2YNEA

Plasmodium vivax n-myristoyltransferase in complex with a benzothiophene inhibitor
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yneA00
3H5ZA 2YNCA 4CYOA 4B13A 2YNCC 4CAEA 4CYQA 4C2YA 4A31A 4B11A 4C2ZA 4C7IA 4A2ZA 5G20A 3IU2A 5G22A 2WUUA 4A95A 5AG4A 5AG6A 2YNDA 4B12A 4CGPA 4CYPA 4UFWA 5AG7A 5AGEA 4C7HA 4CYNA 4A33A 4A30A 4CGOA 5AG5A 4UFVA 4B14A 4A32A 4CGNA 4CGMA 2YNEA 3JTKA 3IWEA 5A27A 4UCPA 4UCNA 4BBHA 3IU1A 5G1ZA 5A28A 4UCMA 4B10A 5G21A 4CGLA 4CAFA 4C2XA 2WSAA 4UFXA 4C68A
chains in the Genus database with same CATH superfamily
3KKWA 2OB0A 3WC6A 3BLNA 4F0YA 4KLVA 4P4FA 2HV2A 1CX8A 1S7LA 3D7GA 3FEDA 4XPDB 2JBKA 3G8WA 1YW4A 2A4NA 2OZUA 1Z8LA 2ABZA 2PE3A 2PR8A 3PBEA 3S6GA 5LYIA 2ZEHA 3WC7A 1X10A 4EVYA 4UF4A 5EMIA 4KUAA 4X5KA 3QAHA 1Z4EA 4ZBGA 3KI9A 2ZEGA 3V8IA 3MRUA 4EWTA 3D4UA 4AB7A 3IWGA 4H6UA 4IHMA 4BBHA 2J9AA 4ONUA 5E96A 4PXCA 5KTAA 4HNYB 2R1IA 2QJ8A 2CF4A 4FD5A 4FBEA 1YLOA 1KUVA 2B4DA 2Q04A 1N71A 1ZLIA 1HDQA 2GREA 2PRBA 4MMOA 1EE3P 2PIYA 3EO4A 3I3GA 4NGTA 4X8IA 5G22A 4DUKA 1MJ9A 1KWMA 4U5YA 4P10A 2CNMA 3B3TA 4UEZA 3JVNA 4M6HA 2Y0MA 1HEEA 3FIXA 4YU9A 5JPHA 2NMTA 3S9LA 2GU2A 2DEAA 4IF5A 1PYTB 1KUYA 2JBJA 4HNWB 2C6CA 3I1UA 1XJOA 2CY2A 4KSAA 4Z65A 3P2FA 4A37A 3TO9A 4KVXA 5A28A 1L0CA 3IIBA 2FT0A 4NF1A 5IB9A 1Z8WA 2DPSA 3NE8A 2QMLA 4CAFA 3RBUA 4KVOE 4UIAA 1P4NA 2REEA 4HPSA 4P45A 4XPKA 5THWA 4OIWA 5K8PA 4P6YA 3VWDA 4H6ZA 2YNCC 4P4IA 2FIWA 4MCPA 4NJQA 1M4IA 1YR0A 1CM0A 3S6HA 5F49A 3FBUA 4KVME 4H89A 2X7BA 3F5BA 2EK9A 1M4DA 4B5PB 1MJBA 1BAVA 2I3CA 4MFPA 2YGWA 3KHXA 3TC8A 4MHNA 3TCVA 1IICA 2Z3OA 4R9MA 1JWQA 5F48A 1YREA 2V8GA 3JUWA 4U9ZA 4ZX8A 2PJ8A 4GM5A 5EC4A 2VEZA 4NFRA 3B3VA 2PJ0A 2HC9A 4H2KA 4AXVA 4EMEA 1Z9UA 2EO8A 2R98A 3D68A 1HDUA 3N5FA 4OC3A 4C68A 1XFOA 4QC6A 3QNVA 1KUXA 4B11A 3PB7X 4NEXA 5HVGA 4NGNA 1Y9WA 3IU2A 4JXRA 2WUUA 3RZAA 5LYDA 2YNDA 3LODA 4LX9A 2HB6A 1DTDA 3EXNA 1BOBA 4OKOA 1Z2LA 4R57A 4Y49B 4CRYB 4MCRA 2PJ1A 2Q4YA 1Z4RA 3FB3A 2AFXA 4KS9A 4NGRA 1WK4A 4MHDA 5KTCA 1TF9A 4WJBA 2B5GA 3EY5A 4UIBA 4A94A 1ON0A 1X12A 3RAMA 2C6GA 5LRKA 4XNHC 4MFQA 2PJ3A 5C88A 2Q51A 3CXPA 3B8GA 4UCMA 5D29A 2IMOA 4AVBA 3PFEA 1ZG9A 3T90A 5HVHA 5LYFA 3D8PA 3NA6A 4ZY2A 4A39A 4KOUA 4UFXA 4ZY1A 1B6BA 4QUSA 3F8KA 1BPMA 1RO5A 3D3SA 1M4LA 3K9UA 1F2OA 2ANPA 1A2ZA 1M1DA 3TO7A 5H84A 3PZJA 4KSFA 1BLLE 2ODFA 5F47A 4MRIA 4E2AA 2ZELA 1MJAA 3D2PA 5JGFA 4PXDA 1OBRA 3CZXA 3D2MA 2PRQA 4CGNA 4GS4A 1H8LA 4UBRA 1CPXA 1I1DA 3D7HA 2PQ8A 3FVLA 4BINA 2PSWA 4NGSA 2V8VA 3KQXA 1QMUA 2P6GA 4M3SA 4UEFA 2EBJA 4P44A 4YWYA 4CYOA 2YNCA 3V7ZA 3FJUA 2AE6A 2VL1A 2JDCA 3DLJA 4NJRA 1CBXA 3B35A 4IUSA 2VQYA 1ARMA 3PEIA 2J8RA 3R1KA 1YQEA 4JXQA 3G3SA 2B58A 2ZW4A 2G3TA 2PJ9A 2V8DA 3WC5A 1F57A 2PVWA 1WWZA 4B5OA 3EC4A 4PPZA 3BHXA 2WZNA 4A33A 1Y0RA 1IU8A 1CP6A 2PC1A 2PDOA 4WWVA 4L8AA 4F9UA 3KZWA 3JTKA 1YW6A 2ZOFA 2G9DA 3FRMA 3KL9A 1RTQA 4FD4A 5G1ZA 4MCSA 1J4JA 2GFQA 4JYWA 3SJEA 4XPDC 4DNCA 1ZO0A 2C1CA 3LD2A 4AG7A 2VZZA 4Q38A 3D7DA 3FMCA 4JZ0A 4OLLA 1BO4A 3E0KA 3H8FA 4A38A 4QB9A 5K8NA 3GY9A 2OOTA 3CPAA 3UY5A 2CNSA 2JEVA 2R8VA 1M4GA 2ZXVA 1LANA 4OC2A 2V8HA 4MY3A 3W6XA 1IIDA 4MJ8A 4A95A 5J1QA 2Q44A 1PCAA 2JDDA 4M6IA 1Y7RA 2CIJA 2FVGA 4OC0A 4CAVA 1DE4C 2XEFA 3SI0A 3OWCA 