2YNKA

Wzi, an outer membrane protein involved in group 1 capsule assembly in escherichia coli, is a carbohydrate binding beta-barrel
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
456
structure length
441
Chain Sequence
b'AGLVVNDNDLRNDLAWLSDRGVIHLSLSTWPLSQEEIARALKKAKPSYSSEQVVLARINQRLSALKADFRVTGYTSTDQPGTPQGFGQTQPADNSLGLAFNNSGEWWDVHLQGNVEGGERISNGSRFNANGAYGAVKFWNQWLSFGQVPQWWGPGYEGSLIRGDAMRPMTGFLMQRAEQAAPETWWLRWVGPWQYQISASQMNQYNAVPHAKIIGGRFTFSPIQSLELGASRIMQWGGKGRPESLSNFWDGGNQLAGFDFKFKLEPTLGWPVSFYGQMIGEDESGFLPSANMFLGGIEGHHGWGKDAVNWYLEAHDTRTNMSRTNYSYTHHIYKDGYYQQGYPLGDAMGGDGQLVAGKVELITEDNQRWSTRLVYAKVNPENQSINKAFPHADTLKGIQLGWSGDVYQSVRLNTSLWYTNANNSDSDDVGASAGIEIPFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WZI
publication title Wzi is an Outer Membrane Lectin that Underpins Group 1 Capsule Assembly in Escherichia Coli.
pubmed doi rcsb
molecule tags Membrane protein
total genus 130
structure length 441
sequence length 456
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14052 Caps_assemb_Wzi Capsule assembly protein Wzi
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.130 Mainly Beta Beta Barrel Porin Porin 2ynkA00
2YNKA
chains in the Genus database with same CATH superfamily
3AAAA 1BH3A 3LK42 3A0HO 1PHOA 2KXPB 2MNHA 3PQSA 1Q9FA 1E54A 5B5EO 1GFNA 3PGUA 3VZWX 4GCQA 1S5LO 3DA4A 1OPFA 3G7GA 4PUXA 4RJWA 4AYNA 4F4BA 1G90A 5E79O 1T16A 1HXXA 3BS0A 4AYDC 2XE5A 3WU2O 3KVDD 4E1TA 4AFKA 2ERVA 2XG6A 3UPGA 3SY9A 4AKMA 4FOZA 3RBHA 4CTDA 2F1CX 3TZGA 8PRNA 2R8AA 3HWBA 1GFPA 4FESA 1QJ8A 4KR8A 2R4LA 2WJRA 5DL5A 2LHFA 3AA0B 4FZLA 2ZFGA 3SY7A 1P4TA 2F1VA 3KZIO 1BT9A 5PRNA 2Y0LA 1MM5A 3DA3A 4GHBA 5JDPA 1BXWA 5B66O 2K0LA 1IZNB 3WI5A 3VY9X 3DWOX 3NSGA 4FZNA 4UB8O 5G3AA 3HOEA 3SYBA 4AKRA 3PGRA 4G76A 5G26A 2N2LA 5GV0A 1GFQA 3T24A 3PRNA 3A2SX 2IWVA 4N58A 4O3WA 4FZMA 2FGRA 4QQ1A 2XTQA 1ZHYA 4AYEC 3AA6A 3NJTA 4LSFA 4D65A 2O4VA 5DL7A 2AXTO 4C4VA 2M07A 2KZ7A 2YPVA 4G75A 4O4UA 3SYSA 5AFUL 4FT6A 4GCPA 3LK2B 3QRAA 4N74A 4AUIA 