2YNKA

Wzi, an outer membrane protein involved in group 1 capsule assembly in escherichia coli, is a carbohydrate binding beta-barrel
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
456
structure length
441
Chain Sequence
AGLVVNDNDLRNDLAWLSDRGVIHLSLSTWPLSQEEIARALKKAKPSYSSEQVVLARINQRLSALKADFRVTGYTSTDQPGTPQGFGQTQPADNSLGLAFNNSGEWWDVHLQGNVEGGERISNGSRFNANGAYGAVKFWNQWLSFGQVPQWWGPGYEGSLIRGDAMRPMTGFLMQRAEQAAPETWWLRWVGPWQYQISASQMNQYNAVPHAKIIGGRFTFSPIQSLELGASRIMQWGGKGRPESLSNFWDGGNQLAGFDFKFKLEPTLGWPVSFYGQMIGEDESGFLPSANMFLGGIEGHHGWGKDAVNWYLEAHDTRTNMSRTNYSYTHHIYKDGYYQQGYPLGDAMGGDGQLVAGKVELITEDNQRWSTRLVYAKVNPENQSINKAFPHADTLKGIQLGWSGDVYQSVRLNTSLWYTNANNSDSDDVGASAGIEIPFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Wzi is an Outer Membrane Lectin that Underpins Group 1 Capsule Assembly in Escherichia Coli.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords WZI
total genus 130
structure length 441
sequence length 456
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14052 Caps_assemb_Wzi Capsule assembly protein Wzi
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.130 Mainly Beta Beta Barrel Porin Porin 2ynkA00
2YNKA
chains in the Genus database with same CATH superfamily
2ODJA 3POXA 1Q9FA 4G76A 4GCPA 4N74A 1THQA 4F4BA 4LSHA 2KC0A 4E1SA 2KDYA 4FUVA 4C4VB 2QTKA 2IWWA 4GHBA 3PQUA 4N75A 1QJ8A 1BT9A 1ZHWA 3DA4A 3KVDD 5G39A 5ADXK 3AAEB 4XNKA 5GV0A 1G90A 1BH3A 4N59A 1IZNA 4AYNA 4FZMA 4AKMA 3AA7A 4UB8O 4PJ0O 3PGRA 2M06A 3A0BO 3DA3A 5DL6A 4LSFA 3LK3A 4O49A 1OSMA 7PRNA 3UAQA 5E79O 3PQSA 3PF1A 5KAFO 5G26A 2Y0HA 4AYEC 3UPGA 3AA6B 2MHLA 3BRYA 2K4TA 2ERVA 2XE3A 2FGQX 4GF4A 3K19A 5IYUA 3AA0B 2YNKA 3C5OA 4AKRB 3LK42 2KZ7B 3HW9A 3PORA 3EMNX 2OMFA 4AZLA 2XE5A 4IL6O 4O3XB 3PRNA 4JFBA 4AYID 3V8UA 3DWNA 3HOEA 1HXXA 3NSGA 3VE2A 3WI4A 2XTRA 2F1TA 2KXPA 2Y0LA 3RBHA 4RLBA 3SZVA 1P4TA 2XMXA 1QJPA 1ZHYA 2R4LA 1ZHZA 4FMSA 3VZWX 5H2FO 5KAIO 5EE2A 2XG6A 1MM5A 4RL9A 2PRNA 2O4VA 5G38A 4O3ZA 4C00A 4O3YA 3QRAA 2GE4A 1Q9GA 2JMMA 2X9KA 