4BD9A 4FD7A 2H5MA 5I0CA 4P4BA 1Q2YA 1YVKA 2YNEA 4FAIA 3PBBA 1Z8TA 3QAYA 4OP4A 2BOAA 3IU1A 3FXTA 3TO6A 3W6SA 4BMHA 3GLJA 4RUHA 4B6ZA 5HH1A 1TKFA 2Z3LA 4L89A 4R3KA 3D66A 5LYLA 2DF5A 4NGMA 2RB7A 1MK4A 5IX3A 4R76A 4AVAA 1CPSA 3T8WA 4YRHA 2K5TA 4CPAA 3DDDA 4KUBA 2Q7SA 1Y0YA 2Q4VA 3P2HA 3PP9A 3ZJ0A 2D4OA 3VARA 1AYEA 3IC1A 2P6EA 1VIXA 4U9YA 1LRZA 4OC5A 3DR6A 2IJZA 2ZEDA 4R3LA 3TTHA 1IB1E 3MGDA 2GLFA 1VKCA 2CTCA 4TNUA 1VHSA 1XMBA 2KCWA 1UWYA 4FUUA 3KASA 4X3RA 4AVCA 5HXDA 1XBUA 2BL1A 2O53A 4ONWA 4CRZB 2XEJA 3RO0A 1R43A 2Z10A 5IV0A 1S7FA 2G0BA 1ZG8A 5LRGA 1FT7A 3SXOA 3SHPA 5JQ4A 2I79A 2J8MA 3SJFA 4CAEA 2Z11A 3PFOA 4G1PA 3BXMA 4C7IA 5F46A 2Z3PA 4NXYA 3PB4X 2OR4A 4O23A 5G20A 2B4DB 6CPAA 4JJXA 3TOAA 1QSRA 4QBJA 4KLWA 1S3ZA 5K8OA 2FL4A 3IJ3A 3IFEA 2WPWA 3DGVA 3WR7A 3B3WA 3S9MA 3PGPA 4FD6A 5ELYA 1YMEA 1XMTA 2WYRA 1AUGA 3IGRA 4KOSA 2EUIA 3IWWA 2AJ6A 5A27A 1NMTA 3PB6X 3DR8A 4IK2A 2Z0ZA 2CXAA 3SXNA 3NH4A 3F0AA 3PB8X 4KSIA 4MFZA 1U6MA 1K4JA 2B3VA 4GXHA 4R8FA 4C2XA 2GANA 4RI1A 1PU9A 4Y49C 1LCPA 3L2NA 4QVTA 2EK8A 1XF8A 2PR1A 4J3GA 3LWUA 2J8NA 2Q7BA 1LOKA 4P4DA 3D67A 5CPAA 1IOFA 1YX0A 1QSNA 4UEEA 3RNZA 3FEEA 3GB0A 3GIUA 4ZY0A 4MHZA 2ATRA 4TWEA 3H4QA 1YVOA 4C7HA 3RYOA 3DSBA 3S6KA 2D4PA 4RN7A 1IGBA 1ZLHA 2O28A 1Y9KA 5AG5A 4B14A 1GHEA 3R96A 3FECA 2XEIA 3I9SA 8CPAA 4CS0B 2JEWA 5G21A 4PK2A 2WSAA 4HNXB 1Z5RA 3MN8A 4OAEA 1Q2DA 1VHEA 4YGOA 2IQ6A 2ZEFA 3VH9A 4A31A 4C2ZA 2RFHA 2CNTA 2R7HA 2NSMA 5CBMA 4MFKA 4CAXA 4B12A 2RC4A 2FXFA 2VZYA 2P6FA 2PJAA 2ZW5A 5GCNA 4E0AA 5KTDA 4UFWA 1Q2CA 2Q0YA 5AG7A 3FX6A 3K9TA 1ARLA 4Q36A 3A9LA 3H8EA 4II9A 3KQZA 2PJBA 2V77A 2JLMA 1R57A 4F9VA 1IOIA 2GIVA 5H86A 1PUAA 1ZG7A 1P0HA 2Z3NA 4HKFA 1LAMA 1IYLA 5JH9A 2PIZA 5EBVA 4KOWA 2PJCA 3FNCA 2PJ4A 4B5PA 2AFMA 2OH1A 3IO1A 1M44A 2B5GB 4KOTA 2OZGA 1UFHA 4PXBA 1I12A 1CP7A 1RXTA 3V38A 1QQ9A 5K8MA 2POKA 4FWUA 3BI1A 5FVJA 4ZYQA 2AFZA 2QYVA 4DJLA 2Q43A 3R9GA 4E8OA 3BJ8A 3B7IA 3VATA 2HUZA 1R3NA 2FSRA 3CDXA 4KORA 4NGPA 5AGEA 2ZEMA 3T9YA 4MHYA 1TKJA 1XE4A 3IEHA 1YK3A 1NSAA 4A30A 4CGOA 4I49A 1NE9A 2VXKA 4UWJA 2F7VA 4MY0A 5ISVA 3IWEA 3B3CA 3R9EA 3LACA 4R6TA 1ELLP 4NGQA 1XIXA 1XRYA 1V0CA 3CXQA 4JWPA 4KOYA 4MBUA 3WT4A 4NSQA 3CPXA 1YGHA 1IYKA 3H5ZA 2DXQA 4MFJA 2Q4ZA 4OC1A 4JLYA 4PSWA 4F8ZA 1GYTA 1XOVA 3FYNA 3S9NA 1TXRA 2AFSA 2FE7A 2G3AA 2GLJA 3SJGA 5JM6A 5AG6A 1FY7A 4XPLA 4MCQA 1LAPA 3K2KA 4M6GA 1NSLA 3D7FA 1VHOA 3B2YA 4M85A 1BPNA 2B3UA 3DNSA 4CAWA 2BO9A 2IL4A 1I21A 4PV6A 4UCPA 4F0XA 2HQYA 2ZW7A 2P0WA 3PRTA 2OU2A 2C27A 1S7NA 4B10A 2DPTA 2FS5A 2ZENA 2XEGA 2PJ7A 1B87A 3R95A 2BSWA 3HUVA 3KHZA 5J8FA 1QSOA 2B4BA 2O4HA 4PXEA 4RS2A 1VGYA 4CYQA 2FCKA 5J8CA 3SI1A 2QIRA 3SJXA 1Z8XA 2Z3KA 4F6AA 2OZHA 2ZW6A 3KR4A 3NH5A 4IAVA 1XEBA 5D8NA 3TFYA 4LQGA 4OADA 3VWEA 2ZEOA 3GYAA 4DYOA 2PVVA 2NYQA 4R7MA 4ZX9A 3R9FA 5C82A 2PJ2A 1CJWA 4PK3A 5LRJA 5BWAB 2ARHA 2PJ5A 2PJ6A 4EFDA 2I00A 5IB0A 3TX8A 1CG2A 2Z3MA 4CGLA 4KOVA 4OIDA 3ZZIA 4MXUA 3LMSA 4W9YA 3TE4A 4XNHB 1ELMP 4P4EA 1AMPA 1JQGA 2ZOGA 3WABA 3BI0A 3NFZA 4AG9A 4MI4A 4PQAA 3N7ZA 3NE7A 4KZTA 2FIAA 1TIQA 2QVPA 1TKHA 2C6PA 4X2TA 2VBQA 4NCZA 4CGPA 4UWIA 2EWBA 4PSXA 1QSMA 1SQHA 4CYNA 4ZI6A 3HLPA 2ZEEA 5CNPA 4A32A 3NH8A 3QB8A 4CGMA 2ZPAA 4KOXA 3GUXA 2WPXA 3B3SA 