4B61A 2WVPA 3JCUO 4IL6O 5ADXK 3T20A 2FGQX 2M06A 2XE3A 2Y0HA 3AA1A 2LFUA 3LK3B 3GP6A 5ADXL 5DL6A 7PRNA 4O4XA 4FRXA 2KC0A 4PJ0O 4RJXA 1ZHTA 2Y2XA 3AAAB 4AYMC 2F1TA 3PORA 3DZMA 4LSIA 3VZTX 1MM4A 3O0EA 2JQYA 5EE2A 3JTYA 3VE1A 2IWWA 4K3BA 5TISO 2ZLDA 3K19A 4U9CA 2ODJA 3POXA 5D5DA 3AA7A 4N59A 2N2MA 5KAIO 4JFBA 4O3XB 3VY8X 2XE2A 5IYUA 5DL8A 2X27X 3C5OA 4FRTA 3T0SA 5H2FO 4N75A 2J4UP 3UAQA 3AAEA 3POQA 4AYID 4BUMX 2Y7SA 2XMXA 2R88A 1ZHZA 3PQUA 1PRNA 1OSMA 2KXPA 2W81C 4FSOA 4LSEA 3SZVA 4D64A 1GFMA 5GTHO 1YS5A 3POUA 4RLCA 3UU2A 1ZHWA 4FMSA 3HOLA 1H6S1 1Q9GA 3HW9A 2K4TA 2MHLA 4AKRB 4E1SA 2JMMA 1ZHXA 2XE1A 3VE2A 4LSHA 3BRYA 4C69X 4O3YA 5KAFO 2OMFA 4XNLA 1T1LA 4JCHA 4C00A 2W80C 5AFUK 4GCSA 4O49A 4Z3TA 3AA6B 5FVNA 3AA0A 3PF1A 4KRAA 3BRZA 4C4VB 2KZ7B 5T5FA 3EMNX 3A0BO 2R4PA 4XNKA 1GFOA 2XTRA 4RLBA 3WI4A 1IZNA 3AA1B 1QJ9A 3VZUX 5GTIO 2YNKA 4AZLA 3LK41 1MPFA 4K3CA 2R4NA 4KR4A 4UB6O 2WJQA 5G38A 2GE4A 2QTKA 2R89A 3DWNA 3QRCA 1HXTA 4D5UA 2X9KA 6PRNA 2Y0KA 5G39A 4GF4A 1HXUA 4FUVA 4FQEA 2J1NA 2R4OA 3LK2A 3AA7B 4FSPA 4O3ZA 3SZDA 3V8UA 1THQA 4RL9A 2PRNA 4PR7A 3LK3A 2PORA 1QJPA 1ORMA 2KDYA 3FYXA 3AAEB 3PGSA
chains in the Genus database with same CATH topology
3AAAA 1BH3A 3LK42 1PHOA 2KXPB 2MNHA 3PQSA 1Q9FA 1E54A 1GFNA 3VZWX 4GCQA 3DA4A 4RJWA 1OPFA 3G7GA 4PUXA 4AYNA 4F4BA 1G90A 4AYDC 1HXXA 2XE5A 3KVDD 4E1TA 4AFKA 2ERVA 2XG6A 3UPGA 3SY9A 4AKMA 4FOZA 3RBHA 8PRNA 3TZGA 3HWBA 1GFPA 4FESA 1QJ8A 4KR8A 5DL5A 2LHFA 3AA0B 4FZLA 2ZFGA 3SY7A 1P4TA 2F1VA 3SZDA 1BT9A 5PRNA 2Y0LA 1MM5A 3DA3A 4GHBA 5JDPA 1BXWA 2K0LA 1IZNB 3WI5A 3VY9X 4AKRA 3NSGA 4FZNA 3SYBA 3HOEA 4G76A 5G26A 2N2LA 5GV0A 1GFQA 3T24A 3PRNA 3A2SX 4N58A 4O3WA 4FZMA 2FGRA 4QQ1A 2XTQA 1ZHYA 4AYEC 3AA6A 4LSFA 4D65A 2O4VA 5DL7A 2M07A 2KZ7A 2YPVA 4G75A 4O4UA 3SYSA 5AFUL 4FT6A 4GCPA 3LK2B 3QRAA 4AUIA 4B61A 5ADXK 3T20A 2FGQX 2M06A 2XE3A 2Y0HA 3AA1A 2LFUA 3LK3B 3GP6A 5ADXL 5DL6A 7PRNA 4O4XA 4FRXA 2KC0A 4RJXA 1ZHTA 2Y2XA 3AAAB 4AYMC 2F1TA 3PORA 4LSIA 3VZTX 1MM4A 3O0EA 5EE2A 3JTYA 3VE1A 2ZLDA 3K19A 