2YNMA

Structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
ALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR
publication title Structure of Adp-Aluminium Fluoride-Stabilized Protochlorophyllide Oxidoreductase Complex.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Oxidoreductase
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ynmA00
5EXXA 2RGNA 2W0SA 1LS1A 1MO5A 3R8CA 4BFYA 3LW8A 1ZNZA 3GLIB 2WAYA 1E99A 4AK9A 3HYTA 4H1VA 4F91B 1ODFA 4PR0A 4WVFA 4DEXA 2ZRAA 2OCBA 2OO7A 3GLHA 1KI6B 1T0JB 1X1RA 3LH5A 1JJVA 1SVWA 3OEHA 4Q01A 2FA9A 4D0LB 3DO6A 1ZCAA 4OHXA 1F6BA 4P4UA 1SVSA 4IXNA 1N5JA 3KB2A 2GF0A 3IIMA 3O8DA 5DHFA 2NZ8A 4DJTA 5L8VA 4LBYA 1CS4C 4CEIA 4B2LA 3AVYA 1NVXQ 1XD2A 3GLGE 3CLVA 1OH7A 3CRQA 4TYNA 3HR8A 2QQEA 4TN1A 4BZXA 4Q4JA 2VBCA 5E7MA 4B48A 3UMRA 1Y63A 2OZEA 2IWRA 1BH2A 4R2IA 3MWYW 2GBLC 2G83A 3ZH9B 2A30A 2ZI3A 3P26A 2VIIA 3QKSA 4JBXA 3RC3A 3U3KA 4Q1BA 3SR0A 2VLIA 3MSXA 3KKOA 1ZC4A 3Q5DA 3RRMA 2FSGA 2ZUDA 2A5FA 4BRWA 3BAFA 4MYUA 2GNOA 4A6PA 3EPJA 5EUQB 3W5JA 2O8CA 1CU1A 4MRSA 2ZPTX 3BB4A 3QG1A 2NOAA 5C1BA 4A2QA 3MWKA 5JHGB 3KQUA 3CONA 1E94E 1G9XA 5KDDA 1W0KD 3WP1B 1YRBA 2HF9A 1XEXB 3K9HA 2ZRFA 2QPAA 5FPHA 4XVQA 2CHVA 2VQSA 2X77A 1W0KA 2XSZD 2ZR9A 3PUXA 1J7KA 4CEJA 2XZPA 2P5TB 4Q19A 3VAAA 1NSFA 1ONBA 4AKEA 4JBWA 4Q1EA 3CW2A 3ETLA 3MGCA 2G9NA 3A37A 1GNQA 4I4LA 4MA4A 1TF5A 4LZZA 4MKFA 4CEHA 4DCNA 4A0RA 2GETA 2WWIA 3SDZA 2YC2C 2WHXA 2G77B 2Z0MA 3GLHE 5AUPB 1T6NA 2ZANA 1ZNYA 1KGDA 1KSGA 1DOAA 3K0AA 3AUXA 3T15A 3VHLB 5EZ5A 1D2EA 4ON9A 2IF2A 2H17A 1P9RA 1E69A 4BECA 3W34A 3Q7QA 4EDHA 2FPMA 2XB2A 1TAGA 2YC4C 1M34E 4MGZR 4RD4A 3ADDA 4RJLA 5SZJA 2IEZA 3VTKA 2F9LA 4Q03A 2XNSA 1GTVA 1P5ZB 4UXIA 4Q1FA 1TQ6A 5FOWA 2CEAA 4BFZA 1P60A 4LBZA 2C98A 2O8BA 2OM2A 3M6AA 3O47A 4HLQB 1PVOA 2YWEA 2IYUA 2ORWA 3CPEA 3IPYA 5FBVB 2F7SA 1E2EA 2ZS7A 4WW0A 3C14C 2KE5A 1G5RA 3W8NA 4WXRA 2D06A 4LHYA 2FF7A 3FVQA 1PV4A 1CLUA 4OQMA 4NCHA 1Q3TA 1Y3AA 1HA3A 3R20A 2C78A 4HAVA 5DNYB 1G7SA 3DZ8A 1N0VC 1J8YF 2R44A 3FMPB 1G20E 1IY1A 1SVLA 5K8TA 3LVRE 5KPDA 3K70C 3U44B 2GK7A 2REXB 3R9XA 4TWZA 2R6DA 4NCKA 3QF7A 3U61B 2KWIA 1HE1C 1ZW6A 2PLRA 2PH1A 2XEXA 2VEDA 3PEWA 2ZETA 4JKYA 1W7AA 2ZE6A 1FTNA 1OH5A 4D81A 5FBQB 4US1R 1HE8B 1T5LA 1I4LD 5JEEA 1NY6A 4UKDA 1AM4D 4TMKA 2GF9A 4FI3C 2F6RA 1D9XA 5EXTA 3FWYA 4A8JC 3CR7A 3K0CA 3DKVA 2L0XA 4LBWA 1DAKA 4QRHA 3EIEA 4AYXA 3I5YA 1PLLA 1XTIA 3AVQA 4QHYA 3U3RA 1WB9A 2WOOA 1HH4A 4TLDA 1N6IA 1NNEA 2O8EA 5AJZA 2ZQ5A 2ZJ8A 3RS2A 1CRPA 1EFHA 1P75A 4QKQA 4CGZA 3BE4A 2FFBA 1W47A 2WKQA 4NTZA 5TMPA 4MRNA 2OFWA 5LD2C 1GL9B 2BM1A 1P4SA 3PEUA 4UNNA 5FTLA 4AY2A 4YMTA 2GK6A 4WZAE 1TEXA 2ORIA 2ZU0C 3I4LA 1QHXA 4N1AA 1DELA 3QEJA 1R7RA 4XJXA 2NIPA 2Z4RA 1NIPA 3THYA 4Q9IA 4B2IA 2ZJYA 2GZDA 1US8B 2XTMA 1SVMA 2WSMA 2DFTA 2FX3A 3WBJA 4EPVA 1KK2A 1SXJC 3TBKA 3LX5A 3DPUA 3VHXA 1NMYA 1YRAA 4URYR 2FDCA 4F93B 2IWHA 4D4LA 5JHHB 1OKKD 2OCPA 3ASYA 1OSNA 4IW3B 1X6VA 1L7VC 3CWQA 4OI4A 5E4FA 1FL9A 3SQXA 4P4SB 4ZCMA 2IXFA 2OBNA 4KI0A 1OKKA 4LYAA 1R0XA 4TSFD 4DRZA 1ZINA 1MRSA 5FUVA 5CITA 1CP2A 2HJVA 4LWZA 1HYQA 4LX0A 3KKMA 3B82A 3NH9A 3LQQA 3SJZA 5FTKA 2MSCB 2FWRA 4L4UA 721PA 4B3GA 2IYZA 1T5IA 3AEZA 1KJYA 3AGPA 2VP9A 3HU2A 1A5TA 3CF0A 3GEHA 3F8TA 4D4KA 5LPNA 4U7DA 4LYFA 4OI2A 4OYHA 4LY6A 4OK3A 1CJKC 1UPTA 2A78A 3TNFA 4BWYA 821PA 1TF2A 1R0YA 3R9WA 4HB2A 5EP3A 3D8BA 2GXAA 2F1JA 1MO6A 2Q9CA 1TNDA 4DDUA 2ONKA 3K9LA 3CH4B 4PFSA 5GADl 1CJMA 2YNMA 2QMOA 2Z5FA 4A0FA 1J8MF 1GDDA 5E3HA 2FJUA 1II9A 1U0LA 3ZLJA 1HQCA 3SJAA 3M1IA 3B1VA 1OYYA 4EFNA 4Q4AA 2KSQA 3AVOA 1D2MA 4DIEA 4B43A 4K81B 1ZM2A 5JZVA 5KDOA 1HURA 3T35A 1TUEA 1X3SA 1DE0A 1JXMA 1GL7A 1QHHA 5IK2A 1IQPA 3E5HA 2B8WA 2ZI6A 2JJ8A 2OXRA 3NVAA 1NLFA 5JRZA 1QHYA 5JRJA 3SU8A 1G21E 1ZM9A 2GXQA 1PJRA 4FCWA 1GG2A 2IBMA 1K5DA 1HV8A 1C4OA 2WPDD 3NC1C 3NXSA 3WHLA 3X1DA 4DCVA 3IPXA 3CO5A 1R10A 2ZJBA 1KDRA 5GVSA 4JLAA 1KZGB 2IUSA 3HYRA 4S35A 3B1WA 4Z1MD 3T1TA 1YR9A 3I73A 3M4YA 3KXLA 4BLQA 3FHTA 4ZKEA 2BCJQ 3ZGXA 2D74A 4Z1MA 2WM9B 5F2EA 1WMSA 1X1SA 4B74A 2P2LA 1CR2A 3L82B 3U7EB 3MJHA 2FFAA 1AS0A 4POAA 3L2OB 4L9SA 4UNPA 2CJWB 1P3JA 5CM9C 3CM0A 1EFRD 1H8ED 5HKKD 2ECKA 4A92A 5EJEA 1E9RA 3C16C 3LQRA 5KU1A 1D5CA 2GTPA 4JT4A 4HLCA 1SKQA 5EE5B 4ZDWA 1DEKA 3NH6A 1Z6GA 1S9HA 2EFHB 3PR1A 5HKKA 2FU5C 2IXGA 2GVZC 2DYKA 1KI8A 4B35A 4DSTA 1JALA 2WJYA 1LB1B 2ZAMA 1Z0AA 2JGNA 3QF4A 1GIAA 2ZSFA 3QUSA 3PUZA 3ZIAA 3IIKA 3RAPR 1KHTA 4HDOB 1F48A 2QP4A 1KO1A 2CXXA 2GCOA 3IUYA 1TQ2A 1VPLA 2GJAA 4LV8B 1HQYE 4JIMA 3PUVA 4HZUB 3E70C 2IYLD 1OJLA 3RSOA 1ETUA 3RYTC 2RGDA 1B0UA 3DZDA 4TLEA 3SS8A 1AJEA 2HV8A 4DB4A 3I92A 4MYTA 5E95A 2O8CB 1Q1BA 4R2HA 2WKPA 4M1SA 3LRPA 1NI3A 4D2IA 3OFND 3KJEA 1RYFA 3U2QA 1W49A 4DT1B 3GLFE 4DLYA 4XVRA 2XZOA 4G01B 4LJ9A 2XXAB 2J0UB 3X1ZA 1E96A 3CZPA 4HLDA 3OFNA 2O0HA 2ZRJA 2GKSA 3ADBA 5TXGA 1TADA 4LYHA 5AJXA 3DM5A 1N6PA 2ASEA 1TF7A 4FWIB 3K70B 2BMFA 3PITA 2AKAB 4ARZB 1KKLA 1HUQA 5F98A 2ZRMA 2O8FA 2YZ2A 1XTSA 1XJ0A 2GXSA 2V3CC 3NC0C 4QL3A 4G3XA 4GT1A 1ZIOA 1AGPA 2O8DB 1PLJA 3DMDA 4JL8A 4UJ3A 