2YNMA

Structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
ALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Adp-Aluminium Fluoride-Stabilized Protochlorophyllide Oxidoreductase Complex.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Oxidoreductase
molecule keywords LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ynmA00
1OXUA 1OIVA 2B6HA 2FZ4A 2LCFA 2CK3D 2W6JA 1FW6A 4AI6A 4JMPA 5AK0A 1MO5A 4R7ZA 2F3TA 1UF9A 1Z6XA 3M6AA 2PLRA 2A9KA 5DGXA 4D0NA 1W4RA 3OF5A 4JKYA 2WPDA 4EPYA 4KFSA 1G3QA 2C9OA 3KDSE 1FL9A 1WF3A 3OE7D 5DISB 1CLUA 4JYBA 1SGWA 2EFDB 1KK0A 1NN3A 2F1RA 4ZIRB 4Q5IA 3PCRB 4A8JB 3MGCA 5FUXA 1LB1B 4FD2A 4Q01A 1E9CA 4LHXA 4DIEA 2CE2X 3K1JA 1A4RA 4G5SA 5J4VA 2J87A 5JI3E 2OCBA 1U99A 2F9LA 4X8MA 1E2KA 2A5JA 4TL8A 4GOJA 2GAAA 2OCYC 2WIAA 1G17A 5FUVA 1M8PA 2IUTA 1GL6A 4RD0A 4NYMQ 3AV0B 3AGPA 1ANKA 5EQTA 2N42A 4KAXA 3W5IA 4EQ6B 3CIOA 1F60A 3FFBA 1L2TA 1R0YA 4DVGA 1OHHA 4JLDA 1DAMA 1VG8A 1HE1C 2PEYA 3U6KA 1P3JA 2UZIR 3RC3A 2AKYA 3QSYA 4V0MA 3BORA 3EX7C 4DLYA 1XPUA 2WHXA 4FWIB 1JR3E 2C9CA 4DUGA 3WP0A 4XWKA 3GPLA 1ZC3A 1J8YF 4GZLA 4JLKA 4PO9A 4BECA 1J7KA 2ZQ5A 5SZJA 5L3SA 4IXNA 3FE2A 1WBBA 3IHLA 2B7BA 3AQ4A 4Z51A 1CP2A 2FE4A 4Q1EA 1JPNA 2Q3HA 3LXXA 4FN5A 2F3RA 4KSBA 2HYDA 2RHMA 4RD3A 3ZVMA 4CT4B 1RFLA 4DLXA 1CJMA 4EFMA 1E6CA 2NO6A 3NWJA 1PUIA 4DT1A 4B3CA 2AFIE 3GEIA 1N3BA 2PZGA 3RS4A 4B3FX 4LPSA 2GJKA 4TMTA 2IYZA 3NDPA 5AJWA 2ZM5A 3B13B 3K09C 4K46A 4DLUA 1U90A 1VG0B 2A5YB 2GZHA 2OE2A 2ZS7A 4DZZA 2DFLA 4R71A 2PZEA 2F7SA 3TE6A 1XJ0A 3T34A 4ZCLA 2ZR7A 1JQLB 1FQJA 1O3YA 3B2EA 3BE4A 1NJGA 1F48A 1UDXA 1VHLA 4M2LA 3ZD6A 1BMFA 4AKHA 4MUBA 4WXPA 4CZ2A 5KU1A 1KI1A 1WXQA 2GVDC 1VECA 4TL6A 4TT3D 4HUTA 2ZYWX 2IYQA 1GKIA 2W0MA 4F7WA 2G83A 3T1VA 3CH5A 3X1XA 2PBRA 4D82A 4H1VA 1N6PA 3VU9A 1NN1A 1P9WA 3VNVA 1TQDA 4JLBA 3SQWA 1G16A 4EIWA 1OW3B 4QJ4A 2ZXUA 3CRQA 1KOFA 4QL3A 2AK2A 4AD8A 3I32A 2GEVA 4LDJA 1JXOA 1K6MA 2VYFA 1ZM3A 5J4KA 3L82B 2O8FA 5DYIA 4A2QA 2GETA 2XJ4A 2CHQA 4KVGA 3RS2A 4BFZA 3VKGA 1JR6A 1D9ZA 4AURA 1ZIPA 5JLJA 3CRRA 2EVWX 1KMHA 4TMKA 5GJBA 2V54A 5CYPA 3P32A 3TUZC 1AN0A 3B78A 4LBYA 4YC7A 2JATA 1WE2A 1EFHA 1SVMA 4L8GA 4RD1A 1HQYE 5B30A 1T3SA 1XEWY 3FFAA 4YXWD 1G8PA 1SXJB 5J47A 4AKGA 4BFWA 1COWD 1MABA 3KUCA 1LS6A 1IM2A 3VX4A 3RANA 2CEAA 1SVSA 4HZUA 1EK0A 4JJZA 1W4BA 2JLQA 4EQ6A 4F92B 2PZFA 1W4CA 3WBKA 1W0JD 3AM1A 1CR2A 5KUTA 2D62A 4QGFA 4OQLA 2VF8A 1Z83A 5FOWA 2IL1A 1OYWA 2IS4A 2ZU6A 2G88A 3CF2A 2VP4A 3S1AA 2GK6A 4JLJA 2EWWA 1CF4A 4MDFA 2A5GA 3ADBA 1X8JA 1P2SA 1OFIA 2YYZA 1IJEA 2QTVB 1TQ2A 1G19A 3O8DA 1Q0UA 2HXSA 1Z07A 4II7A 2XTNA 2OAP1 1Q1BA 1WA5A 3UMFA 4A0GA 1OH6A 1OFTA 3LD9A 3X1DA 2HJGA 5FOSA 3FKQA 2ZJ2A 4CYMA 1YZKA 2V1UA 5F98A 3RDPA 1Z63A 5FL7A 1L4UA 2WSMA 4MH0R 4RKEA 1Q12A 2QRZA 4LBZA 3EZ6A 3X1ZA 5HZHA 1IAQA 3R8CA 5HKKD 2AR7A 2YVUA 3A1UA 1KGDA 5JHHB 1UKYA 2DPXA 2BMJA 3U3KA 4BFSA 1M74A 3REFA 1JI0A 1VCOA 4HDCA 5LD2B 4GZMA 1CIPA 4CRWB 4UQOA 4B2IA 5KNBA 4H1UA 3MJRA 2W6JD 4M9QA 2IEYA 4A0RA 3X1YA 4BLRA 4DCVA 5EUMA 4NYMR 3QKRB 4N1AA 1FZQA 2LKDA 2G9NA 4AKIA 1KO8A 2VIIA 2BOVA 1ZCBA 3PVSA 3KXLA 3U5ZB 3KJGA 5EE0A 2QZ4A 2OUKA 2KI5A 1YZTA 3E70C 3AF0A 5LDDC 4B76A 3NG1A 4U5XA 4MRRA 3LX5A 2WOJA 3F3YA 2CNWA 3GLGB 4PQYA 4PSVA 1KI7A 5J4LA 1XMJA 3D8BA 4A1FA 2CL6X 5KPDA 4PC3A 3AVUA 4IOJA 4R98A 4DXAA 4Z1MA 4GT1A 2ZS9A 3L43A 5CIQA 5HR5A 3E5HA 3UG6A 3MCAA 3FGNA 1AQUA 3DOEA 4B32A 2C99A 1Z2CA 3R9WA 1NY5A 1W36B 2P3SA 4HSEA 2DBYA 2R6CA 4P32A 2VL7A 3W9YA 4M8NE 3BH7A 4BFTA 1W36D 1Q1QA 2CL0X 2VLIA 1QHGA 2ZJAA 2GEUA 1QHHB 4O0MA 4IVQA 4HAVA 1E2FA 4TLAA 3R20A 1W5TA 3Q7QA 1W47A 3PITA 4RZ3A 2GBLC 2OZEA 3QEOA 3WMGA 4N0DA 1NKSA 4U02A 1G291 5CM8B 1JALA 1XD2B 2XTMA 3NKVA 3IHWA 1OH5A 2CJWA 1II0A 2GCPA 3LFUA 1AKEA 4XIGS 2V55B 1N5IA 2NG1A 4C0AC 4WXRA 4B3GA 1KDOA 2WTUA 1G7TA 4LHYA 4RJLA 3FKSD 4FCWA 5FPKA 2D4HA 3P4XA 2VP2A 3WY9A 5JS7A 1AZTA 3ZZTA 1XD9A 3GJ4A 5JEDA 1TUIA 2W2TA 4TLDA 3WBJA 2CBZA 3PENA 4QBIA 4DHEA 1SQ5A 3BGWA 3GFTA 5JZVA 4GRAA 1ZNZA 2BJVA 3IIJA 5KYKA 4M9ZA 3LW7A 1P5ZB 3E2IA 1UAAA 1SKQA 1NLFA 2ANCA 3FKSA 3CX8A 1G4UR 1W36C 1Z29A 4EPVA 5H8WA 2ZUDA 2QAJA 4MKFA 1U0LA 1KKLA 1XTJA 2QM7A 4BLQA 1E0AA 4TSFA 1RRCA 1IBRA 1KJYA 3D6TB 3VR5A 5B58C 3AVTA 1KI8A 1T8UA 2G1KA 2IUSA 4O2LA 1AGPA 1NVVQ 2J41A 3CUEF 1E32A 3J81k 2IWRA 4JBXA 4RZUA 2GILA 1AA9A 3WRXC 1W0KD 1GKYA 4B75A 4TYWA 3GCGA 3JZAA 4JZKA 1GNPA 3ADKA 4K8OA 4B6FA 3U4QA 1GDDA 1YKSA 4HB4A 1II8A 2GNOA 1OF1A 3B82A 4M4SA 4ZPXA 4WW0A 1PLLA 1UDWA 3B1XA 3K9GA 4IOMA 1G4AE 2BDTA 2BMFA 3CH4B 3B8HA 1LVGA 1NN5A 1TUEA 3THYA 3BH6A 1IXSB 3H1TA 5SZHB 3PJRA 5HE8A 3GJ3A 3QF4A 4HLCA 4OBEA 1SVOA 2R6AA 3DMDA 3R8FA 4V0NA 1NI3A 1N6HA 2QAGA 4A6XA 2J46A 1G9XA 2YINC 4P0TA 3RC8A 4LBVA 4BGDA 4MQBA 4I1UA 2ASEA 1ZC4A 5UKDA 2FSHA 2WBLC 4RZ2A 1W4AA 2QORA 1E2JA 1EFRA 5JWOA 1KHTA 2OLJA 4DEYA 3KFXA 1KJWA 2B8TA 3SHWA 2QAGB 3QBTA 3UXMA 5AUPB 3GEEA 1U9IC 3BERA 3AP3A 4TTRA 3QXJA 2H7VA 1QF9A 3HWSA 4LYFA 4A2PA 1YJ5A 3MUFA 4ZDIA 2IYLD 3AKEA 5JWRA 3AVWA 5EXPA 2QP4A 4WZAE 1N0UA 5JWHA 2BKUA 1R10A 4TQUS 2O8DB 1QG2A 1E0JA 