2YNEA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
384
structure length
384
Chain Sequence
b'DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yneA00
4BBHA 4CGPA 4CGLA 4A31A 4UFVA 2YNDA 2YNCA 4UFXA 4B10A 4UCPA 4C7IA 4UFWA 5AG6A 4A30A 2WUUA 5AG7A 5AG5A 3IU2A 5G22A 4CYNA 4UCMA 5A27A 5G1ZA 2WSAA 3IWEA 4CYPA 4CAFA 4A32A 4B11A 4C2XA 4A95A 5G20A 4B12A 4A2ZA 4C2YA 4CAEA 5A28A 3H5ZA 4UCNA 5AG4A 5G21A 3JTKA 4A33A 5AGEA 2YNCC 4CYQA 4B14A 4CGMA 4B13A 4C7HA 2YNEA 4CGNA 4CGOA 3IU1A 4C2ZA 4C68A 4CYOA
chains in the Genus database with same CATH superfamily
2GE3A 1IGBA 5DWMA 4F9UA 3BJ7A 5LYIA 3PB9X 4NGQA 5I4MA 5H84A 4AXVA 2ZPAA 2PE3A 2GANA 2AFSA 1P4NA 4F6AA 1LAMA 4KOVA 2OU2A 5GCNA 5IB0A 1CX8A 4PQAA 4MFJA 4DYOA 5K8NA 4NF1A 3W6SA 5F48A 3TE4A 4FWUA 1LCPA 3FECA 1YLOA 2HQYA 4O23A 4Q36A 3I1UA 1VHSA 4A2ZA 3KI9A 2AFZA 1IOFA 2Q04A 4UCNA 3S9LA 2Z10A 2CNMA 1I12A 4P45A 1IIDA 5AGEA 3CXSA 3FYNA 1KZFA 2OZHA 4MJ8A 1RXTA 4UWIA 4DUKA 3TFYA 3BJ8A 3FIXA 1TKJA 4BBHA 4ORFA 2J8MA 5JQ4A 4KVXA 1TXRA 3WC5A 4ZY2A 3PB4X 5J8CA 4B10A 3B3CA 3F0AA 3IGRA 2P6GA 4R8FA 4UFWA 4LX9A 3BI0A 5AG6A 3IFEA 3SXOA 5G1ZA 4R7MA 1M4GA 1ZG9A 1OZPA 1YVKA 2EK9A 3VH9A 4FUUA 4HPSA 1NSAA 5FVJA 2PRBA 4NJQA 2ZXVA 2PJ5A 1Q7LA 1YSJA 2IJZA 2RB7A 3JVNA 1YR0A 4X3RA 4G1PA 1Z4RA 3H8EA 2XEGA 3D68A 4Y49B 3F5BA 4CGNA 5K8MA 2AFUA 1VGYA 2PR8A 2PSWA 3MGDA 2Q51A 2ZOGA 2WPXA 4CGPA 3NFZA 4PSXA 2VZYA 1VIXA 3FRMA 1CBXA 2Q44A 3DNSA 4E8OA 1RO5A 2EVNA 4E2AA 2B3VA 3PFOA 1LAPA 4KUBA 4YRHA 1A2ZA 3TOBA 5LRJA 2OOTA 2P6EA 5F46A 3LODA 4UEEA 2FIAA 1KUVA 4CPAA 2RC4A 5EMIA 4F0XA 1YVOA 3TO9A 1TIQA 1ON0A 3D7FA 3CPAA 1F2OA 4JWPA 2WPWA 4KS9A 2PJ6A 3R9EA 3TO6A 1J4JA 3JTKA 2YNCC 2BSWA 4P4FA 3EC4A 4B5OA 3PGPA 5HVGA 2BUEA 4C7HA 2PIZA 1BOBA 1S60A 1ELLP 4KOXA 1Y0YA 3B8GA 3CXPA 4I49A 1LFWA 1DTDA 3PP9A 4FD6A 3NH8A 1CM0A 3IIBA 3KHXA 4PXBA 5C88A 4ZI6A 2OB0A 6CPAA 2PDOA 3LMSA 3T8WA 4MI4A 3JUWA 2PVWA 2Q43A 3G8WA 1Z9UA 2C6PA 1XF8A 4KSFA 4DJLA 1BPMA 4FD4A 5C82A 2GIVA 2AFXA 3D67A 3NH4A 2Z3MA 4OC0A 3VARA 2Q7BA 1AUGA 3IO1A 2I3CA 4LQGA 4CAXA 5AG4A 5KTAA 4CYQA 3BHXA 3LACA 4MCPA 2CTBA 4EVYA 4EWTA 3PB7X 5J1QA 1XMTA 2PJ4A 2OH1A 3B35A 5CPAA 1R57A 1VHEA 4MBUA 3RYOA 3V38A 2X7BA 4NEXA 2YGWA 5E96A 5JPHA 3B3TA 4KORA 5K8PA 3FF3A 2CIJA 2EK8A 2HUZA 4HNYB 4R87A 4MHNA 4MY0A 3B2YA 2F8HA 4RI1A 1FY7A 5JH9A 4OC2A 4CAVA 2EUIA 4PSWA 4MMOA 4UCMA 3KQZA 4R57A 2JBKA 5HVFA 1ELMP 3GB0A 4ZBGA 3SJXA 1X10A 3CXQA 3KHZA 1M4DA 4R6TA 4CAEA 1QSOA 2Q0YA 2O28A 2XEIA 1TF9A 2Z3LA 3LWUA 2DEAA 2HB6A 4JXQA 3TOAA 1YLEA 1XFOA 5THWA 2AE6A 1Y7EA 3RBUA 2QVPA 4GXHA 4JYWA 1CP7A 3JRUA 1HEEA 4FD7A 2PIYA 4C68A 4KUAA 2DPTA 4XNHB 2NMTA 2DXQA 5CBMA 1XIXA 3S6KA 1LOKA 2QMLA 2V8HA 2G3TA 1ZO0A 2ZENA 4KLVA 4UWJA 5D29A 3S9NA 3D7GA 2PJ2A 4LUAA 1FT7A 2HV2A 5G22A 2VXKA 2AJ6A 1QSRA 2CNSA 2VBQA 3D2MA 3DLJA 4OAEA 4ZGYB 4UA3A 2Z3PA 4P4BA 2FSRA 4CYPA 4P6YA 4HNXB 3T90A 4IUSA 2ZEEA 3MRUA 3TX8A 5EC4A 2PJBA 2GLFA 2ZW6A 2J9AA 4MY3A 4OLLA 4ONUA 4F9VA 4KOUA 4JXRA 5DWNA 2Z3OA 1Y9KA 4M6IA 5J8FA 1JQGA 4UEZA 2GFQA 2PJ1A 3FEDA 4J3GA 4A38A 4MFZA 2BEIA 4OADA 5I0CA 3QB8A 2ODFA 3KL9A 4Q38A 4NJRA 2DPSA 3FB3A 2EBJA 4NGNA 2PQ8A 5JGFA 1XRYA 3D4UA 4AVCA 1PCAA 4XPDB 1ZLIA 3NE8A 5LYDA 4A30A 2Q4YA 3D2PA 4MCQA 3B7IA 