1AQYA 5CK5A 4K46A 4QOSA 1P2UA 3K0AB 1MO4A 2PZFA 4IDQA 4A8JB 2NO0A 2PJRA 4LHXA 2FMXA 4TYPA 3AKEA 1UAAA 1G17A 2NO6A 1P2TA 2J5XA 2HLDA 3PCRB 5B30A 2ANCA 1IJEA 4JVLA 1GOTA 1D9ZA 3W8RA 1EGAA 3LFUA 2YWHA 1UJ2A 1OB5A 1QG2A 4I1UA 4TLBA 1IJFA 2P6RA 1GUAA 1YZTA 3WMGA 1Z22A 5LD2B 1FX0A 2VHQA 5M04A 4MDFA 5DISB 4MUAA 1D6JA 1MABB 1ZD9A 4M21A 3GJ0A 5JWHA 5TVKA 2WSSD 2O8BB 3VMFA 2G1KA 1NN1A 1KI9A 3R8FA 2XGJA 3Q7PA 4NCNA 3UWKA 3BD9A 2TMKA 1E2GA 1NP6A 4RZ2A 3TR5A 2XTZA 4BGDA 2RB4A 1CR0A 1P2VA 4TQ9A 2F9MA 5GVRA 4Q9LA 1E0JA 3QBTA 1KY2A 1SXJB 1EG7A 2VA8A 4P4TA 5KHOC 1QF9A 4PZZA 4B3DA 2C77A 3I8XA 3RLFA 4MDEA 4KLNA 5G40A 3SE0A 3N5CA 3HP1A 3CZQA 3A58B 2HXSA 2NPIA 3V4RA 4XIGS 1JR3D 2A3RA 1TQ4A 2O5VA 1A2KC 3PXGA 3ZQJA 1MR3F 3SYKA 3H84A 4B71A 1JR3A 3CNOA 3PJRA 4A2WA 3HPQA 5FPKA 4KYIB 1OB2A 4KITB 4MRRA 2ZE5A 2D2EA 4Q7LA 4U02A 3VKWA 1DS6A 1KKMA 3BERA 4UNRA 4DDVA 3IBYA 3CNLA 4YDSA 2ZITA 2FZ4A 2ZRPA 3MUFA 4N3NA 1F2UB 4F38A 4R71A 3KB1A 3OIUA 4HYYA 3AF3A 3BOSA 2J3EA 2I1VB 5DGXA 1VMAA 5LB4A 2IYQA 5JJKA 4L8GA 5D3QA 3UG7A 2AD5A 4URZR 4PPGA 3SYNA 5BW8A 1GWNA 1UM8A 4LJ6A 5LB2A 4JYCA 1LNZA 2MMGA 4ZIRA 1AKYA 1CIPA 1Z6YA 4QC2A 4Q4LA 4X8OA 4G5GA 1FP7A 4GMXA 4EJSA 4KODA 1W4AA 2P0EA 4LPSA 3FFBA 4HLUA 2IUTA 4C0QC 5AUNB 2DPXA 2UZIR 3QI2A 4XH9B 1FNNA 4CT5A 1U9IC 2OUKA 4DSNA 4QGFA 3K9GA 4AC9A 1GRRA 1VYVA 2WWWA 3RRYA 1GKYA 1KO4A 2OAQ1 5FTMA 4Z51A 4A36A 4M9SA 2ZJAA 5CB8A 1Q20A 3GPLA 2WWHA 1Q1EA 3QG5A 3TUJC 3JZAA 5KSZA 5C2JB 1M7GA 4Z54A 4DLTA 1NG1A 1G3MA 1N5KA 5HTKA 2PCLA 2C96A 2PEZA 2EFCB 2V6JA 1JR3E 2W2VA 2YVUA 3AB3A 3LLUA 2OLKA 4ZDJA 8OHMA 1UFQA 1W0JA 5FL7D 1AN0A 4OBEA 3VU9A 5HCNA 2GZHA 5CYPA 3SBEA 4ESHA 4E03A 5H70A 2J7KA 5FOTA 3BORA 4NYIQ 4E07A 2AL7A 4WOPA 4D0NA 3H1TA 3ZJYA 2ZI9A 3PIRA 2AHOA 4DSUA 3I5XA 3FYHA 2BDTA 3KUCA 1E79A 3WRYC 2BOVA 3ZZTA 4E5UA 4B6EA 4JYBA 4F4JA 4HUTA 1YHNA 3K0FA 1SHZA 2UVQA 2R8RA 3NDPA 3UMSA 2ZU6A 5TB5A 2B6HA 3RWMB 2QORA 1W48A 3IBGA 4JLPA 2AN9A 2VF8A 2ZYTX 3OF5A 2QPTA 1JXOA 2IS1A 1KK0A 1G41A 4NP6A 4BZQA 4EJSC 2IYWA 3MWJA 4DLUA 1S1MA 2XOKD 1NLYA 3FMIA 3X1YA 4HLUC 4ZPXA 2RAPA 1KDPA 2REOA 4MKHA 5JS7A 1OLOA 1XRJA 3TGPA 3QY0A 3DKPA 1JQLB 1JI0A 1G19A 2HXYA 2W2XA 2XOKA 2OE2A 2QNRA 4B6FA 1SKYB 1MRNA 2YYZA 1ZVQA 2GDJA 3DDCA 1M7BA 5FI0B 1II8B 2V1UA 1RFLA 3REFA 1YU9A 4EPXA 1JPNA 4ABYA 1SULA 3B6EA 4W5WA 1XFAA 1N25A 4RKFA 2YJTD 2IA5A 1K8RA 4C3ZA 2WZQA 4C9BA 2ZI4A 5KSOA 3A36A 4GOKA 1YVDA 4JS0A 2ZROA 3CB4A 4KSBA 1A1VA 1FMJA 2PMKA 2O0JA 3OAAD 1XEFA 3RANA 3LBIA 5CIWA 2ODNA 4AKGA 3KFXA 4F92B 4C2UA 1G6HA 3BXZA 1E2IA 1KJZA 1KTVA 1SVOA 2AXPA 2ERYA 3LXXA 4JSTA 4Y0AA 5SZIA 3TSOA 2LCFA 1YZUA 3OAAA 1G64A 4IEEA 4M0LA 1W46A 3KKNA 3LD9A 1F5NA 1G5PA 1T91A 1XTJA 3UPUA 1XXHA 3SFVA 3NHAA 4KV9A 4JJZA 1H65A 3FE2A 1AS2A 3KXIA 4TTQA 3KX2A 1E9SA 3QF4B 3OHMA 1G18A 1T8TA 1W36C 2X19A 2QBYA 4LRWA 4ACBA 2IHBA 1GNRA 1Z08A 4V0LA 4KFTA 1UKYA 2H7VA 2OBMA 2W00A 4PAMA 3LWNA 4RZUA 5FR2A 4RCZA 5EE1A 2IS2A 2GCOB 3EZFA 5JBQA 3NBFA 5FBRB 4M4SA 4C0BA 2R6FA 4O2LA 1RRGA 3L0IB 1J2JA 2WOJA 2ZSAA 1WA5A 4KHZA 1KYIA 1UEJA 1KJWA 4GP6A 1YZQA 1RRPA 3BH7A 1D8TA 3KZ1E 3PQCA 1DAMA 2CK3D 4PZYA 4PANA 1E0KA 4Q02A 4OQFA 4JLOA 2WKRA 4FMBB 1U8ZA 2CK3A 2XNDD 2A5YB 1KMHB 5FOSA 1S1CA 2A7QA 2HCBA 4TTPA 1KSHA 3PV0A 5HZKA 4WXPA 3CPJB 4BFXA 1M7HA 2ZRIA 5DO9A 5EE9A 3R9IA 2JDID 3TQCA 5JS8A 5ELXA 3AP1A 1WF3A 2GA8A 1E98A 4LV5B 2G88A 3GJXC 1UF9A 5BQ5A 3V4FA 5F3WB 4Q5IA 1TU4A 1HY3A 4JLVA 2ONJA 2WICA 3ZD7A 1OHHD 2WJIA 2PX0A 3Q8XB 1AKEA 4C0SA 2RGNC 1G8GA 4MUBA 2IK8A 2XSZA 2ZR0A 1AZTA 4GNKA 2N46A 2ZJ2A 1OHHA 1XXHE 3ZS8A 1DADA 4Q7JB 1K6MA 4U00A 3G82C 3U3OA 1G7TA 2ZRCA 5EP2A 2ZSEA 2WVJA 4W5HA 1CULC 1N6NA 1G16A 3GEEA 4GI7A 1N3BA 5DE3A 4BASA 4E09A 3VX3A 5J4YA 1LVGA 5SZKB 3TH5A 1P61B 2Q9AA 3EWAA 4XTCS 3OESA 4URXR 1TU3A 4TMVA 2Q3FA 3CBQA 3CX6A 4KFRA 4HATA 2CDNA 2LKDA 2H18A 1AA9A 1IN6A 2ATVA 5LBIA 1N0WA 3B2EA 4IVPA 2JLXA 1E0AA 2DFLA 3KJGA 4MYHA 2X2FA 4AYWA 2QZ4A 3GQBA 4LC1A 5JFGA 4DCTA 3AVXA 4IOMA 4Q21A 3ICQB 2ODEA 2GJ9A 3PVSA 1Q1ZA 5G3ZA 4IOKA 5IT5A 4IOJA 1JECA 4Q4HB 2R65A 4LYJA 4YDHB 4K8OA 1Z47A 3DMNA 3A4NA 4KVGA 1XJQA 3HWSA 4M1YA 3QEOA 3BFXA 4TYQA 1LS6A 3THXA 3F3YA 4FCTA 4QXAA 1U98A 3QXCA 4D25A 1Z8FA 3VKGA 4D6PA 3TQFA 5KPJA 4LJ7A 4AG6A 1ZM7A 1IN5A 1QHGA 1T9HA 3NWJA 2FOLA 1GVNB 1Z3IX 3KTAB 5CJPA 3CNNA 3I8SA 4LOAA 1Z06A 3AKYA 1QHNA 5JEDA 2VYFA 3S1AB 1Z28A 1OIWA 4B33A 4NPHA 3DL0A 1JAHA 1IN7A 4JJKA 2GESA 1YQTA 2K5UA 4IXMA 3NBZC 3LY5A 1G3QA 1LTQA 2WMNB 4FMCF 3KL4A 1XU4A 2QMEA 1U81A 2ZR7A 1VG9B 1QVRA 4C0KA 3L8YA 2NGRA 4JBYA 2ZJZA 3U6KA 1VECA 1ZD1A 3UKDA 4RVCA 3SQWA 3TW8B 3UK6A 3NDBB 2JJ2D 1VCOA 2JAQA 4BE7B 3LA6A 3KXKA 4EPYA 4B3XA 4RFSB 2WBLC 4IDPA 1T8UA 4OKSA 5D3MB 1O3YA 5DI3A 1NBMD 3GFTA 2EWWA 2GEVA 2JEOA 3O8RA 4BUJA 3QE0A 1RRCA 1IY0A 4ZDIA 3X1WA 1LFDB 3SN6A 4M8NE 1NBMA 3SJBA 3U60B 2RHDA 3QXXA 1UBCA 1GAJA 3THWB 1KO7A 4JT2A 3RS0A 2EYQA 3OIVA 5A5GA 2V1XA 3ADKA 5DYGA 4NCJA 1TX4B 4FWTA 1GP2A 3RRNA 2NTYC 3Q3JB 5IF9A 3IGFA 3QKTA 3ADCA 3LO5A 2A2ZA 3VR2A 5BN5A 3NEJA 3O8BA 1D2NA 3G5UA 2C99A 1KI4A 1ZUIA 4KAXA 3FKSD 4A4DA 3DEFA 