2KE5A 3SJBA 5EXXA 1LNZA 1XEFA 2ZRMA 2NQ2C 4MITA 1P72A 2A3RA 4B47A 4JVNA 2GJ8A 4UJ3A 2ORIA 2RGBA 1M2OB 3ZYCA 1HURA 2BV3A 5J4HA 1P75A 4TWZA 1ONBA 4D0GA 2ZRHA 1UEIA 1P2TA 5JCPA 3AB3A 2EYUA 2C9YA 3EZ9A 5BN3A 3EPHA 3CB4A 3QG5A 4OQMA 2A7QA 3SJZA 2XB2A 2XZPA 1H8HD 4B3DA 4W5HA 2ZYUX 3LLUA 4BLPA 4GOKA 2PT7A 4I1SA 4DB2A 2MSCB 4TYPA 1COWA 1S96A 4B74A 4PANA 1EXMA 2QTHA 1NMYA 4YXWA 4B44A 2QPAA 4PHHA 3TH5A 2OFWA 1E9SA 5FTLA 3FB4A 2QUZA 2WJYA 1DBSA 2NPIA 2B8WA 4TMWA 2ZANA 1MOZA 4LHZA 5DHFA 3OEHD 2BIFA 4XD7D 3L0OA 2NO1A 1K8RA 2IC5A 3TUIC 3DVLA 3MFYA 3AF2A 3GJ6A 1XCGB 2O0JA 3BOSA 3N2EA 1OYYA 4RCYA 4RZXA 5GJWC 3LNCA 5L3VA 4YMSA 3KKPA 3B1VA 3W8NA 3C41J 4IJMA 3HU2A 1Z5ZA 1SULA 2QENA 3K0CA 1L4YA 4Y0VA 1XD2A 4M9XA 5CITA 1JQJC 3CM0A 4CDGA 2GZAA 2WKQA 3FHOA 2IHYA 1XTRA 1DAHA 2OEPA 4A0HA 1CR4A 2W2XA 2OBMA 4RD6A 1XDBA 1R5OA 3B85A 4MKIA 3T12A 4GP6A 4M1MA 5EP4A 3RRYA 3TAUA 5F9HA 4AY2A 2QM8A 2ZSAA 2GZDA 3M0EA 3FMFA 4PPFA 3LV8A 4C0JA 4LGMA 1QDEA 2NO0A 2QN6A 4HYYA 2CVHA 1A82A 4GPTA 2W58A 1KI6A 2R65A 2X2FA 1P61B 3NEJA 2GKSA 3RWMB 1RRPA 3PR1A 3B1ZA 4TT3A 2QMEA 1IONA 1RRFA 1PV4A 4OHXA 2H17A 5SZIA 4ASUD 2WV9A 2IXGA 3N70A 3A4NA 4URWR 4IDQA 3BBPA 1NL3A 1Z0IA 2ZIAA 3IBGA 4W7SA 1XMIA 4GSYA 2ZSFA 4Q9HA 4AC9A 5G40A 4BFYA 4ZO4A 2IK8A 2Y8EA 4Z1MD 5H1YA 4BPBA 4MUAA 2FGKA 2X19A 2J59A 2NO7A 2JLWA 4LBWA 2ECKA 3ZQ6A 2HYIC 2O8DA 2ZREA 3PIRA 4IDOA 1GRQA 3G82C 2Q21A 1S1MA 4PQRA 1XTSA 2X1VA 4ACAA 2ZEJA 1X1SA 1FQKA 1OHHD 4HATA 1IJFA 2QAGC 1OPXA 3CKLA 4TMZA 4PXAA 1NSTA 2H18A 1VIAA 2RMKA 4JVSB 4Q7JB 3WHKA 4B48A 5DH9A 3T5GA 1C9KA 4LPKA 1X1RA 4WOPA 1GILA 5KDLA 1PUJA 3I62A 2ODEA 4YMWA 3GFOA 2R6FA 1U98A 2AHOA 5EJEA 3T5DA 2ZI9A 3RYTC 4V0ME 2GHIA 4LJ5A 5JSZA 2I1VB 5JI2E 2V3CC 2ZJYA 3F8TA 5FI0B 4QJ3A 1AJEA 3AEZA 1KSHA 2D06A 5C4GB 3UMSA 4PC2A 4HB3A 1KI6B 2GXUA 1T91A 5C2JB 3DO6A 4B33A 2GCOB 1UJ2A 2VP5A 1R0ZA 2JCSA 3AKDA 3CPHA 2C77A 3Q9LA 3QF4B 4AG6A 1Z0AA 3B1WA 3RS0A 2WWFA 2RAPA 3B9QA 4PPGA 2EWVA 4KLNA 1D9XA 4CW7A 1TQ4A 3AGQA 3BH0A 3GJ7A 4YDSA 1CEEA 1U8ZA 1P2VA 2FNAA 1GRRA 4LX0A 1KAOA 4ITRC 2QL6A 5CK4A 2WJJA 3P1JA 4I4LA 3CR7A 4KBGA 1YQTA 4KYIB 3QPVA 5FPTA 4M1TA 1K5DA 3MJHA 5CM9C 2V7QD 4HZIA 2KB0A 4DWJA 1UBFA 1U8YA 2HT6A 4NZYA 3SR0A 1E2IA 3ICEA 1U9IA 2V6JA 1SXJA 3NBXX 1XZQA 3KB1A 3B60A 1D6JA 2REBA 1E99A 4MRPA 5KDDA 4M0LA 3FOZA 2G1JA 3H84A 2W6ID 3KQUA 4FCVA 1I4DD 3F5FA 4BASA 1ZW6A 1Y63A 1DEKA 3NBZC 5JECA 5ELXA 5KOYA 2UZ3A 2ODWA 2A5FA 2AD1A 4S35A 4OI1A 3DOFA 4HAZA 2XB4A 2PH1A 2R9VA 1XX6A 4UXIA 3PV0A 3A36A 3KX2A 2CDNA 3SE0A 2N1BA 2FX3A 1RW4A 3NTUA 5SZKB 4NYJQ 1XU4A 2CHVA 3KTAB 5J4YA 1IN8A 1EX6A 4PPQA 2KWIA 5JS8A 2OFOA 3A6PC 1E2PA 4PHGA 2QT1A 3RNLA 3L8ZA 1E96A 4B3XA 2ZR9A 3V4FA 3IILA 2GXAA 2ZROA 2XOKD 2O0KA 5TXGA 4DLWA 3AVPA 1GOTA 4XVUA 3NH9A 3T06B 4ZDWA 3DDCA 2IYRA 3VKWA 3PQCA 2P2LA 4YMTA 5KSOA 3U44A 2HXYA 3D31A 3ZVLA 1OXTA 5EE5B 1N5LA 2J45A 2BBSA 5G41A 2FDCA 1I2DA 2GK7A 4M1KA 4FMBB 2IF2A 2IXFA 1DOAA 1VG1A 3WMEA 3BIFA 3HYRA 1GNRA 3I8SA 4QOSA 5AJZA 5L3QB 4JLAA 4PO1A 2EFGA 4HEJA 2XOKA 4PTLA 1HH4A 1MH1A 3ND8A 3A58B 2R6DA 4F4IA 3K70B 1OJLA 1G6HA 2I3BA 1QHHA 1W0KA 3P20A 5CJPA 1RIFA 2GF9A 2ZRPA 3OIUA 3L0PA 4RCZA 4S2EA 3I3SR 1GL9B 2ZRAA 1W2HA 3EARA 1NJFA 3AF4A 3NHAA 3F0TA 1DTSA 2H16A 4CVNA 2FWRA 5L3SB 1CRQA 4IFEA 3ZS9A 1C4OA 4Q1AA 2ATXA 3D3QA 4DKXA 1WDTA 1IN4A 4W9MC 3KQNA 1JAIA 4LC1A 4C30A 3VNUA 3JVUA 1NMZA 2IYUA 1AIPA 1Z0FA 3EZFA 3KB2A 4RY2A 5HTKA 3LA6A 5FL3A 3RVBA 2Q3FA 3LBIA 3SBDA 3REGA 2FFHA 3AUXA 1G3RA 2VP0A 2FU5C 3DZ8A 4E22A 1QVAA 5G53C 1ZD1A 5EE3A 3RAPR 1BO6A 1EG7A 3QY0A 2ZTSA 4PC6A 1VIYA 3PUZA 4KU4A 1SZPA 1R6BX 2W83A 4DDVA 4EFNA 1J2JA 2CK3A 3HR8A 4N0EA 3TUJC 1U0HC 1T0JB 1G7CA 1E0KA 1U81A 3IPYA 3QKRA 3RHFA 1VMAA 3CX7A 4UNSA 4ZDJA 2C98A 3U4QB 3KKOA 3QUSA 2C03A 3Q5DA 4E09A 1X86B 1DAGA 4MYUA 3BB1A 1F2UA 4LI0A 3SYNA 3ZZUA 1Y3AA 3EXAA 4NCJA 1JAHA 1P9RA 3VTKA 1OE0A 4LYJA 1IN6A 1GVNB 1Z2AA 2HLDA 3LVRE 4PZLA 4B34A 1Q3HA 1NNEA 4LJ4A 1ZNWA 3GLHB 3O47A 1KSGA 5CK5A 5LPNA 2ODNA 4MYHA 2HF8A 5FL7D 3BJIC 1XPRA 2JDIA 1P60A 1R7RA 1ZU5A 1E0SA 3GJXC 3I5YA 2BM1A 1F6BA 1OV4A 1UKVY 1FMLA 2RGNA 4A4DA 2Z4RA 5JJLA 2DR3A 1QHNA 2FPMA 2WPDD 4IFBA 2O8BB 2TMKA 5F9FA 1TEXA 2QA5A 1S3GA 4PC7A 5JJKA 2VEDA 1ZNYA 1M6NA 1N6RA 4FMCB 4MYCA 5JRZA 4B3BA 1VHTA 2WJGA 5AWFC 1YRBA 4H9GA 4YQFA 5HCNA 1I2MA 1HEIA 3IO3A 3S1AB 5TY0A 2GCNA 3GJ0A 5AJVB 3K0EA 3IBYA 3TQCA 4EUNA 5DE3A 3W5JA 2Z5FA 1M7GA 4W5JA 2JLVA 2QE7A 2NPFA 4G5RA 1LTQA 4Q4AA 4AG5A 2B21A 3I73A 1OIXA 3FVQA 4HZUB 5CLQA 2Q0HA 3QIAA 4QNMA 2BCJQ 3GD7A 2L0XA 5FBWB 2CJWB 3NIBA 4RKFA 5D3QA 1G8FA 1GITA 2FPLA 2YC2C 4ARZA 2ZRGA 1WCV1 4JSTA 1KDRA 2ZRJA 2QY9A 4OK6A 2I1QA 4XD7A 1E9RA 4C0BA 2GXSA 1BS1A 2QTFA 4ASUA 4IHQA 4U00A 5EE1A 1S4QA 2VF7A 3PUWA 4X8HA 4XVQA 3TVTA 5CB8A 3CF0A 3KKNA 1RJ9A 1QHIA 1R2QA 4F93B 1ZM4A 1S9DA 1Z22A 1GNQA 2FN4A 1SKYE 3THXB 3HPQA 1KKMA 1AQYA 1XXHE 2FEMA 2Q6TA 3U2QA 1ZM9A 1H8ED 2E87A 3ZQJA 1NF3A 2DCUA 3I1FA 4XVRA 1NLZA 2XSZA 4GP7A 3QKTA 2IW3A 4MGZR 3X2SA 1GKUB 1G8GA 2IYWA 3IGFA 5FOVA 4C0SA 3P27A 2WJHA 3SQXA 2ZAOA 4XSHA 4LHWA 3WYGA 2BC9A 4BRUA 