4U9CA 2ODJA 3POXA 5D5DA 3AA7A 4N59A 2N2MA 4JFBA 4O3XB 3VY8X 2XE2A 5IYUA 5DL8A 2X27X 3C5OA 4FRTA 3T0SA 2J4UP 3UAQA 3AAEA 3POQA 4AYID 4BUMX 2Y7SA 2XMXA 3PQUA 1ZHZA 4LSEA 1PRNA 1OSMA 2KXPA 2W81C 4FSOA 3SZVA 4D64A 1GFMA 1YS5A 3POUA 4RLCA 3UU2A 1ZHWA 4FMSA 3HOLA 1H6S1 1Q9GA 3HW9A 2K4TA 2MHLA 4AKRB 4E1SA 2JMMA 1ZHXA 2XE1A 3VE2A 4LSHA 4C69X 4O3YA 5AFUK 2OMFA 4XNLA 4JCHA 2W80C 4GCSA 4O49A 4Z3TA 3AA6B 5FVNA 3AA0A 4KRAA 2KZ7B 5T5FA 3EMNX 4XNKA 1GFOA 2XTRA 4RLBA 3WI4A 1IZNA 3AA1B 1QJ9A 3VZUX 2YNKA 4AZLA 3LK41 1MPFA 4KR4A 2GE4A 2QTKA 3QRCA 1HXTA 4D5UA 6PRNA 2Y0KA 4GF4A 1HXUA 4FUVA 2J1NA 3LK2A 3AA7B 4FSPA 4O3ZA 3V8UA 1THQA 4RL9A 2PRNA 3LK3A 2PORA 1QJPA 1ORMA 2KDYA 3FYXA 3AAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNK A; 
#chains in the Genus database with same CATH topology
 3AAA A;  1BH3 A;  3LK4 2;  3A0H O;  1PHO A;  2KXP B;  2MNH A;  3PQS A;  1Q9F A;  1E54 A;  5B5E O;  1GFN A;  3PGU A;  3VZW X;  4GCQ A;  1S5L O;  3DA4 A;  1OPF A;  3G7G A;  4PUX A;  4RJW A;  4AYN A;  4F4B A;  1G90 A;  5E79 O;  1T16 A;  1HXX A;  3BS0 A;  4AYD C;  2XE5 A;  3WU2 O;  3KVD D;  4E1T A;  4AFK A;  2ERV A;  2XG6 A;  3UPG A;  3SY9 A;  4AKM A;  4FOZ A;  3RBH A;  4CTD A;  2F1C X;  3TZG A;  8PRN A;  2R8A A;  3HWB A;  1GFP A;  4FES A;  1QJ8 A;  4KR8 A;  2R4L A;  2WJR A;  5DL5 A;  2LHF A;  3AA0 B;  4FZL A;  2ZFG A;  3SY7 A;  1P4T A;  2F1V A;  3KZI O;  1BT9 A;  5PRN A;  2Y0L A;  1MM5 A;  3DA3 A;  4GHB A;  5JDP A;  1BXW A;  5B66 O;  2K0L A;  1IZN B;  3WI5 A;  3VY9 X;  3DWO X;  3NSG A;  4FZN A;  4UB8 O;  5G3A A;  3HOE A;  3SYB A;  4AKR A;  3PGR A;  4G76 A;  5G26 A;  2N2L A;  5GV0 A;  1GFQ A;  3T24 A;  3PRN A;  3A2S X;  2IWV A;  4N58 A;  4O3W A;  4FZM A;  2FGR A;  4QQ1 A;  2XTQ A;  1ZHY A;  4AYE C;  3AA6 A;  3NJT A;  4LSF A;  4D65 A;  2O4V A;  5DL7 A;  2AXT O;  4C4V A;  2M07 A;  2KZ7 A;  2YPV A;  4G75 A;  4O4U A;  3SYS A;  5AFU L;  4FT6 A;  4GCP A;  3LK2 B;  3QRA A;  4N74 A;  4AUI A;  4B61 A;  2WVP A;  3JCU O;  4IL6 O;  5ADX K;  3T20 A;  2FGQ X;  