1JBKA 1R4AA 3P27A 121PA 2BWJA 1VCNA 3MMPA 1WBDA 5KO2A 2VHUA 1T3LA 1XNJA 2ZYWX 3RABA 4HUQA 3Q5EA 3CIOA 1KK1A 1UBGA 5EZ6B 2GJKA 1KI7A 4WZ6A 2ODBA 5JI3E 4P32A 4DLVA 1RRFA 2AFIE 4XTRA 4RKEA 2I4IA 4M1TA 4RD2A 1E1QD 3A4MA 2C8VA 3FHOA 2A5GA 2OCYC 1ZUNB 1Q0UA 3BBPA 4URVR 4JLMA 2QGZA 4TSFA 4UQOA 4B2PA 1E1QA 1M74A 4D4MA 3QIAA 3BFVA 3VFDA 1TUIA 4PO8A 5B57C 1VHLA 1LW7A 1NN5A 4OI1A 2QROA 1KI2A 2QPOA 3IHLA 3AVUA 1W36B 3NG1A 3K0CC 1M8PA 4HEJA 4L9WA 4O0MA 4TTRA 2BCGY 2CVFA 1E2DA 1GSIA 4CRWB 1VG0B 3RS7A 6Q21A 3GJ3A 3IO5A 1OFIA 1XWIA 3U5ZB 3VNVA 5JLJA 1IHUA 2JJ1D 2QT1A 3WP0A 3GLGB 2IYSA 1VHTA 3H0KA 5EXSA 2GEUA 3BH0A 3FB4A 1ZAKA 4YONB 4LHZA 2JJ1A 3AKDA 3U4QA 421PA 1P9WA 3EA5A 1NBME 3DOEA 3LV8A 5AK0A 3OIWA 1X8KA 3LXRA 3MG9A 1U0JA 221PA 4HB3A 3X2SA 4TT3D 1ZP6A 3CRW1 4ASUD 1UDXA 3QVVA 5EUMA 5CDFA 2JCSA 5JMTA 5CM8B 1DG3A 2BEKA 3IIJA 5DIFA 1YR7A 3M0EA 4Q9JA 4ASUA 4TT3A 1FOEB 2VPPA 4I1OA 5B58C 4DLXA 1UDWA 4M1MA 3VR3A 3IQWA 4RD3A 1FPMA 4OK6A 4TL7A 2B21A 5GJWC 3KDSE 2R6GA 4MH0R 4TMZA 4XWKA 3HR7A 4A1FA 3SNHA 3GLFA 1E2FA 3AUYA 3EPLA 1XPOA 5DH9A 2C04A 3L0PA 5KSPA 2WPDA 1XCGB 2R6AA 4EQ6A 5DI9A 4X8HA 4ERNA 5K8UA 1Z0IA 4HDCA 3W90A 2GAOA 2YOFA 1GKUB 2EFDB 5FI1B 1UBEA 3ZZ0A 2JLWA 5KUTA 1BMFD 2PL3A 4LC0A 2ZRLA 4NH0A 1C9KA 5KNBA 5DHAA 3VR4A 4AG5A 4MRPA 4E22A 2IYRA 2NO9A 3K53A 1F2TA 1NMXA 3GLHB 2YHSA 1KNQA 4V0MA 3QJYA 1XMIA 2BKEA 3IEVA 3B13B 3TAUA 2IXEA 3HU1A 3U7HB 2W58A 1EFRA 4PTLA 1H8EA 4RFVA 1NKSA 4JLDA 4LDJA 1VTKA 3MLEA 4A6XA 2RGBA 4FD2A 2J1LA 1XZPA 3T1OA 3SHFA 4CEIB 2QMHA 5EXPA 1FUKA 5F9HA 1XD2B 4YMVA 2CCKA 1YKSA 4UNQA 4NMMA 1ZU4A 1XCPA 2DR3A 2VHCA 5FOVA 4B32A 3CPHA 4Q4JB 5JWOA 2ZEJA 5CIQA 4NBSA 2PJZA 1CEEA 2KB0A 2OCAA 3K1JA 3QKSB 4ZO4A 1NIJA 1ZYUA 4DUGD 3GLIA 2RCNA 4DIDA 2EWVA 2IT1A 2V7QD 3TRFA 5CDFE 3RS4A 2MSEB 1KI6A 4DUGA 2QP3A 3EC2A 1KSFX 4RZ3A 1BS1A 2VH5R 4AKHA 2V7QA 2KBFA 2YV5A 4Z8XA 2QG6A 3JVUA 4WAUA 1Q57A 4I1VA 4RD0A 4V0NA 3BC1A 3X1XA 2EYUA 1NVVQ 2OBLA 5AUQA 1KDOA 2V54A 5FUXA 2ZRDA 3G0HA 2ERXA 1XX6A 5FOUA 2SHKA 3U3JA 3C15C 2UKDA 5TARA 4PO9A 3CF2A 1IM2A 3O8CA 3T5GA 4CEJB 2AK2A 2FSHA 2OT3B 4A0GA 2H8KA 1E9CA 4X8MA 1R5NA 1UADA 1GITA 3NBYC 3A1VA 4IOLA 2IC5A 1KY3A 4LJ8A 1OXVA 5K8IA 4CEHB 4Q00A 4UNSA 4WZBE 4BPBA 2D3WA 1A7JA 2J59A 2Q9BA 2ZSDA 1P9NA 4Q1AA 3FMFA 4V0ME 1OPXA 4GL2A 1FW6A 1P73A 4NZYA 2F3TA 2CCGA 5CLQA 1L2TA 4CIDA 3QSYA 1RJ9A 4NYMR 2Y8EA 4PPQA 2ZI7A 4M22A 1MOZA 1CR4A 3VQTA 1ZUHA 3CRRA 1XEXA 2REBA 4ACAA 2QTHA 4KXFB 4N0EA 4HAYA 1JQJC 1E32A 1E2HA 4OHWA 3LLMA 5KNDA 2W83A 1QDEA 2QM8A 1E6CA 2VP4A 3B8HA 3L43A 2FSFA 2JATA 5FUYA 1M1YE 3I72A 4IRUB 3GLIE 2HJGA 4DXAA 1P72A 2EQBA 1E2QA 2C5LA 3GJ5A 5FTNA 2FFQA 4NYMQ 4EUNA 1JNYA 4TZ6A 2Q6TA 4UXHA 2WSSA 4NYJQ 2FSIA 1OH8A 3WNDA 4HAUA 4CW7A 1KAGA 4OJKA 4KU4A 1MT0A 1JEEA 4JZKA 1EK0A 3RDPA 4C0AC 3ND8A 1N2CE 3UG6A 2PLFA 1MKYA 2Q3MA 2JLRA 2F3RA 4OHVA 4PC3A 5CJ2A 2J0SA 2ZS9A 1W2HA 2DB3A 3EIHA 3KKQA 4YC7A 5J4LA 2KBEA 3UXMA 2FG5A 1SHKA 2GXUA 1ANKA 1HT2E 1YZKA 4XVUA 4QM6A 4DLSA 1JAIA 4PAOA 4YXWD 2BBSA 4KBFA 1NN0A 1E2PA 4NHOA 3LW7A 3AKCA 4C0LA 1BOFA 1G3RA 2FN4A 2OEPA 1CF4A 2H1LA 3AF4A 4YXWA 5G53C 4GBMA 1OXXK 4C2TA 3N2EA 5IHPA 2OAP1 3C41J 1JPJA 4GOJA 2IYTA 4LHWA 2FH5B 1YZNA 5JCPA 2CHQA 3HJNA 3MD0A 3OEED 3QXSA 3NKVA 4S2EA 3W6OA 1TMKA 4IKEA 2VHTA 3AGQA 2LKCA 4HI0E 3AV0B 4G5QA 5DI3B 2OFXA 2O8EB 2E87A 3P4XA 4FMDF 4KFUA 4LJAA 3U44A 4YMUA 1EXMA 1S0UA 1O87A 3EW9A 4B3BA 4W5JA 5G41A 2HYIC 2AKYA 1FQKA 1AIPA 1VYTA 3U3MA 4URUR 1XD9A 5EE3A 2CCJA 3DHWC 1IXZA 4BFTA 1OV4A 2J41A 2RGXA 1EFCA 2ZYUX 3THYB 2ZE7A 3QKUA 1DBSA 1IAQA 4JL5A 2ZXUA 5BN4A 5JECA 1EESA 4LJ5A 1G6OA 2P67A 3D7MA 3GEIA 4G1UC 4H1UA 4PHTA 4Q47A 1WCV1 2J7PD 2Q3HA 1XJCA 1DO0A 1W2GA 3IKJA 1G8PA 4V02A 4NYIR 3F0TA 2B92A 3RVBA 2HT1A 4ZI2A 3CRVA 1VCIA 2BMEA 2J7PA 3P1JA 4DHEA 1J90A 1IBRA 2XITA 3P32A 4AIIA 1SQ5A 4ZV4A 1IN4A 3FGNA 5IRCD 3ZVMA 5F9FA 1OT3A 5HCIA 3K0SA 1XCMA 4LI0A 2VSXA 2ZI5A 4EKDA 2ZUCA 1X8JA 4HAWA 1UKEA 1NG9A 4DB2A 2CLSA 4B34A 4PXAA 2H16A 1RE0A 2QE7D 4AWXA 2QA5A 1L4UA 4C4PA 1QZXA 2IEYA 4HB4A 5TY0A 5FL7A 1US8A 2BKUA 2I3BA 3TKLA 1E2LA 2IS4A 1IN8A 5BWMA 1PLKA 4MGIR 4Q1CA 5EQTA 4B3CA 4QGAA 1CJTC 3C7KA 5L3SA 4EIWA 1BKDR 1ZM3A 3MCAA 3ECCA 4IFBA 5HR5A 4W9MC 2V8OA 2AXNA 3GMTA 3TVDA 3TW4A 2D62A 2PBRA 3K09A 1ZNXA 1E9BA 1G7RA 1Z07A 2V55B 4DVGA 2YOHA 4KO8A 2RGGA 4P4SA 4UXJA 3IILA 4PO1A 2NPFA 2QMUA 4B44A 4CVNA 5BXQC 1ZC3A 2GVDC 4Q4AB 5FOXA 2OLJA 4QBHA 2QU8A 1RIFA 4DDTA 3WY9A 4HB0A 4BRUA 4AURA 1QHHB 3TJZA 5J4VA 3H2YA 1KSJA 3V00A 1BO6A 1ZJ6A 1U94A 4QGHA 1BYIA 3LDAA 1HEIA 2XB4A 2OESA 1VYUA 1R2QA 1GKIA 3PEYA 4QJ5A 4V0OA 1OFUX 4OQLA 3TVTA 2QQ0A 3SEAA 1DO2A 3MJRA 1E2JA 4C30A 3KKPA 3QKRA 2QM7A 3AQ4A 4MGYR 2X8AA 3H4MA 2GCPA 5BN3A 4PPNA 4R9UC 1XEWX 2ZJ5A 4KVAA 3VR5A 1R8QA 1B23P 4B3FX 1XMSA 2VP0A 1ZIPA 1Z63A 2Z4SA 3SFZA 1XTRA 2HUPA 3EZ9A 3B5JA 3B9PA 1G4UR 2WJJA 3FMOB 1NF3A 3MRSA 4RY2A 3FTQA 1KZ7B 4NE2A 1E2MA 2ZRNA 1AQUA 4ZI3A 1KK3A 3EARA 3C8UA 4EFLA 4CF7A 1E1RD 5FPSA 1JEDA 5C4MA 5JCZA 5KNCA 4O3MA 1ZD8A 1GNPA 1YZLA 4KBGA 5H1YA 2EFGA 2VSOA 1TQDA 2XJ9A 3PENA 4C7OA 4QHSA 2QTVB 