3AAEA 3LK2A 3NJTA 4RJXA 1H6S1 2R89A 3AAAB 5PRNA 1HXUA 2W81C 3FYXA 3QRCA 4GCSA 4K3CA 1MPFA 3A0HO 4K3BA 4AKRA 4FRTA 4FT6A 4Z3TA 5AFUL 4KR8A 1OPFA 3POUA 2XE1A 3AA6A 3A2SX 5DL5A 5DL7A 3TZGA 3VE1A 4AYMC 2WJRA 4D5UA 2MNHA 3SYSA 1S5LO 2XE2A 4C69X 2XTQA 4QQ1A 5DL8A 3SY9A 1HXTA 3KZIO 3PGSA 3SZDA 4XNLA 2K0LA 4FZNA 2IWVA 1MM4A 1PRNA 2R4OA 2R8AA 4B61A 4FZLA 3LK41 5B66O 4FSOA 2KXPB 2KZ7A 2Y2XA 8PRNA 3AA0A 5GTIO 4BUMX 2F1CX 1ZHTA 2ZFGA 2J1NA 2X27X 4E1TA 2Y7SA 3GP6A 2N2MA 4C4VA 3T20A 4FSPA 4RLCA 4RJWA 4N58A 3PGUA 1YS5A 4G75A 4O4XA 3VZTX 3T0SA 2M07A 3SY7A 2PORA 5GTHO 4AUIA 3LK2B 2R4NA 2WJQA 2ZLDA 1BXWA 1GFMA 2LHFA 4KR4A 5T5FA 1PHOA 2W80C 4FESA 3JTYA 1GFPA 5TISO 4AFKA 3VZUX 2LFUA 3DWOX 4U9CA 3AA1B 5ADXL 1T16A 1IZNB 4O4UA 3BS0A 3SYBA 3DZMA 3T24A 2JQYA 3WU2O 3POQA 4O3WA 1QJ9A 5B5EO 3UU2A 3JCUO 2FGRA 2WVPA 1ZHXA 3WI5A 3AAAA 1T1LA 4D65A 6PRNA 5D5DA 3VY8X 3G7GA 4FRXA 4CTDA 2F1VA 4PR7A 4UB6O 4GCQA 5FVNA 2R88A 4LSIA 1GFQA 4FQEA 3LK3B 1GFOA 1GFNA 4D64A 3BRZA 4LSEA 4JCHA 2J4UP 3HOLA 5AFUK 3AA7B 4KRAA 2AXTO 4AYDC 2YPVA 2N2LA 5G3AA 1ORMA 3VY9X 3AA1A 4FOZA 2Y0KA 3HWBA 2R4PA 1E54A 4PUXA 5JDPA 3O0EA
chains in the Genus database with same CATH topology
2ODJA 3POXA 1Q9FA 4G76A 4GCPA 1THQA 4F4BA 4LSHA 2KC0A 4E1SA 2KDYA 4FUVA 2QTKA 4GHBA 3PQUA 5ADXK 1QJ8A 1BT9A 1ZHWA 3DA4A 3KVDD 5GV0A 3AAEB 4XNKA 1G90A 1BH3A 4N59A 1IZNA 4AYNA 4FZMA 4AKMA 3AA7A 5DL6A 2M06A 3DA3A 4LSFA 3LK3A 4O49A 1OSMA 7PRNA 3UAQA 3PQSA 5G26A 2Y0HA 4AYEC 3UPGA 3AA6B 2MHLA 2K4TA 2ERVA 2XE3A 2FGQX 4GF4A 3K19A 5IYUA 3AA0B 2YNKA 3C5OA 4AKRB 3LK42 2KZ7B 3HW9A 3PORA 3EMNX 2OMFA 4AZLA 2XE5A 4O3XB 4AYID 3PRNA 4JFBA 3V8UA 3HOEA 1HXXA 3NSGA 3VE2A 3WI4A 2XTRA 2F1TA 2KXPA 2Y0LA 3RBHA 4RLBA 3SZVA 1P4TA 2XMXA 1QJPA 1ZHYA 4FMSA 1ZHZA 3VZWX 5EE2A 2XG6A 1MM5A 4RL9A 2PRNA 2O4VA 4O3ZA 4O3YA 3QRAA 2GE4A 1Q9GA 2JMMA 3AAEA 3LK2A 4RJXA 1H6S1 3AAAB 5PRNA 1HXUA 2W81C 3FYXA 3QRCA 4GCSA 5AFUL 1MPFA 4AKRA 4FRTA 4FT6A 4Z3TA 4KR8A 1OPFA 3POUA 2XE1A 3AA6A 3A2SX 5DL5A 5DL7A 3TZGA 3VE1A 4AYMC 4D5UA 2MNHA 