3IU2A 1YW4A 1M44A 2V77A 3KZWA 4NFRA 4P4JA 4R76A 3V8IA 2G3AA 4II9A 3R9GA 2G9DA 3KQXA 3FJUA 3H8FA 2FIWA 3S6FA 4Y49C 1TKFA 1H8LA 2A4NA 2RFHA 2V8VA 2ZEMA 4X8IA 3SXNA 1LRZA 2K5TA 3FNCA 4AB7A 3PZJA 2PJCA 4C2ZA 4ZX9A 3NH5A 4KSAA 3QAHA 4UEFA 4GS4A 4MCRA 2C6CA 2VZZA 2YNCA 3WR7A 1FNOA 1Q2YA 4JJXA 1UWYA 4UCPA 2JEVA 4E0AA 2BOAA 3R95A 4KOSA 1CG2A 4NCZA 4YGOA 2PJ0A 4MHPA 4OIDA 3QNVA 4JZ0A 3CT9A 4QC6A 2ZEGA 1PYTB 2JDCA 5G20A 5A28A 1IOIA 1CPSA 4KVME 3IWWA 2ZELA 1QMUA 3DGVA 4FAIA 4MFKA 5IV0A 2PJ7A 4P10A 1M4IA 3FH4A 4H89A 1L0CA 4IAVA 2EWBA 3SI1A 2BL1A 2ZEPA 1BAVA 2P0WA 2VEZA 2YNEA 3FEEA 4CGLA 4ZY0A 3RNZA 1KUXA 4GM5A 4R3KA 3CZXA 2Q4VA 1ARMA 3CPXA 4LQ6A 7CPAA 2QJ8A 3UY5A 2Z11A 4UBRA 1Z4EA 4K30A 1K4JA 4MHYA 1IYLA 3PB6X 2PJ9A 3IJ3A 1Y9WA 2FCKA 4M85A 4MHZA 4C7IA 4Z65A 1NE9A 2FT0A 2GLJA 2O4HA 2FL4A 3LD2A 3P2FA 2Z3KA 4NXYA 4R9MA 1B87A 2NYQA 5EBVA 1CP6A 4B11A 4C2XA 4C2YA 1I1DA 2ATRA 3D7HA 5HH1A 4MXUA 4YU9A 2FXFA 3HLPA 5K8OA 4AVBA 4OKOA 4FD5A 3ISXA 2I79A 2ZOFA 2GU2A 4EMEA 1PUAA 4IK2A 2OR4A 3E0KA 4NGSA 1XJOA 3SI2A 3V7ZA 1MJAA 2NSMA 3K9TA 4CYOA 1ZG8A 1U6MA 4KSIA 2FVGA 3PRTA 4PK2A 4UF4A 8CPAA 1S3ZA 4OC1A 3K9UA 4AG7A 2EO8A 4UFVA 4L8AA 4OIWA 4MCSA 3TCVA 2XEFA 1Z8WA 1EE3P 4RN7A 3R9FA 2D4OA 2REEA 1Y7RA 4M6HA 5AG5A 5LRKA 3FVLA 5HXDA 5LYLA 2XEJA 5BWAB 2ANPA 1CPXA 4CAFA 1GYTA 3BXMA 2BCOA 2ZW5A 2AFMA 4H6UA 4NGTA 2QIRA 1XE4A 4NGMA 4XNHC 4CS0B 5HVHA 3KR5A 4HKFA 4OC4A 2JLMA 4R3LA 4B6ZA 3RAMA 4PV6A 4M6GA 2R7HA 4AG9A 5LRGA 2FS5A 2VL1A 3I9SA 2JEWA 4XPLA 5F47A 2PVVA 3F8KA 3EFAA 4KZTA 3WT4A 1DE4C 3TC8A 1VKCA 2ARHA 2V8GA 4F0YA 4PK3A 1YMEA 2JBJA 2B58A 1HDUA 2WSAA 3IEHA 2ZEFA 4MRIA 1Q2CA 3DR6A 3L2NA 3PBBA 5F09A 2F7VA 3QAYA 4IF5A 5ELYA 2IQ6A 3SI0A 1HDQA 1AYEA 5G21A 3PB8X 3ZZIA 3S6HA 2P6FA 4RUHA 2ZEDA 1YGHA 1VHOA 3D66A 4P4EA 4ZYQA 4BINA 4CGMA 4XPDC 2HC9A 1IY7A 2B4DB 3K2KA 1BLLE 4YWYA 3TT2A 1S7KA 3VWDA 5LYFA 4W9YA 4P4IA 1Q2DA 4A31A 1N71A 2BO9A 2I00A 1Z8LA 2ZEHA 4UFXA 2Y0MA 2O53A 3BI1A 1IB1E 3PFEA 4WJBA 4K3NA 5DS0A 4OP4A 1JWQA 5HMNA 2VQYA 4UIAA 1TF8A 1BPNA 2V8DA 2G0BA 2OZUA 2B4BA 1QSMA 1QSTA 3DDDA 1XBUA 1AMPA 1RTQA 1S7NA 3DSBA 3IWEA 3TO7A 4F8ZA 1OBRA 2D4PA 4U9YA 3B3WA 2PRQA 4B12A 3G3SA 1S5KA 1Z5RA 2PC1A 4MFLA 2QYVA 3WC7A 4NGRA 5CNPA 1SQHA 1ARLA 2CY2A 3PEIA 4U5YA 3GLJA 1QQ9A 2JDDA 2WZNA 3GYAA 2C27A 3IC1A 4ONWA 3KKWA 1NMTA 4MHDA 1F57A 4OMEA 4BD9A 1TKHA 3D7DA 4B5PA 3S6GA 4RS2A 2DF5A 1ZG7A 3I3GA 3N5FA 4KOWA 2PJ3A 3N7ZA 5AG7A 3W91A 1R3NA 1Z8XA 3KASA 1WK4A 4OC3A 4PXEA 4Q7AA 5KTDA 3R96A 3DR8A 4KOTA 2PR1A 3NE7A 2R1IA 3CDXA 2H5MA 1MK4A 3H5ZA 1YW6A 1YX0A 2J8NA 3IWGA 1I21A 4PXCA 1YREA 4MFQA 3RZAA 1BO4A 1UFHA 3MN8A 4CRYB 4B13A 3D8PA 4OC5A 1QSNA 3HUVA 2R8VA 1CJWA 1KUYA 1S7LA 2ABZA 1IICA 2CF4A 2CNTA 2FE7A 2PCUA 4CGOA 2Q7SA 4X5KA 2IL4A 4IHMA 3FBUA 3WABA 3PBEA 4A37A 5IX3A 4KOYA 4TWEA 4B5PB 4EFDA 5KTCA 2AFWA 3SHPA 2Q4ZA 2B5GA 2WUUA 3FMCA 2F5IA 4U9ZA 4KLWA 2WYRA 3FX6A 2CXAA 1R43A 4HNWB 3A9LA 4A94A 4YFJA 5JM6A 3VWEA 2B3UA 1B6BA 2C1CA 1M4LA 4A33A 3WC6A 3SJFA 2ZEOA 1Z8TA 4P44A 1XEBA 3VATA 1YK3A 3ISZA 2GREA 3H8GA 3IU1A 3NA6A 5D8NA 5ISVA 3P2HA 5F49A 1X12A 3ZJ0A 3B3VA 1WWZA 4PXDA 4ZY1A 2OZGA 1LANA 3SJGA 4UIBA 2AFOA 2Z3NA 2IMOA 2J8RA 3GY9A 5A27A 3W6XA 2R98A 2Z0ZA 2B5GB 3GUXA 3GKRA 4DNCA 