4FMDF 1QRAA 4V0OA 1BKDR 5C1BA 2RCNA 4CGZA 4YMVA 4KVAA 4URYR 4C7OA 1AS3A 3VR6A 1FUKA 2ZRLA 1JJ7A 1VCMA 3TIFA 3U3OA 3UWOA 5IT5A 1WB9A 4OJQA 4EJSB 4MGKR 1XP8A 2IF0A 1TU3A 2G77B 3T15A 3SZRA 3ETLA 1XNJA 3MG9A 3TVDA 4LJ8A 4CEIA 1C1YA 1DE0A 1KK3A 1YZLA 2VO1A 4C3ZA 1QHYA 2H1LA 3DHWC 3LBHA 2QSYA 2JJ1A 1E1QD 4GDFA 2PEZA 4NCNA 3ZLJA 3SN6A 2V9PA 1QZXA 2ZSDA 2ZRBA 2CLCX 1F2TB 2BBOA 3BXZA 2O8BA 4JKIA 5D3MA 2O52A 2FGJA 3QEJA 3K70C 4I99A 4NMMA 4Q9KA 3BAFA 5E7MA 2NZ8A 3W90A 1VCNA 2REXB 3W8RA 121PA 2J0SA 4A2WA 4TL7A 3Q72A 1II9A 2V1XA 3MWLA 3GLHA 3CNOA 5EXTA 2JIZA 2P6NA 3QXHA 1HT2E 1WQ1R 5A4JA 5AJYA 1PLKA 5FUYA 3ASYA 3QQ5A 4JT4A 5FPSA 5E3HA 3WRYC 2F43A 4E07A 4ERNA 2A30A 4KITB 5EE9A 3WNBA 1T0HB 3N2IA 4EPTA 1US8A 2FFAA 4OKSA 2HCJB 2V7QA 1GG2A 5BN4A 2G0NA 2F55A 3ASZA 1DAKA 3UG7A 1KNQA 3PEVA 1FNNA 4HUQA 1KNXA 4D4LA 1PJRA 2YWHA 2VQSA 1TAGA 1AK2A 1XJQA 3B6EA 1VPLA 2IBMA 4RFSB 4HDOB 5FTKA 5BWMA 1E1RA 1DS6A 2ZE6A 3V4RA 1T8TA 4GOXA 2JLUA 4DDTA 3CRW1 2OCPA 1G7SA 3OEHA 4ZCMA 1TMKA 2VP9A 1N6KA 2ZSBA 3OESA 3ZIAD 1DPFA 4WIAA 1G21E 2ONKA 2QMOA 2OM2A 5DSZA 3SNHA 2J0QA 2GCOA 1ZD9A 5FR1A 1FP6A 1BIFA 1GIAA 1Z6GA 1KI9A 1F3OA 4A8JA 1OFHA 5H70A 5G3ZA 4NP6A 1Z6AA 1FTNA 3B9PA 1DO2A 4RD2A 4QM6A 4QGAA 1ZBDA 2YC4C 1RC8A 1P62B 3Q5EA 6Q21A 1H8HA 3GJ8A 5JHGB 1Z0KA 2WVJA 2RB4A 2Z4SA 4JLMA 4LWZA 3K70D 3U3JA 1E2DA 5CLLA 3TNFA 1XFAA 1G5PA 5LBIA 3K9HA 2WWWA 3QOFA 2O5VA 3TR5A 1YU9A 3WMFA 4URUR 1ESNA 5KSZA 1CJTC 1E2QA 1Z28A 3FTQA 1W7AA 4DCUA 4LHVA 5LB2A 4TN1A 1W2GA 3O8RA 1Z0JA 1YZGA 3VU9B 3EIHA 4NTZA 4A82A 5KO2A 4FXPA 1UBGA 1IY1A 5H68A 4D4MA 4C2UA 1ELOA 1D2EA 3IQWA 2WICA 1BH2A 2KSQA 4LZZA 2ZUCA 4Q18A 2EFHB 4HAUA 4M1WA 4ZKEA 3A1TA 2NIPA 4JVMA 2PX3A 4A0FA 1Q1ZA 2EW1A 5F3WB 4YDHB 2IWHA 1AGRA 4M22A 3WYFA 4XWOA 2J0VA 3KJIA 2CE7A 1EFTA 3IIKA 2EFEB 4OK3A 1UBEA 1EFUA 2P6UA 1W49A 2X77A 1KZGB 4CEHA 1N6IA 1OB2A 2WSSA 3BFVA 1Q44A 2WJIA 3CRMA 5JEEA 3EPJA 1OKKD 4QJ5A 4LJ6A 3U60B 1Z47A 1R0XA 2E1RA 1R5BA 4WAUA 5EP3A 1DADA 4F4JA 3CWZA 4BZPA 3AF3A 4LC0A 4AK9A 1S2MA 3NXSA 2GTPA 3TSZA 3THXA 2BBTA 1UFQA 2O8CA 2J3EA 1P9NA 2ZYTX 4TLEA 4D6PA 4AYXA 5K8UA 3FPAA 1R8QA 1OH7A 4QFMA 3DM5A 2FZLA 4US1R 1ZJ6A 3PXGA 4BLTA 4NCKA 3VQTA 1HQCA 5B2ZA 4JBWA 2BJWA 2J5XA 4OI2A 4V0LA 1A1VA 3KZ1E 3QF7A 3VHXA 5F2EA 1NSFA 2JLYA 3T1TA 4JVLA 421PA 1YZQA 5TDHA 3NDBB 3CLVA 1ZVQA 3GMTA 2OESA 3I72A 2P6RA 4JLNA 4LRWA 1KSJA 3VR1A 2RGXA 1ZD8A 4QGGA 521PA 4I1OA 4IDPA 1D2NA 1N6OA 2OBLA 1CXZA 2YOFA 2OO7A 5AJXA 2XEXA 2QGZA 2IX3A 1Z6TA 2QP9X 1FX0B 4BZXA 3HU3A 5CDFA 3T35A 3CRVA 2QROA 2O8EB 1U8AA 2OLKA 1QHXA 2HUPA 2CXXA 4BEJA 1XJCA 3B5JA 1S3SA 3GJ5A 4IKEA 3SYKA 3PEWA 2JJ8A 2WIBA 4CEJA 2GJ9A 3MD0A 1YR9A 5EP2A 3LBNA 4ZIRA 3A1WA 4LYAA 2HLDD 3QG1A 1UM8A 3LLMA 2AK3A 1U2RA 5JRJA 4ESHA 1NP6A 4XWAA 2CVFA 3OFNA 4P4SB 2UKDA 3TQFA 4ZDKA 1ZUNB 3FDIA 4Z8XA 2GF0A 4M21A 1IHUA 3A1SA 3LRPA 3QXCA 4TYNA 2WWGA 3GLGE 1OXSC 1ZIOA 3QPWA 1D5CA 4NPHA 5HE9A 1NVXQ 3MWYW 1ZM2A 2BKEA 4Q1DA 3U3RA 4D26A 4A8JC 2QPTA 5IDVA 1S1CA 3EA5A 1CR1A 2OAQ1 1VDZA 1NRJB 4DCSA 1G5TA 2GAOA 3HR7A 4P31A 3UANA 2FV8A 3UKDA 4I1VA 3M4YA 3OEEA 3R9IA 4F38A 4KCGA 5DI3B 1MKYA 3K9LA 2FSGA 1VCIA 2MSDB 2IHBA 3BK7A 5EZ6B 1HV8A 2NGRA 2DWOA 2W00A 3TAHA 4LOAA 2FFQA 4NCHA 1KZ7B 3IIMA 1DARA 5JJIA 4C4PA 2IYYA 4MDEA 2YV5A 3LVQE 2ONJA 2VH5R 2GEDA 2KBEA 4G01B 3CW2A 3TW4A 2HJVA 1J8MF 1G20E 2XZOA 1O87A 1HT1E 2H57A 2J7PA 4QBGB 4Q21A 4URZR 3V9PA 1A2KC 1HTWA 1KK1A 1YR8A 3K8YA 3TKLA 4ZI2A 3QBVA 4MRSA 1OKKA 3FMOB 3T1QA 1ZU4A 1E4VA 4PAQA 5HCIA 4YLGA 1J90A 4WA7A 3FHTA 1YRAA 1UPTA 3SBEA 1KI2A 4NDZA 4EJSC 4E03A 4NYIQ 3GLIE 1IXZA 2ZPTX 1XB2A 4A15A 1S9HA 1MRNA 4HAYA 4ABYA 4PQFA 4G0NA 3KL4A 4NCIA 2GJSA 1G3IA 3G0HA 2C96A 4HLDA 4J0QA 4DBLC 1I4TD 1YVDA 3Q85A 1E2LA 1XXHA 1E2NA 5J5CA 1P2UA 2J9RA 2XXAA 2PCJA 4Q9IA 1DAFA 3L0IB 3ZVNA 5G3YA 1W0JA 3HPRA 1ODFA 2PCLA 2HV8A 3CPEA 1KO7A 2NO9A 2JEOA 2FFBA 2D2FA 1SVKA 2XSZD 3TBKA 4PSAA 1M1YE 2FMXA 1EGAA 2ZYVX 1KK2A 3EZ7A 3GQBA 4M53A 4MGIR 3IKJA 4LJYA 4TLCA 2QRNA 3NC0C 4JSYA 4PFSA 2X2EA 2ZITA 2WKPA 4B73A 1A7JA 3V00A 3BB3A 3IO5A 4PO8A 2VSFA 3HJNA 4W5WA 5KTYA 2B7CA 1JEEA 1V5WA 3I92A 2SHKA 5AR1A 5DHAA 5DN6D 2P65A 1KJZA 1FPMA 1P73A 4IVRA 4ZV4A 4GBMA 3IEUA 1Q57A 1U0JA 3WYAA 1DVRA 1XZPA 3PEUA 2UVQA 1E9FA 2F9MA 3K0CC 4Q9JA 2ZVQX 1E2MA 5FOTA 1MT0A 2QMHA 4KO8A 4PHTA 4QNRA 3UPUA 4D4JA 4G3XA 1X8KA 1G6OA 3TR0A 1JECA 4DSOA 5E7IA 4F91B 2H92A 1UADA 4FMDB 4O3MA 4OL0A 4M1OA 2VHQA 1NVWQ 4IVPA 3I5XA 1IY2A 3EG5A 4MKGA 2QE7D 1E1RD 4L9WA 4PR0A 4QHSA 5BQ5A 4G5QA 4QBFA 2D2EA 3QE0A 4NKRA 3UK6A 1T3HA 1ESMA 1GM5A 2VHJA 2QG6A 3SFVA 1XCMA 1OSNA 4KODA 2WZQA 2QEQA 3P26A 4MGYR 1MO4A 2F1HA 3C4JA 3SFZA 5M04A 4BWYA 2BMEA 4XJXA 3C14C 4TQAA 2V8OA 4R2IA 2H8KA 3NEYA 3LQRA 2IYVA 5C46F 3RRZA 3B7GA 1SHKA 3VKHA 2QT0A 4FINA 4DLVA 1AS0A 1LY1A 2JLXA 2PMKA 3K0AA 2ZRDA 5FI1B 1BOFA 4KFRA 2WMOB 4IOKA 2W6IA 2F43B 2WWXA 2OT3B 3T61A 4WZ6A 3QKSB 4OHYA 4URXR 1IN7A 4C9BA 2PL3A 3BFXA 2PT5A 2R6GA 2BVNA 2QI9C 2E9SA 2GA8A 3AVXA 1MRSA 2VP6A 4JLVA 5BYJA 4C0KA 2P5TB 3A4MA 5FPHA 4DLRA 2FSIA 2JJ1D 3W3ZB 2FPKA 3SI7A 2CHGA 1IY0A 