2YNHB

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
406
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
molecule tags Hydrolase
source organism Hiv-1 m\:b_hxb2r
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
total genus 113
structure length 406
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhB03
3RB4A 1S9GB 2W8KA 2YNIB 2YNGB 4TY8B 4RZRA 2ASDA 4H4MB 4Q45A 2BANB 3BREA 3PW0A 4QWDA 2W9BA 1HYSA 2GIRA 4GC7A 4EEYA 3NBPA 1GX5A 4EBEA 4DL2A 3C6UB 3OSPA 4IDKB 3MF5A 2R2SA 4YMEA 4RUCA 1HNVA 1Z4UA 3MEDA 5KFIA 3H4BA 2ATLA 3SI8A 4RU9A 5JUMA 4NRTA 2RDJA 5KFDA 1N56A 3HKWA 3PJWA 3E01B 2VG6A 3KHHA 4M95A 2JEIA 2BE2B 5KT7A 2BRKA 1RTDA 4H4MA 2W7PA 4IRCA 3C6TB 2XCPA 4FS2A 2I5JA 4RW7A 4IG3B 2W9BB 3GIMA 4I7FA 3MTKA 4EBDA 5K14A 4R5PB 2HNZA 4O4GB 1RTJB 3IG1A 1SH3A 3CDWA 4MKBA 4NCGB 4J9LA 4U6PA 4URQU 1R0AA 3MECB 1K1QA 2B6AA 5I42A 1BQMB 3BSCA 5I3UA 3V81B 3H5SA 1MMLA 5KFFA 2HAIA 2RKIB 1FK9B 2WOMB 2WONB 4DG1A 2R2UA 2BANA 4IKAA 4M94A 5KG4A 5DLFA 4Q8EA 4PQUB 1HYSB 4LQ9A 4YP3A 3GIJA 5DLGA 3LP2B 3LP0B 4J9OA 3DRSB 4YQWA 3KNAA 4KB7A 3BR9A 4EYIB 2UUTA 4YR3A 2E9TA 1RT5B 4FS1A 4MIBA 1K1SA 4IFVA 5DGAA 3BQ0A 3DI6B 3KLEA 5KFJA 3FQLA 2V4QA 3KLHB 3KHLA 1FK9A 2WOMA 5HLFA 4JV0A 4J9RA 2IM0A 5F8IA 1IM4A 1T3NA 1N6QA 1LWEA 1BQNA 3OHBA 4O4GA 2WCXA 5C5JA 1QAIA 1C0UB 4KKOB 1YVFA 5KFAA 3T5HA 3RAQA 2C2RA 1S9FA 1S10A 1TKTB 2JEJA 2IBKA 4ZPAA 3SFGA 1RT5A 3UPFA 4I2PB 1J5OB 3T1AA 1TQLA 4NYZA 1SH0A 4TQSA 2AU0A 3LP1B 5HP1A 1HNVB 4RW6A 4O3PA 3T5LA 5J2MB 5HLFB 1HARA 5KT5A 3GILA 1HPZA 3Q8PB 1ZTTA 1S97A 4Q0BA 4KO0A 3E51A 1C1CB 2VG7B 4O44B 3HVWA 5DQGA 3OHAA 3PW2A 4FBTA 3IRXB 3CJ4A 3HHKA 4MIAA 3GV5B 2R8KA 4MK8A 3OL9A 4IG3A 3KK1A 3NKYA 4ZVFA 4Q44A 2JC0A 5L1JA 2HWHA 2HNZB 5KFHA 2R8HA 1S4FA 1RT4A 3TQ1A 3KLIB 3QO9B 5KG7A 2WTFA 4H4OB 3MR3A 1LW2B 1W25A 2IJNA 5CYQA 1ZTWA 1TKZB 2XWYA 3QYYA 4DL5A 2JEGA 4QWBA 3OL7A 1VRUB 4O44A 4O3QA 4QW9A 3KLHA 2R2TA 2QV6A 2YKNB 3UR0A 2B5JA 5KFBA 5DG8A 2FLLA 5F8NA 1RT7A 2D41A 4ECSA 3EPIA 3H59A 1QAJA 2XI2A 1HQUA 2BRLA 3PJXA 3MFIA 3N6MA 4WXOA 3PW5A 1VRTB 1EP4B 4ED0A 1TKTA 1KHVA 4XPCA 2HNDB 4RW9A 3H5YA 4LQ3A 2YKMB 4LSNB 4YR2A 3JSMB 1RTHA 3DM2B 2XGPA 4XPEA 1FKOB 1LWCB 4RNOA 1C1BA 3MEGB 4O3NA 2D7SA 1SV5B 5L1LA 5KT2A 1T05B 4ZP6A 3KMSA 4WZMA 1S1XA 2IM3A 2B43A 5J2PB 4KO0B 3I5BA 4ZPBA 4QWEA 4O3SA 3CDEA 4EO8A 1EP4A 1SH2A 4RW9B 4WFZA 1MU2A 3LP1A 2CKWA 3KHRA 4NLXA 3QGGA 2FJWA 3CJ0A 1JLQA 5F9NA 4ZHRA 1IKYB 2RF2A 3DOKB 4TYAA 1S1XB 1N5YB 2IA6A 2UVVA 4KFBB 3QIPB 1HNIA 5KFLA 2V4RA 1TV6B 3KJVB 3D28A 3OL8A 4ED1A 5DG7A 2UUWA 4QWCA 2VG5A 1C2PA 3RBEA 1JLGA 3BQ2A 4JV1A 1JLFB 2E9RX 3BJYA 1S1WB 4RNHA 1RTHB 5KFCA 3C6UA 2ILZA 4K4SA 1RDRA 3T19A 5K14B 3FFIA 4R5PA 4ED8A 1JLBA 1XR6A 1RT2B 2C22A 5CYMA 5KFKA 4RW8B 2GIQA 5KFQA 3GV7B 2JC1A 2OPQA 5KG1A 3LP2A 1VRUA 2VG6B 4ZP8A 5L1KA 3MEGA 5J1EB 3V6KA 4XO0A 3PHEA 4URSA 2ASLA 4IG0B 1RT1A 3LAMA 4TLRA 5KFTA 5KFSA 5KFXA 1GX6A 1S0NA 4DL7A 4DL6A 5L1IA 2VA2A 2WHOA 4IRDA 3H5XA 1JLBB 1VRTA 4Y2CA 4QWAA 4HYKA 3MECA 2FLNA 1KLMB 2QE5A 5KFZA 4IR1A 1BQNB 3GV8B 3MR6A 1MU2B 1RA6A 3DLGB 2F8EX 4ECUA 4ECWA 1LWFB 1S9EB 2EC0A 4MFBB 5FDLB 4IG0A 4NLOA 4PQUA 3BSAA 2R8GA 2C28A 2C2DA 1LW0B 3DYAB 3QIPA 3BGRA 1TV6A 3QZ7A 4K4WA 1RT3A 3CJ2A 3PZPA 3T5KA 5J2MA 5KFYA 2ZE2B 3TAMB 4RW8A 5KG2A 4IRKA 2OPQB 2IM2A 4TYBA 4WFYA 3IGVA 1S0OA 4PWDB 2XC9A 3I0RB 4U7CA 4LSLB 4IH6A 4DEZA 2FVPA 3GIIA 4JV2A 2W9AA 1DTTA 3IN5A 4KV8B 3Q8RB 1HNIB 1LWEB 3BSNA 3KJVA 3RB6A 3BGRB 3KK3A 3QO9A 2D3ZA 5J1EA 4WXWA 3DLKB 4Q43A 3V4IB 4IOBA 4NLRA 2XGQA 4EYHB 5KFNA 5F8JA 2YNHA 3DRRA 2YNFB 5CYQB 3QLHA 3HVAA 4WFXA 3MR5A 3CJ5A 1XR7A 5HP1B 1ZETA 4IDKA 4WYWA 4RW6B 3KLIA 5CYMB 2E9ZA 1T03A 1U09A 1S1TA 2OPSA 1KHWA 1S1UA 5DG9A 2WK4A 2O5DA 5EWEA 4KHMA 4NLWA 4ECTA 3NMAA 5HBMA 4O3OA 3M9NB 2ILYA 3OLBA 5KT6A 3DLKA 4MFBA 2B5JB 5FDLA 2IJFA 3V6JA 5C24A 3JSMA 2FVSA 1JKHA 4ZVEA 1FKOA 1LWCA 3LAKA 3RAXA 4PWDA 1DTQA 3DRPA 1RTJA 3IG1B 5J2QB 1DTTB 1N48A 1JLEA 3UDLA 2OPSB 4NLPA 3SFUA 1JLAA 3DLEA 3DLGA 2DPIA 2DPJA 2BQRA 2IMWP 3ISND 3CWJA 2YKNA 3EPGA 2JEFA 2RDIA 4Y2AA 2I5JB 4RW7B 2OPPB 3QLHB 2GC8A 4RNMA 4ED2A 3V6DA 2OPRB 3ISNC 4J9PA 1N4LA 2IAJA 5KFWA 4GC6A 3PW4A 3KMQA 1DTQB 3DRPB 2AX1A 4NCGA 2HNYB 2HNDA 1SUQB 1FKPB 3I0SB 1BQMA 2FJXA 2UVWA 1JLEB 5KFUA 4IFVB 1JX4A 1T94A 3IGNA 3I5CA 2R8IA 4HKQA 3PR5B 3N6NA 3PW7A 1QUVA 4DL3A 3H2LA 4NLVA 5KG6A 3CJ3A 3H98A 4RW4B 2ASJA 4ECVA 3JYTB 2AGPA 1S48A 4Y3CA 1JLCA 4K4XA 5HBMB 3FRZA 4IFYB 2XI3A 3TVKA 4YR0A 3RB0A 1IKVB 4ID5A 1JLGB 5J2NA 2J6UA 1EETB 2YNFA 3FSIA 2WB4A 3M8QB 2J6SA 1TL1A 1TKXA 2HMIA 3KLVA 1HQEA 3CIZA 3RBDA 3FFIB 2WRMA 3DOKA 1RT2A 2HWIA 2W9CA 1S1TB 4Q8FA 5F8LA 4DL4A 1N6QB 1S6PB 1N5YA 3KK2B 3KLGB 1RAJA 3N6LA 4Q0BB 5KT4A 3H5UA 4NLDA 3PR4A 4R0EA 1RTIB 3IRXA 2YNIA 5KFOA 1IKVA 3RB3A 1JLFA 4ECQA 3KLFA 5C24B 2OPPA 3M9OB 3GIKA 3GYNA 3V6DB 3D5MA 5C25A 4G3IA 4F4YA 1S49A 4MK7A 5F8HA 4K4ZA 3MEDB 3IS9B 4J9NA 1KLMA 4H4OA 5D3GA 4B3OA 2BR0A 2OH2A 3KK2A 2ZD1A 1RT3B 4H54A 5F9LA 2YNGA 4TY8A 3I5AA 4TQRA 1IKWB 2FVQA 4ID5B 1NNDA 5J2NB 1RT1B 4QW8A 3C6TA 4Y34A 4R8UA 5F8MA 