1Y0RA 3TTHA 4H2KA 4MFPA 2QECA 4QVTA 1GHEA 4QBJA 3OWCA 4WWVA 1XOVA 4ZX8A 2C6GA 3KGQA 1KWMA 4NGPA 4CAWA 4X2TA 2PJ8A 1ZLHA 3D3SA 1M1DA 4CRZB 3R1KA 4B14A 1PU9A 3EXNA 2B4DA 3EO4A 4TNUA 1NSLA 4NSQA 2ZW4A 4PPZA 3FXTA 5H86A 4XPKA 2POKA 4JD6A 4KVOE 2VI7A 2YNDA 2CTCA 2ZW7A 4M3SA 4FBEA 1F2PA 1XMBA 3RO0A 4AVAA 1MJBA 1IYKA 3EY5A 4CYNA 3SJEA 3H4QA 2PJAA 4L89A 4A32A 1S7FA 4A95A 3KR4A 4H6ZA 4JLYA 3GIUA 4A39A 5IB9A 1YQEA 1P0HA 4P4DA 1IU8A 4QUSA 4BMHA 3T9YA 1MJ9A 3B3SA 3C26A 1V0CA 3S9MA 3BLNA 1Z2LA 4QB9A 2KCWA 2REFA
chains in the Genus database with same CATH topology
2GE3A 5DWMA 3BJ7A 5H84A 2ZPAA 2GANA 1P4NA 4F6AA 4KOVA 2OU2A 5GCNA 5IB0A 4MFJA 4NF1A 3W6SA 5F48A 3TE4A 2HQYA 4Q36A 1VHSA 4A2ZA 2Q04A 4UCNA 2Z10A 2CNMA 1I12A 1IIDA 5AGEA 3CXSA 3FYNA 1KZFA 2OZHA 4MJ8A 1RXTA 4UWIA 3TFYA 3BJ8A 3FIXA 4BBHA 4ORFA 2J8MA 5JQ4A 4KVXA 5J8CA 4B10A 3F0AA 3IGRA 2P6GA 4UFWA 4LX9A 5AG6A 3SXOA 5G1ZA 1M4GA 1OZPA 1YVKA 5FVJA 2PRBA 2ZXVA 3JVNA 1YR0A 1Z4RA 4CGNA 4Y49B 3F5BA 2PR8A 2PSWA 3MGDA 2WPXA 4CGPA 4PSXA 2VZYA 3FRMA 2Q44A 3DNSA 4E8OA 1RO5A 2EVNA 4E2AA 2B3VA 4KUBA 4YRHA 3TOBA 2P6EA 5F46A 3LODA 2FIAA 1KUVA 2RC4A 4F0XA 1YVOA 3TO9A 1TIQA 1ON0A 4JWPA 4KS9A 3R9EA 2WPWA 3TO6A 1J4JA 3JTKA 2YNCC 2BSWA 3EC4A 4B5OA 3PGPA 2BUEA 4C7HA 1BOBA 1S60A 4KOXA 3B8GA 3CXPA 4I49A 3PP9A 4FD6A 1CM0A 5C88A 2OB0A 2PDOA 4MI4A 3JUWA 3G8WA 1Z9UA 1XF8A 4KSFA 4FD4A 5C82A 2GIVA 2Z3MA 2Q7BA 4CAXA 5AG4A 5KTAA 4CYQA 4EVYA 1XMTA 2OH1A 1R57A 3RYOA 4MBUA 2X7BA 4NEXA 2YGWA 5E96A 5JPHA 4KORA 2HUZA 4HNYB 4R87A 4MY0A 4RI1A 1FY7A 4CAVA 2EUIA 4PSWA 4UCMA 4R57A 4ZBGA 3CXQA 1M4DA 4CAEA 1QSOA 2Q0YA 4JXQA 2O28A 2Z3LA 4KOTA 3TOAA 1YLEA 2AE6A 4FD7A 4C68A 4KUAA 2DPTA 4XNHB 2NMTA 2DXQA 1XIXA 3S6KA 2QMLA 2G3TA 1ZO0A 4KLVA 4UWJA 4LUAA 2HV2A 5G22A 2VXKA 2AJ6A 1QSRA 2CNSA 2VBQA 3D2MA 4OAEA 4ZGYB 4UA3A 2Z3PA 4CYPA 2FSRA 4HNXB 3T90A 4IUSA 5EC4A 4MY3A 2ZW6A 4OLLA 4ONUA 4KOUA 4JXRA 5DWNA 2Z3OA 1Y9KA 5J8FA 4J3GA 4MFZA 2BEIA 4OADA 5I0CA 3QB8A 4Q38A 2DPSA 3FB3A 2PQ8A 4AVCA 4XPDB 4A30A 2Q4YA 3D2PA 5AG7A 3IU2A 3V8IA 1M44A 2G3AA 4II9A 3R9GA 2FIWA 3S6FA 4Y49C 2A4NA 3SXNA 1LRZA 2K5TA 3FNCA 4AB7A 3PZJA 4C2ZA 4KSAA 3QAHA 4GS4A 2VZZA 2YNCA 3WR7A 1Q2YA 4JJXA 4UCPA 4E0AA 2JEVA 3R95A 4KOSA 4NCZA 4YGOA 4QC6A 2JDCA 5G20A 5A28A 4KVME 4MFKA 5IV0A 1M4IA 4H89A 5ISVA 1L0CA 2BL1A 2P0WA 2VEZA 2YNEA 4CGLA 1KUXA 4R3KA 2Q4VA 3UY5A 2Z11A 4UBRA 1Z4EA 4K30A 1K4JA 1IYLA 4C7IA 4M85A 1Y9WA 2FCKA 1NE9A 2FT0A 3P2FA 2FL4A 3LD2A 2Z3KA 4NXYA 4R9MA 1B87A 5EBVA 4CS0B 4B11A 4C2XA 4C2YA 1I1DA 2ATRA 5HH1A 2FXFA 4AVBA 4FD5A 2I79A 1PUAA 3E0KA 1MJAA 4CYOA 1U6MA 4PK2A 1S3ZA 4AG7A 3K9UA 4UFVA 4L8AA 3TCVA 3R9FA 2D4OA 2REEA 1Y7RA 5AG5A 5BWAB 4CAFA 2ZW5A 4H6UA 2QIRA 1XE4A 4XNHC 4HKFA 2JLMA 4R3LA 4PV6A 4AG9A 2R7HA 2FS5A 3I9SA 4XPLA 5F47A 3F8KA 3EFAA 4KZTA 1VKCA 2ARHA 4F0YA 4PK3A 2B58A 2WSAA 1Q2CA 3DR6A 4IF5A 5G21A 3ZZIA 3S6HA 2P6FA 1YGHA 4CGMA 4XPDC 2B4DB 3TT2A 3VWDA 1S7KA 1Q2DA 4A31A 1N71A 2I00A 4UFXA 2Y0MA 1IB1E 5HMNA 2VQYA 2G0BA 2OZUA 2B4BA 1QSMA 1QSTA 3DDDA 3DSBA 3IWEA 1S7NA 3TO7A 2D4PA 4U9YA 4B12A 3G3SA 1S5KA 2PC1A 4MFLA 5CNPA 1SQHA 2CY2A 4U5YA 3GYAA 2JDDA 2C27A 3KKWA 1NMTA 4MHDA 4B5PA 3S6GA 4RS2A 3I3GA 4KOWA 3W91A 3N7ZA 1WK4A 5KTDA 3R96A 3DR8A 2PR1A 