1Z08A 3X1WA 2GWHA 3SC3A 4DLTA 3U6BA 2IS1A 1R5NA 2VBCA 2BMDA 2WJVA 1GUAA 4AWXA 1PVOA 4LV5B 2ORVA 2NZJA 2VHTA 2YWFA 1MV5A 2ZS8A 4QM7A 2ZSEA 1IN5A 1D8TA 1NLYA 2ZRCA 1H65A 4R9UC 1G7RA 2RGEA 5A5GA 1KMQA 3KJHA 4M1SA 4BZQA 1G18A 1W1WA 4OHWA 1PZNA 3QENA 5CB6A 4EJSA 1BMFD 1JR3D 1YE8A 4DIDA 4DJTA 1H8EA 4KSCA 1FOEB 1ZUIA 2JAQA 1V43A 3H2YA 4GFDA 4GI7A 3DPUA 2MMCA 4G5GA 4X8LA 2XNSA 4QHTA 1AS2A 3K09A 1VG9B 4C0HA 4C7OB 3DZDA 3VR2A 2VRWA 4QBHA 3ZGXA 3EWAA 5TB5A 4LJ9A 4NE2A 2AKAB 3N5CA 4BUJA 1E3MA 1NKTA 1CU1A 1XMVA 3OAAD 3VR4A 4RVCA 1Q21A 3ND9A 1E79D 2GDJA 5IK2A 1X8LA 2LKCA 1R0WA 1TL7C 4BQSA 3JVVA 3LXRA 4MYTA 3PUVA 3TSWA 4EFLA 4DRZA 4QXAA 1N0VC 4TSFD 2ZI3A 1HA3A 3TLXA 3EA0A 1CBUA 1KSFX 4B35A 4D81A 3ZVRA 3R7WA 1B23P 3IPXA 2A5DA 4P4SA 2DFTA 1XEXA 3MAAC 2C04A 1RJ9B 2AN9A 1MO3A 4V0KA 2G0TA 4A6PA 4A9AA 4U7DA 3KKQA 4TZ0A 1E2HA 2DYKA 1JBKA 2OBNA 1KDTA 1GZSA 1T9HA 4L9SA 4JLPA 3NVAA 4TTQA 1EFCA 2PX0A 2O8EA 1Q20A 4D4KA 2X8AA 1LW7A 3FHCB 1N5KA 2MSEB 2GVZC 3A8TA 3C8UA 3KQLA 3QI2A 2ZE8A 4HDQB 2AXNA 2P5SA 4X8OA 3RSLA 721PA 3OIYA 1GAJA 1GWNA 1S0UA 2ZRIA 4UKDA 2DWQA 1DAEA 2C8VA 4QC2A 1E9DA 4CF7A 3GP8A 3OFND 1KY2A 3W34A 2ZE5A 2YZ2A 3RS7A 2OHFA 1S8FA 3CZPA 3WNDA 4ACBA 1OFUX 3WHLA 2DB3A 1RRGA 2ZVPX 4EKDA 2FSFA 1LS1A 3ZD7A 5HKKA 1T5LA 2V6IA 3IEVA 4LV6A 4O25A 4DSTA 3MLEA 2FJUA 2WAXA 4N3NA 1KMHB 2BCGY 3ZZ0A 3QXSA 4UJ5A 4Z54A 3R7WB 2HDNB 2XNDA 4US0R 2WWYA 2D7DA 5BW8A 1XPOA 2JLSA 5KPJA 2ZI4A 3ADCA 4DDUA 4XTCS 4IDHA 1RZ3A 2F6RA 1GFIA 4P4UA 621PA 2J1LA 4KFUA 1AZSC 1W44A 2FA9A 1SVLA 1DO0A 4MA4A 3NBFA 1I4LD 2ZJBA 2OXCA 3QJYA 2JIZD 3UMRA 1U94A 1NIJA 4OQFA 5P21A 3JZMA 1WBDA 2J0UA 2CNWD 4PZYA 2VPPA 3GLHE 3C5HA 4WBSA 1XF9A 3ECCA 3EPKA 4GNKA 2EU8A 3THWA 3QVUA 2QNRA 4PZZA 3LX8A 5K8TA 1UKZA 1LV7A 2FF7A 4URVR 5CJ2A 1CTQA 2QQ0A 3DMNA 2HF9A 3AH8A 4Q4HB 4XTRA 4AYWA 3GEHA 3CZQA 4Q19A 1J99A 4F4CA 3WP1B 5EUQB 2P0EA 1NBME 5EP1A 4QGHA 3WXMA 4PX9A 1KDPA 1E94E 2DFKB 2ANBA 2ERXA 3H0KA 1FUUA 3CO5A 4JL6A 2Z83A 3NBYC 1MR3F 2VSOA 1TF2A 4IXMA 1TTTA 4DUGD 4JYCA 1FNMA 1M7BA 5FBLB 2ZU0C 3Q8XB 4L4UA 5E4FA 1KTVA 3LO5A 1VYTA 4OQXA 3BB4A 4BFUA 1T3LA 3QKSA 1OXVA 5FH9A 3TRFA 4M1YA 4ILEA 4Q7MB 4EAQA 3LWNA 1KIMA 5B64A 3AP2A 3OZXA 3K0AB 1G64A 5AUQA 3KXIA 2PJZA 4KXFB 2OSBA 1KYIA 1VKJA 3KKMA 2AFHE 4R2HA 1ZRHA 2ZE7A 2QGNA 3W6PA 1WP9A 5L3QA 2RGNC 2CMKA 1G3MA 2PMDA 2WM9B 4K81B 3CNLA 1OIWA 3THWB 3GLFA 1P6XA 2AX4A 3WNCA 1J70A 3SHFA 1P4SA 3L2OB 2IS2A 1II8B 1OXXK 3BC1A 4B2LA 2FH5B 2J0UB 5C4MA 3EAQA 3Q3JB 2D7CA 4LCBA 1MABB 2PLFA 2DHRA 4UNNA 1US8B 2C95A 2QSZA 1PLJA 3THOA 1TX4B 2LWIA 4PAOA 2AD5A 1CRPA 2IEZA 1TF7A 2IYXA 3CX6A 3MSXA 4OHVA 4KFTA 1IOZA 1UEJA 3KTAA 2XNDD 1EWQA 4DSNA 2C5LA 1NVUQ 4L5BA 1DAIA 1A2BA 1NIPA 5TV2A 1G8HA 5FTJA 1W48A 4A36A 4EPWA 4FWTA 4HAWA 4IDNA 2VTKA 1Q22A 4DB4A 5D3MB 5DIFA 1YR6A 2CLDX 1F2TA 4KYUA 4B2PA 5HPYB 3CNNA 1RPZA 4E5UA 1OLOA 2CCKA 2JLRA 4EPRA 4UNQA 3BFKA 3AF1A 5GJCA 1Z3IX 2EQBA 1XCPA 2ZJOA 5L8VA 2D3WA 2R62A 3ICQB 2DY1A 3W3AA 3HYTA 5CIWA 1TQ6A 1N5JA 2XITA 3G5UA 1Q1EA 2BEJA 4NBSA 1E1QA 1JJVA 2PJRA 4D25A 1BYUA 3CWQA 3H86A 5DLQC 4NH0A 5DYGA 4V02A 1AKYA 4EDHA 3GLFB 3MWJA 3RS5A 3RWOA 5TVKA 2ZJZA 3AVYA 4Z8YA 3EIEA 3FMIA 1XXHB 1TEVA 2FG5A 4XOIA 5DNYB 4Q02A 2AL7A 1P7CA 2F1JA 4EPXA 5KSYA 5C18A 1L7VC 3K0FB 1TPZA 1XTKA 2WSSD 4LV8B 4RSGA 4OK5A 1YZNA 1XRJA 4D80A 3R9XA 5HZKA 1MO6A 1FMJA 2QPOA 3KXKA 1XEXB 4TQ9A 2WMNB 2YOHA 3B1YA 1LF0A 2ZRFA 5KNCA 4RD4A 1N2CE 1ZUHA 2JJ2A 4C0QC 3ADDA 3EASA 3EC1A 4HB2A 4DCNA 3BRWD 1E9AA 4C0LA 1JXMA 1M34E 5J40A 2ORWA 4G1UC 3PFIA 1CJVC 3KUDA 3OAAA 4QHYA 5JMTA 4ARZB 2IA5A 3NHBA 1M7HA 1E2EA 1DG3A 3BWDD 2ZJ5A 3RLFA 2JASA 3SOPA 1SHZA 1ZYUA 4LK2A 3GLGA 4Q4HA 4G5OA 4IOLA 4OJKA 5IRCD 5FOXA 3AVVA 4Q1BA 4JL5A 3D7MA 1NBMD 4I81A 3RS3A 3U7EB 3AP1A 4AIIA 1D2MA 1KO5A 1QG4A 2YJTD 3QPUA 2ZI6A 4ZI3A 3ONWA 1Z8FA 1ZM7A 3SJAA 3ZIAA 2ODBA 4DSUA 2VHUA 4A92A 4DC9A 1L8QA 4Q7LA 3VHLB 2XJ9A 4HAXA 3TW8B 2IXEA 1N6NA 3VR3A 5KDOA 1QHSA 4CT5A 2GJAA 1N6LA 1XD8A 1X3SA 4C2TA 4CIDA 4TTPA 2QP3A 4OI4A 4ZCIA 4KBFA 1Q3TA 1E4YA 4HLUA 2QMUA 2N46A 3EZ2A 4XH9B 3PUXA 1SXJD 3DKVA 3UATA 3Q7PA 5ANRB 3I8XA 1NG9A 4JIMA 2FEOA 3DEFA 1EX7A 2BWJA 3LQQA 3LY5A 3AVOA 4FCTA 2ZJ8A 3RSOA 2BM0A 4Q47A 4CEJB 4JT2A 2JLZA 3A4LA 3LH5A 5LB4A 4MRNA 1F2UB 5LD2C 1GRNA 4BLOA 2C78A 821PA 4LJ7A 3AUYA 4WZBE 5A0FA 4Y0AA 3E1SA 4YMUA 1JPJA 1CJKC 2Q3MA 3CBQA 4OHZA 3QVVA 3DKPA 3VFDA 221PA 5FOUA 4D2IA 4D0LB 1LFDB 3EWSA 1B0UA 1NBMA 4BRWA 4B71A 3U7FB 1N25A 2R8RA 2RKOA 4IEEA 4KLZA 1ZCAA 4Q66C 1E69A 2NTYC 3ZDQA 2IUUA 1ZINA 3RRMA 5CYOA 4PSKA 4OI0A 2BHRA 5JBQA 2B92A 2YOGA 4GMXA 2RHDA 3PEYA 1Z0DA 2VA8A 1RVDA 1GTVA 1GSIA 4B6EA 2RGAA 3FMPB 2C2HA 3K9NA 1KO4A 2R44A 1UBCA 3AKYA 2EFCB 3EW9A 1G3UA 1E2GA 2V4ZA 2CL7X 3W6OA 2XX3A 4ESVA 2ZETA 1TF5A 5KSPA 3DL0A 2Z43A 4Q4JB 4NL4H 3ZH9B 2O8FB 1NY6A 3KFVA 1N0WA 2I4IA 1VYVA 3C5CA 5GVSA 3SEAA 1SKYB 2RGCA 4DDWA 2AWOA 3K0SA 3GLFE 4DLZA 2KBFA 1CULC 1ETUA 3PUYA 2RGDA 5TMPA 4UXJA 1R4AA 3T1OA 4KHZA 4Q48A 4Q4LA 5BN5A 5DO9A 1ZNXA 4Q1FA 4OQNA 2HEIA 2K5UA 5FFMA 4TL9A 1HYQA 3L0SA 1Z6YA 1W5SA 4NONA 8OHMA 4QKQA 4UXHA 