3KR5A 3H8GA 4MHPA 3S6FA 3FH4A 4P4JA 1S60A 1FNOA 2AFUA 4OMEA 3PB9X 3TOBA 5HVFA 4LUAA 2AFWA 4K30A 4UA3A 3W91A 5DWMA 1Q7LA 7CPAA 4B13A 3BJ7A 4R87A 5DWNA 2BEIA 4C2YA 4LQ6A 4A2ZA 4ORFA 1QSTA 5I4MA 2EVNA 3ISXA 5AG4A 1TF8A 3EFAA 4Q7AA 4CYPA 3FF3A 5DS0A 1Y7EA 1KZFA 3ISZA 3CT9A 4K3NA 1F2PA 3JRUA 3KGQA 4JD6A 2REFA 4UFVA 1YLEA 1YSJA 2BUEA 4OC4A 4ZGYB 4MFLA 5HMNA 2PCUA 2ZEPA 3SI2A 1S7KA 2QECA 4UCNA 2VI7A 3GKRA 1OZPA 2GE3A 1IY7A 3CXSA 1S5KA 2CTBA 5F09A 2BCOA 2F8HA 4YFJA 1LFWA 3TT2A 3C26A 2AFOA 2F5IA
chains in the Genus database with same CATH topology
3KKWA 2OB0A 3BLNA 4F0YA 4KLVA 2HV2A 1S7LA 4XPDB 3G8WA 2A4NA 2OZUA 3S6GA 2PR8A 4EVYA 4KUAA 4X5KA 3QAHA 1Z4EA 4ZBGA 3V8IA 4AB7A 3IWGA 4H6UA 4BBHA 4ONUA 5E96A 5KTAA 4HNYB 2R1IA 4FD5A 1KUVA 2B4DA 2Q04A 1N71A 2PRBA 3EO4A 3I3GA 5G22A 1MJ9A 4U5YA 2CNMA 3JVNA 2Y0MA 3FIXA 5JPHA 2NMTA 4IF5A 1KUYA 4HNWB 4KSAA 2CY2A 3P2FA 3TO9A 4KVXA 5A28A 1L0CA 2FT0A 4NF1A 2DPSA 2QMLA 4CAFA 4KVOE 1P4NA 2REEA 4XPKA 3VWDA 4H6ZA 2YNCC 2FIWA 1M4IA 1YR0A 1CM0A 3S6HA 5F49A 3FBUA 4KVME 4H89A 2X7BA 3F5BA 1M4DA 4B5PB 1MJBA 4MFPA 2YGWA 3TCVA 1IICA 2Z3OA 4R9MA 5F48A 1YREA 3JUWA 4U9ZA 5EC4A 2VEZA 1Z9UA 2R98A 4C68A 4QC6A 1KUXA 4B11A 4NEXA 1Y9WA 3IU2A 4JXRA 2WUUA 2YNDA 3LODA 4LX9A 3EXNA 1BOBA 4R57A 4Y49B 4CRYB 2Q4YA 3FB3A 1Z4RA 5KTCA 4KS9A 1WK4A 4MHDA 2B5GA 3EY5A 1ON0A 4XNHC 4MFQA 5C88A 3CXPA 3B8GA 4UCMA 4AVBA 3T90A 3D8PA 4KOUA 4UFXA 1B6BA 4QUSA 3F8KA 1RO5A 3D3SA 3K9UA 1M1DA 3TO7A 5H84A 3PZJA 4KSFA 5F47A 4E2AA 1MJAA 3D2PA 3D2MA 4CGNA 4GS4A 4UBRA 1I1DA 2PQ8A 2PSWA 2P6GA 4M3SA 4CYOA 2YNCA 2AE6A 2JDCA 4IUSA 2VQYA 2J8RA 3R1KA 4JXQA 3G3SA 2B58A 2ZW4A 2G3TA 1WWZA 4B5OA 3EC4A 4A33A 2PC1A 2PDOA 4L8AA 3JTKA 3FRMA 4FD4A 5G1ZA 1J4JA 4XPDC 4DNCA 1ZO0A 3LD2A 4AG7A 2VZZA 4Q38A 4OLLA 1BO4A 3E0KA 4QB9A 3GY9A 3UY5A 2CNSA 2JEVA 2R8VA 1M4GA 2ZXVA 4MY3A 3W6XA 1IIDA 4MJ8A 4A95A 2Q44A 2JDDA 1Y7RA 4CAVA 3OWCA 4FD7A 2H5MA 5I0CA 1Q2YA 1YVKA 2YNEA 3TO6A 3IU1A 3FXTA 3W6SA 4BMHA 5HH1A 2Z3LA 4L89A 4R3KA 5IX3A 1MK4A 4AVAA 4YRHA 2K5TA 3DDDA 4KUBA 3P2HA 2Q4VA 3PP9A 3ZJ0A 2D4OA 2P6EA 4U9YA 1LRZA 3DR6A 4R3LA 3TTHA 1IB1E 3MGDA 1VKCA 1VHSA 2KCWA 4AVCA 2BL1A 4CRZB 2Z10A 5IV0A 1S7FA 2G0BA 3SXOA 3SHPA 5JQ4A 2I79A 2J8MA 4CAEA 5F46A 2Z11A 4C7IA 2Z3PA 4NXYA 5G20A 2B4DB 4JJXA 3TOAA 1QSRA 4QBJA 4KLWA 1S3ZA 2FL4A 2WPWA 3WR7A 3PGPA 4FD6A 3IGRA 1XMTA 4KOSA 2EUIA 5A27A 2AJ6A 1NMTA 3DR8A 2Z0ZA 2CXAA 3SXNA 3F0AA 4MFZA 1U6MA 1K4JA 2B3VA 4C2XA 2GANA 4RI1A 1PU9A 4Y49C 4QVTA 1XF8A 2PR1A 4J3GA 2J8NA 2Q7BA 1YX0A 1QSNA 2ATRA 3H4QA 1YVOA 4C7HA 3RYOA 3DSBA 3S6KA 2D4PA 2O28A 5AG5A 1Y9KA 4B14A 1GHEA 3R96A 3I9SA 4CS0B 5G21A 4PK2A 2WSAA 4HNXB 4OAEA 1Q2DA 4YGOA 4A31A 4C2ZA 2CNTA 2R7HA 4MFKA 4CAXA 4B12A 2RC4A 2FXFA 2VZYA 2P6FA 2ZW5A 5GCNA 4E0AA 5KTDA 4UFWA 1Q2CA 2Q0YA 5AG7A 4Q36A 3A9LA 4II9A 2JLMA 1R57A 2GIVA 5H86A 1PUAA 4HKFA 1P0HA 2Z3NA 1IYLA 5EBVA 4KOWA 3FNCA 4B5PA 2OH1A 4KOTA 1M44A 2B5GB 2OZGA 1UFHA 1I12A 1RXTA 5FVJA 3R9GA 4E8OA 3BJ8A 2HUZA 2FSRA 4KORA 5AGEA 3T9YA 1XE4A 1YK3A 4A30A 4CGOA 4I49A 1NE9A 2VXKA 4UWJA 4MY0A 5ISVA 3IWEA 3R9EA 1XIXA 3CXQA 1V0CA 4JWPA 4KOYA 4MBUA 4NSQA 1YGHA 1IYKA 3H5ZA 2DXQA 4MFJA 4JLYA 4PSWA 3FYNA 2FE7A 2G3AA 5AG6A 1FY7A 4XPLA 1NSLA 4M85A 2B3UA 3DNSA 