3NE7A 2R1IA 2H5MA 1MK4A 3H5ZA 3IWGA 1YX0A 2J8NA 1I21A 1YREA 4MFQA 1BO4A 1UFHA 4CRYB 4B13A 3D8PA 1QSNA 2R8VA 1CJWA 1KUYA 1S7LA 2CNTA 1IICA 2FE7A 4CGOA 4X5KA 2IL4A 3FBUA 5IX3A 4KOYA 4B5PB 5KTCA 3SHPA 2B5GA 2WUUA 2F5IA 4U9ZA 4KLWA 2CXAA 4HNWB 3A9LA 4YFJA 3VWEA 2B3UA 1B6BA 4A33A 1XEBA 1YK3A 3IU1A 3P2HA 5F49A 3ZJ0A 1WWZA 2OZGA 2Z3NA 2J8RA 3GY9A 5A27A 3W6XA 2R98A 2Z0ZA 2B5GB 3GKRA 4DNCA 3TTHA 4MFPA 2QECA 4QVTA 1GHEA 4QBJA 3OWCA 4CAWA 3D3SA 1M1DA 4CRZB 3R1KA 4B14A 1PU9A 3EXNA 2B4DA 3EO4A 1NSLA 4NSQA 2ZW4A 5H86A 3FXTA 4XPKA 4JD6A 4KVOE 2VI7A 2YNDA 2ZW7A 4M3SA 4AVAA 1MJBA 1IYKA 3EY5A 4CYNA 3H4QA 4L89A 4A32A 1S7FA 4A95A 4H6ZA 4JLYA 1P0HA 4QUSA 4BMHA 3T9YA 1MJ9A 3C26A 1V0CA 3BLNA 4QB9A 2KCWA 2REFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBH A;  4CGP A;  4CGL A;  4A31 A;  4UFV A;  2YND A;  2YNC A;  4UFX A;  4B10 A;  4UCP A;  4C7I A;  4UFW A;  5AG6 A;  4A30 A;  2WUU A;  5AG7 A;  5AG5 A;  3IU2 A;  5G22 A;  4CYN A;  4UCM A;  5A27 A;  5G1Z A;  2WSA A;  3IWE A;  4CYP A;  4CAF A;  4A32 A;  4B11 A;  4C2X A;  4A95 A;  5G20 A;  4B12 A;  4A2Z A;  4C2Y A;  4CAE A;  5A28 A;  3H5Z A;  4UCN A;  5AG4 A;  5G21 A;  3JTK A;  4A33 A;  5AGE A;  2YNC C;  4CYQ A;  4B14 A;  4CGM A;  4B13 A;  4C7H A;  2YNE A;  4CGN A;  4CGO A;  3IU1 A;  4C2Z A;  4C68 A;  4CYO A; 
#chains in the Genus database with same CATH topology
 2GE3 A;  1IGB A;  5DWM A;  4F9U A;  3BJ7 A;  5LYI A;  3PB9 X;  4NGQ A;  5I4M A;  5H84 A;  4AXV A;  2ZPA A;  2PE3 A;  2GAN A;  2AFS A;  1P4N A;  4F6A A;  1LAM A;  4KOV A;  2OU2 A;  5GCN A;  5IB0 A;  1CX8 A;  4PQA A;  4MFJ A;  4DYO A;  5K8N A;  4NF1 A;  3W6S A;  5F48 A;  3TE4 A;  4FWU A;  1LCP A;  3FEC A;  1YLO A;  2HQY A;  4O23 A;  4Q36 A;  3I1U A;  1VHS A;  4A2Z A;  3KI9 A;  2AFZ A;  1IOF A;  2Q04 A;  4UCN A;  3S9L A;  2Z10 A;  2CNM A;  1I12 A;  4P45 A;  1IID A;  5AGE A;  3CXS A;  3FYN A;  1KZF A;  2OZH A;  4MJ8 A;  1RXT A;  4UWI A;  4DUK A;  3TFY A;  3BJ8 A;  3FIX A;  1TKJ A;  4BBH A;  4ORF A;  2J8M A;  5JQ4 A;  4KVX A;  1TXR A;  3WC5 A;  4ZY2 A;  3PB4 X;  5J8C A;  4B10 A;  3B3C A;  3F0A A;  3IGR A;  2P6G A;  4R8F A;  4UFW A;  4LX9 A;  3BI0 A;  5AG6 A;  3IFE A;  3SXO A;  5G1Z A;  4R7M A;  1M4G A;  1ZG9 A;  1OZP A;  1YVK A;  2EK9 A;  3VH9 A;  4FUU A;  4HPS A;  1NSA A;  5FVJ A;  2PRB A;  4NJQ A;  2ZXV A;  2PJ5 A;  1Q7L A;  1YSJ A;  2IJZ A;  2RB7 A;  3JVN A;  1YR0 A;  4X3R A;  4G1P A;  1Z4R A;  3H8E A;  2XEG A;  3D68 A;  4Y49 B;  3F5B A;  4CGN A;  5K8M A;  2AFU A;  1VGY A;  2PR8 A;  2PSW A;  3MGD A;  2Q51 A;  2ZOG A;  2WPX A;  4CGP A;  3NFZ A;  4PSX A;  2VZY A;  1VIX A;  3FRM A;  1CBX A;  2Q44 A;  3DNS A;  4E8O A;  1RO5 A;  2EVN A;  4E2A A;  2B3V A;  3PFO A;  1LAP A;  4KUB A;  4YRH A;  1A2Z A;  3TOB A;  5LRJ A;  2OOT A;  2P6E A;  5F46 A;  3LOD A;  4UEE A;  2FIA A;  1KUV A;  4CPA A;  2RC4 A;  5EMI A;  4F0X A;  1YVO A;  3TO9 A;  1TIQ A;  1ON0 A;  3D7F A;  3CPA A;  1F2O A;  4JWP A;  2WPW A;  4KS9 A;  2PJ6 A;  3R9E A;  3TO6 A;  1J4J A;  3JTK A;  2YNC C;  2BSW A;  4P4F A;  3EC4 A;  4B5O A;  3PGP A;  5HVG A;  2BUE A;  4C7H A;  2PIZ A;  1BOB A;  1S60 A;  1ELL P;  4KOX A;  1Y0Y A;  3B8G A;  3CXP A;  4I49 A;  1LFW A;  1DTD A;  3PP9 