2M06 A;  2XE3 A;  2Y0H A;  3AA1 A;  2LFU A;  3LK3 B;  3GP6 A;  5ADX L;  5DL6 A;  7PRN A;  4O4X A;  4FRX A;  2KC0 A;  4PJ0 O;  4RJX A;  1ZHT A;  2Y2X A;  3AAA B;  4AYM C;  2F1T A;  3POR A;  3DZM A;  4LSI A;  3VZT X;  1MM4 A;  3O0E A;  2JQY A;  5EE2 A;  3JTY A;  3VE1 A;  2IWW A;  4K3B A;  5TIS O;  2ZLD A;  3K19 A;  4U9C A;  2ODJ A;  3POX A;  5D5D A;  3AA7 A;  4N59 A;  2N2M A;  5KAI O;  4JFB A;  4O3X B;  3VY8 X;  2XE2 A;  5IYU A;  5DL8 A;  2X27 X;  3C5O A;  4FRT A;  3T0S A;  5H2F O;  4N75 A;  2J4U P;  3UAQ A;  3AAE A;  3POQ A;  4AYI D;  4BUM X;  2Y7S A;  2XMX A;  2R88 A;  1ZHZ A;  3PQU A;  1PRN A;  1OSM A;  2KXP A;  2W81 C;  4FSO A;  4LSE A;  3SZV A;  4D64 A;  1GFM A;  5GTH O;  1YS5 A;  3POU A;  4RLC A;  3UU2 A;  1ZHW A;  4FMS A;  3HOL A;  1H6S 1;  1Q9G A;  3HW9 A;  2K4T A;  2MHL A;  4AKR B;  4E1S A;  2JMM A;  1ZHX A;  2XE1 A;  3VE2 A;  4LSH A;  3BRY A;  4C69 X;  4O3Y A;  5KAF O;  2OMF A;  4XNL A;  1T1L A;  4JCH A;  4C00 A;  2W80 C;  5AFU K;  4GCS A;  4O49 A;  4Z3T A;  3AA6 B;  5FVN A;  3AA0 A;  3PF1 A;  4KRA A;  3BRZ A;  4C4V B;  2KZ7 B;  5T5F A;  3EMN X;  3A0B O;  2R4P A;  4XNK A;  1GFO A;  2XTR A;  4RLB A;  3WI4 A;  1IZN A;  3AA1 B;  1QJ9 A;  3VZU X;  5GTI O;  2YNK A;  4AZL A;  3LK4 1;  1MPF A;  4K3C A;  2R4N A;  4KR4 A;  4UB6 O;  2WJQ A;  5G38 A;  2GE4 A;  2QTK A;  2R89 A;  3DWN A;  3QRC A;  1HXT A;  4D5U A;  2X9K A;  6PRN A;  2Y0K A;  5G39 A;  4GF4 A;  1HXU A;  4FUV A;  4FQE A;  2J1N A;  2R4O A;  3LK2 A;  3AA7 B;  4FSP A;  4O3Z A;  3SZD A;  3V8U A;  1THQ A;  4RL9 A;  2PRN A;  4PR7 A;  3LK3 A;  2POR A;  1QJP A;  1ORM A;  2KDY A;  3FYX A;  3AAE B;  3PGS A; 
#chains in the Genus database with same CATH homology
 3AAA A;  1BH3 A;  3LK4 2;  1PHO A;  2KXP B;  2MNH A;  3PQS A;  1Q9F A;  1E54 A;  1GFN A;  3VZW X;  4GCQ A;  3DA4 A;  4RJW A;  1OPF A;  3G7G A;  4PUX A;  4AYN A;  4F4B A;  1G90 A;  4AYD C;  1HXX A;  2XE5 A;  3KVD D;  4E1T A;  4AFK A;  2ERV A;  2XG6 A;  3UPG A;  3SY9 A;  4AKM A;  4FOZ A;  3RBH A;  8PRN