4CAWA 2IL4A 4PV6A 1I21A 4UCPA 4F0XA 2HQYA 2ZW7A 2P0WA 2OU2A 2C27A 1S7NA 4B10A 2DPTA 2FS5A 1B87A 3R95A 2BSWA 5J8FA 1QSOA 2B4BA 4RS2A 4CYQA 5J8CA 2FCKA 2QIRA 2Z3KA 4F6AA 2OZHA 2ZW6A 1XEBA 3TFYA 4OADA 3VWEA 3GYAA 3R9FA 5C82A 1CJWA 4PK3A 5BWAB 2ARHA 5IB0A 2I00A 2Z3MA 4CGLA 4KOVA 3ZZIA 3TE4A 4XNHB 4AG9A 4MI4A 3N7ZA 3NE7A 4KZTA 2FIAA 1TIQA 4CGPA 2VBQA 4NCZA 4UWIA 4PSXA 1QSMA 1SQHA 4CYNA 5CNPA 4A32A 3QB8A 4CGMA 2ZPAA 4KOXA 2WPXA 3S6FA 1S60A 3TOBA 4LUAA 4K30A 4UA3A 3W91A 5DWMA 4B13A 3BJ7A 4R87A 5DWNA 2BEIA 4C2YA 4A2ZA 4ORFA 1QSTA 2EVNA 5AG4A 3EFAA 4CYPA 1KZFA 4JD6A 2REFA 4UFVA 1YLEA 2BUEA 4ZGYB 4MFLA 5HMNA 1S7KA 2QECA 4UCNA 2VI7A 3GKRA 1OZPA 2GE3A 3CXSA 1S5KA 4YFJA 3TT2A 3C26A 2F5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H5Z A;  2YNC A;  4CYO A;  4B13 A;  2YNC C;  4CAE A;  4CYQ A;  4C2Y A;  4A31 A;  4B11 A;  4C2Z A;  4C7I A;  4A2Z A;  5G20 A;  3IU2 A;  5G22 A;  2WUU A;  4A95 A;  5AG4 A;  5AG6 A;  2YND A;  4B12 A;  4CGP A;  4CYP A;  4UFW A;  5AG7 A;  5AGE A;  4C7H A;  4CYN A;  4A33 A;  4A30 A;  4CGO A;  5AG5 A;  4UFV A;  4B14 A;  4A32 A;  4CGN A;  4CGM A;  2YNE A;  3JTK A;  3IWE A;  5A27 A;  4UCP A;  4UCN A;  4BBH A;  3IU1 A;  5G1Z A;  5A28 A;  4UCM A;  4B10 A;  5G21 A;  4CGL A;  4CAF A;  4C2X A;  2WSA A;  4UFX A;  4C68 A; 
#chains in the Genus database with same CATH topology
 3KKW A;  2OB0 A;  3WC6 A;  3BLN A;  4F0Y A;  4KLV A;  4P4F A;  2HV2 A;  1CX8 A;  1S7L A;  3D7G A;  3FED A;  4XPD B;  2JBK A;  3G8W A;  1YW4 A;  2A4N A;  2OZU A;  1Z8L A;  2ABZ A;  2PE3 A;  2PR8 A;  3PBE A;  3S6G A;  5LYI A;  2ZEH A;  3WC7 A;  1X10 A;  4EVY A;  4UF4 A;  5EMI A;  4KUA A;  4X5K A;  3QAH A;  1Z4E A;  4ZBG A;  3KI9 A;  2ZEG A;  3V8I A;  3MRU A;  4EWT A;  3D4U A;  4AB7 A;  3IWG A;  4H6U A;  4IHM A;  4BBH A;  2J9A A;  4ONU A;  5E96 A;  4PXC A;  5KTA A;  4HNY B;  2R1I A;  2QJ8 A;  2CF4 A;  4FD5 A;  4FBE A;  1YLO A;  1KUV A;  2B4D A;  2Q04 A;  1N71 A;  1ZLI A;  1HDQ A;  2GRE A;  2PRB A;  4MMO A;  1EE3 P;  2PIY A;  3EO4 A;  3I3G A;  4NGT A;  4X8I A;  5G22 A;  4DUK A;  1MJ9 A;  1KWM A;  4U5Y A;  4P10 A;  2CNM A;  3B3T A;  4UEZ A;  3JVN A;  4M6H A;  2Y0M A;  1HEE A;  3FIX A;  4YU9 A;  5JPH A;  2NMT A;  3S9L A;  2GU2 A;  2DEA A;  4IF5 A;  1PYT B;  1KUY A;  2JBJ A;  4HNW B;  2C6C A;  3I1U A;  1XJO A;  2CY2 A;  4KSA A;  4Z65 A;  3P2F A;  4A37 A;  3TO9 A;  4KVX A;  5A28 A;  1L0C A;  3IIB A;  2FT0 A;  4NF1 A;  5IB9 A;  1Z8W A;  2DPS A;  3NE8 A;  2QML A;  4CAF A;  3RBU A;  4KVO E;  4UIA A;  1P4N A;  2REE A;  4HPS A;  4P45 A;  4XPK A;  5THW A;  4OIW A;  5K8P A;  4P6Y A;  3VWD A;  4H6Z A;  2YNC C;  4P4I A;  2FIW A;  4MCP A;  4NJQ A;  1M4I A;  1YR0 A;  1CM0 A;  3S6H A;  5F49 A;  3FBU A;  4KVM E;  4H89 A;  2X7B A;  3F5B A;  2EK9 A;  1M4D A;  4B5P B;  1MJB A;  1BAV A;  2I3C A;  4MFP A;  2YGW A;  3KHX A;  3TC8 A;  4MHN A;  3TCV A;  1IIC A;  2Z3O A;  4R9M A;  1JWQ A;  5F48 A;  1YRE A;  2V8G A;  3JUW A;  4U9Z A;  4ZX8 A;  2PJ8 A;  4GM5 A;  5EC4 A;  2VEZ A;  4NFR A;  3B3V A;  2PJ0 A;  2HC9 A;  4H2K A;  4AXV A;  4EME A;  1Z9U A;  2EO8 A;  2R98 A;  3D68 A;  1HDU A;  3N5F A;  4OC3 A;  4C68 A;  1XFO A;  4QC6 A;  3QNV A;  1KUX A;  4B11 A;  3PB7 X;  