A;  4FD6 A;  3NH8 A;  1CM0 A;  3IIB A;  3KHX A;  4PXB A;  5C88 A;  4ZI6 A;  2OB0 A;  6CPA A;  2PDO A;  3LMS A;  3T8W A;  4MI4 A;  3JUW A;  2PVW A;  2Q43 A;  3G8W A;  1Z9U A;  2C6P A;  1XF8 A;  4KSF A;  4DJL A;  1BPM A;  4FD4 A;  5C82 A;  2GIV A;  2AFX A;  3D67 A;  3NH4 A;  2Z3M A;  4OC0 A;  3VAR A;  2Q7B A;  1AUG A;  3IO1 A;  2I3C A;  4LQG A;  4CAX A;  5AG4 A;  5KTA A;  4CYQ A;  3BHX A;  3LAC A;  4MCP A;  2CTB A;  4EVY A;  4EWT A;  3PB7 X;  5J1Q A;  1XMT A;  2PJ4 A;  2OH1 A;  3B35 A;  5CPA A;  1R57 A;  1VHE A;  4MBU A;  3RYO A;  3V38 A;  2X7B A;  4NEX A;  2YGW A;  5E96 A;  5JPH A;  3B3T A;  4KOR A;  5K8P A;  3FF3 A;  2CIJ A;  2EK8 A;  2HUZ A;  4HNY B;  4R87 A;  4MHN A;  4MY0 A;  3B2Y A;  2F8H A;  4RI1 A;  1FY7 A;  5JH9 A;  4OC2 A;  4CAV A;  2EUI A;  4PSW A;  4MMO A;  4UCM A;  3KQZ A;  4R57 A;  2JBK A;  5HVF A;  1ELM P;  3GB0 A;  4ZBG A;  3SJX A;  1X10 A;  3CXQ A;  3KHZ A;  1M4D A;  4R6T A;  4CAE A;  1QSO A;  2Q0Y A;  2O28 A;  2XEI A;  1TF9 A;  2Z3L A;  3LWU A;  2DEA A;  2HB6 A;  4JXQ A;  3TOA A;  1YLE A;  1XFO A;  5THW A;  2AE6 A;  1Y7E A;  3RBU A;  2QVP A;  4GXH A;  4JYW A;  1CP7 A;  3JRU A;  1HEE A;  4FD7 A;  2PIY A;  4C68 A;  4KUA A;  2DPT A;  4XNH B;  2NMT A;  2DXQ A;  5CBM A;  1XIX A;  3S6K A;  1LOK A;  2QML A;  2V8H A;  2G3T A;  1ZO0 A;  2ZEN A;  4KLV A;  4UWJ A;  5D29 A;  3S9N A;  3D7G A;  2PJ2 A;  4LUA A;  1FT7 A;  2HV2 A;  5G22 A;  2VXK A;  2AJ6 A;  1QSR A;  2CNS A;  2VBQ A;  3D2M A;  3DLJ A;  4OAE A;  4ZGY B;  4UA3 A;  2Z3P A;  4P4B A;  2FSR A;  4CYP A;  4P6Y A;  4HNX B;  3T90 A;  4IUS A;  2ZEE A;  3MRU A;  3TX8 A;  5EC4 A;  2PJB A;  2GLF A;  2ZW6 A;  2J9A A;  4MY3 A;  4OLL A;  4ONU A;  4F9V A;  4KOU A;  4JXR A;  5DWN A;  2Z3O A;  1Y9K A;  4M6I A;  5J8F A;  1JQG A;  4UEZ A;  2GFQ A;  2PJ1 A;  3FED A;  4J3G A;  4A38 A;  4MFZ A;  2BEI A;  4OAD A;  5I0C A;  3QB8 A;  2ODF A;  3KL9 A;  4Q38 A;  4NJR A;  2DPS A;  3FB3 A;  2EBJ A;  4NGN A;  2PQ8 A;  5JGF A;  1XRY A;  3D4U A;  4AVC A;  1PCA A;  4XPD B;  1ZLI A;  3NE8 A;  5LYD A;  4A30 A;  2Q4Y A;  3D2P A;  4MCQ A;  3B7I A;  3IU2 A;  1YW4 A;  1M44 A;  2V77 A;  3KZW A;  4NFR A;  4P4J A;  4R76 A;  3V8I A;  2G3A A;  4II9 A;  3R9G A;  2G9D A;  3KQX A;  3FJU A;  3H8F A;  2FIW A;  3S6F A;  4Y49 C;  1TKF A;  1H8L A;  2A4N A;  2RFH A;  2V8V A;  2ZEM A;  4X8I A;  3SXN A;  1LRZ A;  2K5T A;  3FNC A;  4AB7 A;  3PZJ A;  2PJC A;  4C2Z A;  4ZX9 A;  3NH5 A;  4KSA A;  3QAH A;  4UEF A;  4GS4 A;  4MCR A;  2C6C A;  2VZZ A;  2YNC A;  3WR7 A;  1FNO A;  1Q2Y A;  4JJX A;  1UWY A;  4UCP A;  2JEV A;  4E0A A;  2BOA A;  3R95 A;  4KOS A;  1CG2 A;  4NCZ A;  4YGO A;  2PJ0 A;  4MHP A;  4OID A;  3QNV A;  4JZ0 A;  3CT9 A;  4QC6 A;  2ZEG A;  1PYT B;  2JDC A;  5G20 A;  5A28 A;  1IOI A;  1CPS A;  4KVM E;  3IWW A;  2ZEL A;  1QMU A;  3DGV A;  4FAI A;  4MFK A;  5IV0 A;  2PJ7 A;  4P10 A;  1M4I A;  3FH4 A;  4H89 A;  1L0C A;  4IAV A;  2EWB A;  3SI1 A;  2BL1 A;  2ZEP A;  1BAV A;  2P0W A;  2VEZ A;  2YNE A;  3FEE A;  4CGL A;  4ZY0 A;  3RNZ A;  1KUX A;  4GM5 A;  4R3K A;  3CZX A;  2Q4V A;  1ARM A;  3CPX A;  4LQ6 A;  7CPA A;  2QJ8 A;  3UY5 A;  2Z11 A;  4UBR A;  1Z4E A;  4K30 A;  1K4J A;  4MHY A;  1IYL A;  3PB6 