1E4VA 3B78A 4JVMA 3LAWA 5CK4A 1F60A 1XZQA 3W6PA 2P3SA 1N6KA 4RD6A 3ZS9A 1U8YA 1U90A 3K09C 3UWOA 1W5TA 1ZBDA 3AM1A 3UATA 4HSEA 1NVUQ 3CX8A 2QN6A 2DBYA 1OW3B 4RD1A 3QPVA 4NU0A 4F4IA 4PSAA 4DKXA 5CLLA 5G3YA 1Q1QA 3OEHD 4P33A 4PX9A 2GRJA 1CBUA 1UBFA 1VIAA 2CNWD 2YWGA 4JMPA 2CJWA 1OIXA 5HE9A 4N0DA 4XWAA 1DTSA 3EPHA 3T1QA 2CNWA 2EVWX 3JVVA 2ZM5A 2DWQA 1TL7C 4O2RA 4XSHA 4XWOA 3KQLA 4NONA 4IDNA 1ESNA 4I81A 1U2RA 4TZ0A 2VF7A 2ZVQX 1T0HB 2Z83A 5L3QA 2V4ZA 2PZEA 2X2EA 1VCMA 4LSGA 2XNDA 5FFMA 3VKHA 2E1RA 1KNXA 1QBKC 4EPRA 1W4RA 2J87A 4XOIA 4BLOA 3CF6R 3EX7C 2HEIA 1XF9A 2O8FB 1M6NA 4HZUA 2JDIA 3TIFA 3EG5A 1G3UA 4MQBA 3CUEF 5CB6A 1GM5A 1QHIA 2QP9X 3ND9A 3FKQA 3VX4A 4BEJA 3WYFA 3KJHA 5K8LA 4GFDA 2WIBA 4OI0A 1FQJA 4XSGA 3BFKA 1OXSC 1HT1E 1S96A 1KI1A 4C0JA 1S9DA 1DPFA 5EE0A 4KYUA 2CMKA 4NL4H 1RJ9B 2ZAOA 4DBLC 2AK3A 3Q72A 2ZRHA 1W4BA 2C9OA 4BZPA 3A4LA 3AH8A 2FEMA 4DT1A 3GCGA 3KQNA 4Q9HA 3TSWA 1S3GA 2KJQA 1WBBA 5FUWA 2XXAA 2J0UA 4L5BA 5DSZA 1ZU5A 2BC9A 2OG2A 1FP6A 3MFYA 3K70D 3BK7A 1OH6A 2D7DA 1JR6A 3HPRA 4RZXA 3T12A 1ZMXA 3GJ8A 2RH5A 3CKLA 2WWGA 4PQRA 3FFAA 4M53A 1QG4A 2IYYA 2WWFA 1CJVC 1G8HA 4IDHA 3W9YA 4B75A 2FEOA 4ARZA 2ATXA 2EU8A 4TLCA 1FX0B 2GHIA 2V9PA 3PG5A 2IYXA 3QPUA 4FMCB 5AR1A 4M2LA 4V0KA 3E2IA 1TTTA 4LPKA 4FW9A 2ZREA 2O8DA 1COWD 2BJVA 5FR1A 4PPFA 4HAZA 2EFEB 1NJFA 3GD7A 2JLYA 4TMXA 3ZD6A 1COWA 2VRWA 4MRVA 4A8JA 1GZSA 3SBDA 4R7ZA 2QENA 3EWSA 2BEJA 1WXQA 4OL0A 4PC2A 3SYLA 2VP5A 1NMZA 2FGKA 5JSZA 2F1HA 1M2OB 5E7JA 2JLZA 1QVAA 3ZQ6A 2WV9A 1IXSB 3D31A 2AR7A 4BFSA 1NRJB 1Z6TA 4BEBA 4F4CA 4U5XA 3BGWA 3AVPA 3B9QA 3H86A 3AVVA 3TMKA 4L15A 1MABA 2W0MA 5EP1A 2FPKA 1A4RA 3SZRA 3UIEA 3EAQA 4PC7A 3B1ZA 1RZ3A 4TL8A 1VG8A 2IHYA 5J4HA 4US2R 1N0UA 2VO1A 4NKRA 3SHWA 1SXJD 3CX7A 2ZIAA 2GILA 1G8YA 1G291 1JJ7A 4MITA 4JL6A 1GL6A 1NVWQ 2PCJA 4D80A 5C46F 1RVDA 1S3SA 3D6TB 1KOFA 1J99A 1SXJA 5DN6D 3WHKA 3B85A 4QG7A 2J9RA 2QL6A 4PZLA 1E2NA 1XMJA 4Q1DA 5FH9A 3U7FB 4EAQA 3FPAA 1A2BA 1T4GA 3RWOA 1CXZA 5DN6A 3AF1A 1EWQA 2C03A 2AD1A 2N42A 3BRWD 2JLQA 3GFPA 5DLQC 2DHRA 1Z29A 3RNLA 4ZIRB 1V5WA 2P6NA 5J5CA 3WRXC 3RS5A 1Z0FA 5J47A 1T3HA 2JJ2A 3LX8A 1XMVA 4EJSB 3OE7D 1N5LA 3T06B 1R0WA 4CT4B 4ZDKA 4JVNA 3B7GA 4BFWA 4O25A 4Q9KA 2O0KA 1EX6A 2I1QA 3GJ6A 2UZ3A 3LNCA 3OE7A 4BLTA 2AFHE 2GJ8A 1FZQA 3RSLA 3Q9LA 4EPWA 1EFUA 4QM7A 1NSTA 2GJSA 2F1IA 1FUUA 1F2UA 3FOZA 4PAQA 3R7WA 4TL6A 2WWXA 3ASZA 1Z2CA 4XD7D 1RPZA 3HU3A 4MKIA 2GCNA 2NO1A 2VL7A 2RKOA 1N6LA 4OK5A 1J70A 2EW1A 3P4YA 3IDQA 4XD7A 5FBWB 1MO3A 2IUUA 2OXCA 4GP7A 1E9FA 3WYAA 4A82A 2GAAA 1E9EA 1T3SA 4II7A 4DSOA 3FKSA 2CL0X 5SZHB 4TMTA 2MMCA 2YOGA 2JIZD 2H92A 5JJIA 3QXHA 4PHFA 2ANBA 2PMDA 3VU9B 2CBZA 2R62A 1WE2A 3EASA 2FNAA 2BM0A 2OFOA 2JIZA 4PQYA 3PUWA 1OIVA 3U6BA 2ZUBA 1SXJE 2B7CA 4GRAA 4B47A 1R5OA 3D3QA 1IONA 4QBIA 5FTJA 2XZLA 3WMEA 3IEUA 5L3SB 2F43A 2BIFA 3T34A 4ILEA 4LBVA 3I61A 3RC8A 5GJBA 3K0FB 1KO5A 4IJMA 3KFVA 4FCVA 2PT7A 2N1BA 3AF0A 3MWLA 1VKJA 1G1MA 2FZLA 1DAFA 5BYJA 3RRZA 1OYWA 3A1SA 2IS6A 3W3ZB 2B7BA 5FPTA 3AP2A 1G5TA 1R8SA 4Q48A 3UANA 1UKVY 1GFIA 3WBKA 1A82A 2C9YA 2O52A 3THOA 3HDTA 1F3OA 4G5RA 5ANRB 4LHVA 2CE7A 1WP9A 3I32A 3N2IA 1II0A 4YQFA 4G5SA 5GJCA 2Z6VA 5C4GB 1TEVA 3VR1A 4BQSA 5HZHA 2PZGA 3NHBA 5B2ZA 1S2MA 2ZTSA 3NIBA 2BMDA 4FIDA 3A1UA 5J40A 5H8WA 2MSDB 2R9VA 1Z6XA 1N5IA 2BBTA 3K0EA 3QKRB 1G3IA 2W2TA 2C2HA 2ZVPX 1GILA 2A5JA 2E9SA 2QGNA 1LV7A 2J46A 4LUCA 3KQKA 4Q66C 2XAUA 1AZSC 5IK2D 4OQXA 3TAHA 1IXRC 4MKGA 3VR6A 5FPYA 5DYIA 5JJLA 1NLZA 3QPWA 3ZVRA 3DOFA 5CYOA 1E9AA 2RGCA 2QAGA 3T61A 2G1JA 4GZLA 4G0NA 4M1KA 4WBSA 2Q0HA 4KFSA 1II8A 1XXHB 1YJ5A 1IOZA 3P20A 5HE8A 4WA7A 2PT5A 4C7OB 3ICEA 1W5SA 5AWFC 4QFMA 1BMFA 4DWJA 2OHFA 2QI9C 3EC1A 3REGA 4DC9A 4RSGA 2VHJA 4UJ5A 2HYDA 3DVLA 3WXMA 2NG1A 4GMDA 2QBYB 1GRNA 2J45A 1X8LA 5KDLA 3I1FA 2H5EA 2XX3A 1NJGA 5L3RA 1VIYA 1KI3A 621PA 3TUIC 2CLDX 5TV2A 4R98A 4A2PA 4QJ4A 2QTFA 1Q12A 3E1SA 3TK1A 2WAXA 1G7CA 2JA1A 5EP4A 2WMOB 3LBNA 4PC6A 2QAJA 1I4DD 1NVVR 3A8TA 3MAAC 1OXUA 4A0HA 2QSZA 1L8QA 4QJ3A 2RGAA 1AK2A 2OILA 2WTUA 3SI7A 3CRMA 4YMSA 1BIFA 2XJ4A 1P62B 1DVRA 1IY2A 3BH6A 1CR1A 2FFHA 3L8ZA 4JKIA 3DM9B 3ZIAD 5B64A 3RHFA 5H68A 1I2DA 4LK2A 2Q21A 1ZRHA 4YMWA 2RHMA 2CL7X 2WJGA 3UMFA 1HTWA 2BBOA 1KDTA 3ZDQA 1GRQA 3N70A 5L3QB 1LY1A 3EIQA 1KMQA 2NO7A 4G5OA 5BYKA 2JLSA 3T5DA 1VG1A 1Z6AA 2CLCX 3OIYA 2JLUA 3NBXX 3ZVLA 2XTNA 3SJCA 3WMFA 4B73A 1PZNA 1ZM4A 2CE2X 2LWIA 4RCYA 4P31A 3B1YA 2QAGC 1DAIA 2F1RA 4DZZA 1P6XA 1WRBA 4PSVA 2KI5A 3LBHA 2IYVA 1UKZA 1SKYE 1I4TD 1XP8A 1Z0DA 1K5GA 4KLZA 4M1OA 5HPYB 3B60A 3IQXA 2IX3A 2C95A 4TYWA 3U7GA 3IO3A 1OF1A 2CHGA 4PHHA 2HF8A 4ZCLA 1E4YA 1KMHA 1U8AA 2G0NA 2IL1A 3BB1A 3JZMA 4L16A 1OFTA 3AP3A 3W6NA 3K9NA 3J81k 4D26A 1XPUA 3ZVNA 4GSYA 4TL9A 2GEDA 1FNMA 4NYJR 1QRAA 4JSYA 4MYCA 4QNMA 4GZMA 1Z0JA 1VDZA 3BIFA 5E7IA 4BFVA 4DDWA 4JLBA 1RKBA 3WYGA 3QOFA 2BBWA 1N6RA 2ZJOA 4CDGA 3SOPA 1Z0KA 2IW3A 4Y0VA 3T1VA 5P21A 2NMVA 1NY5A 3RS3A 1TPZA 3QBVA 2HLDD 3FHCB 1MV5A 1JB1A 1NN3A 1OXTA 2BJWA 3AVTA 1PUIA 1E0SA 2DFNA 3VNUA 2QSYA 3PEVA 4IVRA 1N6OA 3TR0A 3I3SR 