A;  3TZG A;  3HWB A;  1GFP A;  4FES A;  1QJ8 A;  4KR8 A;  5DL5 A;  2LHF A;  3AA0 B;  4FZL A;  2ZFG A;  3SY7 A;  1P4T A;  2F1V A;  3SZD A;  1BT9 A;  5PRN A;  2Y0L A;  1MM5 A;  3DA3 A;  4GHB A;  5JDP A;  1BXW A;  2K0L A;  1IZN B;  3WI5 A;  3VY9 X;  4AKR A;  3NSG A;  4FZN A;  3SYB A;  3HOE A;  4G76 A;  5G26 A;  2N2L A;  5GV0 A;  1GFQ A;  3T24 A;  3PRN A;  3A2S X;  4N58 A;  4O3W A;  4FZM A;  2FGR A;  4QQ1 A;  2XTQ A;  1ZHY A;  4AYE C;  3AA6 A;  4LSF A;  4D65 A;  2O4V A;  5DL7 A;  2M07 A;  2KZ7 A;  2YPV A;  4G75 A;  4O4U A;  3SYS A;  5AFU L;  4FT6 A;  4GCP A;  3LK2 B;  3QRA A;  4AUI A;  4B61 A;  5ADX K;  3T20 A;  2FGQ X;  2M06 A;  2XE3 A;  2Y0H A;  3AA1 A;  2LFU A;  3LK3 B;  3GP6 A;  5ADX L;  5DL6 A;  7PRN A;  4O4X A;  4FRX A;  2KC0 A;  4RJX A;  1ZHT A;  2Y2X A;  3AAA B;  4AYM C;  2F1T A;  3POR A;  4LSI A;  3VZT X;  1MM4 A;  3O0E A;  5EE2 A;  3JTY A;  3VE1 A;  2ZLD A;  3K19 A;  4U9C A;  2ODJ A;  3POX A;  5D5D A;  3AA7 A;  4N59 A;  2N2M A;  4JFB A;  4O3X B;  3VY8 X;  2XE2 A;  5IYU A;  5DL8 A;  2X27 X;  3C5O A;  4FRT A;  3T0S A;  2J4U P;  3UAQ A;  3AAE A;  3POQ A;  4AYI D;  4BUM X;  2Y7S A;  2XMX A;  3PQU A;  1ZHZ A;  4LSE A;  1PRN A;  1OSM A;  2KXP A;  2W81 C;  4FSO A;  3SZV A;  4D64 A;  1GFM A;  1YS5 A;  3POU A;  4RLC A;  3UU2 A;  1ZHW A;  4FMS A;  3HOL A;  1H6S 1;  1Q9G A;  3HW9 A;  2K4T A;  2MHL A;  4AKR B;  4E1S A;  2JMM A;  1ZHX A;  2XE1 A;  3VE2 A;  4LSH A;  4C69 X;  4O3Y A;  5AFU K;  2OMF A;  4XNL A;  4JCH A;  2W80 C;  4GCS A;  4O49 A;  4Z3T A;  3AA6 B;  5FVN A;  3AA0 A;  4KRA A;  2KZ7 B;  5T5F A;  3EMN X;  4XNK A;  1GFO A;  2XTR A;  4RLB A;  3WI4 A;  1IZN A;  3AA1 B;  1QJ9 A;  3VZU X;  2YNK A;  4AZL A;  3LK4 1;  1MPF A;  4KR4 A;  2GE4 A;  2QTK A;  3QRC A;  1HXT A;  4D5U A;  6PRN A;  2Y0K A;  4GF4 A;  1HXU A;  4FUV A;  2J1N A;  3LK2 A;  3AA7 B;  4FSP A;  4O3Z A;  3V8U A;  1THQ A;  4RL9 A;  2PRN A;  3LK3 A;  2POR A;  1QJP A;  1ORM A;  2KDY A;  3FYX A;  3AAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...