3SYSA 4C69X 2XE2A 2XTQA 4QQ1A 5DL8A 3SY9A 1HXTA 3SZDA 4XNLA 2K0LA 4FZNA 1MM4A 1PRNA 4B61A 4FZLA 3LK41 4FSOA 2KXPB 2KZ7A 2Y2XA 8PRNA 3AA0A 4BUMX 1ZHTA 2ZFGA 2J1NA 2X27X 4E1TA 2Y7SA 3GP6A 2N2MA 3T20A 4FSPA 4RLCA 4RJWA 4N58A 1YS5A 4G75A 4O4XA 3VZTX 3T0SA 2M07A 3SY7A 2PORA 4AUIA 3LK2B 4KR4A 2ZLDA 2J4UP 1BXWA 1GFMA 2LHFA 5T5FA 1PHOA 2W80C 4FESA 3JTYA 1GFPA 4AFKA 3VZUX 2LFUA 4U9CA 5ADXL 3AA1B 1IZNB 4O4UA 3SYBA 3T24A 3POQA 4O3WA 1QJ9A 3UU2A 2FGRA 1ZHXA 3WI5A 3AAAA 4D65A 6PRNA 5D5DA 3VY8X 3G7GA 4FRXA 2F1VA 4GCQA 5FVNA 4LSIA 1GFQA 4D64A 3LK3B 1GFOA 1GFNA 4LSEA 4JCHA 3HOLA 5AFUK 3AA7B 4KRAA 4AYDC 2YPVA 2N2LA 1ORMA 3VY9X 3AA1A 4FOZA 2Y0KA 3HWBA 1E54A 4PUXA 5JDPA 3O0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNK A; 
#chains in the Genus database with same CATH topology
 2ODJ A;  3POX A;  1Q9F A;  4G76 A;  4GCP A;  4N74 A;  1THQ A;  4F4B A;  4LSH A;  2KC0 A;  4E1S A;  2KDY A;  4FUV A;  4C4V B;  2QTK A;  2IWW A;  4GHB A;  3PQU A;  4N75 A;  1QJ8 A;  1BT9 A;  1ZHW A;  3DA4 A;  3KVD D;  5G39 A;  5ADX K;  3AAE B;  4XNK A;  5GV0 A;  1G90 A;  1BH3 A;  4N59 A;  1IZN A;  4AYN A;  4FZM A;  4AKM A;  3AA7 A;  4UB8 O;  4PJ0 O;  3PGR A;  2M06 A;  3A0B O;  3DA3 A;  5DL6 A;  4LSF A;  3LK3 A;  4O49 A;  1OSM A;  7PRN A;  3UAQ A;  5E79 O;  3PQS A;  3PF1 A;  5KAF O;  5G26 A;  2Y0H A;  4AYE C;  3UPG A;  3AA6 B;  2MHL A;  3BRY A;  2K4T A;  2ERV A;  2XE3 A;  2FGQ X;  4GF4 A;  3K19 A;  5IYU A;  3AA0 B;  2YNK A;  3C5O A;  4AKR B;  3LK4 2;  2KZ7 B;  3HW9 A;  3POR A;  3EMN X;  2OMF A;  4AZL A;  2XE5 A;  4IL6 O;  4O3X B;  3PRN A;  4JFB A;  4AYI D;  3V8U A;  3DWN A;  3HOE A;  1HXX A;  3NSG A;  3VE2 A;  3WI4 A;  2XTR A;  2F1T A;  2KXP A;  2Y0L A;  3RBH A;  4RLB A;  3SZV A;  1P4T A;  2XMX A;  1QJP A;  1ZHY A;  2R4L A;  1ZHZ A;  4FMS A;  3VZW X;  5H2F O;  5KAI O;  5EE2 A;  2XG6 A;  1MM5 A;  4RL9 A;  2PRN A;  2O4V A;  5G38 A;  4O3Z A;  4C00 A;  4O3Y A;  3QRA A;  2GE4 A;  1Q9G A;  2JMM A;  2X9K A;  3AAE A;  3LK2 A;  3NJT A;  4RJX A;  1H6S 1;  2R89 