4NEX A;  5HVG A;  4NGN A;  1Y9W A;  3IU2 A;  4JXR A;  2WUU A;  3RZA A;  5LYD A;  2YND A;  3LOD A;  4LX9 A;  2HB6 A;  1DTD A;  3EXN A;  1BOB A;  4OKO A;  1Z2L A;  4R57 A;  4Y49 B;  4CRY B;  4MCR A;  2PJ1 A;  2Q4Y A;  1Z4R A;  3FB3 A;  2AFX A;  4KS9 A;  4NGR A;  1WK4 A;  4MHD A;  5KTC A;  1TF9 A;  4WJB A;  2B5G A;  3EY5 A;  4UIB A;  4A94 A;  1ON0 A;  1X12 A;  3RAM A;  2C6G A;  5LRK A;  4XNH C;  4MFQ A;  2PJ3 A;  5C88 A;  2Q51 A;  3CXP A;  3B8G A;  4UCM A;  5D29 A;  2IMO A;  4AVB A;  3PFE A;  1ZG9 A;  3T90 A;  5HVH A;  5LYF A;  3D8P A;  3NA6 A;  4ZY2 A;  4A39 A;  4KOU A;  4UFX A;  4ZY1 A;  1B6B A;  4QUS A;  3F8K A;  1BPM A;  1RO5 A;  3D3S A;  1M4L A;  3K9U A;  1F2O A;  2ANP A;  1A2Z A;  1M1D A;  3TO7 A;  5H84 A;  3PZJ A;  4KSF A;  1BLL E;  2ODF A;  5F47 A;  4MRI A;  4E2A A;  2ZEL A;  1MJA A;  3D2P A;  5JGF A;  4PXD A;  1OBR A;  3CZX A;  3D2M A;  2PRQ A;  4CGN A;  4GS4 A;  1H8L A;  4UBR A;  1CPX A;  1I1D A;  3D7H A;  2PQ8 A;  3FVL A;  4BIN A;  2PSW A;  4NGS A;  2V8V A;  3KQX A;  1QMU A;  2P6G A;  4M3S A;  4UEF A;  2EBJ A;  4P44 A;  4YWY A;  4CYO A;  2YNC A;  3V7Z A;  3FJU A;  2AE6 A;  2VL1 A;  2JDC A;  3DLJ A;  4NJR A;  1CBX A;  3B35 A;  4IUS A;  2VQY A;  1ARM A;  3PEI A;  2J8R A;  3R1K A;  1YQE A;  4JXQ A;  3G3S A;  2B58 A;  2ZW4 A;  2G3T A;  2PJ9 A;  2V8D A;  3WC5 A;  1F57 A;  2PVW A;  1WWZ A;  4B5O A;  3EC4 A;  4PPZ A;  3BHX A;  2WZN A;  4A33 A;  1Y0R A;  1IU8 A;  1CP6 A;  2PC1 A;  2PDO A;  4WWV A;  4L8A A;  4F9U A;  3KZW A;  3JTK A;  1YW6 A;  2ZOF A;  2G9D A;  3FRM A;  3KL9 A;  1RTQ A;  4FD4 A;  5G1Z A;  4MCS A;  1J4J A;  2GFQ A;  4JYW A;  3SJE A;  4XPD C;  4DNC A;  1ZO0 A;  2C1C A;  3LD2 A;  4AG7 A;  2VZZ A;  4Q38 A;  3D7D A;  3FMC A;  4JZ0 A;  4OLL A;  1BO4 A;  3E0K A;  3H8F A;  4A38 A;  4QB9 A;  5K8N A;  3GY9 A;  2OOT A;  3CPA A;  3UY5 A;  2CNS A;  2JEV A;  2R8V A;  1M4G A;  2ZXV A;  1LAN A;  4OC2 A;  2V8H A;  4MY3 A;  3W6X A;  1IID A;  4MJ8 A;  4A95 A;  5J1Q A;  2Q44 A;  1PCA A;  2JDD A;  4M6I A;  1Y7R A;  2CIJ A;  2FVG A;  4OC0 A;  4CAV A;  1DE4 C;  2XEF A;  3SI0 A;  3OWC A;  4BD9 A;  4FD7 A;  2H5M A;  5I0C A;  4P4B A;  1Q2Y A;  1YVK A;  2YNE A;  4FAI A;  3PBB A;  1Z8T A;  3QAY A;  4OP4 A;  2BOA A;  3IU1 A;  3FXT A;  3TO6 A;  3W6S A;  4BMH A;  3GLJ A;  4RUH A;  4B6Z A;  5HH1 A;  1TKF A;  2Z3L A;  4L89 A;  4R3K A;  3D66 A;  5LYL A;  2DF5 A;  4NGM A;  2RB7 A;  1MK4 A;  5IX3 A;  4R76 A;  4AVA A;  1CPS A;  3T8W A;  4YRH A;  2K5T A;  4CPA A;  3DDD A;  4KUB A;  2Q7S A;  1Y0Y A;  2Q4V A;  3P2H A;  3PP9 A;  3ZJ0 A;  2D4O A;  3VAR A;  1AYE A;  3IC1 A;  2P6E A;  1VIX A;  4U9Y A;  1LRZ A;  4OC5 A;  3DR6 A;  2IJZ A;  2ZED A;  4R3L A;  3TTH A;  1IB1 E;  3MGD A;  2GLF A;  1VKC A;  2CTC A;  4TNU A;  1VHS A;  1XMB A;  2KCW A;  1UWY A;  4FUU A;  3KAS A;  4X3R A;  4AVC A;  5HXD A;  1XBU A;  2BL1 A;  2O53 A;  4ONW A;  4CRZ B;  2XEJ A;  3RO0 A;  1R43 A;  2Z10 A;  5IV0 A;  1S7F A;  2G0B A;  1ZG8 A;  5LRG A;  1FT7 A;  3SXO A;  3SHP A;  5JQ4 A;  2I79 A;  2J8M A;  3SJF A;  4CAE A;  2Z11 A;  3PFO A;  4G1P A;  3BXM A;  4C7I A;  5F46 A;  2Z3P A;  4NXY A;  3PB4 X;  2OR4 A;  4O23 A;  5G20 A;  2B4D B;  6CPA A;  4JJX A;  3TOA A;  1QSR