4NLGA 4X2BA 2OPRA 3MFHA 1LW0A 1C0TB 1TKXB 5HROB 1WNEA 2IAJB 4MKAA 4ZMMA 5C25B 4ZPDA 4LSLA 2HNYA 4IFYA 3CVKA 3NAIA 4KBIA 4IH5A 4KV8A 5C42B 1JXLA 5EUHA 1LW2A 1NHUA 3DOLB 2CJQA 3KLGA 2FVRA 3NBPB 3DM2A 1REVA 3GQCA 2ZD1B 3CO9A 3M9MB 2W7OA 1RA7A 4I2QB 3G6VA 3G6XA 4ED3A 1LWFA 1S9EA 1D0EA 4KE5A 4FBUA 2WONA 3HVTA 3CDUA 1S1VB 1S6QB 5KFMA 3DYAA 4I7FB 5EDWA 3FQKA 4OL8A 1HQUB 5J2PA 3QZ8A 3OL6A 2D3UA 3KK3B 5KT3A 2BE2A 4EBCA 4MH8A 3IS9A 1R0AB 4NLYA 1EETA 4ICLA 5C42A 1IKXB 3V81A 4WYLA 1S1UB 3DMJB 2ALZA 1I6JA 1C1BB 3KLEB 3MEEB 3I0RA 1SV5A 1JLQB 2V9WA 4ZHRB 1T03B 4ECYA 3HVTB 1HMVB 3QGHA 5D3GB 4B3OB 4KHRA 3MR2A 3PVXA 1TL3A 1TVRA 2UVRA 3DRSA 3LALA 5L9XA 5EWGA 1C0UA 5J2QA 1DLOA 3Q8SB 2VG5B 2RKIA 3M8PB 4WE1B 4DG1B 5DGBA 5KFPA 2R8JA 1TP7A 3H4DA 4K4VA 4NLTA 1IKXA 4ECXA 1CSJA 2AGQA 3V6HA 3UQSA 1C0TA 1JKHB 5HROA 1RT6B 2UVUA 4K4TA 2IC3B 1UWBA 4NLQA 5KFGA 4ED7A 2FLPA 4WZQA 4G1QB 3ITHB 2FVCA 2V0NA 4ZP9A 4KSEB 1HMVA 4NZ0A 3BQ1A 3LANA 4KFBA 1JLAB 3DLEB 4PUOA 1REVB 4TN2A 4KKOA 4TY9A 4F4XA 2BQUA 2VA3A 4I2QA 3QGIA 4ED6A 1QE1A 4NLSA 3G6YA 5KG5A 5DQHA 3I0SA 4I2PA 1J5OA 1S1VA 1S1WA 5KG3A 3DMJA 4JUZA 4ZP7A 4O3RA 4J9MA 3KHGA 3MEEA 1S0MA 2IC3A 4K50A 4ECRA 4G1QA 4IQXA 1SUQA 1D1UA 3ICLA 1NHVA 4RW4A 3DOLA 2R2RA 3NAHA 1HPZB 5KFVA 1TL3B 4RNFA 4QPXA 2AGOA 3EZUA 2AWZA 1TKZA 1JLCB 5KG0A 3H40A 3NL0A 2ZKUA 1DLOB 3M8PA 1QE1B 4WE1A 4F50A 1S6QA 3G86A 2C2EA 3KK1B 1RT7B 1RYSA 4J9KA 4ECZA 1TL1B 2HMIB 1TVRB 2AQ4A 1HQEB 1C1CA 1S9GA 2VG7A 3NGDA 4ZVHA 1UWBB 5F8GA 2XCAA 2BQ3A 3FDSA 1RYRA 4URGA 3ITHA 4J9SA 1FKPA 4O4RA 4ICLB 4ZPCA 4EO6A 4K4YA 2B6AB 5I42B 4IH7A 5JXSA 2YKMA 4LSNA 2IM1A 3KOAA 2JLEA 3E01A 5KFRA 1RTIA 1RT4B 4K4UA 3OLAA 4NRUA 2FJVA 3VQSA 2W9CB 3KLFB 3JYTA 2AX0A 3QIDA 4F4WA 3BSOA 5EWFA 4PUOB 3LP0A 4KAIA 4RUAA 1OS5A 4F4ZA 2ZE2A 3TAMA 1RTDB 3V4IA 4IR9A 2YNHB 3DRRB 4RNNA 3M8QA 4J9QA 3T5JA 1RT6A 3DI6A 1XR5A 4ZVGA 3DDKA 4MK9A 5DQIA 1IKWA 2J6TA 2W8LA 1T05A 4NLUA 5T14A 2I1RA 3Q8QB 1IKYA 2RF2B 4R8UB 3OSNA 1JIHA 4TXSA 5I3UB 1S6PA 5KFEA
chains in the Genus database with same CATH superfamily
2Q79A 5AXKA 3ZZRA 1S9GB 2CPZA 3C15B 3I87A 5AJ3F 3PFEA 3I6PA 2MKHA 2YNIB 3UI3A 4CI0B 2ASDA 2UXDF 1FXDA 2BANB 4NWBA 3PW0A 3AD9C 4OMFG 1HYSA 2YXLA 2W9BA 3MAQA 4GC7A 1X31C 2R3VA 3C6UB 3TEGA 2E1PA 2D74B 3MF5A 2R2SA 2BEFA 1JMTA 1KKHA 4UT4A 1LK7A 5JUMA 3MM8A 4NRTA 2CPEA 1R6VA 3OR1A 4A47A 2VICA 1NSKL 2HQ3A 2Y8WA 2UUAJ 4ZITA 2Z8QA 2K3KA 2I8EA 4JBCA 2VG6A 3QQCD 3KHHA 1FNMA 4M95A 1H2VZ 2AZ3A 1IBKF 2BE2B 3GFZA 3LPYA 5E5NA 4AQYJ 1IBMJ 2W7PA 1R0BG 3R7SB 4QBUA 4DV1F 4XDDA 3FEXB 4ED4A 1H74A 3D68A 1YJTA 2P6SA 2MYFA 3DRYA 3MGJA 4HI1A 4PXBA 4ZVRB 2RUSA 3U1LA 5K14A 3LWMA 1AYEA 1HI1A 4O4GB 2F3JA 4ENOA 4OHWA 2OKQA 1FESA 2WBRA 3CDWA 5EX0A 4U6PA 3B82A 2QA4S 4J9LA 3MECB 3CMES 5IM0B 4B9TA 5I42A 2NR0A 5CZXA 5LXYA 4LF7F 2J7WA 1V3ZA 2CNNB 3H5SA 1VJWA 3M32B 4F26A 2XS2A 2CZ9A 4QYZK 2AEMA 3R1HA 3NS7B 1EJ7L 3CCES 5KFFA 2DGVA 2FPHX 2HAIA 1UP1A 2KB2A 4IKAA 5CZVA 4PR6A 3M1VA 2GW8A 2RUGA 5KG4A 4OI3A 1ZBTA 3C2PA 1Y3KA 3FCVA 4DI6A 2XMWA 1DQ8A 4J9OA 3DRSB 2DISA 3R1LA 1RGVA 1NKEA 1YRTA 3VV2B 3DGPB 2ZHOA 2UUTA 1FNXH 4LRFA 2RB7A 1M1HA 1T9TA 4U67Q 5CD4A 2RU3A 4FS1A 2E9TA 5A2QY 1K1SA 3LPEA 3VTIA 2HW3A 1UZHA 5B0BA 4DFKA 3N4WA 3BQ0A 4ZA1A 1OO0B 3B4DA 5KFJA 3ADAC 3BKTA 1U2RA 4OYBA 2AP6A 4OI0A 2E7XA 5H9FK 3PIPQ 4OHZA 1WORA 1VQ4S 3G2XA 4J9RA 2XB2D 1IM4A 2H54B 3R27A 2MTLA 2Y9HA 1IQTA 2XO6A 3LTOA 2PSZA 3K59A 3ZO7A 1S9FA 4KYZA 3CGIA 1RKJA 1HWKA 5D6GA 1ZOTA 5CQGA 2APOA 3CSKA 3UPFA 5K8MA 4I2PB 2LEAA 2BKOA 3F44A 4HLBA 2DGXA 4RX6A 4LIWA 4OV6A 1HHQA 3U02A 4TQSA 2CG8A 3P45B 1RCXB 3HSDA 1SC3B 3SSSA 2M3DA 3T5LA 4NYPA 5T41A 1HARA 5KT5A 2ZH3A 4Q5VA 2J0SD 3JB9k 4KO0A 1SVDA 4LFBF 4V19X 1BXNA 3IRXB 2DXDA 1G4CA 3CJ4A 4HR2A 4MIAA 2FLPA 1N5SA 2E1MC 4ZVOB 2JLFA 3JQJA 2ZJRQ 4N41A 1M5KC 4HHJA 2GS8A 3N01A 3OL9A 3KK1A 2KXHA 3GMGA 1F3FA 2EC2A 3HHEA 2BZ2A 4Q44A 2JVOA 5L1JA 4OIXA 2HWHA 2HNZB 3C3LA 1KN6A 2PN6A 1RT4A 3PACA 3S7RA 4CDIA 4DR4J 4AFFA 2NS1B 4USWA 5HI7A 3A3PB 5E3QA 3TWZA 4PYAA 4Y28C 2CFXA 4LF6J 5J1NA 5DS7A 2YQ1A 1LW2B 2IJNA 2XMMA 5CYQA 2XWYA 1BGXT 1RE1B 3P4UB 4C3MA 3VAGA 1Q79A 2BOAA 3D6TB 3OL7A 2BOPA 4JV5F 4JI0F 4BC9A 4B3SF 3TA1A 1YZ7A 1TL7A 2QV6A 2YY3A 4ID8A 1V3RA 3A1YG 5E7OB 5KFBA 3K5NA 2ZHBA 2HG4A 3I82A 3VAFA 2FLLA 4JI3F 2PIIA 1RWKB 1PAEX 2EI5A 5HMWA 2GHWA 1HQUA 2NYHA 3IMQJ 3MFIA 3MM9A 3N6MA 3PX4A 1VRTB 1VQOS 2NSBA 3QAUA 1M5OC 4RW9A 2KM8C 4IR1A 1NXIA 2YKMB 4JOUA 1F9FA 2HAFA 4DZ6A 3CE8A 3R5GA 4ZVUB 4ZLJA 4XPEA 1LWCB 1N52B 2EK1A 2HLTA 3MEGB 4EZ6A 3AA9A 3RBXA 2V8DA 1VQNS 5AT1B 3KMSA 2MKKA 4TVAB 2H1YA 3TX0A 2RNEA 1S1XA 1PC4A 3C16B 1SXLA 3OVAA 3QRRA 2GHVC 2B43A 2EKYA 3UN2A 4P2SA 3HZGA 3K5PA 3OJSA 4KO0B 2QSWA 1NJIT 4B9VA 4OZ0A 1WDDA 1KLNA 2QFIA 4ZPVR 2VB6A 3WX4A 4DSIA 4DR7F 1OSCA 2H5EA 2LU2A 4QPTA 3JAMU 4X64F 3OQ2A 4OYAA 4PG6A 4BC7A 1HR0F 3I55S 4B3MJ 5G0RA 1P9QC 2V67A 1MU2A 3DXBA 3V2UC 1VHIA 1U26A 1VK8A 1VC5A 4DSKA 2B4PA 3ILOA 3QT7A 1W2BR 1VQPS 4ZHRA 3NOGA 2RF2A 5D0GA 2DGWA 2ABYA 1F1BB 3FZBA 1Z2ZA 2CDRB 2EFGA 2GAHC 3CO0P 4KH0B 1KQFB 1A9NB 