X;  2PJ9 A;  3IJ3 A;  1Y9W A;  2FCK A;  4M85 A;  4MHZ A;  4C7I A;  4Z65 A;  1NE9 A;  2FT0 A;  2GLJ A;  2O4H A;  2FL4 A;  3LD2 A;  3P2F A;  2Z3K A;  4NXY A;  4R9M A;  1B87 A;  2NYQ A;  5EBV A;  1CP6 A;  4B11 A;  4C2X A;  4C2Y A;  1I1D A;  2ATR A;  3D7H A;  5HH1 A;  4MXU A;  4YU9 A;  2FXF A;  3HLP A;  5K8O A;  4AVB A;  4OKO A;  4FD5 A;  3ISX A;  2I79 A;  2ZOF A;  2GU2 A;  4EME A;  1PUA A;  4IK2 A;  2OR4 A;  3E0K A;  4NGS A;  1XJO A;  3SI2 A;  3V7Z A;  1MJA A;  2NSM A;  3K9T A;  4CYO A;  1ZG8 A;  1U6M A;  4KSI A;  2FVG A;  3PRT A;  4PK2 A;  4UF4 A;  8CPA A;  1S3Z A;  4OC1 A;  3K9U A;  4AG7 A;  2EO8 A;  4UFV A;  4L8A A;  4OIW A;  4MCS A;  3TCV A;  2XEF A;  1Z8W A;  1EE3 P;  4RN7 A;  3R9F A;  2D4O A;  2REE A;  1Y7R A;  4M6H A;  5AG5 A;  5LRK A;  3FVL A;  5HXD A;  5LYL A;  2XEJ A;  5BWA B;  2ANP A;  1CPX A;  4CAF A;  1GYT A;  3BXM A;  2BCO A;  2ZW5 A;  2AFM A;  4H6U A;  4NGT A;  2QIR A;  1XE4 A;  4NGM A;  4XNH C;  4CS0 B;  5HVH A;  3KR5 A;  4HKF A;  4OC4 A;  2JLM A;  4R3L A;  4B6Z A;  3RAM A;  4PV6 A;  4M6G A;  2R7H A;  4AG9 A;  5LRG A;  2FS5 A;  2VL1 A;  3I9S A;  2JEW A;  4XPL A;  5F47 A;  2PVV A;  3F8K A;  3EFA A;  4KZT A;  3WT4 A;  1DE4 C;  3TC8 A;  1VKC A;  2ARH A;  2V8G A;  4F0Y A;  4PK3 A;  1YME A;  2JBJ A;  2B58 A;  1HDU A;  2WSA A;  3IEH A;  2ZEF A;  4MRI A;  1Q2C A;  3DR6 A;  3L2N A;  3PBB A;  5F09 A;  2F7V A;  3QAY A;  4IF5 A;  5ELY A;  2IQ6 A;  3SI0 A;  1HDQ A;  1AYE A;  5G21 A;  3PB8 X;  3ZZI A;  3S6H A;  2P6F A;  4RUH A;  2ZED A;  1YGH A;  1VHO A;  3D66 A;  4P4E A;  4ZYQ A;  4BIN A;  4CGM A;  4XPD C;  2HC9 A;  1IY7 A;  2B4D B;  3K2K A;  1BLL E;  4YWY A;  3TT2 A;  1S7K A;  3VWD A;  5LYF A;  4W9Y A;  4P4I A;  1Q2D A;  4A31 A;  1N71 A;  2BO9 A;  2I00 A;  1Z8L A;  2ZEH A;  4UFX A;  2Y0M A;  2O53 A;  3BI1 A;  1IB1 E;  3PFE A;  4WJB A;  4K3N A;  5DS0 A;  4OP4 A;  1JWQ A;  5HMN A;  2VQY A;  4UIA A;  1TF8 A;  1BPN A;  2V8D A;  2G0B A;  2OZU A;  2B4B A;  1QSM A;  1QST A;  3DDD A;  1XBU A;  1AMP A;  1RTQ A;  1S7N A;  3DSB A;  3IWE A;  3TO7 A;  4F8Z A;  1OBR A;  2D4P A;  4U9Y A;  3B3W A;  2PRQ A;  4B12 A;  3G3S A;  1S5K A;  1Z5R A;  2PC1 A;  4MFL A;  2QYV A;  3WC7 A;  4NGR A;  5CNP A;  1SQH A;  1ARL A;  2CY2 A;  3PEI A;  4U5Y A;  3GLJ A;  1QQ9 A;  2JDD A;  2WZN A;  3GYA A;  2C27 A;  3IC1 A;  4ONW A;  3KKW A;  1NMT A;  4MHD A;  1F57 A;  4OME A;  4BD9 A;  1TKH A;  3D7D A;  4B5P A;  3S6G A;  4RS2 A;  2DF5 A;  1ZG7 A;  3I3G A;  3N5F A;  4KOW A;  2PJ3 A;  3N7Z A;  5AG7 A;  3W91 A;  1R3N A;  1Z8X A;  3KAS A;  1WK4 A;  4OC3 A;  4PXE A;  4Q7A A;  5KTD A;  3R96 A;  3DR8 A;  4KOT A;  2PR1 A;  3NE7 A;  2R1I A;  3CDX A;  2H5M A;  1MK4 A;  3H5Z A;  1YW6 A;  1YX0 A;  2J8N A;  3IWG A;  1I21 A;  4PXC A;  1YRE A;  4MFQ A;  3RZA A;  1BO4 A;  1UFH A;  3MN8 A;  4CRY B;  4B13 A;  3D8P A;  4OC5 A;  1QSN A;  3HUV A;  2R8V A;  1CJW A;  1KUY A;  1S7L A;  2ABZ A;  1IIC A;  2CF4 A;  2CNT A;  2FE7 A;  2PCU A;  4CGO A;  2Q7S A;  4X5K A;  2IL4 A;  4IHM A;  3FBU A;  3WAB A;  3PBE A;  4A37 A;  5IX3 A;  4KOY A;  4TWE A;  4B5P B;  4EFD A;  5KTC A;  2AFW A;  3SHP A;  2Q4Z A;  2B5G A;  2WUU A;  3FMC A;  2F5I A;  4U9Z A;  4KLW A;  2WYR A;  3FX6 A;  