A;  4QBJ A;  4KLW A;  1S3Z A;  5K8O A;  2FL4 A;  3IJ3 A;  3IFE A;  2WPW A;  3DGV A;  3WR7 A;  3B3W A;  3S9M A;  3PGP A;  4FD6 A;  5ELY A;  1YME A;  1XMT A;  2WYR A;  1AUG A;  3IGR A;  4KOS A;  2EUI A;  3IWW A;  2AJ6 A;  5A27 A;  1NMT A;  3PB6 X;  3DR8 A;  4IK2 A;  2Z0Z A;  2CXA A;  3SXN A;  3NH4 A;  3F0A A;  3PB8 X;  4KSI A;  4MFZ A;  1U6M A;  1K4J A;  2B3V A;  4GXH A;  4R8F A;  4C2X A;  2GAN A;  4RI1 A;  1PU9 A;  4Y49 C;  1LCP A;  3L2N A;  4QVT A;  2EK8 A;  1XF8 A;  2PR1 A;  4J3G A;  3LWU A;  2J8N A;  2Q7B A;  1LOK A;  4P4D A;  3D67 A;  5CPA A;  1IOF A;  1YX0 A;  1QSN A;  4UEE A;  3RNZ A;  3FEE A;  3GB0 A;  3GIU A;  4ZY0 A;  4MHZ A;  2ATR A;  4TWE A;  3H4Q A;  1YVO A;  4C7H A;  3RYO A;  3DSB A;  3S6K A;  2D4P A;  4RN7 A;  1IGB A;  1ZLH A;  2O28 A;  1Y9K A;  5AG5 A;  4B14 A;  1GHE A;  3R96 A;  3FEC A;  2XEI A;  3I9S A;  8CPA A;  4CS0 B;  2JEW A;  5G21 A;  4PK2 A;  2WSA A;  4HNX B;  1Z5R A;  3MN8 A;  4OAE A;  1Q2D A;  1VHE A;  4YGO A;  2IQ6 A;  2ZEF A;  3VH9 A;  4A31 A;  4C2Z A;  2RFH A;  2CNT A;  2R7H A;  2NSM A;  5CBM A;  4MFK A;  4CAX A;  4B12 A;  2RC4 A;  2FXF A;  2VZY A;  2P6F A;  2PJA A;  2ZW5 A;  5GCN A;  4E0A A;  5KTD A;  4UFW A;  1Q2C A;  2Q0Y A;  5AG7 A;  3FX6 A;  3K9T A;  1ARL A;  4Q36 A;  3A9L A;  3H8E A;  4II9 A;  3KQZ A;  2PJB A;  2V77 A;  2JLM A;  1R57 A;  4F9V A;  1IOI A;  2GIV A;  5H86 A;  1PUA A;  1ZG7 A;  1P0H A;  2Z3N A;  4HKF A;  1LAM A;  1IYL A;  5JH9 A;  2PIZ A;  5EBV A;  4KOW A;  2PJC A;  3FNC A;  2PJ4 A;  4B5P A;  2AFM A;  2OH1 A;  3IO1 A;  1M44 A;  2B5G B;  4KOT A;  2OZG A;  1UFH A;  4PXB A;  1I12 A;  1CP7 A;  1RXT A;  3V38 A;  1QQ9 A;  5K8M A;  2POK A;  4FWU A;  3BI1 A;  5FVJ A;  4ZYQ A;  2AFZ A;  2QYV A;  4DJL A;  2Q43 A;  3R9G A;  4E8O A;  3BJ8 A;  3B7I A;  3VAT A;  2HUZ A;  1R3N A;  2FSR A;  3CDX A;  4KOR A;  4NGP A;  5AGE A;  2ZEM A;  3T9Y A;  4MHY A;  1TKJ A;  1XE4 A;  3IEH A;  1YK3 A;  1NSA A;  4A30 A;  4CGO A;  4I49 A;  1NE9 A;  2VXK A;  4UWJ A;  2F7V A;  4MY0 A;  5ISV A;  3IWE A;  3B3C A;  3R9E A;  3LAC A;  4R6T A;  1ELL P;  4NGQ A;  1XIX A;  1XRY A;  1V0C A;  3CXQ A;  4JWP A;  4KOY A;  4MBU A;  3WT4 A;  4NSQ A;  3CPX A;  1YGH A;  1IYK A;  3H5Z A;  2DXQ A;  4MFJ A;  2Q4Z A;  4OC1 A;  4JLY A;  4PSW A;  4F8Z A;  1GYT A;  1XOV A;  3FYN A;  3S9N A;  1TXR A;  2AFS A;  2FE7 A;  2G3A A;  2GLJ A;  3SJG A;  5JM6 A;  5AG6 A;  1FY7 A;  4XPL A;  4MCQ A;  1LAP A;  3K2K A;  4M6G A;  1NSL A;  3D7F A;  1VHO A;  3B2Y A;  4M85 A;  1BPN A;  2B3U A;  3DNS A;  4CAW A;  2BO9 A;  2IL4 A;  1I21 A;  4PV6 A;  4UCP A;  4F0X A;  2HQY A;  2ZW7 A;  2P0W A;  3PRT A;  2OU2 A;  2C27 A;  1S7N A;  4B10 A;  2DPT A;  2FS5 A;  2ZEN A;  2XEG A;  2PJ7 A;  1B87 A;  3R95 A;  2BSW A;  3HUV A;  3KHZ A;  5J8F A;  1QSO A;  2B4B A;  2O4H A;  4PXE A;  4RS2 A;  1VGY A;  4CYQ A;  2FCK A;  5J8C A;  3SI1 A;  2QIR A;  3SJX A;  1Z8X A;  2Z3K A;  4F6A A;  2OZH A;  2ZW6 A;  3KR4 A;  3NH5 A;  4IAV A;  1XEB A;  5D8N A;  3TFY A;  4LQG A;  4OAD A;  3VWE A;  2ZEO A;  3GYA A;  4DYO A;  2PVV A;  2NYQ A;  4R7M A;  4ZX9 A;  3R9F A;  5C82 A;  2PJ2 A;  1CJW A;  4PK3 A;  5LRJ A;  5BWA B;  2ARH A;  2PJ5 A;  2PJ6 A;  4EFD A;  2I00 A;  5IB0 A;  3TX8 