2NZCA 3KJVB 3D28A 5DG7A 2HZVA 2GMLA 2H3EB 1C2PA 2HRUA 3FMBA 5K5MA 3RBEA 1FHTA 4JV1A 2DK2A 1LNQA 2MKIA 4YB7A 3BQ2A 3EDRB 4DS4A 2GV1A 5KFCA 3MD1A 4ED8A 2GGPB 4HEA9 2BDPA 1P8GA 2KVQE 4L74A 2GIQA 3QATA 3T1HF 1YZ6A 2JC1A 4OZ5A 4DCPB 4PABA 4C0OC 4R25A 2I6WA 3MEGA 3V6KA 2LDYA 4HL9A 2ASLA 4ZVSB 1GK8A 3NWRA 3LAMA 3QWPA 1FDNA 3CJQA 3ENQA 1UEKA 2CJ9A 4GRSA 1UFLA 3NS5A 4KGMA 3V4MA 1S6OA 4DL6A 5L1IA 3SQGB 1T02A 1X9SA 4IRDA 1OY8A 2X51A 2Z30B 4Y2CA 3FEYB 3H5XA 4CLTA 4K2XA 3HFZB 3GSDA 3QJJA 1D8ZA 2Y3YA 3CJRA 4DU7A 3GB0A 4LF8F 2UUBF 1U1KA 3L3CA 1MU2B 1ZA2B 3DLGB 1FJGJ 2F8EX 2HFNA 5A8RA 4ECUA 2EKNA 5C2CA 1S9EB 2BA9A 1ZA1B 4MFBB 4XIUA 4IG0A 2DHGA 4PQUA 4NLOA 3NNHA 2C2DA 1Y5NB 4HACA 2FHOB 2XQCA 4TU7A 3TZWA 2YPYA 2VPYB 3AAWB 3CJ2A 3QRPA 3CCRS 2VJVA 5KFYA 1Q81T 4C48A 4RW8A 3PY8A 1GQEA 1KP6A 1YSJA 2OPQB 1GMUA 1S4EA 5LMNF 2ASYA 3OR2A 2YQ0A 3B54A 3R5AA 3SCIE 2XC9A 3EX7B 3I0RB 4DPYA 1Q7YT 1S0OA 2GGPA 1GTEA 2ROEA 4OZ2A 4C8YA 5DETA 5D77A 2VPWB 1V5VA 1U0HB 2HS4A 2F4VF 1NSPA 2RIJA 1FRIA 4NCAA 1U24A 4DR6F 4P9SA 3HHLB 2QLJB 4OX8A 1RWVB 2JH3A 1N5QA 4WXWA 1KFSA 2HS0A 2I2YA 3GR1A 3PDNA 4NLRA 2XGQA 4EYHB 1SL2A 2YNHA 4ELTA 5CYQB 3GYGA 4DV4F 3T41A 4AL5A 2CWXA 2VFRA 3IM9A 2Q6CA 1E6YB 3ZTQA 1XR7A 2JL9A 4NZ6A 1Q5YA 2FHKA 2RQ4A 5CYMB 4LBPA 1WI6A 2E9ZA 2HLUA 2H51B 3BS9A 2V50A 3IAS9 2NREA 1W2IA 1FKAF 1U7LA 4LVOP 1KHWA 3IWXA 5DG9A 1WHYA 2O5DA 2CWKA 4KHMA 4OZ3A 4BWJA 5HBMA 3SV4A 5IC4B 3CCUS 1OY6A 4PEOA 4J9SA 4MFBA 4HI2A 4A8FA 4OJ3A 5FIIA 2LQ9A 3MPWA 4D3GA 1CVJA 1JKHA 4ZVEA 2XULA 1LWCA 3DCAA 1UETA 2DXEA 2HK3A 1YTYA 1DTQA 3DRPA 1VOMA 2IA0A 1DTTB 5F3TA 1VIXA 3W2VB 1F5BA 1JLAA 1G7CB 1HIYA 1B7YB 2GA7A 1LEOA 3BF4A 4OJGA 4PKDB 2XMJA 4B9UA 2IMWP 1KEKA 3CWJA 2QL9B 2HKEA 3W5ZA 5IOLA 4K7QA 2K7JA 4QIEA 2OPPB 1Q5VA 2QN6B 5DJBA 1MSWD 1YLXA 4RUHA 3BV8A 4IQMA 2IBOA 4LRAA 3HHLA 3CW2C 5KFWA 3PW4A 4NCGA 4WU2A 4PPZA 4FXVA 3KG1A 1SUQB 1JLEB 3UDVA 3BO3A 3ILIA 1ZM4A 1JX4A 6FD1A 4MYTA 4MKVA 1T94A 2R8IA 1XBWA 2UZAA 4A48A 2MZSA 3PR5B 4DR4F 3MXHP 4DV1J 1GMWA 3CD0A 2XM3A 3VAJA 1ZAWA 4HHHA 5KG6A 2F8HA 3CJ3A 3HJFA 3JYTB 2B9WA 1SIWB 2CRLA 2VKRA 4MMOA 5LL6d 4UY8T 2WW4A 3E8OA 5HBMB 3FRZA 1U1OA 2XI3A 4CO5A 1DARA 2DYAA 1PJ6A 1T9WA 2NXEA 2H9ZA 3C66A 2J6UA 1WG5A 2VJUA 2RHQB 3FSIA 1IR1A 1DQ9A 1IBLJ 1TL1A 3KLVA 4P52A 4ZK7M 2QLXA 3FFIB 1XMQJ 1XERA 2HHHF 4USTA 2ZDOA 1FRLA 2G13A 2CPYA 3UW1A 4DL4A 1S6PB 5LJ5Y 1DBDA 1WD6A 5BYRA 1QDUB 3DLHA 4NLDA 1HWJA 1RTIB 1TAUA 1RHKB 3IRXA 2MZTA 4C8KA 2RRBA 1S72S 2CQ2A 2YWHA 2VQFF 3SMZA 3RB3A 2GO8A 2OPPA 4EBDA 2GMHA 2XMKA 4ES2A 2DNQA 3ZZUA 4G3IA 2AJ0A 3QBCA 4F4YA 2CQ0A 4I1TA 3W5XA 5F8HA 1GMVA 2XG8A 4X62J 5D3GA 4B3OA 4HDHA 2R4FA 4OI2A 4FYVB 3UNYA 2YKOA 4C8OA 5A8KB 1UVIA 2ZD1A 5EHHA 2LU1A 2QYCA 1IWGA 1F60B 4TY8A 4TQRA 3AQOA 1QSYA 8ATCB 1U25A 3MFHA 1WNEA 5B0EA 1NZ8A 2CJAA 1TMMA 2QZ8A 3N0VA 5C25B 3CDBA 4MKAA 3MPUB 4ZPDA 5ETRA 2HNYA 4F0MA 5IWAF 4NXNF 3I4PA 4DR1J 4CLSA 2CJKA 1QSLA 1KOOA 5E33A 3DOLB 2QLBB 2E1CA 3CCJS 4ZCLA 1Y9OA 2JJ4D 3R5CA 2J9DA 2W4PA 3CO9A 3HHLC 1RA7A 1YBUA 2K1RA 1PYTA 3CTRA 1LWFA 4KE5A 4FBUA 1WHWA 3PX6A 3CDUA 3PRDA 1S1VB 1S6QB 4KGKA 1Y11A 3DYAA 4I7FB 1HBUA 3IBWA 3FQKA 3TVYA 4U8VA 4CT9A 6FDRA 2XLIA 1KSPA 1AW0A 1U45A 4YHHF 3D1HA 3OL6A 2D3UA 2VFVA 1H73A 1KWMA 3PTWA 5F3ZA 1J5EJ 5HVFA 4DJBA 4B3RF 1VQMS 5C42A 2N7YA 2IJRA 1WC4A 3OVBA 4OQJA 1N5TA 3IP0A 1IBCB 2ADCA 2F5GA 4OYOA 3SIPB 4DX8H 4ZHRB 4RL1A 5IV3A 1QTMA 3NNAA 3HVTB 2F9JA 5GMDA 5D3GB 4B3OB 3MR2A 2UXBJ 1QVGR 2VUGA 1TVRA 5HQ8A 3RU0A 3ZTSA 1ZYQA 4TLQA 3LALA 3GJRB 2JNJA 2V4JB 1ITPA 3MMCB 7AT1B 4WE1B 3G82B 3GCWP 2KJVA 1NDPA 2FJEB 2K8GA 3KDOA 4ZLPA 5KFPA 4NLTA 1NK5A 1IKXA 3DU5A 1FDAA 1VBZA 1LFPA 2WSEC 3L7PA 2DVIA 4X4UA 5A6WA 3CCSS 2UVUA 1RP5A 2OTJS 1UWBA 3NWGA 4M5IA 2CPIA 5CD4H 3SDEB 2LXUA 1VI7A 4Y6IA 4KSEB 3US5A 2Z57B 4ZPTR 4KFBA 1H38A 4EK2A 4PUOA 2ZDPA 4FF1A 2E7VA 4KKOA 4K0KF 3CT9A 1NAQA 1FWLA 1TK8A 2DCUB 4NLSA 2EG2A 5KG5A 2B4VA 2HFVA 4WWSA 1J5OA 1FX4A 2DJWA 4UTGA 3AJ1A 1S1VA 1S1WA 4YB1P 5I3QA 1HNZF 4O3RA 4HTJA 4EZ9A 2BE7D 1WI8A 1S0MA 5U47A 3Q23A 1RAIB 4G1QA 1D1UA 1HW9A 1NHVA 4GO5X 1J5EF 4JI8J 3BH6B 4ZVPB 4QPXA 1NBEB 2DNLA 2YWFA 3EZUA 3H40A 3M30A 2ZKTA 4DQSA 5IV4A 4JI5J 2R7UA 2HHUA 3M8PA 1QE1B 1T9VA 2PDAA 1N0UA 4CNZA 1Q8BA 4DV3J 2KL8A 2V34A 2NXUA 4J9KA 1HFEL 2MY7A 1HBNA 1TL1B 1IJEB 1TVRB 1WACA 3AY0A 2VIHA 2KT2A 1D3WA 1Q16B 4YS2A 5F8GA 3TARA 1TR0A 3ITHA 2DNMA 3AT1B 3R5BA 4ZN3A 1TL5A 1XQIA 2X3GA 4NOHA 4V1Ak 1Y5LB 4ZPCA 1DRZA 5I42B 5JXSA 1VQ6S 1X4AA 3EGNA 3A4TA 3NP5A 5LSOA 4JYAF 4DV5J 1WF2A 3BM7A 1RTZA 1RTIA 3GG0A 3BR8A 5GAGI 2UUBJ 2M52A 2FJVA 1RAAB 3RGIA 3VQSA 1YJ9S 2A10A 2H4WB 2V68A 1LWXA 2AX0A 2RRNA 5AXLA 2DR8A 4PUOB 3A8JA 2C3OA 4KAIA 5IZHA 3I31A 3MM7B 3LO3A 4Q2MA 1UA1A 5IT9Y 1RHUB 1RTDB 4I4BA 1TTHB 4UY85 1S76D 4I64A 2YNHB 3D4JA 5K9FA 5A8KA 3UD4P 1UZDA 3IXQA 2ZZTA 3DDKA 3EXCX 2AMCB 2CA9A 3LUYA 3L9ZA 4Z7CA 5DQIA 2H5JB 2I1RA 4TXSA 5I3UB 3DN9A 4ZLNA 1XMOJ 4M5MA 2R7VA 3MAAA 3D7SB 4B08A 3RB4A 1XIQA 1URNA 4OHXA 4ETZA 3M8ZA 3AXKA 2HHSA 1KVIA 1SQGA 4BHQA 4Q45A 2MKSA 4KT0C 3BREA 3P3DA 3W62A 4I6WA 1OY9A 