5KSYA 4JLKA 4M9QA 2RMKA 521PA 2ZE8A 4TLAA 3K8YA 5JSZB 1WDTA 2FV8A 5IDVA 5A4JA 4FMDB 3GP8A 4M9ZA 4IEIA 4QGGA 1AS3A 1CTQA 1P7CA 1RYHA 1RW4A 4OJQA 1ZCBA 1XDBA 2PX3A 3THXB 1G4AE 3BWDD 4AI6A 4CYMA 1R0ZA 2RGEA 5AUOB 1SGWA 1LF5A 3QXJA 1Q3HA 4H9GA 2ZYVX 2WIAA 5J4KA 5L3VA 3CWZA 2VTKA 1RC8A 1Q22A 1U9IA 2DCUA 4IFEA 5GJVC 1NKTA 1PUJA 4LCBA 5JI2E 4FN5A 4V03A 4OQNA 1ZNWA 2AWOA 2G6BA 3TE6A 1QHSA 4TYYA 3QVUA 3AVWA 2FE4A 1Q44A 4IDOA 1X86B 1W1WA 1EWRA 2ZRBA 4FXPA 2P65A 2ZRGA 4WIAA 2OSBA 2QRZA 1NL3A 3C5HA 2IF0A 4Q4HA 1L4YA 1H8HD 4PQFA 3BJIC 1KAOA 1ELOA 1XPRA 1FMLA 2FGJA 3KJIA 3EZ7A 2ZSBA 5KYKA 4QBFA 1H8HA 3QQ5A 4YLGA 2WJVA 3CH5A 4DCUA 3KTAA 2G3YA 2PEYA 3C5CA 4LGMA 2NQ2C 1MH1A 2ORVA 5KOYA 4QBGB 4DLZA 2QY9A 3S1AA 3GFOA 4EFMA 4HZIA 1S4QA 3QENA 3OEEA 1EX7A 2A9KA 4PC1A 4GDFA 1DAGA 4ESVA 4M9XA 4AKIA 1BYUA 2G0TA 4DLRA 4Q7MB 2DFKB 4US0R 3R7WB 1KO8A 4HDQB 2X1VA 2CVHA 1S8FA 2GZAA 3V9PA 1YZGA 4EPTA 4C0HA 2VP6A 1XTQA 3LVQE 3GJ4A 4LJ4A 5AJWA 4AD8A 2A5DA 2P6UA 1XB2A 2BVNA 2R6CA 3L0SA 2JASA 4RFSA 3ZYCA 3BS4A 4A15A 2W6JD 4KJZA 1P2SA 4Q18A 4HUQB 2BHRA 2HCJB 2J0VA 4NCIA 5D3MA 5FBLB 4BLRA 2J0QA 4Q7KA 2W6JA 2Z43A 3AF2A 1OFHA 3EA0A 3NTUA 4I1SA 4URWR 2D4HA 1Z5ZA 3PUYA 2B8TA 2VSFA 3I62A 2V6IA 3QNUA 5AJVB 1R5BA 3THWA 1W44A 4QHTA 3EXAA 1CJUC 2CL6X 2F55A 4TQUS 4JLJA 1AGRA 1XTKA 3EZ6A 4CZ2A 2QRNA 1Q21A 4PSKA 2F43B 1CKEA 1UEIA 3KUDA 1E9DA 3WNBA 4W7SA 4DCSA 2HDNB 1I2MA 1LF0A 4D4JA 1W4CA 2FPLA 1U99A 2DY1A 4A9AA 1SVKA 2QE7A 2YINC 3KQHA 4FINA 2DWPA 3TSZA 1N6HA 2WJHA 4P0TA 2GWHA 1DARA 4KCGA 3WNCA 1W0JD 4KSCA 4Z8YA 2W6ID 4GOXA 1E3MA 3A1WA 1CRQA 2BV3A 3PFIA 4P3YA 3ZZUA 3CR8A 3ONWA 2AX4A 2W6IA 4MGKR 4BLPA 2ZS8A 3U4QB 4X8LA 1G8FA 2ODWA 5LDDC 3L0OA 1XBTA 1E79D 4GPTA 5C18A 1XEWY 1YR6A 4IHQA 4J0QA 4ZCIA 1KIMA 1C1YA 5KTYA 2YKGA 1W36D 1YR8A 1YE8A 4DEYA 1ESMA 1E2KA 4F7WA 4OHZA 3TLXA 4ITRC 1U0HC 3W5IA 4DLWA 2BMJA 4LV6A 2D7CA 5TDHA 3EZ2A 3C4JA 3Q85A 4LJYA 2HT6A 1Z2AA 2NZJA 3A6PC 3A1TA 2QT0A 3F5FA 5UKDA 3GLFB 2C9CA 3EPKA 2YWFA 3GLGA 2ZRKA 4IVQA 4HAXA 2P5SA 2DWOA 3NEYA 4D0GA 4EQ6B 3W3AA 1XD8A 2QAGB 1FFHA 2GBLA 3GJ7A 1Z83A 2JLVA 2H57A 4JLNA 5FL3A 1OE0A 2OV2A 2R2AA 4TMWA 5AJYA 1DAHA 1DG1G 1F2TB 3BB3A 3IHWA 4QNRA 3B1XA 2VP2A 1WQ1R 4D82A 2D2FA 3SC3A 1DAEA 4PHGA 4I99A 2AWNA 4BFUA 4BLSA 4ZKDA 1FTSA 4M1WA 1E1RA 1SZPA 5A0FA 1R6BX 2WWYA 3FDIA 5JWRA 2QUZA 3TUZC 4NDZA 4B76A 4OHYA 2QEQA 1EFTA 1SVIA 3OZXA 1V43A 4JVSB 4TQAA 4AYTA
chains in the Genus database with same CATH superfamily
3C8DA 2KS6A 4X91A 2VBFA 2EJVA 4I9FA 2X5NA 3K92A 1IZ9A 2X41A 3LW8A 4ZI7F 1T3GA 2R4UA 1MQAA 4AK9A 4F7DA 5EWLA 4BVFA 1RT9A 1T2CA 3DMGA 1ODFA 4F91B 1NF8A 3AVVA 2I78A 4YJ2F 2OCBA 4HEA1 3FFWA 1KI6B 5ALOA 1H6AA 1J23A 2AZ4A 2NU7B 1JJVA 3LH5A 4Q01A 4TYMA 4D0LB 5AVSA 4OSOA 5JARA 5KYXB 3INYA 3IDFA 3PE4A 2OXEA 1F6BA 4P4UA 3GU3A 2JH9A 4IJUA 1Z17A 4JDPA 1Z18A 2Q1YA 2ZRQA 3EBOA 2GF0A 3KALA 4H3KB 4M83A 1EM6A 4FEGA 3GGPA 1C0EA 3ASUA 4R4JA 4DJTA 5CVTA 4CEIA 4B2LA 2V3VA 4NJOA 1XD2A 2W43A 5TE9A 4RC9A 5IAAA 1TA0A 4JODA 3CRQA 4PYQA 3R75A 1PEYA 1E7SA 4F2PA 2GF2A 4BZXA 4FB5A 3L0YA 2QU7A 3JYHA 3UMRA 2E0IA 4GG1A 4R2IA 3MWYW 1SKMA 2G83A 1X13A 4NEHB 3ZH9B 2ZI3A 3QKSA 4BJ5A 3U3KA 4MV6A 1V5IA 2Q7DA 2B1GA 3TCXB 1EXWA 3WV5A 3M3HA 4J49A 3I0MA 1PHRA 3I01A 2A5FA 3CBGA 3CUWA 3W5JA 2R8PA 1I8TA 4X1OA 5HQ3B 1CJSA 1VPWA 3HVKA 1P0MA 4NNPA 4D3XA 2Z2XA 3KQUA 3CONA 1E94E 1XZNA 2FPRA 2WF6A 4A6EA 2AGVA 1YRBA 2PYDA 3I6BA 4ZQIA 5CGZA 3COPA 2QPAA 1JSRA 3U4MA 1DIAA 2B83A 2X77A 3WK7A 2HCFA 2XSZD 4RTQA 2C31A 3GFGA 1J7KA 3PUXA 2CHEA 2P5TB 3TMYA 3HE3A 3PC7A 4XKJA 3ZX4A 1ONBA 4JJ6A 3UVEA 2V58A 1Q6ZA 4HGYA 4QSHA 4AKEA 4HPXB 3LUFA 4Q1EA 3ETLA 2HK9A 1NVMB 4L4RA 1NWCA 4MA4A 1TF5A 5TT1A 4I4TF 1A8HA 4CEHA 3GGDA 3G85A 2Y68A 3I09A 1RWBA 2GETA 2WWIA 1IHPA 1NJ6A 2G77B 3JR7A 4W8HA 3O8QA 3V2IA 4NENB 5C37A 4LZNA 4XDGA 1XDZA 3EGEA 1L4LA 1NRWA 2ZANA 4KXYA 1U1CA 2Z30A 1ESZA 1KGDA 2ID9A 4ER3A 1JDJA 4R8RA 3VHLB 4HPWA 5EZ5A 2CXSA 5IF3A 1UMKA 1MAVA 1WW2A 3R5SA 2H17A 3H1AA 4JU9A 5C8VA 2H65A 1KC3A 2VPWA 3DAOA 3H2BA 4M88A 5I9MA 4TKLA 3W34A 1EE1A 5ILGA 4ARSA 3Q7QA 4RHXA 2OL4A 3CIFA 2RIRA 4XYBA 4BQOA 4HVLA 5CD9A 5IJZA 1M34E 3A2LA 1JPVA 3QVGB 4AZ0B 2IVFA 1TCAA 3QVLA 3TXAA 4FGWA 5HCUA 4Q4DA 3KQPA 1PN3A 4KWIA 4C87A 2H2AA 3VTKA 3ZGVA 2YHAA 4JA2A 2BLLA 2O3SA 3MS7A 1X9IA 2O2IA 3QYAA 4ZARA 1U28A 4MWDA 3LUAA 2ODQA 4XZ3A 1P60A 4YP0A 3FHJA 3KKZA 4TPKA 4ZA2A 4WT7A 2GCIA 3O47A 5B4UA 4X84A 3R3XA 2ORWA 2DH6A 3CPEA 5ELMA 5FBVB 1R6XA 3DEHA 1QUEA 1E2EA 2PM8A 2KE5A 1J8VA 1PFKA 2ZT8A 1G5RA 2QLMA 3K96A 3Q88A 3W8NA 4EUEA 3EFBA 1VB5A 4D4GA 2D06A 2YBEA 4LYYA 2FF7A 3G2OA 2JI9A 3DLIA 2FMFA 3WICA 4CV2A 3ZK9A 2ES4A 1U6JA 4OQMA 5IASA 1Q3TA 1A9PA 1HZZC 5E6UB 3FVTA 5HGJA 4LF7B 2PMWB 1IYZA 4MPPA 1HA3A 3C8HA 2C78A 4KMMA 3B51X 4KYVA 1G7SA 3LUJA 1H2FA 1KJNA 1N0VC 3LHIA 4EGFA 3QEBZ 1J8YF 1H9AA 2R44A 1QFXA 1IY1A 1F6WA 1UJNA 4P3PA 5KPDA 3K70C 3U44B 5E2IA 4HGQA 4TWZA 5KJEA 3R9XA 1LDMA 2PH7A 4EO7A 3E3MA 2XYRA 3GO4A 5LDHA 1HE1C 1ZW6A 1N8SA 2PH1A 2XEXA 2VEDA 5GONB 3I9JA 4EG3A 4F04A 1VCHA 4JKYA 3VO8A 1SOMA 3DDWA 2RKBA 