2YNMA

Structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
ALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR
publication title Structure of Adp-Aluminium Fluoride-Stabilized Protochlorophyllide Oxidoreductase Complex.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Oxidoreductase
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ynmA00
1SVLA 2GETA 1DO0A 2ZTSA 2WWFA 4PTLA 1LW7A 4P33A 4BUJA 3K1JA 1GZSA 3NG1A 2VP2A 5FBRB 3FDIA 4AYWA 2ZSAA 2A9KA 3CPEA 1JNYA 1IY0A 5HR5A 3BRWD 4DSNA 1DBSA 4D0LB 1P72A 3E1SA 3U7EB 2RGEA 3W8RA 2H5EA 3LDAA 4AURA 2IYZA 2JASA 4D26A 3Q8XB 4US1R 2NTYC 3VQTA 3TSWA 5J47A 3M1IA 4C0HA 1JR3D 1P2UA 2V4ZA 4GT1A 5TXGA 4D81A 3DKVA 2AK3A 4YQFA 3GLGA 1XPOA 2P67A 3A36A 5DI3B 2GWHA 2WJHA 1Z22A 2QPOA 1Z0KA 2JLYA 2GVZC 3U7GA 4LJ9A 1NSFA 5FOSA 3SOPA 3I62A 1G5RA 1SVOA 3C4JA 4R98A 2XAUA 1CR4A 1E9SA 3REFA 1TQDA 2LCFA 5FTMA 2ZRHA 4QBIA 2QI9C 1EX6A 4DCSA 3NH9A 1LS6A 3UMRA 1S3SA 4A8JC 4GOJA 1FL9A 2LKCA 3GJ0A 1OHHD 1YHNA 4DIDA 1NMZA 4Z54A 4C0KA 4C2UA 1QHHA 4JIMA 4B47A 4MRPA 4KBFA 4BFXA 1KTVA 5FL7A 4M9ZA 4Q9JA 1TU4A 4D4JA 1OH6A 1OXVA 2Z43A 1QG4A 3RANA 4XVUA 1RZ3A 5FH9A 1CJUC 2E87A 3K70B 1N6KA 2IYTA 4XTCS 2FJUA 4JMPA 4PANA 2B21A 3M4YA 4DCUA 5JJKA 5CM9C 4HEJA 2HT1A 2D62A 1JEEA 2MSCB 3OEEA 4LOAA 3QQ5A 4R71A 2QRZA 4V02A 4L4UA 4DWJA 4BPBA 3M0EA 1FUKA 5HE8A 2OLJA 1G6OA 5IRCD 4LJYA 4Y0AA 1NY5A 3P27A 1GM5A 2FSGA 3TMKA 5FPSA 1W7AA 1G8FA 4JLDA 1KI2A 1Z29A 2JJ8A 1KI9A 3DHWC 4URYR 3AKCA 4L8GA 2G83A 3JZMA 3RS3A 2XJ4A 4NYJQ 5EP2A 2RGAA 3EIHA 3C15C 3OE7A 4OHXA 2KE5A 2VHCA 2IX3A 4RZXA 2SHKA 4QL3A 2ZRFA 2N46A 4KLZA 4X8LA 2GJKA 2WKRA 3D8BA 2GAAA 3W3AA 2HF8A 4C2TA 3QKTA 3ZD7A 4Q1EA 3BJIC 2BCGY 4GDFA 2A2ZA 3U6KA 2DY1A 4LYHA 5FTLA 2JJ1A 5G41A 3I5YA 1SULA 2XJ9A 