4Q9LA 3MMPA 4DEXA 1KI4A 1LF5A 3H4MA 4AKEA 2DFNA 2OFXA 3KJEA 3U44B 3KQKA 3RABA 3I61A 3OIVA 2REOA 1NVVR 1E9BA 1HE8B 4QRHA 4TMXA 3HP1A 4IW3B 5FBQB 2XXAB 3IQXA 2GBLA 2R2AA 4OYHA 3BS4A 4DCTA 1XWIA 4UNRA 3QNUA 1EFRD 3UWKA 3U7HB 2ERYA 2WWHA 4ZKDA 1KI3A 4JLOA 1W46A 1HUQA 5KNDA 5FBRB 1AM4D 3VMFA 3LAWA 2IYSA 2A78A 2CCGA 4HLQB 3GLIB 3U3MA 3SJCA 4V03A 2IYTA 4Q00A 4DT1B 4NYIR 3VAAA 5IHPA 2F1IA 5K8IA 3AVQA 2GRJA 1ZAKA 2IS6A 2VHCA 2Q9AA 3NC1C 5L3RA 1KAGA 2WWIA 5EXSA 3KQHA 3NH6A 3SU8A 3EIQA 4WVFA 4BEBA 4GL2A 2J7PD 2XAUA 1SXJC 3O8CA 1CR0A 1SVWA 4L15A 1BYIA 1QBKC 1FTSA 4TYQA 3THYB 1X6VA 4JBYA 1OB5A 1TADA 5JCZA 1K5GA 1IXRC 2JGNA 2G3YA 3SDZA 3CONA 1YHNA 3C16C 3LW8A 4RFSA 5BXQC 5DN6A 2CCJA 2Z0MA 4P3YA 2HT1A 1E9EA 1T4GA 4HUQB 3W6NA 3HDTA 1ZMXA 5E95A 4FIDA 5FTMA 2RH5A 4BE7B 1RKBA 3U61B 1IQPA 3M1IA 1GL7A 5FUWA 4JL8A 1ZP6A 2Q9CA 4L16A 2YKGA 2KJQA 2HCBA 3C15C 4BFXA 1XBTA 4P4TA 2J7KA 3BD9A 3DM9B 2W0SA 3MRSA 1SVIA 2DWPA 4RFVA 2ZI7A 3TK1A 3OE7A 2ZI5A 3C7KA 3TJZA 2OXRA 1CS4C 1KY3A 4NHOA 5FBVB 2ZRNA 1HY3A 2O0HA 1JB1A 5JSZB 4Q03A 1F5NA 1E98A 3ZJYA 2AWNA 3EPLA 1GP2A 4PHFA 2BBWA 4TLBA 3CR8A 4TMVA 4YONB 4BFVA 2GESA 1QVRA 2GXQA 4LJAA 4JS0A 4UNPA 3GLIA 5FTNA 3IUYA 3VX3A 4DLSA 4B43A 5AUNB 3PG5A 4PPNA 2ZR0A 2NOAA 1G1MA 1VTKA 1JNYA 1RYHA 2VSXA 3L8YA 2G6BA 3RRNA 3TMKA 1G8YA 1R8SA 3CF6R 4CEIB 2YHSA 4Q1CA 5BYKA 1DG1G 1NMXA 1E79A 4NU0A 5IK2D 1FX0A 2AXPA 4US2R 1DELA 5DI9A 1YZUA 2YWEA 3A37A 5GVRA 3I4LA 1WMSA 2YNMA 2QBYA 2Z6VA 2W2VA 1T6NA 3OIWA 1YR7A 3IDQA 1SXJE 3LDAA 3SYLA 1EESA 1TNDA 5B57C 1JEDA 4FI3C 3TSOA 4TZ6A 1XEWX 2BEKA 2IT1A 5EZ5A 5JFGA 1KO1A 1JR3A 1XTIA 4QG7A 3TGPA 3QXXA 5GADl 4HB0A 4TYYA 2JJ2D 4POAA 1A5TA 4O2RA 2QU8A 4ON9A 1G41A 5TARA 1CJUC 1NN0A 1XMSA 2ZUBA 1RE0A 4Q4JA 2O8CB 4LSGA 2ZRKA 1TU4A 4MRVA 4AYTA 2P67A 2YWGA 4KV9A 5AUOB 1EWRA 3A1VA 5IF9A 2MMGA 3FWYA 3ZS8A 3AKCA 2CLSA 2OG2A 2WOOA 2NMVA 3K0FA 4M9SA 4CEHB 3OHMA 3GFPA 1OT3A 4IEIA 2ATVA 4P33A 3FYHA 1RYFA 2D74A 4KI0A 5FPYA 4PAMA 1FFHA 2OILA 2OCAA 2XZLA 4IRUB 4HLUC 4GMDA 4MKHA 4Q4AB 3SS8A 2XTZA 2EYQA 1WRBA 2JDID 1G5RA 4NYJR 3O8BA 1FP7A 3HU1A 1VYUA 3EC2A 2QBYB 2OV2A 4BLSA 4LYHA 3CPJB 3K53A 4LUCA 1T5IA 1CKEA 1Z06A 2WKRA 4HI0E 4PC1A 4XSGA 2XGJA 5GJVC 3MWKA 3U7GA 5DI3A 2FOLA 1NG1A 1XTQA 2H5EA 4JJKA 4KJZA 2Q9BA 3P4YA 5E7JA 1UKEA 2A2ZA 4LY6A 2RGGA 5CDFE 5FR2A 1OH8A 3OEED 2QQEA 2WAYA 2ZAMA 4FW9A 3UIEA 2JA1A 4FMCF 5KHOC 5K8LA 3QKUA 4Q7KA
chains in the Genus database with same CATH superfamily
1YA4A 1OXUA 1OIVA 1Q2XA 2LCFA 3DBVO 4DS3A 3NKLA 5AK0A 4PZLA 3R7BA 1JIIA 2JHPA 1TZCA 3C5WP 3LT1A 3M6AA 2A9KA 4MW9A 4RH3A 3AFOA 3E7XA 4YCAA 2FWAA 5AM1A 3D6VA 4C7XA 5TF0A 4KFSA 1PDOA 1CQPA 1F0YA 1G3QA 1FL9A 2C9OA 2YBEA 4X3CA 1CLUA 4YO8A 2EFDB 5JH7B 4PO3X 2F1RA 1FFWA 3FWHA 5FUXA 1LB1B 4BEWA 5L45A 4Q01A 2PYIA 4DIEA 2G4CA 2HRBA 5ALVA 2MR5A 2Q4EA 1RBQA 3BPSA 1HYGA 2JFQA 2Q3CA 4WXEA 2QRVB 3IT3A 4X8MA 1E2KA 4O3MA 2PK3A 2CXNA 4GOJA 1JG1A 2X1LA 1TT7A 2BEVA 2WIAA 4HOYA 2J4DA 2IUTA 3E9QA 4MVJF 4RD0A 2JCBA 3FCSB 3RTDA 3AGPA 1ANKA 2R68A 3BILA 4MV9A 5ALSA 4IJKA 2PUVA 5EQTA 5F7XA 6ABPA 2FJPA 1IY8A 2CVOA 3WAGA 1ZAYA 1U5BB 1R0YA 2PRIA 4JLDA 2I4NA 1DAMA 3EVBA 5F9MA 3JALB 2CYAA 4CNBA 2XGOA 4FBGA 2PEYA 1FDRA 1OFVA 1WMEA 1XCOA 3OTIA 3O31A 1P3JA 2CFCA 4OXRA 5JPIA 3V6LA 5HYVA 4V0MA 2XRZA 3C5VA 3N8IA 3NBUA 1B1CA 1W87A 4DLYA 5HF6A 2VAWA 4FWIB 5LQSA 1FTWA 4HEA1 1J8YF 5LQNA 2FOIA 2HA2A 3IULA 4BECA 1PDVA 1PS0A 4XYLA 4LDAA 1O9BA 1SC9A 4FEYA 3T3GA 3O3CA 3VR3D 4CKCB 3KEGA 1IY9A 2OP0A 1T4MA 2PFGA 3LXXA 5TT0A 2ZAYA 2HYDA 5HS6A 2IKQA 4CT4B 3SY8A 2H1OA 3V7NA 2C3PA 4CETA 1E6CA 3OM0A 1PUIA 5EG5A 1GGNA 1WEKA 3BWMA 5EQDA 2FN8A 2OAGA 1UKAA 1RI1A 2QX4A 4MV4A 2OLEA 3HDJA 2OP1A 3KO8A 4IWNA 4B3FX 2GJKA 5CD1A 5KWJA 3OJCA 1J1IA 3NDPA 4JBLA 3KEFA 4QO8A 1B73A 5AJWA 3RIMA 4KPYA 1WZEA 3FDZA 1BRMA 2AEEA 2BGKA 4IL5A 4MR8A 3A6GA 4CTKA 4PNZA 4R81A 3HEAA 1MPTA 3TDMA 3TE6A 1TC1A 1FBNA 2XF8A 4ZCLA 2NXWA 2NUTA 1FQJA 4EI2A 1O3YA 3LDFA 4G2NA 5G0UA 2P1ZA 1GZHB 2FPGA 4IWYA 3N75A 3TM4A 1F48A 3ZD6A 1NBOA 1Y80A 4GKAA 5G2OA 4AKHA 4MUBA 3WGOA 4BQQA 3RBAA 4CZ2A 3ZVKA 4B4WA 1WNFA 1WXQA 1IBKB 1NW3A 1UIRA 1VECA 3V3TA 4EMSA 2W0MA 1H5NA 4F7WA 3ANYB 2O57A 3B70A 1XZMA 3MCTA 4YFVA 4PG8A 3MW8A 4YJFA 2PBRA 1GXSB 4LQDA 3K1AB 4DNQA 1DBPA 4UAVA 2HLNA 1RCUA 3OTQA 4MR9A 5EEHA 4CR6A 4EKEA 9ATCA 1H2XA 3MWFA 1RCFA 1U4SA 2FEXA 5G1OA 4B9EA 1PQWA 5K0LA 2HMVA 2D1QA 3NQ41 3WQSB 1G16A 4GR9A 4IJUA 4X90A 4D3DA 4HJRA 2CXPA 3Q8KA 2LGJA 2OY0A 4QL3A 2HB6A 1HFEL 1USUA 3E82A 1SR8A 1JXOA 2PGXA 3Q3HA 1K6MA 2VYFA 1ZM3A 2JEYA 2PRJA 4YAIA 5KTRA 2XDWA 5ELMA 2O8FA 4A2QA 1JV2B 2M6SA 2XJ4A 3C8DA 2I29A 3ABQB 2EHDA 4QTUB 4RSMA 5D5QA 2W6PA 4CQMA 1WOYA 4LQLA 5E8RA 2BM9A 1DUIA 3HYSA 4NENB 4GZ3A 4Y6QA 3P32A 5A3SA 3U37A 3GRFA 1WE2A 2Z2KA 1EFHA 1E3SA 2IP4A 2KYRA 1T3SA 1ZEJA 3GYBA 4G24A 1T35A 1XUOA 1MMFB 4OQPA 2XCRB 1SXJB 3E7DA 3AJ8A 1Y8CA 3JQBC 1VJGA 3KUCA 1ZOLA 1LS6A 2PBLA 3KBBA 2J07A 3EXHC 2AG1A 2RBKA 3VX4A 1FNCA 2G6TA 1L4FA 3HKEB 3G17A 1EK0A 1WY7A 1KOJA 2GNAA 4UPVA 1W4BA 2VI5A 4W82A 1L0BA 1TTPB 4F92B 3RC1A 4NU6A 4ZYTA 