2CXA A;  1R43 A;  4HNW B;  3A9L A;  4A94 A;  4YFJ A;  5JM6 A;  3VWE A;  2B3U A;  1B6B A;  2C1C A;  1M4L A;  4A33 A;  3WC6 A;  3SJF A;  2ZEO A;  1Z8T A;  4P44 A;  1XEB A;  3VAT A;  1YK3 A;  3ISZ A;  2GRE A;  3H8G A;  3IU1 A;  3NA6 A;  5D8N A;  5ISV A;  3P2H A;  5F49 A;  1X12 A;  3ZJ0 A;  3B3V A;  1WWZ A;  4PXD A;  4ZY1 A;  2OZG A;  1LAN A;  3SJG A;  4UIB A;  2AFO A;  2Z3N A;  2IMO A;  2J8R A;  3GY9 A;  5A27 A;  3W6X A;  2R98 A;  2Z0Z A;  2B5G B;  3GUX A;  3GKR A;  4DNC A;  1Y0R A;  3TTH A;  4H2K A;  4MFP A;  2QEC A;  4QVT A;  1GHE A;  4QBJ A;  3OWC A;  4WWV A;  1XOV A;  4ZX8 A;  2C6G A;  3KGQ A;  1KWM A;  4NGP A;  4CAW A;  4X2T A;  2PJ8 A;  1ZLH A;  3D3S A;  1M1D A;  4CRZ B;  3R1K A;  4B14 A;  1PU9 A;  3EXN A;  2B4D A;  3EO4 A;  4TNU A;  1NSL A;  4NSQ A;  2ZW4 A;  4PPZ A;  3FXT A;  5H86 A;  4XPK A;  2POK A;  4JD6 A;  4KVO E;  2VI7 A;  2YND A;  2CTC A;  2ZW7 A;  4M3S A;  4FBE A;  1F2P A;  1XMB A;  3RO0 A;  4AVA A;  1MJB A;  1IYK A;  3EY5 A;  4CYN A;  3SJE A;  3H4Q A;  2PJA A;  4L89 A;  4A32 A;  1S7F A;  4A95 A;  3KR4 A;  4H6Z A;  4JLY A;  3GIU A;  4A39 A;  5IB9 A;  1YQE A;  1P0H A;  4P4D A;  1IU8 A;  4QUS A;  4BMH A;  3T9Y A;  1MJ9 A;  3B3S A;  3C26 A;  1V0C A;  3S9M A;  3BLN A;  1Z2L A;  4QB9 A;  2KCW A;  2REF A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  5DWM A;  3BJ7 A;  5H84 A;  2ZPA A;  2GAN A;  1P4N A;  4F6A A;  4KOV A;  2OU2 A;  5GCN A;  5IB0 A;  4MFJ A;  4NF1 A;  3W6S A;  5F48 A;  3TE4 A;  2HQY A;  4Q36 A;  1VHS A;  4A2Z A;  2Q04 A;  4UCN A;  2Z10 A;  2CNM A;  1I12 A;  1IID A;  5AGE A;  3CXS A;  3FYN A;  1KZF A;  2OZH A;  4MJ8 A;  1RXT A;  4UWI A;  3TFY A;  3BJ8 A;  3FIX A;  4BBH A;  4ORF A;  2J8M A;  5JQ4 A;  4KVX A;  5J8C A;  4B10 A;  3F0A A;  3IGR A;  2P6G A;  4UFW A;  4LX9 A;  5AG6 A;  3SXO A;  5G1Z A;  1M4G A;  1OZP A;  1YVK A;  5FVJ A;  2PRB A;  2ZXV A;  3JVN A;  1YR0 A;  1Z4R A;  4CGN A;  4Y49 B;  3F5B A;  2PR8 A;  2PSW A;  3MGD A;  2WPX A;  4CGP A;  4PSX A;  2VZY A;  3FRM A;  2Q44 A;  3DNS A;  4E8O A;  1RO5 A;  2EVN A;  4E2A A;  2B3V A;  4KUB A;  4YRH A;  3TOB A;  2P6E A;  5F46 A;  3LOD A;  2FIA A;  1KUV A;  2RC4 A;  4F0X A;  1YVO A;  3TO9 A;  1TIQ A;  1ON0 A;  4JWP A;  4KS9 A;  3R9E A;  2WPW A;  3TO6 A;  1J4J A;  3JTK A;  2YNC C;  2BSW A;  3EC4 A;  4B5O A;  3PGP A;  2BUE A;  4C7H A;  1BOB A;  1S60 A;  4KOX A;  3B8G A;  3CXP A;  4I49 A;  3PP9 A;  4FD6 A;  1CM0 A;  5C88 A;  2OB0 A;  2PDO A;  4MI4 A;  3JUW A;  3G8W A;  1Z9U A;  1XF8 A;  4KSF A;  4FD4 A;  5C82 A;  2GIV A;  2Z3M A;  2Q7B A;  4CAX A;  5AG4 A;  5KTA A;  4CYQ A;  4EVY A;  1XMT A;  2OH1 A;  1R57 A;  3RYO A;  4MBU A;  2X7B A;  4NEX A;  2YGW A;  5E96 A;  5JPH A;  4KOR A;  2HUZ A;  4HNY B;  4R87 A;  4MY0 A;  4RI1 A;  1FY7 A;  4CAV A;  2EUI A;  4PSW A;  4UCM A;  4R57 A;  4ZBG A;  3CXQ A;  1M4D A;  4CAE A;  1QSO A;  2Q0Y A;  4JXQ A;  2O28 A;  2Z3L A;  4KOT A;  3TOA A;  1YLE A;  2AE6 A;  4FD7 A;  4C68 A;  4KUA A;  2DPT A;  4XNH B;  2NMT A;  2DXQ A;  1XIX A;  3S6K A;  2QML A;  2G3T A;  1ZO0 A;  4KLV A;  4UWJ A;  4LUA A;  2HV2 A;  5G22 A;  2VXK A;  2AJ6 A;  1QSR A;  2CNS A;  2VBQ A;  3D2M A;  4OAE A;  4ZGY B;  4UA3 A;  2Z3P A;  4CYP A;  