3CPJB 1XMVA 4GSYA 1XMSA 3VX3A 2R6DA 2OILA 3TK1A 3LBHA 1NLYA 3LVQE 1JBKA 1MO5A 3TE6A 3U5ZB 2PMDA 1QRAA 1EFTA 4H9GA 2D74A 4LJ5A 4QM6A 5BYJA 5HCIA 1KI1A 3QI2A 4DSTA 2GEUA 5KDDA 3W5IA 3B1ZA 1KI6A 2ZVPX 4PX9A 2Q0HA 4TT3A 4DUGA 2C95A 4C0QC 3HU3A 4W9MC 4M9QA 3UIEA 3TSZA 4TSFA 4NTZA 5E95A 3GJ7A 3GLFE 2FE4A 1T3HA 2C2HA 2F1JA 2VSFA 1E2QA 4C9BA 1AZTA 4JLOA 3OAAA 1SXJA 3UKDA 4Q4LA 4DLUA 2HDNB 4LBVA 4PQYA 3RS7A 1QZXA 1A7JA 4IW3B 1U0LA 1S2MA 3LX8A 5A5GA 1F5NA 1UBGA 3IQXA 4NH0A 5FUWA 2B7BA 4B2PA 3TIFA 1YE8A 1YR9A 2NO9A 3IIKA 2XZLA 3PENA 5J4HA 1XEXA 1BKDR 1DS6A 2Z4RA 4B35A 1NKTA 5DHFA 3TUZC 1MRNA 2Q3MA 2Z83A 1R0YA 2J46A 2ANBA 3OFND 4M9XA 4WXPA 2CE7A 3TJZA 4TZ6A 1E2EA 4P4SA 3TH5A 3AVXA 3EA5A 3AEZA 4H1UA 4LJ7A 2CHGA 4LYFA 4ACAA 1ZU4A 1G7CA 3F0TA 4QJ4A 4TQUS 4DZZA 5AUNB 3ADCA 4Q01A 2IWRA 1XXHE 2Z0MA 2YV5A 3L2OB 3P1JA 5H1YA 4LDJA 1N6LA 2A3RA 3JZAA 4DDWA 1OH7A 4LV8B 1MO6A 1ZCAA 2F43B 2GTPA 4XD7A 1RW4A 1G7SA 4CT4B 1XBTA 1NVXQ 4R9UC 5FTNA 2OLKA 3LLMA 3PV0A 1EWRA 4CW7A 2G0NA 4HLQB 2HT6A 1S4QA 5B58C 2RGCA 1AA9A 4GOKA 3AM1A 3A6PC 4MKIA 2MMGA 4O25A 1JB1A 3VR3A 4EPXA 4KLNA 4F93B 2ZE7A 3PQCA 2AXNA 1N6RA 1UDWA 1E9FA 1H8EA 1W2HA 2WSMA 4HYYA 4TMKA 5DHAA 3NBXX 3OHMA 2D7DA 4IEIA 3THYB 3EC1A 1BMFA 3QKSB 1KI3A 3W6PA 4Q4AB 5KSYA 2H92A 2PBRA 3W90A 2IS1A 3ZLJA 1F2TA 1P60A 2QG6A 4QHSA 4RCYA 1UAAA 4US0R 4TQ9A 1R6BX 4LI0A 5KOYA 4XSHA 2BJVA 3OEHD 5IK2D 1DADA 1M74A 1WF3A 5FPTA 3BBPA 3IBYA 3H0KA 4QGAA 2RGXA 2VF7A 2AR7A 4QGFA 2J0SA 4G3XA 5DISB 3NBYC 3TKLA 4BFZA 4JL8A 1KSFX 1R7RA 3PITA 1AKYA 1JXOA 1ANKA 1PVOA 4JVMA 4HB2A 4II7A 2NIPA 2O5VA 3R9IA 5H8WA 3FMPB 4D82A 4QKQA 5CYPA 4OHWA 5KSOA 4MDFA 1VG1A 4GPTA 1Z07A 4KCGA 4PPGA 1LS1A 3ZYCA 5C4MA 1M7GA 1OXUA 2AFIE 4TYYA 5DI9A 2OBMA 2WVJA 1EFHA 3U60B 1ZYUA 1VHTA 1G16A 