A;  3AAA B;  5PRN A;  1HXU A;  2W81 C;  3FYX A;  3QRC A;  4GCS A;  4K3C A;  1MPF A;  3A0H O;  4K3B A;  4AKR A;  4FRT A;  4FT6 A;  4Z3T A;  5AFU L;  4KR8 A;  1OPF A;  3POU A;  2XE1 A;  3AA6 A;  3A2S X;  5DL5 A;  5DL7 A;  3TZG A;  3VE1 A;  4AYM C;  2WJR A;  4D5U A;  2MNH A;  3SYS A;  1S5L O;  2XE2 A;  4C69 X;  2XTQ A;  4QQ1 A;  5DL8 A;  3SY9 A;  1HXT A;  3KZI O;  3PGS A;  3SZD A;  4XNL A;  2K0L A;  4FZN A;  2IWV A;  1MM4 A;  1PRN A;  2R4O A;  2R8A A;  4B61 A;  4FZL A;  3LK4 1;  5B66 O;  4FSO A;  2KXP B;  2KZ7 A;  2Y2X A;  8PRN A;  3AA0 A;  5GTI O;  4BUM X;  2F1C X;  1ZHT A;  2ZFG A;  2J1N A;  2X27 X;  4E1T A;  2Y7S A;  3GP6 A;  2N2M A;  4C4V A;  3T20 A;  4FSP A;  4RLC A;  4RJW A;  4N58 A;  3PGU A;  1YS5 A;  4G75 A;  4O4X A;  3VZT X;  3T0S A;  2M07 A;  3SY7 A;  2POR A;  5GTH O;  4AUI A;  3LK2 B;  2R4N A;  2WJQ A;  2ZLD A;  1BXW A;  1GFM A;  2LHF A;  4KR4 A;  5T5F A;  1PHO A;  2W80 C;  4FES A;  3JTY A;  1GFP A;  5TIS O;  4AFK A;  3VZU X;  2LFU A;  3DWO X;  4U9C A;  3AA1 B;  5ADX L;  1T16 A;  1IZN B;  4O4U A;  3BS0 A;  3SYB A;  3DZM A;  3T24 A;  2JQY A;  3WU2 O;  3POQ A;  4O3W A;  1QJ9 A;  5B5E O;  3UU2 A;  3JCU O;  2FGR A;  2WVP A;  1ZHX A;  3WI5 A;  3AAA A;  1T1L A;  4D65 A;  6PRN A;  5D5D A;  3VY8 X;  3G7G A;  4FRX A;  4CTD A;  2F1V A;  4PR7 A;  4UB6 O;  4GCQ A;  5FVN A;  2R88 A;  4LSI A;  1GFQ A;  4FQE A;  3LK3 B;  1GFO A;  1GFN A;  4D64 A;  3BRZ A;  4LSE A;  4JCH A;  2J4U P;  3HOL A;  5AFU K;  3AA7 B;  4KRA A;  2AXT O;  4AYD C;  2YPV A;  2N2L A;  5G3A A;  1ORM A;  3VY9 X;  3AA1 A;  4FOZ A;  2Y0K A;  3HWB A;  2R4P A;  1E54 A;  4PUX A;  5JDP A;  3O0E A; 
#chains in the Genus database with same CATH homology
 2ODJ A;  3POX A;  1Q9F A;  4G76 A;  4GCP A;  1THQ A;  4F4B A;  4LSH A;  2KC0 A;  4E1S A;  2KDY A;  4FUV A;  2QTK A;  4GHB A;  3PQU A;  5ADX K;  1QJ8 A;  1BT9 A;  1ZHW A;  3DA4 A;  3KVD D;  5GV0 A;  3AAE B;  4XNK A;  1G90 A;  1BH3 A;  4N59 A;  1IZN A;  4AYN A;  4FZM A;  4AKM A;  3AA7 A;  5DL6 A;  2M06 A;  