1X7XB 3Q6IA 1CR2A 5IJAA 3ETCA 3LY7A 2PS3A 3OM8A 3Q12A 2UZ1B 3QE4A 4FGSA 4BNXA 4EJ6A 2VF8A 3UNXA 3H4IA 1XZNA 1OFUA 1P5RA 2IL1A 3BDVA 1E58A 3FMGA 2ZU6A 3CF2A 4MZDA 4DNXA 4EY7A 5TQ0A 2WVHA 4OM7A 4EEKA 4EKIA 2W43A 3AERA 1Z26A 1TQ2A 2QTVB 3JWEA 5IARA 1QXSA 4CKEB 1IXKA 1P0QA 2C7OA 1Z07A 4FX2A 1NXSA 1Y1QA 1WTCA 3DOOA 1EVIA 4I5GA 1MB0A 3H1GA 1ZRSA 3WE7A 1YJAA 1ZD3A 5DT9A 3NIDB 4HFRA 1HM5A 4P3PA 4CYMA 5J1TB 1YZKA 3V2IA 3KYBA 3UK2A 5K2OA 1Z63A 2Q2QA 5ALKA 2IOQA 4MH0R 4RKEA 4ECEA 1NURA 3NGXA 5C5DA 2QRZA 1V2HE 1WG8A 1E1DA 4LBZA 1C9YA 1G20B 3GUHA 1A04A 3CLHA 5HZHA 5CPBA 4HWSA 1PTJA 1VI5A 5IM5A 4E5KA 5HKKD 3I37X 1KGDA 1VDMA 2V7PA 4HGOA 1AV6A 1VLHA 5IZCC 3E35A 2NU7B 1XN4A 2B35A 2I2AA 3A6HA 2HA6A 3NBAA 5LD2B 2FQWA 1DSSG 4CRWB 3L4SO 1XHEA 4ARVA 1LSJA 4B2IA 4CQMD 3MINA 1WZNA 2W6JD 1BTOA 1OZHA 4NYMR 3QKRB 2FEAA 5IF3A 1KO8A 2VIIA 2PVSA 2BOVA 2CKDA 3R5TA 1CHDA 3OPYB 1N5OX 2QMZA 3HCNA 3WIOA 5JROA 4N39A 3QX9A 2VDJA 4A8HA 5FNVF 1YI1A 3LWZA 2OUKA 1OGYA 1E66A 1YZTA 2EHJA 4PBSA 5AJTA 3DC7A 1O6GA 5THQA 2HBRA 4R2MA 1BDMA 1B2LA 2WOJA 3LX5A 4JDUA 4EFKA 3VSBA 3GLGB 1AMNA 1RZVA 4PQYA 2DBVO 1A5BB 3DD5A 1E5QA 3PC4A 4U9HS 2B1IA 3P94A 4IOJA 3OQMA 1VHQA 2AOWA 3L43A 5CIQA 5HR5A 4QDXA 4RVUA 1AQUA 4Y9RA 1JLKA 4LQCA 1P7WA 3EEIA 4DUYB 3W6UA 1ADCA 4GVPA 3U81A 5BR4A 1TPYA 1Z2CA 5JYDA 1NY5A 4AP5A 3I9FA 1NXVA 2Q62A 1GADO 3WLTA 3R9WA 2OZVA 3TD6A 4HN4B 5F5LA 2R6CA 2Y71A 3DXYA 4RK5A 5CDYA 5HUJA 1QLHA 4JXXA 3BH7A 1WB4A 4MV7A 1Q1QA 2QM3A 5BNFA 1JDPA 4NPAA 3RVJA 4DCMA 2GAFA 4IM7A 4HYTA 2GEUA 1QHHB 3ESYA 2XZTA 1LI7A 5TGZA 2YYYA 4INAA 2RCYA 3IP1A 2V6MA 1R4NA 3OBBA 1A9OA 1USKA 4BQPA 1J5EB 2QJRA 3T9FA 2XUOA 1SBCA 4TMYA 1SA0A 2F2TA 2VXYA 3AUJB 2RAFA 3L06A 3QEOA 5GONA 5T8KA 1EQAA 1G291 5CM8B 5B1EA 1RWBA 1XD2B 4EEXA 1RI3A 1JXAA 3FFXA 3IHWA 4EOGA 4LA4A 3VYTB 2I2BA 4PE5B 3VOTA 1N5IA 3C1AA 2WZBA 3NW9A 4WXRA 4C0AC 1W34A 2ECOA 3KPJA 2CDBA 1IBCA 3MD9A 1G7TA 4LHYA 3ELWA 4LYDA 4RJLA 3HE3A 1R6DA 3UQYS 4G41A 1QZTA 4FCWA 4GGMX 1P44A 5CDSA 2WEKA 2OMEA 2D4HA 2X5OA 3P4XA 1QPZA 4HEA6 3H16A 5JS7A 2UVPB 4JB2A 3PX7A 1M5UA 4K03A 3GRCA 3GG9A 4RQBA 3RSFA 1IWBB 3OOEA 4Y2GA 4ZVUA 1SQ5A 2QGFA 3N86A 1N2OA 5EHXA 4M54A 1ZNZA 1EWTA 3IE0A 3IIJA 1FTGA 4BFLA 3FW1A 5J43A 2IXAA 3E2IA 5LMNB 1ISHA 1SKQA 2E4ZA 1A9PA 1HZZC 2BAGA 5J9FA 5LOVB 3SJ7A 1W36C 4QGSA 1YS6A 1XZEA 2EQ5A 2ZUDA 4MKFA 1U0LA 2VNAA 3G59A 4NK5A 1MAHA 2C3YA 2ILVA 1E0AA 1Z4JA 2BRUC 1IBRA 5JD3A 3D6TB 2Q9UA 3CNHA 1EM6A 2LNDA 2MINA 1KI8A 1KEEB 2VRCA 3KQWA 3Q3CA 4RVNA 5CLHA 1UP6A 4RW0A 4OHCA 1ZL2A 1K7CA 4GF5A 4HPJB 1NJSA 1SOAA 2IWRA 3J81k 5I9LA 2C0QA 5ITVA 2H0RA 3CSUA 3G5LA 5LOVF 2R8XA 1OA1A 1CYEA 1YFKA 4ZT5A 4GQBA 1W0KD 1GKYA 1WDMA 4L50A 3WRXC 4TYWA 4JZKA 3LIIA 3TLJA 1RXVA 1GPUA 2WUEA 2DG2A 4FQ7A 1YKSA 5DHPA 2Z56A 5F3DA 3RTGA 5D01A 4M0KA 2TRSB 2ZUTA 4WXMA 1WLSA 3L0ZA 3MWEB 1OJ7A 3WXBA 3RVLA 2G07A 1UDWA 3BD6A 4M8KA 4MQEA 3B1XA 4PG7A 3K9GA 4MPTA 4RKRA 3CH4B 1R64A 3I2JA 3B8HA 3INNA 5I4CA 4KXUA 4CKZA 1QGZA 3BN3A 4X61A 5GZ3A 2OUIA 1RLJA 3ZU2A 4BTLA 4HR7A 2NU6A 5BV8A 4K26A 3BHMA 4EFDA 4BAUA 3R8FA 1LDNA 1O94D 3DMDA 4ZTBA 3E0XA 3HVRA 3GNQA 2QAGA 1ZDMA 2HDOA 3KIPA 1A1SA 2J46A 1G9XA 2YINC 4Q93A 4X6YA 3SC6A 2PN1A 4L0CA 4FEGA 1U7TA 2ASEA 5KTMA 2VF2A 4M7RA 4N5DA 3KTDA 3ZNOA 2DVMA 2B0JA 5UKDA 5ES4B 4EUEA 1M6YA 2QORA 4C03A 1FNDA 3TJRA 4DMMA 1E2JA 1EFRA 1OLSB 2VYVD 5E9QA 5JLAA 3GEGA 4YMHA 1KJWA 2B8TA 2VF5X 3AJEA 1LBIA 4K86A 1Z5VA 1J6UA 3KKKA 1L9KA 3AP3A 1BE1A 1TJ3A 2QL5A 1KFCB 1QF9A 4EF6A 3BRSA 4LJRA 2HSGA 5T57A 4DBVO 2E18A 4X1YB 3IBFA 3RGWS 3UFXA 4P7BA 1H22A 3C7DB 3TRIA 2PIDA 3VR5D 2QYHA 2V5UA 3CTPA 3WGZA 3M5WA 5AMXA 3SX4A 3TDNA 2VUIB 1OZGA 3L1VA 3C0KA 3GRRA 3I0ZA 1EYZA 1X74A 2XNCA 3T7RA 1K1EA 1TM4E 4XX0B 3SJBA 1U2GA 5EXXA 3S2ZA 2QIPA 1V35A 2BMVA 5HUHA 3NTQA 2CV2A 3SVZA 2NXCA 2VT3A 1PJ3A 4BQNA 3JASA 1BMQA 3O4RA 4Z0HO 2ZRMA 4B4KA 4GKJB 3TOXA 3IESA 3ZXUB 2XGMA 1A8IA 1XZ8A 1G5QA 1ZHOA 2RGBA 2BM8A 1K0FA 1M2OB 2E4WA 3HJBA 4RA6A 3QUBA 2A9QA 5EMLA 4ILKA 2BV3A 3L49A 2XKAA 3QFHA 5BN5B 3GMIA 2BDEA 4AJIA 2ZRHA 2W2QA 4G56A 2CFIA 3A6DA 3EPHA 1NQVA 2A7QA 1GAEO 1NZDA 3MBKA 4IEFB 4LI3X 2XZPA 3T3PB 3BWEA 2OCLA 4U4AA 2DQYA 1HZJA 5DTMA 4B5KA 5K1ZA 4ZOLA 3CNEA 5IC4A 3ZCUA 3B38A 1WSDA 1G8SA 1COWA 5E4YA 3OLWA 4N12A 2WE8A 5TQ2A 1GPLA 2B25A 3EXHB 3TIIA 3WSWA 3NNSA 4PWZA 1AQ6A 3B7PA 7ADHA 3CLSC 1QQ6A 1FFXA 1Y9ZA 2PL1A 3NHJA 5K3DA 5FTLA 2EBFX 3BWVA 2C29D 4AJ2A 2AS0A 2NYUA 1T5DX 3BXEA 4TMWA 3AETB 4J7AA 3USZA 3OOJA 2B78A 4MI6A 3VV2A 2R1TB 3ZCSA 4RJIA 3OEHD 4S1NA 2BIFA 1Y6FA 4NABA 2H07A 3RUPA 2ASVA 2JF0A 4ZT6A 1B8UA 3DVLA 1X77A 1XTVA 3AF2A 1XCGB 3I2KA 4HYEA 5FV7A 3LNCA 1P7PA 1XZFA 1DZ3A 2C42A 2HFJA 2FZEA 2P9QA 3KKPA 3O9VA 4HQOA 1MQSA 4MIEA 1LJ8A 2A58A 3LUDA 4L5YA 4OA5A 3CCBA 1PJSA 5D7BA 1I33A 3R41A 1VE6A 3EGDA 3UFBA 3ZY3A 4BVHA 3KJXA 2ISSD 1U5AA 4CF5A 4DR6B 1FNSA 4M9XA 4KN6A 4F4FA 1JQJC 4FQ8A 5CITA 1N32B 4F84A 1B16A 2WKQA 5FTWA 1E92A 3MT0A 1Z7WA 2OEPA 3EXEB 4LK3A 1YCHA 1GTZA 4RKWA 3TXYA 2OBMA 3H3XA 3PVCA 4H31A 5EIFA 3X1JA 1UK8A 1R5OA 2IUYA 2JW5A 1I1HA 3B85A 4MKIA 5EP4A 5ESWA 