2EVWX 4NYMQ 1T6NA 2H16A 4ON9A 4A2WA 2PEZA 2WOOA 4JS0A 3S1AA 1KOFA 1I4DD 4RZ3A 2UVQA 2W6JA 2QM7A 2XTZA 2AHOA 4P0TA 4W7SA 1IM2A 4A6XA 2H18A 4PC3A 1JALA 1N0WA 2YC4C 3PUZA 3GLIE 1W5TA 1PLJA 3HPQA 1FTNA 4QJ3A 1XU4A 1OKKD 5JRJA 5C1BA 4JLPA 4RJLA 3U3RA 3OZXA 2DHRA 2VBCA 3UATA 4QC2A 2FMXA 1OB2A 4DDTA 2YVUA 2VP0A 2FWRA 1XNJA 5JCZA 4MYUA 2R8RA 3WP1B 2O8BA 2IT1A 4ARZA 2VL7A 2YKGA 1G7TA 3W5JA 1I2DA 1Q57A 1UDXA 3B7GA 2VP4A 3TVDA 1ZMXA 2JGNA 2PT7A 4EUNA 3NVAA 4BFWA 4LHXA 2HLDA 3LRPA 1JJ7A 2FZLA 3NXSA 3SJBA 3WRYC 1F60A 4PHGA 3K0FA 3K9LA 5F9HA 5KDLA 1QHHB 1VCMA 2IYVA 5CJPA 5DGXA 1DAIA 4JL5A 3AH8A 4MKHA 3IQWA 1G20E 1G8PA 2RGBA 3EZ2A 4L5BA 4KSBA 3R8FA 2ZRGA 2BIFA 5CIWA 1DAMA 2QP9X 3B1VA 1XEWX 1XTJA 4D6PA 4DIEA 3O8CA 2ZS9A 4BLSA 4CYMA 2V3CC 1FMJA 2R6GA 3KJIA 1NIPA 5BYKA 4NPHA 3T1OA 2JA1A 2UZ3A 4ZDJA 1Z6GA 5CLQA 1U99A 3QSYA 3N70A 4UKDA 5H70A 3VMFA 2R2AA 3K0EA 1VYUA 4WW0A 1Z28A 4MKFA 4DEYA 4OHYA 5L3QB 1LV7A 4OQNA 1EXMA 2OCYC 4BE7B 2MMCA 1GAJA 1T4GA 2R9VA 4BFVA 2ZI4A 4NCNA 2QSYA 4TMWA 3NTUA 2DYKA 1ZRHA 5JCPA 4DLSA 1SKYE 3FFAA 1TUEA 4CEJA 4LHZA 5FOWA 4ZV4A 3KQKA 1CLUA 1G19A 2L0XA 2QAGB 1BS1A 2WTUA 2QPTA 3P26A 2OUKA 4GMDA 2QM8A 1A4RA 221PA 5JS7A 4TZ0A 4QOSA 2I4IA 4JLAA 4DCVA 1W46A 3ICEA 1GUAA 2Y8EA 2RH5A 4L9SA 3AKEA 5F98A 3REGA 3LD9A 2EYUA 1N6IA 2E9SA 2J9RA 2X19A 2QU8A 3KKOA 3ZZ0A 3C8UA 1KYIA 4LJ4A 1P3JA 4KHZA 2YHSA 1MH1A 1OH5A 3ZQ6A 4ITRC 2ODNA 1HV8A 4BFSA 3T61A 5C4GB 3K9GA 2OBNA 3TSOA 5JWOA 2RCNA 5EE0A 3D31A 1NKSA 2GK6A 2OT3B 2C96A 4Q9KA 4M1MA 3TAUA 2PZEA 2ZI7A 4DLWA 3KTAA 3CWQA 5F2EA 1CEEA 2HJGA 2ZIAA 5TDHA 1T5IA 4N3NA 5DI3A 5EZ6B 5J4YA 2J7PD 2GF9A 4M1SA 2WIBA 4EPRA 3V9PA 4B3XA 5CYOA 1E79A 4UQOA 4AG5A 4FXPA 1HQYE 1E2GA 5KHOC 2D2FA 1K6MA 2QMOA 2FU5C 5AJXA 4CRWB 2CHVA 1QHXA 3B78A 