4MDHA 1A2QA 1AF4A 1W6RA 4INJA 3ZY6A 1E62A 2HA2A 4DV4B 1CCWA 4ZMSA 3R24A 1GA6A 4WD3A 4XDHA 5AT1A 4X1KA 4B17A 4FM9A 4K7JA 4WSOA 5ITVA 2DHEA 3E2PA 1UT6A 2Q46A 4TMKA 3FWYA 4G1VA 1JV2B 2VNIA 3B5EA 3SC6A 2IOQA 2FOIA 4LBWA 1HSOA 2VKQA 4AIRA 4QRHA 2ZIZA 2QTCA 3EK2A 1RTTA 4MVYA 1JEQB 4QHYA 3U3RA 5DRYA 1HH4A 1E3EA 3N8NA 4TLDA 2C5AA 3RU9A 4UDXX 5JD4A 1UP7A 2O8EA 5GAJA 4Y6GB 1FMFA 2OG1A 1P75A 5KHLB 2IP2A 4QTTB 2WKQA 1ZJ5A 3KQMA 1OU4A 1GL9B 3BMNA 3OJWA 1P4SA 4IQGA 3SXJA 3VOAA 4BNYA 1TUBA 3TPZA 4YMTA 1QGED 1QH9A 5IJAA 1PEDA 4BV8A 4N1AA 1DELA 3HJUA 5EWMA 1R7RA 4DAEA 2NIPA 2WZCA 1DC7A 1YVEI 3KHUA 5HOQA 1KP9A 1EIWA 1SC1A 2Q07A 2ZJYA 2XIQA 1G21A 1SIBE 1YU6A 5H81A 5C1PA 4AP6A 5F12A 1SXJC 3WDSA 1IDN1 2EL9A 3TZEA 2PGXA 2J4DA 1IOVA 4OJTA 2E4WA 4HQNA 4BE9A 5KNCH 4Z3DA 3IUMA 4HSGA 2IWHA 4W8GA 1F12A 1ILWA 3ASYA 4HDMB 2WU8A 3PHHA 3OQOA 1YDGA 3CWQA 3MCUA 1SOUA 2YMQA 1L4HA 3KZNA 3JQAD 4IDGA 4OF4A 4Y2PA 4MKXA 3S8YA 3SQXA 1NLUA 4KI0A 1OKKA 1FLNA 3EH1A 4NOKA 4KV7A 3W2IA 4D8TA 2Q4DA 1GXSB 2GZMA 3Q98A 5DX8A 4BXOB 1R6TA 1MRSA 1BDMA 1CYEA 3KKEA 2H06A 3K31A 2C07A 3OIDA 4YRIA 1H4VB 3GNLA 4JT9A 4A1OA 2IH4A 1ISHA 2VUTA 2WSBA 3CMCO 3NBQA 2MSCB 2FWRA 4L4UA 721PA 3NDJA 3RS9A 3AEZA 2O2ZA 4MVJD 4GZ6A 1RI5A 1BQ3A 1L5NA 1Y9ZA 1E2UA 5ALDA 4ZEXA 1CJCA 3CF0A 4JI5B 4D4KA 3UK2A 4U7DA 2X9LA 4J07A 4RQTA 1ULTA 4OI2A 3ETHA 4OK3A 3TNFA 1TGYA 2A78A 2YXLA 4BWYA 3R9WA 3S81A 4HB2A 4FHEA 4L02A 1MO6A 1TNDA 4IYJA 4YRTA 5GADl 2FR1A 1GYRA 4A0FA 4QTZA 4C6RA 1J8MF 1GDDA 4G1MB 5BN3B 1KORA 4WXMA 4TRRA 3AFNA 2FJUA 4UE6A 1JA1A 1HLPA 1XKXA 2DGDA 1DMSA 2W6NA 3SJAA 1MB0A 1NUSA 3CLHA 4FDLA 5EIHA 4IHAA 4A7PA 1A4IA 2PGNA 4K81B 1ZM2A 5KDOA 1HURA 4G4SO 4ZVKA 3JQCA 2G25A 1TUEA 5IK2A 1SKAA 2XDAA 1GL7A 1QHHA 3A3NA 1SD2A 3LC7O 3U7QB 1N7HA 3TB6A 1NUAA 3I6MA 2GN0A 4RK0A 1K9SA 1NLFA 1NJSA 3VU8A 1QHYA 4OYYA 5JRJA 1G21E 1NW6A 3AIKA 3D8HA 2O8NA 1VL2A 4FCWA 1CY6A 1DCMA 1CZHA 1R8XA 1K5DA 1HV8A 2HIGA 2RCYA 4REQB 2W71A 4ETNA 1J9EA 1AUOA 5ALJA 3WHLA 5KYYA 1WVIA 2ZJBA 1KDRA 1XZGA 4S35A 4OQDA 3TSYA 3WB9A 4Z1MD 3IP6A 1KIFA 3I73A 2GBIA 3KFLA 3KXLA 1MXHA 4X45A 2O05A 4JDUA 2BFDA 2BCJQ 2VF5X 3EZGA 5F2EA 2YFYA 1X1SA 5GM1A 4JUDX 2JBAB 3T52A 1QFSA 3MJHA 1BEZA 3LC2O 3VXKA 3WNQA 3QVOA 2CJWB 2DVMA 5TQJA 1L5OA 3ZE9A 2I2CA 3W5AA 2VPYA 1WDKA 1H8ED 4EI7A 1JJFA 1LLQA 5IFKA 2ECKA 1FFXB 3LQRA 1HKUA 5BOSB 4JT4A 4HLCA 4ZDWA 3OQBA 1CS0B 3PR1A 5G4LA 3HL0A 2GLTA 3P0IA 5HKKA 1NNUA 2PMCA 2FU5C 4IDDA 4MCAA 5F3RA 1NQTA 1QGZA 2HK6A 2H4FA 5LQCA 1G55A 3QIVA 1Z0AA 2E4UA 5ER9A 1RYDA 2V7UA 4LAFA 4NG5A 3JCZA 3PT9A 3SF8A 5LQJA 1CY2A 3IRUA 4HTFB 3PUZA 1K92A 2QUBA 4OGLA 3F7OA 4WCFB 4HDOB 4D6YA 4CLOA 4WX2B 1T3ZA 3CWCA 2G5PA 3F7MA 1KO1A 2G4VA 2H4YA 2Q5EA 2KW5A 3KC2A 5HRAA 4NG4A 1HQYE 2B0JA 3I9LA 3LRXA 5FWYA 2AS0A 1L7DA 4HZUB 3FX2A 1ETUA 2G1UA 2TMGA 2GLXA 4RVGA 4DIUA 2FPPA 2RGDA 1B0UA 4TLEA 1T9AA 4X71A 2ACKA 3ZLUA 2HV8A 4DB4A 2O8CB 4MYTA 3HXTA 2PSJA 1ZL0A 4Z99A 2B4TO 2BI7A 2DLNA 4I46A 4ZAZA 1M75A 3P9XA 1OAAA 4KH1A 4N5LA 2A1UA 2VJLA 3ZXIA 3QU2A 1Y98A 3GLFE 4XVRA 4Q3NA 4PVDA 5C1OA 3CT6A 3VAZA 1YOBA 4LJ9A 1V26A 2INGX 2COKA 2J0UB 2YRWA 5BQOA 4CR6A 1G6KA 4ZCQA 4AJKA 2OZVA 3ADBA 4UDYX 5IX8A 3L1VA 3RH0A 5E1BA 2J9FA 2ASEA 5AOCA 4K6GA 3LOPA 1TD1A 4K40A 5JH7B 4ARZB 3SVLA 3OWOA 4RVDA 2Y9MB 3K2BA 1SEVA 5D5QA 5BVHA 3U7RA 2XOEA 4IX9A 4KVZA 1F6DA 3RQSA 4UJ3A 2VDRB 2PJUA 3UMCA 2VSNA 2PRSA 2QLFA 4QWWA 4WECA 1JLLA 3OJCA 5KVQA 3HTXA 1TLTA 1T15A 2A9JA 1UBTS 2UVPB 4RXMA 5C7LO 3OFJA 2JGEA 1M8FA 1U9ZA 3JQ6A 2VOEA 1RACA 3DTTA 5CT5A 4KQHA 5K9ZA 2PKWA 1G17A 4HBGA 1O5IA 1P2TA 3UA3A 2CXPA 4KEAA 2ANCA 1BXKA 1IJEA 2PQ2A 2Q5HA 3VJMA 1RYNA 4JVLA 2GT1A 1GL3A 1Z5NA 2VDJA 1W85A 3IBSA 2UZ1B 2AOTB 4E51A 2P6RA 1IJFA 4IDBA 2Y92A 2OCKA 3K2QA 1QTNA 5D1NA 4IJ6A 1Q7GA 1ULHA 3WMGA 4MLCA 3TINA 5HS4A 2BL4A 4I14A 1KFBB 2IEBA 4EUFA 1A5BB 4EI2A 1YO6A 1D6JA 2XQVA 5LOVB 2F2TA 3GJ0A 1XAIA 2O8BB 3VMFA 3H9QA 1Z5VA 1QFJA 1NN1A 2FXVA 3PSHA 1KI9A 1KZ6A 4FOOA 2ONYA 2XR1A 3AFMA 3OC6A 3L04A 1PQUA 4NCNA 2ZTUA 1NP6A 3AESB 2D5BA 5A4KA 2COUA 5KWVA 3TR5A 2PO5A 3JPWA 1VLZA 1XRNA 3EIWA 1UBLS 4BGDA 3DB2A 1AVTA 1CR0A 2ODTX 2RB4A 4TQ9A 3N58A 4Q9LA 4E5DA 1RAFA 3P0EA 1B6RA 4HGRA 1L4NA 1EDOA 1QORA 2FZCA 2VA8A 3AI2A 4NQRA 5ICSA 3IMKA 1PS8A 4OQEA 2VAWA 3NYQA 4JWTA 5J9FA 1W4ZA 4X90A 4KLNA 5G40A 4F96A 4ZFNA 3CZQA 1M2OA 2NPIA 3V4RA 5LUBA 2AMFA 4XIGS 2B1IA 4DV6B 1TQ4A 3F5MA 2YCLA 5HNKA 4IIJA 2AJTA 1W4LA 4MI3A 5KX5A 3CNOA 5KWSA 4A2WA 4DIBA 4FX2A 1E5LA 3GCXA 4MRRA 3UFXA 3NFYA 5IKMA 4NJMB 4O29A 1ZD3A 3KLOA 1S7CA 5TJHA 1RCFA 3K1AA 4KMRA 2VF2A 4KZPA 1QPBA 2D2EA 1QONA 2VRNA 3H1FA 3KOUA 4YRPA 3DVQX 2JJQA 4RVNA 3VKWA 5K05A 1KKMA 2VHEA 1H2HA 3IBYA 3P71T 1B2LA 2C84A 2ZITA 4H6VA 1JNXX 3MUFA 2YS6A 2PMBA 4IRXA 5K51A 1Z4KA 4ENTA 1KIAA 1REQA 1DGQA 4MUEA 3HXQA 3N7TA 3BOSA 2J3EA 3H7AA 1JU9A 2XXBA 4P81A 2QW8A 3WWDA 3IC5A 1Z45A 3UG7A 3UWMA 1FFYA 4PPGA 5BW8A 3L6EA 3PZBA 1JEOA 5DP1A 1KETA 3VDMA 5K3AA 4XQEA 4YV7A 2G1PA 1JHZA 1GKKA 4GI3A 1Q7EA 4LMBA 4OLFA 2CXQA 4X97A 2JZCA 5CAEB 1DDOA 1UQTA 4YPOA 3AJAA 1ZXXA 1EUZA 1IPEA 2YIMA 5JQGA 1BFUA 