2CIMA 4EEYA 2DNKA 2KN4A 4PG5A 4EBEA 2EBEA 3OXGA 3I56S 4DL2A 4DUYF 4DR3F 1PJ7A 4RUCA 3WC2A 5L39A 3H4BA 3MEDA 2ATLA 3LGNA 3MOZA 2QMWA 5IM0A 3SI8A 4RU9A 1MWZA 1KTQA 1L3KA 1MG7A 5A6PA 4XAKA 4DUTA 1NK0A 2G0IA 1LK5A 2WVCA 1AUDA 1WC0A 5KT7A 2KZMA 1EIYB 3A3NB 3C6TB 1RHQB 4PZVA 2XCPA 4LRCA 2IVYA 1DQAA 3PRVA 1VQKS 1NDCA 3GIMA 5FLXY 2LQ8A 2B4OA 3SSRA 2HNZA 1QUPA 4DV2F 1RTJB 2W7AA 2G1DA 3IR5B 1SH3A 2BVZA 1RWMB 2ZBIA 4NCGB 2IYGA 4MKBA 2MGZA 2B4UA 2KH9A 3D1OA 1K1QA 3EVMA 2EFVA 2HHXA 3BSCA 4ELUA 2XEXA 2J0QD 3V81B 3IM8A 2OAUA 3TJAA 1MMLA 5D15A 3AHPA 2EVZA 4QQBA 5ADZA 3LGMA 2HYIB 2FJDB 1FJ7A 2WONB 2R2UA 1R6YA 2ROPA 4DX6A 4Q8EA 2VC0A 1SC1B 2CQCA 2WSCC 3PYFA 3JAMY 4YP3A 1NK7A 4NA3A 2OFGX 4DSFA 2DHSA 5DLGA 3LP2B 3ZXWA 1B0TA 2LA4A 2FYXA 2MMYA 3BBBA 1KQKA 4AQYF 3QSYB 4EYIB 4YR3A 1RAHB 2IYIA 1FFSB 1P1LA 4XDCA 1U0SA 4FYDA 3W5YA 4IFVA 5DGAA 3ENAA 4GKKJ 3MPDA 3NCPA 5HSPA 1EKRA 4I56A 5LSRA 2PT0A 3FQLA 4X4NA 2CUYA 2WOMA 2KVIA 3AB2B 4JV0A 2VBXA 4OHYA 3BZQA 4IO9Q 1H0HB 2EPIA 2O66A 3OHBA 4F4AA 2BJ3A 2C2RA 2E1RA 5KFAA 4C97A 2DIVA 3V6JA 4OJ1A 3GWCA 1RT5A 3PRBA 4FVMA 3IAM9 4NYZA 3KKFA 3M30B 2DB1A 2OSQA 2DCLA 2QSFA 2AU0A 3AOCA 3MI7X 2AEJA 2RAQA 3OFHA 5HP1A 1O51A 2C3MA 4OFZA 4DV2J 5BYQA 1WDTA 3M6UA 5HVGA 2R7XA 2LDIA 4O23A 1HBMB 3O2IA 1NJYA 1Q82T 4F3MA 2DHXA 1JB0C 4F2RA 2ZBQA 2VH7A 4Q0BA 2XTJP 3OHAA 4DR5J 4LF2A 2YX1A 2C1EB 5HN0A 3HHKA 3M6WA 2MJUA 1KTVA 5ETTA 2JHEA 2QMUB 3N9UC 1DJ0A 3GV5B 2R8KA 3MMBA 2OD4A 2WSFC 2MJNA 4WK1A 2JC0A 4DSLA 3T6BA 1VQSA 2BJDA 2E5JA 2VKZG 3EUNA 1HL6A 1S4FA 3A3OB 4RWWA 5KFHA 3TQ1A 3KLIB 4DPXA 4CCHA 2J9EA 4DPWA 2RT3A 3MR3A 2WTFA 2Q66A 2MQOA 4UUXA 1UW9A 1W25A 2FJAB 1ZTWA 2AIRB 2B51A 5D0EA 3QT5A 4QWBA 3BPDA 4O44A 4OI6A 3TUZC 3OTOJ 3IBFB 1A0OB 1NK6A 2V2KA 2YKNB 4B3TJ 1DZ5A 2B5JA 4FZVA 3HDSA 1T9YA 3C16A 1NPKA 2D3OR 2BRLA 3HHNB 2ADBA 4RLEA 1QTNB 3SQGA 2AYGA 2VFSA 3O3LA 4CP5A 2LMIA 4GVBA 4V19J 2HHTA 4LQ3A 4LSNB 4KGXB 2HBQB 3MAAB 2XGPA 1T0TV 1BE4A 4RNOA 2HVIA 2J7KA 1FX2A 2D7SA 3PFOA 4UW2A 1T05B 3G96A 4F0HA 4CO4A 1SJFA 2IM3A 1QVFR 3M8RA 2XBPA 2KRRA 2L9WA 4P2MA 1S5ZA 2B3TB 2DKOB 2EEYA 4GKJF 1X4DA 4KGZB 2X3DA 4MKYA 1EP4A 4F67A 1X60A 1XWLA 3TQEA 1ZAXA 3M8YA 4RBTA 5M2UA 1UJ4A 2XNRA 1UJ5A 2CKWA 3MHYA 4DR7J 2C2OB 3QGGA 1JLQA 3MM5B 2B0GA 3K57A 2DEJA 3J81U 4WCEQ 2JDJA 2CVEA 3DOKB 1E6VA 3DDIA 3ZZZA 1UVLA 4U95A 3UFCX 2IA6A 2UVVA 4KFBB 3QIPB 5KFLA 1RU2A 5JVGQ 4YHHJ 1TV6B 1N54B 2V69A 4ED1A 4M5NA 1CS4A 5A0YA 1TFYA 1B3TA 1JLGA 3ZFVA 2DNPA 4QIFA 3OBIA 2DRAA 2E9RX 1URRA 4I67A 1S1WB 1SB6A 1RTHB 1WC5A 2RVJA 3C6UA 2ILZA 4F02A 1CULB 2PMWA 2GFFA 3UD5A 3T19A 4R5PA 3WIUA 3C14A 1IR0A 5LMUJ 3NS6A 1B7FA 2NLWA 1XR6A 2HK2A 3CCLS 3K8VA 5CYMA 4U96A 4DV6F 4X64J 2C22A 1EARA 3EYZA 2CQ3A 1RKIA 2Q43A 3VZHA 2CQDA 2MDAA 4B9SA 2VDIA 5KG1A 3LP2A 1VRUA 2VG6B 1G6BA 2F7VA 2M9KA 4ZP8A 5L1KA 1HD1A 1U48A 4XO0A 3PHEA 3ZNJ1 1B99A 3IWLA 4IG0B 1FFWB 1H6KX 2PA8D 1RT1A 4J9VA 4M5KA 4TLRA 4HACB 2QX0A 1S0NA 2CNLB 4DL7A 1YITS 4USUA 4A8SA 1X4BA 2QTWA 1JLBB 4FKXA 1KRPA 1Z1ZA 1ICEB 3MECA 2GQ2A 3O44A 3K58A 4HYKA 2FLNA 4WP3A 3UD3P 1KR4A 3ETOA 2EBGA 2ZWPA 2VONA 4HT7A 1RA6A 1VQ8S 3IA0A 2GHPA 4DFPA 3GZ7A 4L75A 4DN0A 4DXLA 5A8WA 4DV5F 3SQOP 2WW8A 5FDLB 2XSJB 2R8GA 3AD7C 3EXYA 3OFFA 2EC0A 1HNWJ 4WFNQ 3S6EA 4H4KC 3DC2A 3QIPA 2AJFE 3M4XA 3R97A 1TV6A 2OGUA 4NASA 3QZ7A 4K4WA 1RT3A 4UUWA 5D4OA 5CYJA 1ZZNA 3EGZA 1TFWA 3W8PA 3S01A 1OQ6A 3B78A 5THWA 2R7RA 3MAHA 2GMJA 4IRKA 4YOEA 1WSVA 2IM2A 3VAIA 2C42A 3H8YA 4JI4F 3QMQA 1CULA 2Y1LB 2G2OA 1U02A 5B0CA 4U7CA 4LSLB 4ERDA 4DEZA 2HHVA 5IT9U 9ATCB 2M88A 3LW5C 3IN5A 3MMBB 2AHOB 3Q8RB 2V2QA 3AJDA 1FJEB 2E5GA 3QT8A 5D4PA 3RB6A 4C4WA 2HQDA 1H98A 1X9WA 3KK3A 3KG0A 2D3ZA 3KFWX 3TYTA 1IBMF 2HQIA 5ETOA 4IOBA 4C3LA 2IVFB 4AD6A 5F8JA 4P2XA 1VC0A 4HH1A 3O8WA 5K8OA 1S7HA 5CAAA 4F4KA 2WVBA 1ZETA 1X5TA 3NMRA 3QJLA 1UAWA 3M2VB 1VIOA 2NSCA 1FJCA 1RLDA 1KDNA 2VV5A 4B9NA 4CZCA 4ECTA 1VR6A 1BUXA 1RADB 3NMAA 4O3OA 1IUJA 2W2PP 2OLWA 1F2HA 2ILYA 5KT6A 3OLBA 1MROB 5FDLA 2XSJA 3LOUA 1S59A 2CQPA 4PYDA 4ZKAA 2UUCJ 2XMUA 1SC4B 2VC1A 1VCTA 4AL7A 2BM1A 4PWDA 3EVOA 2O01C 1RTJA 1VDHA 5IS2A 5J2QB 5IT4A 2DBBA 3J7YU 1N48A 1NMEB 1JLEA 4PG8A 2DNGA 5GADU 3TR5A 1Q7LB 4NLPA 2W2NP 3SFUA 1UW4A 2VQFJ 5FJ4A 3KYLA 4OLPA 2BQRA 3ISND 2OSRA 3FBBA 4LFAJ 2MQPA 1SKUB 2C2ZB 5B08A 1Y10A 4PRFA 4QU6A 4Y2AA 2I5JB 3QLHB 4ED2A 1PJ5A 2FY8A 3OTEA 4ITSA 3HO1A 2W4CA 4QU7A 1KONA 3KMQA 2HNYB 1NCLA 2DRBA 1Y3JA 1FKPB 1D9DA 4IFVB 2GZOA 1XMOF 2A2CA 2VBZA 3IGNA 4RBVA 1R31A 4DV6J 4L6V3 3TAPA 1PBAA 3MMAA 3DU6A 4AT1B 4QR2A 3ILJA 2OD6A 3C19A 2HEKA 3M2VA 4TNOA 4NLVA 4DLEA 3H98A 1OQ3A 3EZ5A 2B8QA 4EWTA 4Z2XA 4QYZJ 5B0GA 1CEZA 2R7TA 1G1XA 1JLCA 4Y65A 2DR7A 5HANA 2WAQD 1FVQA 1MN9A 4IFYB 3TVKA 1R8PA 2KT3A 1SC6A 5SZTA 3RB0A 2C3UA 5ETQA 4GO7X 2YNFA 2FGCA 2V2ZA 4RO0A 4DCJB 2HMIA 1TKXA 3ZTPA 1PCAA 3D0IE 1FDBA 2E5IA 1R7IA 3CIZA 3W65A 4C6AA 1U8SA 5HVHA 1RUSA 3RYLA 2KYXA 4LREA 1RT2A 2HWIA 2MZQA 2W9CA 4OX7A 5F8LA 1N36J 1RHRB 1N6QB 1N5YA 2M2BA 3KLGB 3OTCA 4OLOA 4Q0BB 1K73T 3H5UA 3PR4A 2YVSA 5KFOA 3Q8VA 1RZMA 4LRDA 3JXOA 2XO7A 