3T12A 3TAUA 2CMHA 5FADA 2ZSAA 4GMFA 5H80A 4YPVA 1NAHA 4LGMA 2NO0A 1ZW1A 4KNVA 3KVNA 4HYYA 5I4BA 5L40A 3PFGA 4F3CA 2AJDA 2PUGA 1SBYA 3E18A 3PFCA 4OBBA 3FI9A 2R65A 1XDGA 4N4AA 5H16A 2M6KA 4KV7A 1YA6A 2X9GA 4B3MB 1AKNA 4H7IA 4J0HA 1YDWA 2CLEB 5AXBA 2HHLA 3KLNA 3FOEC 2I1LA 4FLMA 1RRPA 3JTEA 3RWMB 2J3JA 4RK0A 3PR1A 3H5RA 1CUDA 3E7WA 4KK3A 1NXTA 1JSRA 2QMEA 3FR7A 4FFVA 4TT3A 1PV4A 1YVUA 2YTZA 1KIAA 3JQAB 1FYFA 5IHXA 4NWIA 3C7CB 2P6MA 3DE5X 4L6AA 2DSNA 3MJSA 1HC7A 3OPQA 1LV8A 2IELA 3RT1A 1LH0A 2GPAA 2AVDA 5DCUA 3M9LA 1I3OA 5F51A 2PMFA 3IBGA 4CE6A 2I7CA 3Q2IA 1XMIA 4ZICA 1JFVA 4R31A 5H0IA 3I9NA 5CVEA 3UZUA 3AV3A 2FMKA 2CFSA 3CQ9A 4GYYA 1ADJA 3PD0A 4RDCA 2G5CA 5KZMB 2NO7A 2XWBF 5HQ3B 3QLVA 5SY4A 3OMXA 4R0VA 2ZREA 1X1QA 1HE4A 3VYUB 4PZCA 5DP1A 3ZV6A 4UU7A 3UJPA 3A7EA 3G82C 4FFDA 1XTSA 1ORTA 1K6XA 1YONA 3DTVD 3JD2A 4MICA 2ZEJA 1AD2A 2PUDA 1P3Y1 1NP3A 2GK4A 4TMZA 1J23A 4PXAA 1NSTA 2BEUB 3CVOA 1RHJA 4RWEA 4Q7JB 3Q15C 4HF7A 2O8NA 1FLNA 1C9KA 1K4MA 3IAUA 5KDLA 1GAXA 3ZXSA 4B46A 5AVXA 1A98A 1XYVA 3I62A 3KV1A 5SYMA 3EF1A 1GNVA 3GFOA 1U98A 3IIEA 4MUEA 3G2HA 2A0WA 3N28A 2WPNA 4LJ5A 2V3CC 1D1QA 1MT3A 1EP3B 2I1VB 3A1EA 1EDDA 1EBUA 3EEQA 3F8TA 4FDAA 4CLOA 1KSHA 4BO5A 3AL0C 1Y1SA 1BJTA 1PGQA 1TE2A 2DT5A 1G1AA 1MC5A 1WD7A 1YBFA 3FPGA 4H27A 3UMSA 1OBCA 4KRGA 1ZKDA 4ZMRA 2AB0A 5C8YB 2VP5A 3QU5A 5HIMA 3QF4B 4P5PA 2ARKA 4GOLD 1Z0AA 4CFYA 2VDUE 4Y3UA 2I3AA 4BB9A 5IT4A 3BJEA 4RDHA 2RAPA 1N2CB 3NM6B 1FZTA 4B6OA 4PPGA 3DTNA 3GAAA 3MTJA 3KSMA 5B3KA 3C3BA 5K03A 4P38A 3BH0A 3TCKA 2XIJA 4MQEB 3ZHCA 3DB2A 1P2VA 1JH9A 2H9YA 1X7XA 4X0EA 4ER7A 2AC4A 3RYCB 1QIHA 5EFZA 4KYIB 4KBGA 2HMWA 2BR3A 3M1YA 2DHCA 4MS1A 2ATIA 1K5DA 1YZFA 3N8GA 5CM9C 3PYXA 2V7QD 2OORC 5KWSA 1U8YA 2AFHA 5DSTA 1E2IA 3R3UA 3SLKA 3V2HA 3C3XA 1SXJA 3WQRA 1YMUA 4TXJA 1Z8NA 2E49A 2IE0A 4AB1A 3B1JA 5D51S 3DA8A 5CA1F 4M0LA 3D6UA 2ZM6B 1VKNA 3H84A 4RADA 4I36A 3HVHA 3I0MA 3OTHA 3Q0IA 3ZV4A 1KZ9A 4AX4A 3FCCA 3MHPA 2HPHA 1E63A 1JDSA 3DYIA 3JQEA 3DAGA 4HH0A 5KOYA 4LMRA 2QKYA 2VPXA 5EVJA 5IUKC 4S12A 2FR8C 2ODWA 5CVVA 3T95A 5KNDD 3DNPA 2YXNA 3NAZA 3V8NA 2X8WA 2XLBA 3DOFA 3NATA 2XB4A 4MV6A 1DIRA 2YHIB 3E81A 1SXPA 3KX2A 3E03A 2PSHA 5CAEB 5LYYA 3NTUA 4XQ9A 2GARA 4AF8A 4REQA 2MDTA 3K5WA 3JAKA 2PR2A 3NYRA 5CHEA 3VNRA 5JS8A 2OFOA 5H02A 1E2PA 3PU6A 1Y4DE 3HRHA 4B5LA 1K3TA 2H2WA 2O2YA 2LP4Y 5JYEA 1PYOA 2R7MA 4LRSB 3L8ZA 1DT3A 3RS8A 5BN3B 5FDFA 4B3XA 3ERCA 2EP5A 3A9RA 3VGJA 1QGDA 2O0KA 2XOKD 1VSTA 3RW9A 4XWYA 3QVXA 2JG3A 1Y7IA 2AA3A 2ID9A 2ZIXA 3NH9A 1JLRA 1BA3A 1ZGGA 1PG2A 4Q3AA 4ZDWA 2ZWVA 2BSAA 2IYRA 2PH7A 3VKWA 5KHLB 2O2EA 3RVQA 2P2LA 3AHCA 2ZYRA 4NX2A 1HETA 4UMDA 2PWYA 4OD0A 3N0WA 3JYLA 5KI6A 1OAOA 4A2CA 3A4TA 3OLYA 2DQ4A 2FDCA 3ZDRA 1SG9A 1VLJA 2GK7A 2VRNA 3I04M 2IF2A 4M1KA 5CCDA 1DOAA 3W77A 1FSFA 2NZYA 3CUVA 2P68A 3IDZA 4DG9A 1GNRA 2IZ6A 4TS1A 5AJZA 5L3QB 1H2WA 3O6VA 4DQXA 2XOKA 2XWPA 2Z8ZA 3F78A 3KUKA 1B6TA 1HH4A 1MH1A 3NDJA 2AZMA 4HX5A 3UV3A 2AMVA 3DBHB 3ELBA 2YUIA 3MN1A 2JLBA 2A6PA 1GSAA 2G4LA 3SE7A 3RROA 2RH4A 3DPSA 2AFVA 3P20A 5FWAA 1SKAA 5SYNA 4I2VA 1LD3A 1RIFA 2GF9A 4MYSA 4RCZA 4XZ3A 1XELA 2OL4A 1SUAA 4FKMA 4ENSA 3D6FA 4PINA 3V4SA 4DIBA 4F6RA 3O4GA 3VR4D 2PGNA 3F0TA 1DTSA 3LCVB 4CR7A 4CVNA 2AJLI 2H1FA 3FDFA 1J8DA 1CRQA 4EGJA 4PAWA 4F6LA 4Q1AA 2H1CA 1FJHA 1N2ZA 2ATXA 3GROA 3FNIA 4UE6A 4DKXA 5I7SA 3JQFC 4J4TA 3JQQA 4ZQGA 1Y5NA 4IIJA 2JKZA 1UDBA 2DLDA 4IP0A 5HDQA 1SUCA 4C30A 1UJBA 3TLGA 1WU7A 1EZ1A 1NMZA 2IYUA 5T3UA 2Q5HA 1J22A 1NU8A 3KB2A 3TR6A 1C7JA 3LA6A 4DR7B 3DE0X 3SBDA 3MOSA 5CURA 2VP0A 3S2FA 3R24A 4EUFA 1QVAA 2AQ8A 4C6RA 1ZMBA 4MQ6A 5DBGA 3RAPR 1LPNA 2ZTSA 1HDXA 4XPIB 2R6ZA 3VC1A 2W6OA 1GUZA 3CG4A 2BEVB 3HYLA 4OHKA 4RH0A 1ZK3A 3Q10A 1G7CA 2P1RA 4F71A 3QKRA 3A0UA 4CHGA 4R9NA 2QRVA 3QEKA 1PHRA 1GPDG 3D7NA 4PLWA 4UNSA 4UUMA 3PLAE 4BGIA 3KKOA 5D5PA 4ZVQA 4G9GA 3S7TA 1DWUA 3FNRA 3Q5DA 3S3TA 3O95A 8GPBA 2GFIA 3G5TA 2VAMA 1F2UA 5REQA 3CEJA 5KOJB 4MUXA 3O0TA 2BR5A 2HLDA 2NW6A 3LVRE 1NNEA 3BJRA 1Z18A 4RA9A 5LPNA 3BM5A 1VXRA 4PS1A 4MYHA 2WU1A 3BJIC 4UU8A 4F8JA 4UOEA 1ZU5A 1FRQA 1GUFA 1VL2A 4ZK2A 3RC7A 1SQ6A 1UKVY 2A1TR 2H4FA 2Z4RA 3IXLA 4HGYA 4X1IA 5EJ5A 1GA6A 4E70A 1NW7A 1XKTA 2HADA 3FLMA 5IVKA 1OWPA 4FUQA 1QHNA 4EYSA 1I5RA 2LIPA 1FS5A 4EGCB 4L6CA 1KQPA 2AC2A 3JZFA 1TEXA 3KETA 4IVNA 1T5SA 1ZNYA 2HGZA 1N6RA 2I6GA 1JEAA 1N34B 4B3BA 5FWXA 4YRPA 5TQ0B 5HHTA 4G0UA 3K0EA 4X95A 4QQNA 3TQCA 3UXEA 1PR5A 5TPWA 3H5VA 2OK8A 4RVGA 5AOCA 3ABOB 3K2IA 3SD7A 3W5JA 5AM0A 4W5JA 2VA9A 5A1TA 2NPFA 1ESZA 2XUJA 2GAIA 4NU8X 2COKA 1Q19A 2B21A 3I73A 2QL7A 3QIAA 3OI7A 3KYJB 2CJWB 1YTUA 3KSBC 4ECAA 3AW9A 1G8FA 1GITA 4J4HA 1V8PA 3TPCA 3TZEA 2YC2C 3C6MA 3N5KA 2ZRGA 1TIKA 4JSTA 3VNSA 4ARZA 3DAPA 2ZRJA 5KYYB 4KXXA 3P5BA 1U9JA 3REOA 3VXKA 3UEOA 3GHYA 3PXEA 4WQMA 3AXTA 4OH7A 1JKFA 1S4QA 4NI5A 1CUFA 1RAHA 1ODTC 3P0RA 1QK3A 2AN4A 3NAMA 1LU9A 1MTOA 2ID4A 5CB8A 2X9QA 3PGXA 1DJLA 4E13A 1XMQB 3OOWA 3ACDA 2QZPA 1EUYA 3ZZ1A 4G25A 3DVSX 4I6JA 4U0JA 1K27A 2OQIA 2X76A 2PL9A 2YVKA 3EFEA 4HPXB 1KU6A 1KKMA 3AY3A 1XXHE 3CSDA 3DCIA 