3PXDA 3PKJA 1TJNA 5DX1A 5I4KA 5JYEA 3IRVA 3EXIA 3OM9A 1BDJA 4C0QC 3QI2A 1KOGA 4CQLB 3AUTA 4D42A 3BXEA 1FNNA 4HS9A 1NVAA 3SHVA 4DSNA 2D8AA 4KXQA 3K9GA 3LLSA 1MAUA 1W581 4DYVA 3WNVA 3IPAA 4JBGA 3GDHA 2YDYA 3AB7A 1Z37A 2X8WA 2PX5A 1LDYA 2XMZA 4Z51A 1ZOLA 3HABA 2NVOA 4Z4CA 1UZLA 4XUCA 3WI7A 1OJ7A 4GKJB 1J06A 3IDSA 2NUAB 3QG5A 3TUJC 5DP2A 3JQRA 3QBJA 2BFOA 4HX5A 4OYRA 4HYEA 3ZJTA 5JTTA 4QBKA 5AKZA 1WNFA 2J3IA 2VDMB 1T25A 4JQZA 3A04A 2JFBA 5ILQA 2F4VB 2HU8A 4S0XA 4WK2B 1SG0A 5JJ5A 4N49A 1OMOA 5COAA 4TS4A 4ZOAA 5JALA 3DMTA 4ITUA 2C96A 3DUWA 4L9RA 1J4AA 4WASA 3AB3A 2W2VA 2YVUA 3LLUA 4ZDJA 2CV0A 2JD2A 2CGEA 3PNPA 3QA3E 5DHUA 1EA7A 1OILA 1QIIA 2Q49A 1UFQA 3GG2A 1W0JA 2CWWA 2OBYA 2ZZKA 4OBEA 3AKZA 1NRXA 3QLTA 4LOIA 3ZDAA 5CYPA 3Q6IA 1AE1A 1KY5A 3UWDA 4G6ZA 5H70A 2J7KA 5U1PA 4LF6B 3DFKA 5FOTA 4G24A 4K03A 3AR2A 4GGMX 4U39A 5TX7A 3ECSA 4E07A 4WOPA 2B5VA 2W7TA 4WCDA 3TTTA 2H85A 2ZKLA 2XUIA 3BHJA 3I5UA 3ZJYA 5I9LA 1CW2B 3EAFA 3UQYS 5DLPA 2AHOA 5IVPA 1VGRA 3KUCA 1E79A 4QU0A 4HUTA 2E55A 4QLBA 2WNSA 4TLLB 3D4NA 4BEVA 1SXHA 1YB6A 2ZU6A 3FTCA 2HI0A 3OTWA 3VBCA 3IQHX 2H2IA 3IBGA 1E8DA 4E2FA 2RH8A 2AN9A 4GBJA 3F3KA 2ZYTX 4RQBA 1AKRA 3B7PA 5J5AA 5BV8A 3JRXA 2IYWA 3MWJA 2IHJA 2XOKD 3BN3A 3G8CA 4S1OA 4UMEA 4ZPXA 4MKHA 4D57A 5JS7A 5FBKA 4MJ3A 3SQOA 3TGPA 4JOCA 5EIBC 4Z0TA 4CM8B 3DV0A 2R11A 10MHA 2PAFA 3D3KA 3HI6A 4PFKA 1FJ2A 3W1WA 5AHWA 4B6FA 3TFOA 1JMYA 1ZKMA 3H9UA 2J6CA 4HY3A 1WZCA 1NI5A 4YO8A 3AR9A 3T0IA 3WGUA 1H2WA 4WMLA 1SULA 4X7BA 1W93A 4LFAB 1PQWA 2WAAA 5ALLA 1O08A 5FQNA 1ABFA 3FJYA 1HZJA 1K8RA 4G5XA 3SKVA 2C4VA 4C3ZA 4YI5A 4DCJA 3WRVA 3IEMA 1Z4PX 3A36A 1TZCA 3EIOA 4KE7A 4XIIA 5IXJA 1LCIA 1Z3CA 3CNQS 2XBMA 4Q6BA 1J2RA 3RANA 3LBIA 2ODNA 3QFRA 4NE9A 2HQBA 3KFXA 1H69A 1UJ4A 3NWEA 3VSEA 5ICEA 3KG2A 1IPHA 1KJZA 2OZPA 1SVOA 4R2LA 1CEYA 3NALA 4I50B 2Z3WA 3MINB 1YZUA 1OQAA 3OAAA 1U7PA 3S99A 1YBFA 4RAOA 1HDRA 5T4BA 1XKLA 1MBZA 1TT7A 2WTXA 4RPGA 1EFVB 1FXSA 2AX3A 2VQDA 3NT2A 5EAIA 4BO9A 5LM3A 2I29A 3SFVA 2XF8A 5H3LA 5LQUA 3GIWA 4JJZA 1A9OA 2HR1A 1XSEA 4UMDA 4MP8A 4TTQA 3L9XA 2LCIA 5KU7A 2IDJA 4B2YA 1ZUD1 3HVHA 2WF9A 3BX1A 4PXYA 3RF7A 5DT9A 4C5BA 3AR4A 5HFAA 1VBNA 5GM2A 1DRUA 4RHFA 1K89A 1GNRA 4V0LA 3A3OA 1C8KA 2DU8A 1UKYA 2OBMA 2ZUTA 3MT9A 5KSWB 1WCIB 2XMQA 5JDIA 1TM3E 1UKAA 1ZH6A 2GCOB 1MX5A 1GTMA 2RHHA 2VPIA 3NBFA 1ISFA 3ORYA 3AUSA 1L4KA 2QYSA 2VK8A 2PJDA 4O2LA 1Z4OA 1MB4A 4EJ2A 4BBAA 4DBVO 2GM4A 1KJQA 2BGKA 4RTPA 1YIDA 2QZSA 1BWQA 3HACA 3V8MA 3GLRA 4RO0A 5JSYA 1D8TA 3HZOA 3PQCA 3RREA 4O4HF 4YPVA 2CK3D 4KKXB 2WLTA 4L0QA 2XHZA 5DM4A 3L02A 1NVFA 3HP7A 4PRLA 1GEEA 5DW0A 2IIBA 1E8NA 4IY1A 4EDFA 2XNDD 4NEQA 4KDRA 3DNMA 3ULKA 4FNAA 4UE2A 3AERA 5LNK6 1A77A 5E1MA 3V9PA 1DJOA 1UXJA 2WFLA 1JKJA 4BFXA 5K3FB 1M7HA 4U0KA 3ANMA 1Y1KE 3WE7A 2ZW9A 3O8LA 1ZHOA 1NHWA 3R9IA 2EARA 3TQCA 5ELXA 5TEWA 1QQ7A 3I9V6 1IB0A 4KREA 2FRVA 3I53A 4ZVOA 3TG8A 2XWQA 2J6IA 4Z2YA 1GVHA 1XDDA 3CZ9A 2QKYA 3HSSA 2FEAA 1CUFA 4OMFG 3TTUA 3DTVB 3VH1A 3G5MA 2ONJA 4LNAA 1DC8A 2WF7A 3B2NA 2PX0A 3ZD7A 2OPBA 4FCCA 1G8GA 3A9SA 3CV3A 5GP1A 4G4SP 2IK8A 1AZTA 2PPVA 2QVZX 2ZJ2A 3IMCA 3L8FA 3QFHA 4DNXA 1PK7A 4CMHA 3PZRA 3H13A 3IIEA 4R1QA 4JXXA 1K6MA 3RKSA 3PR2B 1WSDA 2GEJA 3G82C 4KACA 3U3OA 3QBDA 2J4CA 5EP2A 4RY0A 3ZWMA 4B6JA 3MA0A 3P9SA 4NZPA 4U3JA 4GI7A 4BASA 3GEEA 4E09A 1FMTA 1YT5A 1LQUA 2A14A 5DBIA 1BCSA 1PIWA 5J4YA 1LVGA 2IHNA 3TH5A 4FEEA 1EUDA 5TMDA 2YDXA 3R09A 1CHDA 3QJ5A 1KFEB 2V6FA 1G42A 4XR4A 7AT1A 1DBVO 3IQZA 3G1UA 1XZFA 4XWYA 3W5VA 2Q3FA 2C4MA 1KP3A 2CDNA 1VE3A 1ZN9A 2Q0XA 1R6AA 1P5FA 5HX7A 1IN6A 1I3OA 5BPFA 4ENRA 5EMKA 1N0WA 4IVPA 3VU0A 3W06A 1A9TA 4OGGA 4FLEA 4D9FA 1GNVA 3L79A 2X2FA 1SKBA 4JWKA 4AYWA 4EY3A 3T3PB 3TLEA 3AVXA 1L4EA 2Z04A 3MWDB 4Q21A 3PVSA 1GTSA 1Q0ZA 1UC8A 3L0ZA 1U3WA 3G9UA 4HDRA 4KQXA 2BAGA 3DXZA 1TW2A 2IHTA 2X22A 1Q2UA 3D3WA 4PLFA 2R65A 4M7OA 2W2KB 1KVQA 4LYJA 2W70A 1FFEA 1XVUA 3MC1A 1Z7EA 1I1QB 1U2EA 3A4NA 4KVGA 1UBMS 2W5UA 4P80A 1Q11A 4RS3A 4TYQA 5J59A 1LS6A 4QXAA 2FWAA 1U98A 3QXCA 4D25A 3RR2A 2EL7A 3HYNA 4LJ7A 4AG6A 1FYVA 4UCXA 1FFWA 2ZZMA 1GVNB 1GYQA 1HTBA 1M6WA 3KTAB 2RC6A 4RMHA 1L5KA 3MJDA 3ILVA 4HLNA 1AKVA 2ETVA 3CLKA 1JIIA 2VYFA 3S1AB 4AUMA 2A0WA 4R01A 4E1VA 1XMQB 2C82A 3GYBA 1DQSA 1VKRA 4NPHA 3BVPA 3DL0A 3O7WA 1EA5A 1IN7A 1JEAA 4JJKA 4LTMA 4UU1A 5ENZA 2EDAA 3AV3A 3ETJA 3DBLA 3NBZC 1HT0A 3SXPA 4FMCF 2QX8A 5AVWA 1QB8A 5BP7A 2X4GA 2XMDA 5BMVF 1C7EA 4Y2JA 3L8YA 2NGRA 4OXNA 5DRTA 1CRLA 5A62A 2KM1A 1ZD1A 3SQWA 4L2IB 2CC2A 1B8UA 4O2BB 2G28A 4UHKA 4FFLA 4KQFA 3ISJA 5KTMA 1AO0A 1WXXA 1YJXA 4B3XA 4KAJA 4G0YA 4C5CA 3G13A 3A1NA 1HQDA 4RFSB 1P0PA 4N9WA 1JBEA 3Q6NA 2HU7A 4BMSA 1DQYA 4OKSA 4P3NA 3OOWA 1O3YA 2B2XA 2PNFA 3GFTA 2GEVA 3FFXA 3WGIA 5CT6A 1WSAA 4BUJA 4CM7A 4W6ZA 2XA2A 3DDNA 1TZJA 2JHFA 4ZQCB 3PHJA 2BW0A 4MOWA 4K9MA 2C2WA 1EB8A 1CE8B 1LFDB 1QO9A 1CUWA 2A88A 2CZCA 4M8NE 4E2YA 3QXXA 4IIJF 1U7ZA 1KO7A 2OHVA 3RS0A 3IA2A 1B6TA 5I4IA 4Z9BA 2VJNA 5THKA 5KX5F 2NAFA 4DJFC 3TLYA 4J3NA 1GP2A 1UK6A 4OP2A 1C7FA 2NTYC 1FP4B 4O63O 5CB0A 5C31A 4YRLA 5JPIA 3BHNA 