4A8KA 1FO1A 4ECQA 5C24B 3M9OB 4CH7A 3D5MA 5C25A 2FC9A 2LQJA 3PM9A 2XMVA 1S79A 2G2ZA 3X1LB 3KWMA 3NLCA 4NI2A 1SL1A 3IS9B 1KLMA 2BR0A 2HBZB 1DAXA 2MSSA 4YN3B 3CD5A 2OH2A 3AOBA 4MTPA 4N56A 3KK2A 4ZPWR 5E3CA 1RT3B 3A8KA 5F9LA 2AV5A 2HHHJ 3I5AA 2HSEB 1ACMB 2VDHA 2FVQA 4ID5B 5J2NB 4FPRA 3M7VA 5LOQA 3TI0A 1Q0NA 1L3VA 1I5OB 4Y34A 5F8MA 4X2BA 1B0PA 1YQHA 2RE1A 4EMDA 4USHA 1LW0A 1C0TB 4BCAA 2IAJB 2SXLA 3CD6S 2OEMA 3M2UA 2EWHA 1WC1A 4LSLA 1T8EA 4IFYA 3CVKA 2XS7A 3K0JA 3NAIA 4RKUC 3A12A 3JQKA 4IH5A 1K0VA 5C42B 3T1YJ 1NHUA 1ZM9A 2CJQA 2DEIA 2EFPA 2MKJA 2XYHB 3GFHA 3WC0A 1XC9A 2FVRA 1LKZA 1MWYA 4KIAA 1AXQA 1REVA 4NXNJ 3M9MB 2W7OA 4DV7F 4XTTA 4I2QB 3GTYX 4I0WA 4ED3A 1S9EA 1D0EA 1C4AA 3RG6A 1NH8A 3HHDA 5AXMA 5L9NA 2LECA 1JWWA 4UF4A 3HVTA 3NCQA 2C2MB 1Y00A 2O1PA 4OZJA 2DHHA 2FDNA 3TP2A 2OEJA 8RUCA 5KFMA 5EDWA 3OV7A 4OL8A 1GFWB 2CQIA 4LSZB 4CH1A 5GMKa 3QZ8A 2HFSA 1RISA 3W9HA 1LXNA 2F4FA 4OHVA 3H0PA 4EBCA 4FKYA 1WJ9A 1EETA 2BABA 4KH1B 5GAGU 4YY3J 1IKXB 2N82B 3DMJB 3HLUA 1I6JA 2IRUA 4ZCKA 3VGUA 1C1BB 2V2VA 3KLEB 3O5TB 3Q8YA 3MEEB 3I0RA 2DTJA 1JLQB 3MM5A 4UOFA 1WELA 1M5HA 3Q22A 4DDFA 1T03B 2WZ1A 1L3TA 4ZJQA 3QGHA 4J5OA 1QY7A 2I9SA 1KOHA 2WVEA 2AYMA 2NYIA 4P74A 3TX8A 1REGX 3DRSA 1NUEA 1CC8A 2HVZA 5E3AA 4DOZA 7FDRA 4LF9J 1C0UA 5J2QA 3RW6A 1DLOA 1F2GA 1CS4B 1TMJA 3I96A 4DG1B 5A0YB 2Z2ZA 2R8JA 2UUCF 1TP7A 1EQ0A 5E41A 4ECXA 1GT8A 2YQ3A 3SCJE 1C0TA 3UQSA 4CWBA 4NA2A 2FB0A 4K4TA 4NLQA 4ED7A 2AYBA 2CPFA 3BDPA 4G1QB 1XNQJ 4WZQA 1OIAA 1UL3A 3A8IA 1H7XA 2FVCA 3W66A 4ZP9A 3VR1A 2DR9A 2PE8A 4NZ0A 2AJQA 2AT1B 1S99A 2JSXA 3DLEB 3OTBA 2ZJQQ 1REVB 1XN9A 5HL7Q 2BQUA 4LFAF 4I2QA 1QE1A 1UVJA 1MLAA 2NZ4A 4I2PA 2R42A 3FSYA 5GMEA 3DOMA 3MD3A 1A7GE 4ZP7A 1YBAA 2OP5A 3U7JA 2YBVA 1RWNB 4J9UE 4X4TA 1VC6A 2NXCA 5KAKA 3T3FA 2CQ4A 1H7WA 2JLGA 3AODA 2ZH4A 4ECRA 2UP1A 4RNFA 4C8NA 2R2RA 1YRUA 2XHCA 1TL3B 3AD8C 4OV1A 2M4MA 2AWZA 1TKZA 1JLCB 1TK5A 3NL0A 4HHUA 2D3O1 4ZLLA 3UR3C 3MM6A 2V9KA 3CPWR 4CYUA 4DUZF 5CXTA 3KK1B 1RT7B 5EGYA 1U1NA 1RYSA 1BWVA 1HHTP 1U6FA 1AZSB 2BBEA 2HMIB 2ZFHA 1X7VA 3QPIA 3U27A 2AQ4A 2K3IA 1S9GA 3C15A 3ILLA 3F0NA 4ZVHA 1RYRA 1X4EA 2ZH1A 1FNOA 1UPPA 3TUPA 3L4BC 1NKBA 4ICLB 4K4YA 5E2QA 3RRKA 1TUWA 1RHMB 1VHFA 2IM1A 3KOAA 2QYGA 2L41A 3UCGA 2ZVIA 1IBKJ 1EKSA 1UEVA 1TUGB 4NRUA 2HBRB 3POTB 3VVTA 4OX9J 3HMJG 1CJTA 4DWIA 3KUGA 3JYTA 2HS3A 1NLKL 5KFXA 4U7UK 2LA6A 1RWWB 4LIRA 2CQHA 5EWFA 4EI2A 4QIGA 3HK2A 2JRSA 4RUAA 1OS5A 2GAGC 3W1YC 4F4ZA 2Y1JA 3TAMA 4HDGA 5AJ3J 2E5LF 1X4HA 2IRXA 1HD0A 3BN7A 2ZZNA 4A8OA 4OZ1A 3UDEA 4CNYA 1F5AA 2U2FA 2GJFA 1AA1B 3LF0A 2DXFA 4MK9A 1PSDA 1WG4A 3BBFA 4NLUA 3TUJC 1WC6A 5T14A 1IKYA 1YKWA 3NOCA 4JI0J 3EVWA 1OYDA 1S6PA 5IQQA 4B9MA 2HRTA 3CJKA 1UVKA 3FK4A 1CPZA 1YJWS 4C7QA 2YNGB 4RZRA 2FLOA 1LOUA 4O0NA 3MM6B 1S77D 2J8AA 2V8HA 2NUHA 4KHPJ 3TEHB 2PC6A 2GIRA 2VFTA 4F0KA 3RRHA 3KG4A 5B0AA 3A8EA 4A4JA 3UCZP 2ZBRA 4GVLA 2ZNYA 4YMEA 2A1BA 1NO8A 3ZTRA 3THVA 2HVEA 5JMNA 5KFIA 1UVMA 3D3CJ 2L3MA 3H7HB 1T11A 3KTQA 3CJSA 1KVJA 2OTLS 3OTDA 1M5VC 2HFOA 3HKWA 2NCKL 1UA0A 1TUVA 2JEIA 3GJQB 2CJBA 1DY3A 4H4MA 4HT5A 2V6AA 4C0HA 4CLLA 4PXCA 4FS2A 3J7AN 1CJTB 2I5JA 2ACYA 5ETLA 1K9MT 3MTKA 2P9CA 4LBIA 3H2UB 2EW9A 3IG1A 1SBRA 4ZIVA 1VBXA 4FYYB 2ZUGA 4OYMA 1R0AA 3CMQA 3G71S 1TK0A 3PHTA 3AOAA 1SJ1A 2RILA 5BR8F 3GJTB 3KXDA 4HH0A 1QAXA 2QG9B 2YX7A 4J7CA 2HGNA 4NE9C 2MSTA 3TZYA 3KUHA 3E3XA 4DG1A 2WOMB 1ELOA 3D6HB 1RAFB 2BANA 3HCXA 4M94A 5DLFA 1HYSB 5B0DA 1HBUB 1HWIA 3HSJA 4M5GA 5LM7E 3JSYA 4C8ZA 2AKWB 3DRXA 4P7TA 3LP0B 3KNAA 3TRGA 1PKUA 3BR9A 2DO0A 3CDAA 9RUBA 4BDPA 4F04B 1RT5B 5IWAJ 1BC6A 4MIBA 3UN3A 1NPRA 4DV0F 1PO6A 2Z2YB 3MCOA 2J7UA 4PWWA 3KLHB 3GSIA 4WPAA 2V4QA 3BKUA 3QJPA 1FK9A 4C98A 2F65A 1HNXJ 1EZZB 2KJWA 3DOMB 3WQPA 2DR5A 5CCMA 5F8IA 1T3NA 1UFKA 1N6QA 1LWEA 1HA1A 1BQNA 1U8WA 2C2KB 2H4YB 2YWEA 4O4GA 3AFGA 3BGFA 3JQMA 3RAQA 1YVFA 4CLFA 1TKTB 3BPSP 3F73A 4ZPAA 1MMNA 3T1AA 2CNOB 2DGQA 4W98A 4J91A 1SH0A 3BN4A 3OXFA 2N3LA 3S8SA 4CH0S 1WEZA 1FD2A 1HNWF 1P27B 1HNVB 4RW6A 1RLCL 4DR5F 5HLFB 2IFXA 2LVWA 4NA1A 1R89A 1X4FA 2MXYA 2DHAA 1HPZA 2HIYA 3BGLA 1ZTTA 4P6QA 3E51A 3HVWA 1S97A 4O44B 3ZTOA 5DQGA 3PW2A 1AFJA 2J5AA 2K7KA 4JI2J 4G6VB 5IC6B 4IG3A 1YGYA 1VBYA 4R0JA 3FBCA 4ZVFA 4N77A 4X4SA 4DFJA 3MOJB 2R8HA 2O3DA 3KUEA 1UJ6A 3POTA 4ES1A 1HQ2A 4YB6A 4H4OB 2LQBA 3QYYA 5DDQC 4KR0B 4DPTA 4F7VA 1VRUB 3NRBA 1DFDA 3VVUA 4QW9A 3DHWC 3KLHA 3V5RA 1I94J 3P6YC 2JZ5A 3UR0A 4C8LA 4X4VA 2D41A 2OEKA 4ECSA 1HBNB 3H59A 1QAJA 2XI2A 4F8RA 2BX6A 3PJXA 2ZH2A 1UTAA 3BEGB 2UXCJ 1FTRA 2Z58B 3Q0AA 1YG0A 1B70B 2KXNB 1EP4B 1JXVA 1TKTA 1CJKA 1KHVA 2HNDB 1UCNA 2A0FB 4P73A 3R9LA 2CPDA 4C3KA 4X65F 3H5YA 2D1CA 1SI9A 1D9AA 3JSMB 3GYXB 3RZAA 2GNKA 1M5SA 1C4CA 3D0HE 3KJFB 1Q86T 1C1BA 3G8QA 4DPOA 3SZ2A 1SQEA 1L5UA 3ONQA 3K5LA 2H48B 1XJWB 4LJMA 5L1LA 4I68A 4ZP6A 4W90B 4MIWA 4AXIA 2DNOA 2HFZA 1NSAA 3M6XA 2XNQA 4L3KA 4WP8A 5J2PB 2GQQA 4DN9A 3I5BA 4ZPBA 4QWEA 4LFBJ 4DSJA 3CDEA 1TAQA 1SH2A 2XYGB 1RWUA 5G4DA 2FQQB 1BLUA 3PG9A 1K47A 1OYEA 1Y4ZB 4WFZA 3LP1A 2FHJD 2QFJA 4NLXA 1OPIA 3TNVA 