2FSR A;  4HNX B;  3T90 A;  4IUS A;  5EC4 A;  4MY3 A;  2ZW6 A;  4OLL A;  4ONU A;  4KOU A;  4JXR A;  5DWN A;  2Z3O A;  1Y9K A;  5J8F A;  4J3G A;  4MFZ A;  2BEI A;  4OAD A;  5I0C A;  3QB8 A;  4Q38 A;  2DPS A;  3FB3 A;  2PQ8 A;  4AVC A;  4XPD B;  4A30 A;  2Q4Y A;  3D2P A;  5AG7 A;  3IU2 A;  3V8I A;  1M44 A;  2G3A A;  4II9 A;  3R9G A;  2FIW A;  3S6F A;  4Y49 C;  2A4N A;  3SXN A;  1LRZ A;  2K5T A;  3FNC A;  4AB7 A;  3PZJ A;  4C2Z A;  4KSA A;  3QAH A;  4GS4 A;  2VZZ A;  2YNC A;  3WR7 A;  1Q2Y A;  4JJX A;  4UCP A;  4E0A A;  2JEV A;  3R95 A;  4KOS A;  4NCZ A;  4YGO A;  4QC6 A;  2JDC A;  5G20 A;  5A28 A;  4KVM E;  4MFK A;  5IV0 A;  1M4I A;  4H89 A;  5ISV A;  1L0C A;  2BL1 A;  2P0W A;  2VEZ A;  2YNE A;  4CGL A;  1KUX A;  4R3K A;  2Q4V A;  3UY5 A;  2Z11 A;  4UBR A;  1Z4E A;  4K30 A;  1K4J A;  1IYL A;  4C7I A;  4M85 A;  1Y9W A;  2FCK A;  1NE9 A;  2FT0 A;  3P2F A;  2FL4 A;  3LD2 A;  2Z3K A;  4NXY A;  4R9M A;  1B87 A;  5EBV A;  4CS0 B;  4B11 A;  4C2X A;  4C2Y A;  1I1D A;  2ATR A;  5HH1 A;  2FXF A;  4AVB A;  4FD5 A;  2I79 A;  1PUA A;  3E0K A;  1MJA A;  4CYO A;  1U6M A;  4PK2 A;  1S3Z A;  4AG7 A;  3K9U A;  4UFV A;  4L8A A;  3TCV A;  3R9F A;  2D4O A;  2REE A;  1Y7R A;  5AG5 A;  5BWA B;  4CAF A;  2ZW5 A;  4H6U A;  2QIR A;  1XE4 A;  4XNH C;  4HKF A;  2JLM A;  4R3L A;  4PV6 A;  4AG9 A;  2R7H A;  2FS5 A;  3I9S A;  4XPL A;  5F47 A;  3F8K A;  3EFA A;  4KZT A;  1VKC A;  2ARH A;  4F0Y A;  4PK3 A;  2B58 A;  2WSA A;  1Q2C A;  3DR6 A;  4IF5 A;  5G21 A;  3ZZI A;  3S6H A;  2P6F A;  1YGH A;  4CGM A;  4XPD C;  2B4D B;  3TT2 A;  3VWD A;  1S7K A;  1Q2D A;  4A31 A;  1N71 A;  2I00 A;  4UFX A;  2Y0M A;  1IB1 E;  5HMN A;  2VQY A;  2G0B A;  2OZU A;  2B4B A;  1QSM A;  1QST A;  3DDD A;  3DSB A;  3IWE A;  1S7N A;  3TO7 A;  2D4P A;  4U9Y A;  4B12 A;  3G3S A;  1S5K A;  2PC1 A;  4MFL A;  5CNP A;  1SQH A;  2CY2 A;  4U5Y A;  3GYA A;  2JDD A;  2C27 A;  3KKW A;  1NMT A;  4MHD A;  4B5P A;  3S6G A;  4RS2 A;  3I3G A;  4KOW A;  3W91 A;  3N7Z A;  1WK4 A;  5KTD A;  3R96 A;  3DR8 A;  2PR1 A;  3NE7 A;  2R1I A;  2H5M A;  1MK4 A;  3H5Z A;  3IWG A;  1YX0 A;  2J8N A;  1I21 A;  1YRE A;  4MFQ A;  1BO4 A;  1UFH A;  4CRY B;  4B13 A;  3D8P A;  1QSN A;  2R8V A;  1CJW A;  1KUY A;  1S7L A;  2CNT A;  1IIC A;  2FE7 A;  4CGO A;  4X5K A;  2IL4 A;  3FBU A;  5IX3 A;  4KOY A;  4B5P B;  5KTC A;  3SHP A;  2B5G A;  2WUU A;  2F5I A;  4U9Z A;  4KLW A;  2CXA A;  4HNW B;  3A9L A;  4YFJ A;  3VWE A;  2B3U A;  1B6B A;  4A33 A;  1XEB A;  1YK3 A;  3IU1 A;  3P2H A;  5F49 A;  3ZJ0 A;  1WWZ A;  2OZG A;  2Z3N A;  2J8R A;  3GY9 A;  5A27 A;  3W6X A;  2R98 A;  2Z0Z A;  2B5G B;  3GKR A;  4DNC A;  3TTH A;  4MFP A;  2QEC A;  4QVT A;  1GHE A;  4QBJ A;  3OWC A;  4CAW A;  3D3S A;  1M1D A;  4CRZ B;  3R1K A;  4B14 A;  1PU9 A;  3EXN A;  2B4D A;  3EO4 A;  1NSL A;  4NSQ A;  2ZW4 A;  5H86 A;  3FXT A;  4XPK A;  4JD6 A;  4KVO E;  2VI7 A;  2YND A;  2ZW7 A;  4M3S A;  4AVA A;  1MJB A;  1IYK A;  3EY5 A;  4CYN A;  3H4Q A;  4L89 A;  4A32 A;  1S7F A;  4A95 A;  4H6Z A;  4JLY A;  1P0H A;  4QUS A;  4BMH A;  3T9Y A;  1MJ9 A;  3C26 A;  1V0C A;  3BLN A;  4QB9 A;  2KCW A;  2REF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...