A;  1CG2 A;  2Z3M A;  4CGL A;  4KOV A;  4OID A;  3ZZI A;  4MXU A;  3LMS A;  4W9Y A;  3TE4 A;  4XNH B;  1ELM P;  4P4E A;  1AMP A;  1JQG A;  2ZOG A;  3WAB A;  3BI0 A;  3NFZ A;  4AG9 A;  4MI4 A;  4PQA A;  3N7Z A;  3NE7 A;  4KZT A;  2FIA A;  1TIQ A;  2QVP A;  1TKH A;  2C6P A;  4X2T A;  2VBQ A;  4NCZ A;  4CGP A;  4UWI A;  2EWB A;  4PSX A;  1QSM A;  1SQH A;  4CYN A;  4ZI6 A;  3HLP A;  2ZEE A;  5CNP A;  4A32 A;  3NH8 A;  3QB8 A;  4CGM A;  2ZPA A;  4KOX A;  3GUX A;  2WPX A;  3B3S A;  3KR5 A;  3H8G A;  4MHP A;  3S6F A;  3FH4 A;  4P4J A;  1S60 A;  1FNO A;  2AFU A;  4OME A;  3PB9 X;  3TOB A;  5HVF A;  4LUA A;  2AFW A;  4K30 A;  4UA3 A;  3W91 A;  5DWM A;  1Q7L A;  7CPA A;  4B13 A;  3BJ7 A;  4R87 A;  5DWN A;  2BEI A;  4C2Y A;  4LQ6 A;  4A2Z A;  4ORF A;  1QST A;  5I4M A;  2EVN A;  3ISX A;  5AG4 A;  1TF8 A;  3EFA A;  4Q7A A;  4CYP A;  3FF3 A;  5DS0 A;  1Y7E A;  1KZF A;  3ISZ A;  3CT9 A;  4K3N A;  1F2P A;  3JRU A;  3KGQ A;  4JD6 A;  2REF A;  4UFV A;  1YLE A;  1YSJ A;  2BUE A;  4OC4 A;  4ZGY B;  4MFL A;  5HMN A;  2PCU A;  2ZEP A;  3SI2 A;  1S7K A;  2QEC A;  4UCN A;  2VI7 A;  3GKR A;  1OZP A;  2GE3 A;  1IY7 A;  3CXS A;  1S5K A;  2CTB A;  5F09 A;  2BCO A;  2F8H A;  4YFJ A;  1LFW A;  3TT2 A;  3C26 A;  2AFO A;  2F5I A; 
#chains in the Genus database with same CATH homology
 3KKW A;  2OB0 A;  3BLN A;  4F0Y A;  4KLV A;  2HV2 A;  1S7L A;  4XPD B;  3G8W A;  2A4N A;  2OZU A;  3S6G A;  2PR8 A;  4EVY A;  4KUA A;  4X5K A;  3QAH A;  1Z4E A;  4ZBG A;  3V8I A;  4AB7 A;  3IWG A;  4H6U A;  4BBH A;  4ONU A;  5E96 A;  5KTA A;  4HNY B;  2R1I A;  4FD5 A;  1KUV A;  2B4D A;  2Q04 A;  1N71 A;  2PRB A;  3EO4 A;  3I3G A;  5G22 A;  1MJ9 A;  4U5Y A;  2CNM A;  3JVN A;  2Y0M A;  3FIX A;  5JPH A;  2NMT A;  4IF5 A;  1KUY A;  4HNW B;  4KSA A;  2CY2 A;  3P2F A;  3TO9 A;  4KVX A;  5A28 A;  1L0C A;  2FT0 A;  4NF1 A;  2DPS A;  2QML A;  4CAF A;  4KVO E;  1P4N A;  2REE A;  4XPK A;  3VWD A;  4H6Z A;  2YNC C;  2FIW A;  1M4I A;  1YR0 A;  1CM0 A;  3S6H A;  5F49 A;  3FBU A;  4KVM E;  4H89 A;  2X7B A;  3F5B A;  1M4D A;  4B5P B;  1MJB A;  4MFP A;  2YGW A;  3TCV A;  1IIC A;  2Z3O A;  4R9M A;  5F48 A;  1YRE A;  3JUW A;  4U9Z A;  5EC4 A;  2VEZ A;  1Z9U A;  2R98 A;  4C68 A;  4QC6 A;  1KUX A;  4B11 A;  4NEX A;  1Y9W A;  3IU2 A;  4JXR A;  2WUU A;  2YND A;  3LOD A;  4LX9 A;  3EXN A;  1BOB A;  4R57 A;  4Y49 B;  4CRY B;  2Q4Y A;  3FB3 A;  1Z4R A;  5KTC A;  4KS9 A;  1WK4 A;  4MHD A;  2B5G A;  3EY5 A;  1ON0 A;  4XNH C;  4MFQ A;  5C88 A;  3CXP A;  3B8G A;  4UCM A;  4AVB A;  3T90 A;  3D8P A;  4KOU A;  4UFX A;  1B6B A;  4QUS A;  3F8K A;  1RO5 A;  3D3S A;  3K9U A;  1M1D A;  3TO7 A;  5H84 A;  3PZJ A;  4KSF A;  5F47 A;  4E2A A;  1MJA A;  3D2P A;  3D2M A;  4CGN A;  4GS4 A;  4UBR A;  1I1D A;  2PQ8 A;  2PSW A;  2P6G A;  4M3S A;  4CYO A;  2YNC A;  2AE6 A;  2JDC A;  4IUS A;  2VQY A;  2J8R A;  3R1K A;  4JXQ A;  3G3S A;  2B58 A;  2ZW4 A;  2G3T A;  1WWZ A;  4B5O A;  3EC4 A;  4A33 A;  2PC1 A;  2PDO A;  4L8A A;  3JTK A;  3FRM A;  4FD4 A;  5G1Z A;  1J4J A;  4XPD C;  4DNC A;  1ZO0 A;  3LD2 A;  4AG7 A;  2VZZ A;  4Q38 A;  4OLL A;  1BO4 A;  3E0K A;  4QB9 A;  3GY9 A;  3UY5 A;  2CNS A;  2JEV A;  2R8V A;  