2YKQA 3CJ0A 3KJNB 5F9NA 3IBCB 4NMLA 1J27A 4WTYA 5AE3A 1YIJS 3N5BA 3EMTA 3L09A 3C8YA 2QLFB 1F6TA 4KGVB 4N47A 3VAHA 4FNHA 3HULA 4OYIA 1AUSL 2V4RA 2FD2A 5DZ6A 3OL8A 4QWCA 4ZVTB 1NSQA 2CQ1A 2AYEA 3NGUA 4TU8A 3GFXA 2JX2A 3F56A 1JLFB 4JI1F 3VQTA 4RNHA 3ZZYA 3ZC4A 2GVZA 1U6BA 1KD1T 1RDRA 5K14B 3FFIA 2E29A 1JLBA 4B17A 2ZBPA 4JI6J 1GXUA 2CJXB 3ZZPA 5KFKA 4RW8B 2PI4A 1NDKA 5GAHU 3U1MA 2ZOMA 5KFQA 2OPQA 1R27B 4DR6J 1YI2S 5E0OA 4XK8C 1WTFA 3Q24A 4C9DA 2ZITA 1RWXB 1P6TA 3NY0A 3QWUA 3ELHA 5A8WB 1VQLS 2KHCA 2P6TA 1JNZB 1NM2A 2MEWA 3M1VB 3KDNA 3ET6A 3GU0A 5KFTA 2EG1A 1GX6A 4YY3F 3CMAS 4WKRA 1F0XA 2JFDA 1U1PA 3SV3A 2WHOA 5F0WA 3BBCA 1HLWA 4QWAA 4DR3J 3RUBL 4E8UA 2QE5A 3GP9A 5KFZA 5A76A 3CIMA 1BQNB 1UPMB 3AJ2A 3MCNA 3GV8B 1E6YA 2X1GA 3HD1A 1VLYA 4DSEA 1VYAA 4CM2A 2DY1A 3HXMA 3BSAA 1WHXA 4CQ1A 2W4DA 2QIFA 2CDQA 1U6ZA 3MZIA 5HQLA 3HP6A 3BYPA 5LXRA 3BGUA 3D6MB 3H42A 4WU3A 1WKKA 4Y2MA 4ZCIA 3TAMB 3AH6A 2KT5A 5MAOA 3L7OA 3MCSA 5H9FJ 3DNCA 3HZEA 5IFMA 1JJCB 4NEYA 4JI1J 2GCFA 4WFYA 4ZS6A 3CEDA 3DDNA 3MUTP 3T5KA 1CQMA 3FUYA 3IGVA 1N88A 2XHWA 5K8NA 3M8SA 1FE4A 3D2WA 3MMAB 4LRBA 2M8DB 3B8HA 4JV2A 2FVPA 2AJ1A 1DTTA 1HNIB 3CCVS 4G65A 2ZH8A 3BSNA 4ANCA 5ETPA 3BGRB 3WZ0A 1PBUA 3UVJB 1M1KT 2M5YA 2RHSB 3PW5A 3FKBA 4USJC 3V4IB 2CADA 3DLJA 2YNFB 2IPOB 2ROGA 4WFXA 3TJ9A 2BW7A 3CJ5A 2BJ8A 2LQ5A 5HP1B 1RCOB 1WHVA 4WYWA 3R5DA 2W2OP 5DDPC 2VODA 2HFUA 4DLGA 5HJXA 3B6BA 2MZRA 2HRYA 3J81j 3O1LA 2PEBA 3Q8UA 3MPVA 4CT8A 2OUGA 1NH7A 1BY9A 4IUFA 1W26A 4BWMA 3OXLA 4ILRA 4NLWA 4USMA 3WHIA 2ZM6F 2G0JA 1NEEA 3J7YI 1ZS6A 1SKRA 5F0UA 1TL7B 3DLKA 2B7BB 3ZZTA 4DCOB 5C24A 3JSMA 2FVSA 1RAEB 1SPBP 2KDOA 4K59A 4L3NA 5D4LA 3LAKA 2QEXS 3FMWA 1EHWA 3GCXP 1HR0J 1CBKA 2FIUA 3IG1B 4UZCA 2MQMA 1APSA 4USKA 3TO8A 3W63A 5M2PA 1WOPA 5J1PA 4ANDA 3UDLA 2OPSB 5AE1A 2L08A 1YK9A 3WBZA 4OZLA 4FN5A 4W92B 3OTOF 1FRJA 2V94A 2F9DA 2YKNA 2KO1A 4USIA 4K0KJ 2XWXA 3HJVA 2OHDA 1U1MA 2JEFA 2E5LJ 4RW7B 2GC8A 3ULHA 1R3NA 2N4CA 2H5IB 2FY1A 3O6QA 4RNMA 3V6DA 1N0VC 4LF8J 1FI4A 1H3DA 4O0IA 4J9PA 2IAJA 5B09A 4WIIA 3UVJA 4CRJA 4F3OA 4F2SA 1XNQF 4Y2IA 5B0FA 1BQMA 3JS9A 1CJVA 4FVCA 2AW0A 2POKA 4NX9A 5KFUA 3PEJA 2QA4G 2UVWA 1PAUB 3FVYA 4HKQA 4QOTA 3T1HJ 3N6NA 3PW7A 2RD5C 4B3TF 1R8CA 3FBEA 1AFIA 2HQGA 4ECVA 2DT9A 1S48A 2RQKA 4Y3CA 1NK4A 3HVRA 2DNZA 4YR0A 2KKHA 3VAKA 5H9EK 1FJGF 4DL0C 2IDEA 4WF9Q 5ITHA 1EETB 3I9V9 5BJRA 2FUG9 4HVZA 4W4MA 1QSSA 3CC4S 1Y7PA 3LQVA 3M8QB 1HHSA 1Z2LA 1WWHA 4WTOB 5F41A 3M05A 4CLKA 4DF8A 4K5RA 3P49B 2Y8YA 2WRMA 2A18A 4FPIA 4URGA 4DF4A 1Q8IA 2BUNA 4QIVA 3DOKA 1E6VB 5HMYA 4A8YA 1S1TB 3TA0A 5C7PA 4M5DA 1EAYC 2CZ4A 4S0MA 4N76A 3KK2B 1RAJA 2IHR1 3S1TA 3BH7B 1AB8A 4R0EA 2BACA 2CXEA 2YNIA 3OJUA 4LMZA 1VK3A 1IKVA 2CG4A 2P2CB 3KLFA 3GIKA 1GH8A 1NK9A 1I3OB 3GYNA 3JTOA 3V6DB 2FTRA 1Q8LA 4EU0A 5JVHQ 3CCTA 2WBMA 5LMUF 1S49A 4MK7A 3K8WA 2MHEA 4J9NA 1RBOB 4H4OA 2XS5A 4RJVA 1H2UX 1D09B 1ZM2A 3PV8A 5LT5A 3PKMA 4WJBA 3RW7A 4UOCA 2Y1IA 2BV3A 4H54A 4WFAQ 1IKWB 2Y0SD 5FD1A 3THPA 3TANA 1LV5A 4QW8A 3RR8A 1RT1B 4ANEA 4P72A 4R8UA 3MURP 5HATA 1X4CA 2OPRA 2CAJA 2C3YA 3LH2S 5C2GA 4DHVA 4ZMMA 4FF4A 4EUVA 2W24A 4QJVA 1FT8A 4M5LA 5LSLA 4PCQA 4DR2J 1UVNA 3MMCA 4ILMA 1JXLA 5AE2A 3FSXA 3BKFA 4C11B 2CQBA 2HBYB 3NBPB 2LKZA 3TW0A 3GQCA 3UNGC 3G4SS 2JFKA 5IXUA 3OR2B 3G6XA 4H4KA 2RSQA 2XYPB 2CQGA 4LF6F 5MLCV 2IDLA 6AT1B 2HHQA 3IO1A 4JV5J 1CLFA 2DGTA 3KJQB 2MB0B 3HHLD 5J2PA 3UE2A 2IY5B 1FFGB 1T95A 3HI9A 1ZH5A 1T9UA 1N36F 5KT3A 4P2FA 2F1FA 3DGVA 4MH8A 4NLYA 4EGLA 3LGHA 4ICLA 2DRDA 5T7LA 3V81A 4M8LA 4ETXA 4DV0J 2VPXB 2ALZA 5I4MA 3MR7A 2V9WA 1SV5A 3SCLE 3NCRA 3SCKE 1DURA 4L72B 1X0FA 2CPXA 4YB5A 3T1YF 4N5SA 1K0TA 3UDCA 3PVXA 3K7RA 2KXFA 3TJ8A 2MQ8A 3MPYA 2LLZA 3FRYA 2GVDB 4X4RA 2UVRA 1IM6A 4AYBD 5L9XA 2VPZB 4C2MA 4P10A 1HI0P 4B3RJ 2FHMA 5HQMA 2RKIA 3M8PB 2BJEA 3HFVA 3H4DA 4ALZA 4K4VA 2N4DA 1RK8A 2L48A 3D9BA 3RJMB 2ALYB 1FEEA 2AGQA 1JKHB 2YWGA 2HIQA 2W1BA 3CC2S 2ZH9A 3NGKA 4JI4J 4A46A 1FRMA 2VBYA 3HX9A 3ITHB 2E44A 2V0NA 3P8BB 4YEAA 1HMVA 1V5IB 2ATCB 2F40A 1JLAB 1ZPWX 4TN2A 2VA3A 1RACB 4DZDA 2RU9A 1VGYA 2Z2LA 3NG8A 3G6YA 4PAAA 5DQHA 1VQ5S 4CYUB 2MQNA 2UU9F 4ED5A 5KG3A 5DO2A 3D54A 3OFEA 3T6JA 2VBWA 4J9MA 3P96A 3KHGA 4JP8A 1VBKA 2PMZD 2FHJA 2IC3A 1GXTA 4L73A 5B7WA 4IQXA 4FF2A 1PG5B 1SUQA 1FVSA 1HBMA 2EFQA 2AF6A 3NAHA 3GE9A 4PXDA 5T7LB 3CJKB 1J2VA 3VWSA 2AGOA 5DDRC 2MLXA 5KG0A 3ENWA 1Q4RA 1NB2A 4OI4A 2O67A 4WE1A 1WC3A 3G82A 2VQEF 4M1KA 2HWTA 1T9XA 2DGSA 3G86A 1KQSR 3QAEA 1JJ4A 3NGSA 2V8GA 5HMXA 4DBQA 1L3SA 1T7PA 2GVDA 4QR1A 4CO1A 1C1CA 2VG7A 1R0CB 3M6VA 3NGDA 1UWBB 4JI6F 2XCAA 3QT6A 4NEZA 2BQ3A 3MM9B 5L46A 2UXCF 1FKPA 2ERRA 3CC7S 4FF3A 4EO6A 2PGCA 1D9FA 4NZ7A 1IXKA 5ETMA 3MDFA 2YKMA 1IN0A 1U1LA 2HZCA 2EFOA 2JLEA 3E01A 3SSQA 5KFRA 1RI7A 4X66J 2NXJA 1SJ3P 3OLAA 4PXEA 1MNEA 1Q78A 3W7BA 2XLKA 3KLFB 3TAQA 3QIDA 3CNQP 2YH0A 2VF3A 4ZDNA 3THTA 4CLUA 2QJ3A 3BSOA 4D3HA 4F4WA 4OX9F 3LP0A 3PJ9A 2AD9A 1WG1A 1S12A 4UZBA 2ZE2A 5GAHI 4OYXA 5CA5A 2R7OA 3EE3A 3V4IA 2P8IA 4IR9A 1S57A 5EN1A 2PO4A 2OMOA 4KJIA 1UFWA 1M1GA 3T5JA 1RT6A 2NPIA 