3DA3 A;  4LSF A;  3LK3 A;  4O49 A;  1OSM A;  7PRN A;  3UAQ A;  3PQS A;  5G26 A;  2Y0H A;  4AYE C;  3UPG A;  3AA6 B;  2MHL A;  2K4T A;  2ERV A;  2XE3 A;  2FGQ X;  4GF4 A;  3K19 A;  5IYU A;  3AA0 B;  2YNK A;  3C5O A;  4AKR B;  3LK4 2;  2KZ7 B;  3HW9 A;  3POR A;  3EMN X;  2OMF A;  4AZL A;  2XE5 A;  4O3X B;  4AYI D;  3PRN A;  4JFB A;  3V8U A;  3HOE A;  1HXX A;  3NSG A;  3VE2 A;  3WI4 A;  2XTR A;  2F1T A;  2KXP A;  2Y0L A;  3RBH A;  4RLB A;  3SZV A;  1P4T A;  2XMX A;  1QJP A;  1ZHY A;  4FMS A;  1ZHZ A;  3VZW X;  5EE2 A;  2XG6 A;  1MM5 A;  4RL9 A;  2PRN A;  2O4V A;  4O3Z A;  4O3Y A;  3QRA A;  2GE4 A;  1Q9G A;  2JMM A;  3AAE A;  3LK2 A;  4RJX A;  1H6S 1;  3AAA B;  5PRN A;  1HXU A;  2W81 C;  3FYX A;  3QRC A;  4GCS A;  5AFU L;  1MPF A;  4AKR A;  4FRT A;  4FT6 A;  4Z3T A;  4KR8 A;  1OPF A;  3POU A;  2XE1 A;  3AA6 A;  3A2S X;  5DL5 A;  5DL7 A;  3TZG A;  3VE1 A;  4AYM C;  4D5U A;  2MNH A;  3SYS A;  4C69 X;  2XE2 A;  2XTQ A;  4QQ1 A;  5DL8 A;  3SY9 A;  1HXT A;  3SZD A;  4XNL A;  2K0L A;  4FZN A;  1MM4 A;  1PRN A;  4B61 A;  4FZL A;  3LK4 1;  4FSO A;  2KXP B;  2KZ7 A;  2Y2X A;  8PRN A;  3AA0 A;  4BUM X;  1ZHT A;  2ZFG A;  2J1N A;  2X27 X;  4E1T A;  2Y7S A;  3GP6 A;  2N2M A;  3T20 A;  4FSP A;  4RLC A;  4RJW A;  4N58 A;  1YS5 A;  4G75 A;  4O4X A;  3VZT X;  3T0S A;  2M07 A;  3SY7 A;  2POR A;  4AUI A;  3LK2 B;  4KR4 A;  2ZLD A;  2J4U P;  1BXW A;  1GFM A;  2LHF A;  5T5F A;  1PHO A;  2W80 C;  4FES A;  3JTY A;  1GFP A;  4AFK A;  3VZU X;  2LFU A;  4U9C A;  5ADX L;  3AA1 B;  1IZN B;  4O4U A;  3SYB A;  3T24 A;  3POQ A;  4O3W A;  1QJ9 A;  3UU2 A;  2FGR A;  1ZHX A;  3WI5 A;  3AAA A;  4D65 A;  6PRN A;  5D5D A;  3VY8 X;  3G7G A;  4FRX A;  2F1V A;  4GCQ A;  5FVN A;  4LSI A;  1GFQ A;  4D64 A;  3LK3 B;  1GFO A;  1GFN A;  4LSE A;  4JCH A;  3HOL A;  5AFU K;  3AA7 B;  4KRA A;  4AYD C;  2YPV A;  2N2L A;  1ORM A;  3VY9 X;  3AA1 A;  4FOZ A;  2Y0K A;  3HWB A;  1E54 A;  4PUX A;  5JDP A;  3O0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...