1M4G A;  2ZXV A;  4MY3 A;  3W6X A;  1IID A;  4MJ8 A;  4A95 A;  2Q44 A;  2JDD A;  1Y7R A;  4CAV A;  3OWC A;  4FD7 A;  2H5M A;  5I0C A;  1Q2Y A;  1YVK A;  2YNE A;  3TO6 A;  3IU1 A;  3FXT A;  3W6S A;  4BMH A;  5HH1 A;  2Z3L A;  4L89 A;  4R3K A;  5IX3 A;  1MK4 A;  4AVA A;  4YRH A;  2K5T A;  3DDD A;  4KUB A;  3P2H A;  2Q4V A;  3PP9 A;  3ZJ0 A;  2D4O A;  2P6E A;  4U9Y A;  1LRZ A;  3DR6 A;  4R3L A;  3TTH A;  1IB1 E;  3MGD A;  1VKC A;  1VHS A;  2KCW A;  4AVC A;  2BL1 A;  4CRZ B;  2Z10 A;  5IV0 A;  1S7F A;  2G0B A;  3SXO A;  3SHP A;  5JQ4 A;  2I79 A;  2J8M A;  4CAE A;  5F46 A;  2Z11 A;  4C7I A;  2Z3P A;  4NXY A;  5G20 A;  2B4D B;  4JJX A;  3TOA A;  1QSR A;  4QBJ A;  4KLW A;  1S3Z A;  2FL4 A;  2WPW A;  3WR7 A;  3PGP A;  4FD6 A;  3IGR A;  1XMT A;  4KOS A;  2EUI A;  5A27 A;  2AJ6 A;  1NMT A;  3DR8 A;  2Z0Z A;  2CXA A;  3SXN A;  3F0A A;  4MFZ A;  1U6M A;  1K4J A;  2B3V A;  4C2X A;  2GAN A;  4RI1 A;  1PU9 A;  4Y49 C;  4QVT A;  1XF8 A;  2PR1 A;  4J3G A;  2J8N A;  2Q7B A;  1YX0 A;  1QSN A;  2ATR A;  3H4Q A;  1YVO A;  4C7H A;  3RYO A;  3DSB A;  3S6K A;  2D4P A;  2O28 A;  5AG5 A;  1Y9K A;  4B14 A;  1GHE A;  3R96 A;  3I9S A;  4CS0 B;  5G21 A;  4PK2 A;  2WSA A;  4HNX B;  4OAE A;  1Q2D A;  4YGO A;  4A31 A;  4C2Z A;  2CNT A;  2R7H A;  4MFK A;  4CAX A;  4B12 A;  2RC4 A;  2FXF A;  2VZY A;  2P6F A;  2ZW5 A;  5GCN A;  4E0A A;  5KTD A;  4UFW A;  1Q2C A;  2Q0Y A;  5AG7 A;  4Q36 A;  3A9L A;  4II9 A;  2JLM A;  1R57 A;  2GIV A;  5H86 A;  1PUA A;  4HKF A;  1P0H A;  2Z3N A;  1IYL A;  5EBV A;  4KOW A;  3FNC A;  4B5P A;  2OH1 A;  4KOT A;  1M44 A;  2B5G B;  2OZG A;  1UFH A;  1I12 A;  1RXT A;  5FVJ A;  3R9G A;  4E8O A;  3BJ8 A;  2HUZ A;  2FSR A;  4KOR A;  5AGE A;  3T9Y A;  1XE4 A;  1YK3 A;  4A30 A;  4CGO A;  4I49 A;  1NE9 A;  2VXK A;  4UWJ A;  4MY0 A;  5ISV A;  3IWE A;  3R9E A;  1XIX A;  3CXQ A;  1V0C A;  4JWP A;  4KOY A;  4MBU A;  4NSQ A;  1YGH A;  1IYK A;  3H5Z A;  2DXQ A;  4MFJ A;  4JLY A;  4PSW A;  3FYN A;  2FE7 A;  2G3A A;  5AG6 A;  1FY7 A;  4XPL A;  1NSL A;  4M85 A;  2B3U A;  3DNS A;  4CAW A;  2IL4 A;  4PV6 A;  1I21 A;  4UCP A;  4F0X A;  2HQY A;  2ZW7 A;  2P0W A;  2OU2 A;  2C27 A;  1S7N A;  4B10 A;  2DPT A;  2FS5 A;  1B87 A;  3R95 A;  2BSW A;  5J8F A;  1QSO A;  2B4B A;  4RS2 A;  4CYQ A;  5J8C A;  2FCK A;  2QIR A;  2Z3K A;  4F6A A;  2OZH A;  2ZW6 A;  1XEB A;  3TFY A;  4OAD A;  3VWE A;  3GYA A;  3R9F A;  5C82 A;  1CJW A;  4PK3 A;  5BWA B;  2ARH A;  5IB0 A;  2I00 A;  2Z3M A;  4CGL A;  4KOV A;  3ZZI A;  3TE4 A;  4XNH B;  4AG9 A;  4MI4 A;  3N7Z A;  3NE7 A;  4KZT A;  2FIA A;  1TIQ A;  4CGP A;  2VBQ A;  4NCZ A;  4UWI A;  4PSX A;  1QSM A;  1SQH A;  4CYN A;  5CNP A;  4A32 A;  3QB8 A;  4CGM A;  2ZPA A;  4KOX A;  2WPX A;  3S6F A;  1S60 A;  3TOB A;  4LUA A;  4K30 A;  4UA3 A;  3W91 A;  5DWM A;  4B13 A;  3BJ7 A;  4R87 A;  5DWN A;  2BEI A;  4C2Y A;  4A2Z A;  4ORF A;  1QST A;  2EVN A;  5AG4 A;  3EFA A;  4CYP A;  1KZF A;  4JD6 A;  2REF A;  4UFV A;  1YLE A;  2BUE A;  4ZGY B;  4MFL A;  5HMN A;  1S7K A;  2QEC A;  4UCN A;  2VI7 A;  3GKR A;  1OZP A;  2GE3 A;  3CXS A;  1S5K A;  4YFJ A;  3TT2 A;  3C26 A;  2F5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...