3JTNA 1XR5A 2MKCA 3MWBA 1GNKA 1IKWA 3Q83A 2J6TA 2W8LA 1T05A 1FD8A 3K5MA 3IWNC 3Q8QB 2RF2B 4R8UB 3OSNA 2E5HA 4P7VA 2X7IA 1N5YB 2DNNA 1XEZA 4MK8A 3PXGa 2AJ2A 2RJZA 5KFEA 4OYPA 4ER8A 2PFFB 4NMXA 1B4SA 2W8KA 2VASA 4EFAC 2BJ7A 2XLJA 1NJXA 4TY8B 3EICA 2F4VJ 4H4MB 1X5SA 4RPFA 3BGOP 2DITA 3D67A 3OT9A 2BW2A 3QNWB 3DKDA 3PNIA 4C11A 4QWDA 2GJIA 1D8YA 3NBPA 1GX5A 2DIUA 1Q8KA 2B9YA 3BB5A 1GAOA 3EWGA 3OSPA 4IDKB 3VCDA 2Z2MA 1O8BA 3CCWA 2HQCA 1HNVA 2KI2A 1Z4UA 4NI2B 3W8GA 3EZOA 2HQFA 3W2WB 2DH9A 2RDJA 2B8PA 5KFDA 1N56A 3VAMA 3MMJA 2OFHX 3PJWA 4JYAJ 3E01B 2A6OA 1O0PA 1AROP 1S0VA 2BRKA 1RTDA 2FGOA 2Y1RI 3M8WA 4IRCA 5ETVA 3IRWP 1F3VA 4M5HA 1HI8A 4RW7A 1F5CA 4IG3B 1WEYA 2W9BB 1QAYA 4I7FA 2D9OA 4NPOA 4LF4J 1RAGB 4JI7F 4B9LA 4R5PB 3CF5Q 1M0SA 3N28A 4Z7YA 1IWAA 2GX8A 3AXMA 2N3OA 4URQU 3GLJA 2B6AA 4U8YA 1BQMB 1LFWA 5I3UA 2P5VA 3OR1B 4Y2KA 1X0PA 4KRWA 4ZN1A 1PGZA 1VLOA 3E2EA 2N7CA 5A8RB 3J80Y 3K2YA 4BBYA 2RKIB 1FK9B 3FBFA 4KC5A 4IOAQ 3OUYB 2GJ2A 3IFEA 4PQUB 4LQ9A 5D0RA 2RQCA 1EQMA 3GIJA 1U1RA 1G2EA 1AT1B 3MUVP 2UU9J 1KNZA 4YQWA 1OPZA 4DQRA 2QMXA 4WK3A 1Q53A 2ZNZA 2JWNA 4KB7A 4CLYA 4A8MP 1JNRB 3SBMA 1RXOB 1RAOA 2UV8A 3MTJA 4FYXB 3BO2A 5HK4A 4DQQA 1U49A 5DM6Q 1VRQC 3PYEA 3WX8A 2G4BA 2X1BA 3DI6B 3KLEA 5JJBA 4G1IA 1X9MA 1L3UA 1FTCA 4GKJJ 3T9ZA 4ZVQB 2K2PA 5L8RC 4KPCA 3KHLA 5HLFA 1RJJA 4K8RA 4TKTA 4JI5F 2IM0A 1TL4A 1UMJA 3W64A 5KOWA 2G2YA 2ZH5A 1BWEA 2KG1A 3HSGA 5C5JA 2WCXA 1QAIA 1C0UB 4KKOB 1WF1A 5CHCB 2MGZB 3T5HA 2DGOA 1FWKA 4NL5A 1T3OA 4WKYA 1S10A 2JEJA 4QR0A 2IBKA 3FCHA 3SFGA 3OW2R 3PCOB 1J5OB 3N5FA 4AL6A 3MEKA 1TQLA 3JTPA 3LP1B 2UV8G 3J7ZT 1TU0B 2PMHA 2ZEJA 3VF0B 5GVQA 2KHDA 4O3PA 5J2MB 4CO2A 3GIRA 1I94F 1X8DA 3T9NA 3MM8B 1BD6A 1N32J 3MUMP 3GILA 1IVZA 1MN7A 1XNRJ 3Q2TC 2FZKB 3W9JA 4NXMJ 1C1CB 2VG7B 2EK6A 4FBTA 1GEHA 1DHMA 3GFYA 2HPUA 4L76A 1OWXA 1YBTA 4LR7A 3CXCR 3R7NB 1JJ2R 1YRXA 3IC1A 3R7BB 5BR8J 1SJRA 2Z4PA 3NKYA 3EM1A 4QYRA 4FNIA 1OJ4A 1HW8A 1SCJB 2GVZB 2J0XA 5D8HB 1FEHA 3H20A 3HT0A 1NHKL 5H1SV 2ACMA 4LR8A 3QO9B 5KG7A 1I1GA 5RUBA 2RS2A 2J76E 3NEKA 2HGLA 3M32A 1TKZB 4DL5A 2JEGA 2VU5A 4O3QA 3PO4A 3AA8A 1TZ0A 4OX6A 2R2TA 4OZNA 1H72C 3GR0A 1RABB 5F8NA 5DG8A 1Y5IB 2V5HG 2J9DE 1RT7A 3OFGA 7FD1A 4LF5F 1AZSA 3EPIA 4B3SJ 3N79A 3AB4B 5E3RA 1SJ4P 1RB0A 1M90T 3DGPA 4WXOA 3MM7A 4ED0A 1CQNA 4KY3A 4XPCA 1P1TA 3P5BP 4DX7A 3HD2A 2LCWA 4YR2A 2CNKB 4U7UD 3VHQA 1RTHA 3DM2B 1VQYA 1XMQF 2MQQA 2KFNA 1FKOB 3J81Y 3PX0A 4O3NA 2QA1A 3C14B 2YH1A 1SV5B 4X4OA 4LR9A 5KT2A 2LFVA 2RH3A 2M7SA 1YJRA 3K5OA 4WZMA 4LUBA 2GO9A 4PQAA 2BJ9A 1WUUA 4GKKF 1FWPA 2VZ9A 4KQZA 1EB0A 2NQPA 4O3SA 2AEFA 4LF4F 4RBUA 4DR1F 4EO8A 2ZC4A 4BS2A 3HF5A 3GONA 4RW9B 4DS5A 3ENVA 2QC3A 2H65B 3X3UA 3KHRA 3I9ZA 1IQZA 2FJWA 1GTHA 2A2DA 4J90A 4QIWD 2M70A 1IKYB 2AJ4A 2YPZA 5BYSA 4TYAA 1S1XB 1TKDA 3FCWA 1NK8A 1HNIA 2LEPA 4J37A 4WIQA 1VQ7S 1VJQA 3H2VE 5ETSA 4MAKA 2UUWA 2VG5A 2CPJA 3OPKA 5M2RA 4FDFA 4GVBB 4KHPF 2G0CA 3BJYA 1LQ9A 1XMBA 5GAEU 5G0RB 2QT7A 4K4SA 2K06A 1PYOB 2CPHA 2VD3A 1RT2B 1YHQS 1U2CA 1FF2A 3OUYA 4RU2A 1N33F 3SEOA 3KNGA 2UXBF 2DH7A 3GV7B 5HAOA 4ELVA 1MW7A 1SKSA 3DFEA 3GJSB 3TZZA 1GXLA 4ZJOA 1JXEA 5DRKA 3PEHA 2KFZA 5J1EB 4UQTA 1U2FA 3PIOQ 1Q95G 2DY9A 2WVFA 4URSA 2QA2A 2BM0A 2ZBCA 5KFSA 1BHNA 2LEBA 4HTIA 1NU4A 1VFJA 3VGSA 2YKPA 2JOQA 2VA2A 2VFUA 1VRTA 1FRHA 2NXNA 1YJ7A 1KLMB 2XMTA 4WFBQ 2B7CB 2BMBA 1KBRA 1X4GA 3FEZA 3K89A 4LT6A 3HT3A 3ISZA 4K5SA 3MR6A 2QL5B 1I51B 3R6LB 4CM0A 3M2RA 2GIFA 1LWFB 2EXUA 3ZZOA 3EJMA 4ECWA 2MQLA 4NXMF 1KS2A 2HVDA 2HZAA 4RR5A 4IYQA 2C28A 1LW0B 3DYAB 3JSRA 2DNYA 2J8SA 3FNNA 2ZC3A 1HWLA 3BGRA 2VQEJ 3M2UB 1KFDA 3L95X 1JJHA 4BLGA 3PZPA 2HHPA 3DHXA 5J2MA 2XZWA 4P71A 3WDOA 2ZE2B 2DNRA 2Q6BA 4DPUA 5KG2A 2QRRA 3G8SA 4I6YA 1QD1A 2M0GB 1FRXA 4TYBA 5BXIA 4NCBA 2MLZA 4PWDB 1PC5A 1FXLA 2D69A 4IH6A 3R5JB 1Q1KA 3GIIA 4N7TA 2W9AA 2RRAA 4KTQA 5CABA 4KV8B 2CZVC 1WOOA 1SKWA 2VOOA 1Y0HA 1ZPVA 2UXDJ 1LWEB 3A13A 4AUKA 3KJVA 3ZNUA 3QO9A 2MLYA 5J1EA 3RAMA 1WTBA 2V4JA 3DLKB 3BYRA 3VGVA 4Q43A 2Q3PA 2ZWOA 4UOGA 5KFNA 3DRRA 2ZOGA 3FC9A 1NB7A 3QLHA 3HVAA 3MR5A 4A8WA 2V63A 1HBOA 3D0GE 2R7WA 2KFYA 5I3PA 1WKJA 3HM9A 1NKCA 4IDKA 2UUAF 4RW6B 3KLIA 2RQMA 1FERA 4LBHA 2WB1D 4P75A 5E3PA 3D3BJ 1T03A 1U09A 3SDEA 2RMLA 1S1TA 2NUUG 2OPSA 4M5DB 2U1AA 1S1UA 4DX5A 2WK4A 4RUBA 1FCAA 2COLA 4M5JA 5EWEA 5GADI 3M9NB 3TUIC 1UWAA 2DR6A 5ETNA 1GMWD 2ZVSA 3HKZD 2WVDA 4JI2F 2B5JB 2I0XA 2IJFA 1EX8A 1RWPB 2BXJA 2LP4A 2P9EA 3AQPA 8AT1B 5HMZA 3CUNA 2ZHAA 4Y00A 1FKOA 3RAXA 3OVSA 1S7IA 2BE9B 2IRYA 4GMKA 4X66F 1RBLA 4DQIA 2E1AA 4YDDB 4MYUA 3UCUP 3BDEA 4ILLA 3W61A 4FXWA 3CB4A 3RRGA 4DV4J 2R9LA 3DXSX 3DLEA 1BMQB 5K8PA 3DLGA 2DPIA 2MHNA 1WF0A 2BJ1A 1FRKA 1N34F 2DPJA 3G9CA 2JVRA 2DO4A 1P9YA 1ZZFA 3EPGA 2FC8A 1R8AA 2AZ1A 2RDIA 2HVHA 3J7A1 4LF1A 1PILA 3NGRA 3W3SA 2OPRB 2MY8A 3ISNC 4JB8B 1FE0A 1N4LA 1ROFA 2OI2A 3FGVA 3NXZA 2ZM6J 4I69A 4GC6A 1DTQB 3DRPB 4X4PA 2AX1A 1NZAA 1N5VA 2ZH6A 1TELA 2HNDA 1SIZA 3I0SB 1HNZJ 2FJXA 2HGMA 3EGWB 3W2VA 1WSRA 3JSBA 5IQ6A 1N33J 3I5CA 4C0BA 5EX3A 2M8HA 4FXDA 2W2MP 2RDDA 1U1QA 1QUVA 