3HPQA 4LDPA 3WQHA 4BMSA 4ZYWA 4JI8B 2QLJA 5E1DA 3ZQJA 2DCUA 2YRXA 3CKKA 2OC4A 3I1FA 2XSZA 4LVCA 3TMYA 3DJYA 1S8AA 3H6GA 4O4IF 3L4BC 3X2SA 4DV2B 1Q91A 2IYWA 3DBHA 1DC8A 2WJHA 3MERA 2C4TA 4AP9A 2MJLA 3LLCA 4P36A 4PYMA 3ILVA 1O57A 4FMDF 2OXFA 1QMPA 2QXTA 2ZDHA 3E0QA 1Z13A 3F4KA 5TEWA 3UOAB 3LQ1A 3ZWCA 2CWWA 5E6SB 1REQB 1BKDR 3JQ9A 2HW8A 4CGZA 1ORIA 5BWNA 5JISA 1PQ4A 1NUHA 2NZWA 3IODA 3L79A 3R5HA 4URYR 5DNDA 5B4TA 4HTAA 2IZ7A 5EJ4A 2CHUA 1JJFA 1GUBA 1H94A 1XKLA 3H3FA 4HGRA 3WRWA 4E88A 1FUKA 1VRVA 1TD9A 4Y7DA 3V1TC 5LZ4A 1UANA 2BW0A 1CB0A 5HRCA 5I47A 4MKZA 1WB9A 4G97A 3WJ1A 4G85A 2IF0A 1TU3A 2CVZA 5K51A 3T15A 3SZRA 4EG7A 5C53B 3UYKA 1PW7A 1XNJA 3D2LA 4JYPA 4C3ZA 4ADSG 2P6OA 2Z9CA 4ISCA 3GT7A 2Q3LA 2NNWB 2J4FA 1XU7A 2PEZA 4NCNA 2X8JA 4Q24A 3H1EA 4ZREA 4LF7B 2V9PA 1EXNA 1R6TA 2J3KA 2YFKA 3P96A 4Z4FA 2CLCX 5KVCA 2BBOA 5DTJA 4B7UA 4R1NA 4EO4A 1QANA 2VTEA 2O52A 3Q1LA 3K70C 2XA9A 3RK0A 1JEQB 2V8BA 4NMMA 4CLEA 4M3NA 2NZ8A 2REXB 1FFEA 3PC8C 2ZJ4A 5DGCA 4I7EA 2FQ1A 2J0SA 2X23A 1ODSA 4JWTA 2J32A 5EHNA 2V1XA 1JWLA 2W8BA 2FP4B 3MWLA 2I80A 4G5FA 2OQRA 3AINA 2JIZA 3C3EA 3L8MA 3FVTA 4PXSA 4QQRA 1HT2E 1X7ZA 3V7WA 4RPGA 5AJUA 4JC4A 1VC2A 4YECA 3N2IA 2WD7B 2WNIA 1C50A 4P86A 2FFAA 2QUHA 2HCJB 3ZHSA 1U0BB 1I3KA 1UMDA 4E6EA 4QFBA 1VKRA 2G0NA 2F55A 4PRLA 3ASZA 3HZZA 3UG7A 1M2NA 1QO7A 1U3VA 1U5BA 2HA0A 1EUQA 1XRLA 1FNNA 1CY2A 4ZVNA 4TRRA 1PJRA 1RS0A 2H5JA 1SD5A 2VPQA 3IAXA 3OU7A 3I8OA 3RYCA 2JGKA 2WSBA 1YC2A 4N9QA 5BR1A 2XE8A 4HDOB 3GDWA 4OIFA 1JG6A 1JHUA 1PNTA 1QTIA 4EJMA 5EKSA 3ETEA 2PGJA 1ST3A 2HA7A 1JN0A 3OSZA 3GB9A 1WZIA 3G1TA 2QUJA 3ZCTA 2ZSBA 5FD8A 4BVJA 1G21E 1WMBA 5DSZA 1X7YA 4CCWA 4G5XA 3WWEA 1T4DA 2J0QA 4D57A 2B4AA 3WK4A 1PE0A 4O33A 1SIUA 1Z6GA 4AG6A 4YP6A 4AQYB 4NP6A 2B99A 1C3XA 5EHZA 5JI2E 1A9TA 5ICSA 5K0EA 4RD2A 4HYQA 4QM6A 1BXRA 4IJ5A 2B4QA 4JUCA 1ZBDA 3U13A 3TG2A 2YC4C 2YIJA 4KIUA 1P62B 3IMEA 2JIBA 3Q5EA 5DGDA 4K6GA 2RB4A 4PWYA 4P58A 1XN1A 3VTZA 3K70D 3FNQA 2ADFA 5CLLA 3TQQA 1PI3A 3U4IA 4JCCA 2ONYA 2OV4A 3AI3A 1GG8A 2V4MA 2X6RA 4JWKA 4KXYA 3FIUA 1JA9A 3BEDA 5IUJC 1EK6A 4GPZA 5AW4A 1A50B 3L4EA 3R7AA 1BU8A 3WMFA 3VR4H 1E2QA 5AFSA 3FPJA 3H83A 4TN1A 4HS9A 3WLEA 5C80A 1JDBC 1D07A 1RYYA 1YZGA 2CJFA 3F6EX 4LRUA 4NTZA 4RV5A 1RQPA 1IY1A 4RPCA 4RVFA 5AP9A 5H68A 5HQ3A 3TQRA 4C2UA 1W1IA 2WICA 2LPMA 1NZFA 3CS3A 1BH2A 4G63A 2K87A 4DLLA 1J9ZA 4DQ0A 3L6BA 1Z4MA 3V7YA 4CCSA 4DHWA 1QRTA 3A1TA 2YXDA 1FJXA 4IFIA 1QIDA 4A0FA 1IK6A 1ORDA 3QH4A 4H7PA 3KPWA 1PR4A 3TTWA 4E4YA 4CIVA 4M7OA 5F3WB 1CZUA 3M6MD 4IJVA 1DEOA 2QRMA 1NF9A 3L6RA 4ZVPA 4JFRA 4XWOA 4Z6KA 2MR6A 5FO0A 2CXUA 2CE7A 1EFTA 1EFKA 2XUZA 4OGGA 1UBEA 1Z5WA 2CNKA 2P6UA 4J0KA 4WUTA 4E2XA 2Q07A 1ECFA 1KZGB 4CEHA 1OB2A 3WLSA 4WK4B 2BR4A 1P4GA 3HUEA 2O0LA 3BCHA 3C3WA 3CRMA 1X1TA 4JC5A 1RJDA 4QQFA 5TS3A 2IDKA 1OKKD 1NUPA 3SKYA 3EFOA 3B5EA 4QJ5A 4Y6PA 2FK7A 4LJ6A 3IVCA 5AK4A 4WAUA 3PHGA 4MV5A 5AKZA 5EP3A 3FF1A 3QE3A 3OZSA 3QY9A 3VOAA 2QLMA 4A26A 4QVKA 2BBTA 1UFQA 3F9CA 2FPRA 5IBRA 4FN4A 4AYXA 3IP6A 4JJFA 4XE5A 4UFPA 3EE6A 1SCNE 3M5DA 2IEGA 1L8AA 4DOMA 4DZTA 1QH8A 3FUWA 5B2ZA 1QIJA 3OA0A 4P7GA 4OI2A 2RI0A 3ZDYB 4AJEA 4Z3OA 4PGAA 3VHXA 4GICA 5F2EA 1NQ5A 5A6SB 3VNBA 1GTSA 1E3LA 4B3SB 5JZOA 4V38A 2WHPB 4IHJA 2PU7A 1SH7A 2ST1A 3KU1A 4AN0A 4I4IA 4DUPA 5IH3A 4BATA 3SR4A 3GMTA 2VK2A 3NETA 2J9GA 1KSJA 2GN9A 5IAJA 1FDIA 3KFLA 1IMOA 5EI5A 1N6OA 2OBLA 4X7PA 2WTBA 2YS6A 1HGXA 4Q3BA 2PUHA 1D0SA 2IPAB 1TVMA 3CUWA 4BZXA 2YNMC 3HU3A 5CDFA 5A02A 3K31A 4GXQA 1GA4A 1SK8A 2D2XA 1QHXA 3Q7EA 4FLFA 3A4IA 4C7BA 7MDHA 2F90A 4G67A 2WMYA 3B5JA 3OZIA 3S28A 2Q5FA 3PEWA 3I12A 3GFRA 1TZMA 2QTCA 4ETIA 4ZIRA 3QG1A 1UM8A 1U2RA 1ULUA 2GDZA 4F3KA 5JZSA 2PUCA 3OPNA 4YI3A 5E7QA 1WHSB 1ZUNB 1W59A 3FDIA 3EMVA 4JK3A 4PQGA 1N9GA 3A1SA 1E1NA 4QUJA 3UTCA 3D5EA 4H59A 4EI8A 2W6QA 4L5IA 5LKRA 1SC6A 1YJCA 4ANFA 3V3KA 2A35A 5F5NA 1MJNA 1ZM2A 1N2BA 4IIEA 4BVAA 1RLMA 2QPTA 2NT4A 1Q11A 2ZOSA 1BAPA 3A6KA 4LF9B 2E5FA 3EA5A 3OFVA 1B26A 5EHQA 1DQYA 1NRJB 2OBBA 3CTMA 2GAOA 3VZRA 3HR7A 4ZI7B 2AIRA 5BW4A 2RHRA 5DXFA 4BX0A 5B1YA 1BHO1 1R0LA 3OEEA 3R9IA 4F38A 1NHGA 2OGSA 1L1RA 1PP4A 1WABA 3K9LA 4N47A 4FM9A 1FVOA 2Q0SA 4RF3A 2MSDB 5EZ6B 3ADOA 5JADA 1Y4ZA 1CZNA 3F46A 2FFQA 1UINA 1KZ7B 1DARA 3O1HB 2QX9A 5FNVB 2MYTA 1V6SA 3GF4A 1F9AA 4GH5A 4J9VA 2C4MA 3CU5A 3PQ7A 4D9FA 1V6AA 4RHFA 1D0IA 1MAVA 4PZAA 5FBKA 2HMTA 4DILA 3QOXA 1EWKA 4CU5A 2PXHA 1J8MF 1G20E 4PLZA 2Y1LA 3WA6A 4DA9A 2XZOA 3P9NA 1L7BA 1O87A 2H57A 3JYQA 3VSCA 1SCJA 3TSAA 4CMHA 3SXPA 1ZO8A 4D8UA 4JOQA 1C3VA 3O8QA 4EZBA 1HTWA 1KK1A 3D1JA 1C7FA 1MO2A 3TZBA 3PWKA 4NE7A 3QBVA 2E55A 3VJMA 2ZSKA 2NYAA 4ZI2A 3L8HA 5K0ZA 5KS2A 1L4MA 3T1QA 1H1LA 3CC8A 1E4VA 1QBGA 1V5FA 3I1YA 3GZNB 4KW7A 4F86A 1UPTA 5KB3A 1KMCA 4UASA 2G71A 4EJSC 1V3UA 3SC2B 1LDMA 4TKVA 4NYIQ 1GHTA 3BXGA 1VJRA 3GK3A 4KIJA 1IXZA 1YOVA 4C05A 1D4FA 1XB2A 4A15A 1S9HA 1HLPA 4EHBA 3D8NA 2D5IA 4OHFA 4RK1A 1H42A 1CQXA 4NCIA 2EWMA 1ZA2A 3O92A 3B8EA 4Z49A 3G0HA 4YJ3A 4GC5A 3H04A 4N6OA 4HLDA 3OEYA 1XVAA 4J7XA 4OGKA 5JQGA 4R7TA 1Q0LA 2CMGA 1N0IA 3MUOA