3LO5A 3X1MA 2A2ZA 3HVUA 5BN5A 2I87A 5F5NA 1D2NA 4U0JA 4KAXA 1KERA 2W6OA 1RWQA 1R15A 2R6ZA 2WUGA 3P2KA 1M2KA 2WZDA 2VYQA 1T3LA 1XNJA 2WU0A 3QHQA 4K8RB 3RABA 3CZMA 4HUQA 4EEXA 2BLNA 4UHJA 1KK1A 1UBGA 1ZEJA 1LBIA 2IEGA 2RHOA 1T5OA 4QJBA 3GT0A 1EZ4A 3KCNA 1OC4A 3MK31 5FLEX 4CLRB 1IZ0A 5BSEA 5GINE 4CKBA 1CVLA 2GX6A 3EOBI 1BU8A 3U9TA 2AFIE 3PQ2A 1DUSA 2PMEA 1M6VB 4INOA 4RD2A 1E1QD 2BT4A 1E20A 2XKJE 3TEFA 5IKXA 6GPBA 2A5GA 1K7FB 2QD1A 3OLZA 3EF3A 3LC0A 3SC4A 1JIJA 1FTWA 1Q0UA 2IJGX 3BBPA 3QVJA 1C81A 4TXLA 3L7OA 2GNPA 2IFTA 2I8CA 2Y0PA 3I4FA 4QGBA 3RUEA 5I6DA 4RH3A 4WLOA 4D8WA 5JFTA 4GKBA 3QU5A 1NN5A 4OI1A 4PY2A 4NZ9A 1X39A 1CG6A 1P3DA 3AVUA 3U3DA 1UWCA 1BFKA 3HMQA 1G66A 3K0CC 3NG1A 4IV8A 5CVCA 3UO8B 4HEJA 4Q39A 1D6SA 1UBJS 4TTRA 2BCGY 2CVFA 2HAEA 2HDWA 2XMGA 1GGMA 2WIKA 1GSIA 4E1BA 2C2OA 1C29B 3GJ3A 3IO5A 1ZOOA 4WXHA 4UCFA 2Z5GA 2OGUA 5AXDA 2HN9A 2JJ1D 3QX8A 4AN0A 3WP0A 3GLGB 5FFFA 4IIBA 4MVCA 2IYFA 3RYHB 2XE4A 3FB4A 1JPUA 4YONB 4LE0A 6ADHA 1SUEA 4IMIB 3H8VA 3CRZA 3ZU6A 3A1FA 2D1QA 2OB2A 1I9GA 2X76A 4RY9A 1OX6A 5EYPA 1LBEA 3DD5A 1X8KA 4U1RA 1HYEA 2Y4NA 4ABTA 2IYPA 3L84A 1F7VA 4HB3A 1AUVA 4TT3D 1ZP6A 2EF0A 4M9UA 3NRJA 1DXHA 5EUMA 5EZYB 2JCSA 3D4PA 1P1JA 5CM8B 3ELWA 2BEKA 2O23A 2PBFA 3JQGA 1IWBB 4NY1A 4AY6A 5FLYA 4U7HA 1DV2A 3OA0A 4ASUA 4Q3BA 4UFNA 4I1OA 4N6GA 2HCTA 3BKXA 2HZBA 4QUJA 3C1TA 5L7WA 1IFXA 3MQ2A 4C1BA 5A04A 3G88A 1OTXA 3H05A 3KEFA 2ZB2A 1CNEA 3KVNA 2B21A 3GZJA 4DR3B 1MV8A 1NYLA 1Z88A 2R6GA 2CFTA 4G0ZA 2YIDA 4I5GA 1CRWG 4MH0R 4ALIA 3OT5A 2QD2A 3MTIA 4EP1A 4OHFA 3DAYA 3EPLA 1XPOA 4EY5A 1T4CB 1O0CA 2WPDA 1XCGB 3WWOA 2DPLA 4E2WA 4EEZA 1EBBA 2H6EA 2IY9A 3HCRA 2JGDB 2GN2A 4DRYA 4BAGA 1NOKA 1Z13A 5TGZA 4EHNA 2PL3A 4DMCA 1EP3B 2X0KA 4EYGA 2WQ7A 4NFSA 3EXFB 2HUNA 2EDCA 3C3BA 4P35A 2OK8A 4PZEA 1PP4A 3VR4A 4B79A 5KNBA 5KYWB 3KSUA 1F2TA 4WZBA 3L8DA 3M89A 4K0RA 4XEHA 2YHSA 2EJCA 2Q6KA 3G59A 4J1TA 3E8SA 2WKWA 2BKEA 3QJYA 3OZIA 1KAHA 5G0UA 1W25A 3ZNQA 4DA9A 3TAUA 2HADA 3U7HB 2HMTA 2W58A 4R0NA 1EFRA 4UBNA 4AKSA 4JLDA 1KZ1A 2I3ZA 4HPJB 2VS1A 1L5YA 3OQIB 2J1LA 1XZPA 4CGYA 1Y5LA 4UQLA 2HNAA 5CLIA 3SEQA 4OQPA 4U7TB 4NS1A 2D2VA 5EXPA 3GEMA 5DWDA 1PKXA 4G65A 5F9HA 3QLUC 5T6BA 1FDTA 4NZOA 4BZZA 1Z6PA 5EHIA 3HJTA 1UP6A 3D5EA 3UQZA 5FOVA 4Q4JB 4F4FA 4XVCA 3H99A 4WH0A 3L40A 2ZYHA 3T7SA 2KB0A 5ED0A 4ZO4A 4R0VA 1NIJA 2QQFA 2WWTA 4L08A 3K9WA 2DUMA 1YKFA 3UGQA 2RCNA 2Q8NA 4C03A 4MPTA 4DIDA 4YP5A 5I5EA 2V7QD 1AO3A 1M2NA 4AFNA 5EIOA 2O57A 1KI6A 3R7SA 4DUGA 1Z6QA 2QM0A 3OX4A 4RZ3A 3EZYA 3REOA 2QL9A 2P90A 4EI8A 5KYXA 5AVRA 2G09A 2YV5A 4K6CA 3FNFA 1VHJA 4IIXA 1T8SA 2VQFB 1ZXLA 3IAHA 3T38A 4D43A 1DBWA 1FF9A 4C0XA 2Z2IA 4AF7A 1O57A 4U7GA 3ZE2B 3BC1A 1SXQA 3OY7A 5AKEA 1KDOA 4Q16A 3PE3A 1XQ9A 3F73A 2HQOA 2R7MA 2ERXA 3WQHA 1QVWA 1PX2A 3DMHA 1UXKA 3U3JA 1EGMB 3CF2A 2JL1A 3AXTA 3IXMA 3JSAA 1YR2A 2AK2A 3OICA 3X0DA 1XL1A 3MLAA 2OT3B 5ALRA 5THXA 3EVNA 4HQKA 2II6A 3BA1A 4HRXA 3UGTA 1E9CA 4Y1FA 2EP8A 2Y1WA 1UADA 1GITA 5BSMA 4X20B 1LVUA 4WA8A 1ONSA 5H3CA 3GVCA 1E6UA 4MLZA 4NU5A 4JB8A 3C98A 3WV4A 4WZBE 4FFSA 3NYRA 1EE2A 1G5QA 3JV7A 2D3WA 2ZSDA 2XT6A 4G2NA 4ZQBA 4PFQA 1B43A 1B6SA 1IQ0A 1OI3A 4WXEA 1NV9A 1DEAA 1DNPA 4F97A 1FW6A 2F3TA 4JGBA 1LK7A 4JI0B 3BXXA 1L2TA 1HTTA 3COWA 4NYMR 3FVRA 5A5DA 3AJ8A 5I7OA 4HWKA 1GT91 2PKXA 3WWYA 3MMZA 2OCGA 3D5QA 3QUCA 2CNOA 4ZU6X 4ACAA 2GPBA 3K6KA 3I05A 4LZJA 2KPOA 2QTHA 4O0LA 4XB6B 5B6PA 4QFBA 1LRKA 1E32A 3ANXA 4GAEA 3EQZA 4ER0A 4F8JA 3JYQA 1NF2A 1S02A 3LLMA 2OPHA 5K8JB 5KNDA 3NFRA 2CBGA 1E6CA 4GI2A 2P78A 2BSQA 1N2EA 1IQUA 3AIIA 2V8BA 2FSFA 3WYBA 5CD1A 3I72A 2BFPA 5J1TB 4D02A 2B4YA 3OZWA 2WI8A 1L4MA 1CIJA 2ZP1A 2PD3A 4DXAA 1DC5A 2IUYA 2IW1A 2F1OA 2C5LA 3GJ5A 3MJTA 1XZJA 3DAFA 4NENA 4NYMQ 1N33B 4C7BA 1JNYA 1EJBA 4BCCA 3A6DA 3KB8A 3T5AA 3EUAA 2WSSA 4NYJQ 3E81A 1OH8A 4F3RA 3WNDA 4J3JA 3BSYA 1WEKA 4YYEA 2IRWA 4CW7A 3D02A 4OJKA 3E9ZA 3LCJA 3TLZA 1NPYA 1R4ZA 1U1IA 3SYTA 3RDPA 3E18A 1Q0HA 3FMGA 4RX1A 3R44A 4CM1A 4R8MA 2I4RA 5KKCA 4L5CA 3QVGA 4AZ0A 5D6OA 1PJZA 3VNQA 3HGMA 3B89A 3IAM1 4ZZ3A 4BJHB 5AM1A 1F5SA 4JT8A 2OGWA 1UT8A 1EHCA 2OVFA 4IFTA 4MQEB 5CBPB 5KVSA 2P9YA 3HBAA 2LUOA 2CDBA 3GJRA 4OU4A 2KBEA 3UXMA 1N7JA 2SKDA 3GJQA 1ZJWA 1GQQA 1KPHA 4MJLA 3H4TA 4S05A 2GXUA 3EFOA 3EPRA 4XVUA 4UARA 1PJAA 1T6ZA 2I65A 1AG9A 1HYGA 4IH4A 2G40A 8ADHA 2BBSA 1Q95A 2FZKA 7MDHA 1NT4A 1MAAA 1CUBA 1E2PA 2KX7A 2V9ZA 5JMPA 1X14A 1NBEA 5DDIP 1UPAA 1PNOA 3DZHA 4JC4A 2YUTA 4AAYA 4C0LA 1CF4A 1XTVA 1Z4LA 2VAMA 2W2LD 4GPAA 1U0BB 3MJSA 5IHPA 2HJHA 5E6UA 3RVJA 3U4CA 4KWCA 4LHWA 1BQEA 2ISSD 4JZYA 1PWXA 3VVCA 2H08A 3AGQA 4G4IA 2LKCA 2QR3A 3AV0B 4G56A 5IS2A 3ZPXA 2YIJA 3P4XA 4EGAA 4LJAA 3QOYA 4YMUA 3U44A 1QIKA 1JHVA 5E6SB 5B1SA 3EW9A 3ZDDA 1RWVA 4B3BA 4C7VA 1C30B 5G41A 2AKYA 5IPFA 3HLKA 3IAXA 4BQIA 3KXDA 1VYTA 5GONA 5K0CA 4ARCA 3N0XA 4V0SA 3WK8A 5CYGA 2CCJA 4QDXA 5F52A 1OV4A 2J41A 3F97A 3N7UA 5F4BA 1WR8A 3PPXA 5KEIA 2FN3A 1QB7A 2ZYUX 3GFQA 3THYB 3BJZA 3I2KA 3KJFA 2ZVJA 3BQ9A 3S2ZA 1T6YA 1F2DA 1U5CA 2G71A 4JL5A 4RENA 1IHXA 1SUIA 5H80A 3MGAA 4WQMA 2DQ4A 2NO5A