3PYDA 4F3QA 4DL3A 4ZJLA 3H2LA 4OYZA 3QSIA 4PPDA 1RHJB 1RQ0A 1WEXA 4RW4B 1H2TZ 1RBAA 2F63A 2PEHA 5D0HA 5KOXA 4RWXA 2ASJA 2FJBB 2AGPA 3C46A 3TA2A 2YWWA 4DMZA 3OD2A 3RR7A 1SJQA 4K4XA 4A8QA 1X5PA 1CJUA 4YUDA 2L9DA 2MPUA 1IKVB 4ID5A 1JLGB 5J2NA 1NDLA 3EGVA 2J0WA 3MCMA 4CIOA 2DNHA 2WB4A 4UOHA 4DUYJ 1LXJA 2KU7A 2J6SA 2KG0A 3SYZA 2Y0BB 1V3SA 3R8YA 5KTQA 2KTQA 4N8OA 1HQEA 4YFUA 2XSFA 2BKNA 4G1PA 3VALA 4DR2F 5FLXU 2MKYA 3RBDA 1KQGB 1IBLF 2NPFA 2KZZA 1R8HA 4LFCJ 3R3TA 3DLBA 4AXJA 2W01A 3IR7B 2PD1A 4LVNP 5HJYA 2XMAA 1F9HA 4Q8FA 1KVKA 3CULA 3N6LA 3UN5A 5KT4A 2PA3A 1PIEA 2B56A 2EFNA 5CH7B 3ZZ0A 4DFMA 4JI7J 1HKAA 4ZIWA 2PI5A 1XTZA 1JLFA 3G87A 2IMOA 4M63A 1QM9A 2ZJPQ 4JI3J 4F25A 2IVMA 3CCQS 3Q86A 1G3OA 4QCLA 2XZTB 2X1FA 5D4NA 3D6FB 4KPYA 2DD8S 4E98A 1O5JA 3LA0A 3HPOA 1JQGA 4E0DA 4B02A 4K4ZA 3MEDB 2QL7B 3RBZA 5H9EJ 4DU8A 2V8VA 3UO0A 3GPAA 2LXIA 2IIHA 2YNGA 4X62F 2I38A 4Z37A 3G8TA 3CCMS 5LMNJ 1NNDA 2E7WA 3ET6B 4CO3A 4OI1A 3C6TA 2A6MA 2X1AA 1HWUA 2D9PA 2A3JA 5DZ7A 4NLGA 4ZOSA 4CTAA 5HROB 1TKXB 3QRQA 3R2DJ 2R7SA 1BQXA 4ES3A 4ZCMA 1R43A 4LF5J 3W9IA 2C3PA 1IR2A 1VMBA 1CJUB 3Q2SC 1NRKA 4KBIA 2CJYB 4KV8A 3ETMA 1OMSA 5EUHA 1LW2A 3CJ8A 3G6ES 4B3MF 1F9EB 2YX4A 4PWUA 3KLGA 4X4QA 3BO4A 3DM2A 3Q89A 4PG7A 2ZD1B 4U9RA 5CCLA 3G6VA 2HURA 1OSDA 2WONA 3D66A 3GG1A 3SXLA 1ZAVA 4YDXA 4A8XA 1YJUA 1ULRA 1HBOB 2RS8A 1HQUB 2QO3A 3P5TL 2OIHA 1VISA 3KK3B 4E2FB 3LWLA 1X5OA 2BE2A 3NNCA 1N34J 1R0AB 3IS9A 4WBFA 1JK9B 5LJ3Y 2LYVA 2DGUA 4PG4A 2KRBA 1S1UB 1O6XA 3I32A 4Q7AA 4WYLA 3K17A 1XNRF 1NJZA 3RTVA 1YDLA 2ZUAA 4NYOA 4TU9A 1SL0A 2YKAA 3HFKA 4ECYA 2Q1LA 4KHRA 1HMVB 1TL3A 1RWOB 1UKUA 3J80U 3TOQA 5EWGA 4MJKA 3PYGA 2L9NA 1YX2A 3FJ2A 1B64A 1MWQA 2VG5B 2QLWA 4K2JA 4WP9A 5DGBA 3Q8SB 1MROA 1RU1A 4LFCF 2VOPA 2MZ1A 2OO4A 4CLWA 2VHGA 1CSJA 3UWTA 3V6HA 5HROA 1CC7A 1RT6B 2KYZA 2OELA 2IC3B 1K44A 2DH8A 3FZ2A 3H90A 5KFGA 2XZDB 5L38A 2KM8B 3CCZA 4ATNA 1B0VA 2B9EA 3NGTA 4N8NA 1V9OA 3BQ1A 3LANA 1HNXF 4Q2LA 2R7QA 1QLNA 1XK8A 1FDDA 5D78A 4F4XA 2CYYA 3F41A 4TY9A 4OYWA 2F8MA 4DQPA 1MMDA 3QFWA 3QGIA 4ED6A 2Z0GA 3PO5A 2CVIA 2ZH7A 3I0SA 4QZVB 1YJNS 3QGPA 2LXFA 3DMJA 1M5PC 3HSZA 4USVA 4JUZA 2G1HA 4CLZA 1YJVA 3L7UA 1W7WA 4F36A 3MEEA 2BKPA 2Z56B 4FYWB 2P9GA 2OJ3A 4K50A 2YTCA 3EDQB 3ICLA 1IJFB 3W2WA 4RW4A 3DOLA 5KFVA 3Q8PB 1HPZB 2XY6A 2C2NA 5HO4A 3VGTA 3DLLQ 3B4MA 3H25A 2QGFB 4UQGA 4DV3F 2J9CA 3D1QA 2VL1A 2K1RB 2ZKUA 5K20B 2BYCA 1DLOB 4JI8F 2B9XA 2G9OA 4CO0A 3M2RB 1PYSB 2HHWA 4F50A 1S6QA 2C2EA 1N8RT 1R8BA 2E66A 4ECZA 1WOSA 2ZOFA 3CJTA 4Y0FA 1K8AT 2MZJA 4IO1A 2FZCB 1HQEB 4DV7J 1QJHA 4LF9F 1N32F 1WKLA 4FP9A 4I6AA 1FA0A 3FDSA 3QFHA 4IOCQ 2W2QP 2XY7A 4MT1A 4O4RA 5ETKA 1U47A 1CJVB 3TZXA 2B6AB 4IH7A 3IR6B 3R2CJ 4LSNA 5A2QU 1U4BA 1CG2A 1RT4B 4DUZJ 4K4UA 1UEUA 5GAEI 1S6UA 2W9CB 1YWXA 1VQ9S 5DM7Q 5IT0A 1SQFA 2W25A 3I4HX 1NJWA 1A6LA 1FXRA 2GQCA 1CJKB 1ZM3A 2PFDA 4X84A 4OJHA 5DDOC 4AE5A 4LF7J 3CD7A 1RSCA 3DRRB 1V6HA 1VS3A 2V8PA 2YWKA 3M8QA 2OMLA 4X65J 4RNNA 3TVZA 3J7Z5 4J9QA 2XY5A 1KC8T 2ZZMA 3DI6A 4ZVGA 4C8MA 3R6GB 5SUHA 5AXNA 3W60A 3WIVA 4CLPA 3U1NA 3PKYA 1U0HA 1JIHA 4CTAB 1NPPA 2FZGB 3VZIA
chains in the Genus database with same CATH topology
2Q79A 5AXKA 3ZZRA 1S9GB 2CPZA 3I87A 5AJ3F 3PFEA 3I6PA 2MKHA 2YNIB 3UI3A 4CI0B 2ASDA 2UXDF 1FXDA 2BANB 4NWBA 3PW0A 4OMFG 2W9BA 1HYSA 3MAQA 4GC7A 3C6UB 2D74B 3MF5A 2R2SA 1JMTA 1LK7A 5JUMA 3MM8A 4NRTA 2CPEA 3OR1A 4A47A 2HQ3A 2Z8QA 2K3KA 2I8EA 4JBCA 2VG6A 3KHHA 1FNMA 4M95A 1H2VZ 1IBKF 2BE2B 3GFZA 3LPYA 5E5NA 4B9MA 2W7PA 4QBUA 4DV1F 4XDDA 3FEXB 3MGJA 4HI1A 1YJTA 2P6SA 2MYFA 3DRYA 4PXBA 3U1LA 4F67A 3LWMA 4EBDA 1VQ6S 5K14A 1HI1A 4O4GB 2F3JA 4OHWA 2OKQA 1FESA 2WBRA 3CDWA 5EX0A 4U6PA 3B82A 2QA4S 4J9LA 3MECB 3CMES 5IM0B 4B9TA 5I42A 2NR0A 5CZXA 5LXYA 4LF7F 2J7WA 1V3ZA 4F26A 3H5SA 1VJWA 3M32B 2XS2A 3R1HA 3CCES 5KFFA 2DGVA 2FPHX 2HAIA 1UP1A 2KB2A 4IKAA 5CZVA 4PR6A 3M1VA 2GW8A 2RUGA 5KG4A 4OI3A 1ZBTA 3C2PA 1Y3KA 2XMWA 1DQ8A 4J9OA 3DRSB 2DISA 3R1LA 1RGVA 1NKEA 1YRTA 1FNXH 2ZHOA 2UUTA 3G9CA 2RB7A 4U67Q 2RU3A 2E9TA 4FS1A 5A2QY 1K1SA 3VTIA 2HW3A 5B0BA 4DFKA 3N4WA 3BQ0A 4ZA1A 1OO0B 3B4DA 5KFJA 1U2RA 2AP6A 4OI0A 2E7XA 3PIPQ 4OHZA 1VQ4S 4J9RA 2XB2D 1IM4A 3R27A 1IQTA 3K59A 2PSZA 1S9FA 3CGIA 1RKJA 1HWKA 5D6GA 1ZOTA 2APOA 3CSKA 5CQGA 3UPFA 5K8MA 4I2PB 2LEAA 3F44A 4HLBA 3U02A 2DGXA 4RX6A 4LIWA 4TQSA 3SSSA 2M3DA 3T5LA 4NYPA 5T41A 1HARA 5KT5A 2ZH3A 4Q5VA 2J0SD 3JB9k 4KO0A 4LFBF 4V19X 3IRXB 3CJ4A 4MIAA 1M5KC 1N5SA 2E1MC 2JLFA 4N41A 2ZJRQ 4HHJA 3N01A 3OL9A 3KK1A 2KXHA 3GMGA 4Q44A 3HHEA 5L1JA 2BZ2A 3C3LA 2JVOA 1KN6A 4OIXA 2HWHA 2HNZB 2PN6A 1RT4A 3PACA 3S7RA 4AFFA 2NS1B 5HI7A 5E3QA 4Y28C 2CFXA 5J1NA 5DS7A 3CJKA 1LW2B 2IJNA 2XMMA 5CYQA 2XWYA 1BGXT 4C3MA 3VAGA 4JV5F 1Q79A 3OL7A 2BOPA 4JI0F 4BC9A 4B3SF 3TA1A 2QV6A 2YY3A 4ID8A 2ZHBA 1V3RA 3A1YG 5E7OB 5KFBA 3K5NA 3VAFA 2HG4A 3I82A 2FLLA 4JI3F 2PIIA 2EI5A 5HMWA 2GHWA 1HQUA 3MFIA 3PX4A 3MM9A 3N6MA 1VRTB 1VQOS 2NSBA 3QAUA 4RW9A 2KM8C 2YKMB 4JOUA 1F9FA 3CE8A 4XPEA 1LWCB 1N52B 2EK1A 2HLTA 3MEGB 4EZ6A 3AA9A 2V8DA 1VQNS 3KMSA 2MKKA 2RNEA