9G A;  4R3K A;  1M44 A;  5AG7 A;  2FIW A;  1NMT A;  4CGN A;  5HMN A;  2I79 A;  2P6G A;  4F0X A;  4QB9 A;  5KTD A;  4B10 A;  3EO4 A;  4JXQ A;  5JQ4 A;  3TTH A;  5C82 A;  1QSM A;  2P6F A;  4M3S A;  3DR8 A;  4AVA A;  1YX0 A;  4JD6 A;  3TOA A;  2B3V A;  4NF1 A;  3FIX A;  2RC4 A;  4KS9 A;  2JDD A;  2KCW A;  1XE4 A;  3D2M A;  1IID A;  4CGP A;  5HH1 A;  4E0A A;  4B5P B;  3D2P A;  1Y9K A;  4AG9 A;  2H5M A;  4QBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...