3HWSA 3GPLA 2GXQA 5A0FA 4C0AC 5CB6A 1FQKA 2Q9AA 2NQ2C 3WP0A 3GJ4A 3QY0A 4BQSA 2HCJB 1HURA 3AVOA 3WHKA 3RYTC 1IN6A 4IFEA 2NO0A 3KX2A 2WBLC 3QXHA 3CR7A 4TL7A 3PCRB 4PQFA 1E1QA 5HKKA 4HAWA 1L4YA 3BIFA 1N25A 1W2GA 3EIEA 3Q7QA 5BN4A 3EARA 3W6NA 1Q1BA 2V6IA 3MAAC 1KJWA 2Q9BA 1U90A 3SU8A 4DLZA 4BEJA 1T8TA 5FPHA 3OF5A 4EPVA 2CVFA 5GADl 1GDDA 4M1KA 2XB4A 4KV9A 2VA8A 4ZDWA 3NHBA 5FI0B 3G82C 3K0CC 2RAPA 2QMUA 5KNCA 2IYRA 1AGRA 3HDTA 2ZU6A 2XSZA 2GJ8A 2GKSA 4G5QA 1MO3A 3LXXA 2ZU0C 2QSZA 2ZRDA 2XOKD 4IDPA 4UXJA 2QGNA 4ZI2A 2CLCX 1Q12A 2I1VB 3SBDA 1P2SA 1JR3E 2BM0A 2VF8A 2ANCA 3LAWA 4DXAA 5CB8A 4MUAA 3UPUA 4OJQA 2GRJA 3A37A 4A92A 3IKJA 2CJWA 2PT5A 2YWEA 2GESA 4D4MA 2NZ8A 4U00A 4P32A 1OFTA 1GRRA 1MABA 1TF5A 4KYUA 4QBFA 4YC7A 3D6TB 2FDCA 3NDBB 1FZQA 2WAYA 4M2LA 1WBBA 1M2OB 3TNFA 3RSLA 2CK3D 2J7KA 3VX4A 4F4IA 4CIDA 1ELOA 1SHKA 2J5XA 4XOIA 2GJ9A 2G9NA 3W9YA 2ZI3A 2CDNA 1AZSC 1IXRC 1CJTC 4DKXA 1WRBA 1XXHB 5SZIA 1U8ZA 3FKSD 3G0HA 4J0QA 3D7MA 1YR7A 1U0HC 1U94A 4LBYA 2F3RA 5J4KA 1P61B 4YMWA 4LK2A 2EWWA 3FWYA 5FL3A 3U44A 1S1MA 2RGNA 2FA9A 4LZZA 1Q44A 4LGMA 3TR0A 4G0NA 2J1LA 3I61A 1RC8A 3TUJC 4KVGA 3CRW1 4KAXA 1JI0A 2B92A 5CDFE 1LF0A 5KNBA 2JLSA 3CIOA 3LX5A 1COWD 5EXPA 4ZIRA 2J0QA 4C0LA 1LB1B 3AP2A 1FW6A 1KDTA 3S1AB 3Q5DA 2GXUA 4WOPA 3I8SA 1JR3A 1CR2A 3THWB 3R8CA 4X8MA 1E2JA 2VTKA 3HPRA 3Q85A 3IEUA 4DJTA 1HT2E 3I32A 1ESMA 4JJKA 2MSDB 5E7MA 1VCOA 1XTIA 5C46F 4WZAE 4TLAA 1KSJA 4JT4A 5D3MA 1E2HA 2FPKA 3TR5A 4HAUA 1XCPA 1IN7A 3RABA 1TEXA 2C9OA 2PMKA 2EFDB 3K9HA 4GRAA 3ADBA 2DFNA 3RRZA 1NBMD 2JLRA 2IYSA 2ZJZA 5ANRB 1E98A 4WZBE 1OHHA 1EX7A 3GCGA 4XWOA 2QZ4A 3ZVLA 3UG7A 2ZJ5A 1F2UB 4NE2A 1A5TA 5GJCA 1J8YF 4B71A 3QE0A 3NC0C 3EPKA 3PEYA 4Q19A 3X1YA 1P4SA 3QEOA 3CRMA 2X2EA 4RKEA 1JAHA 1MR3F 2WWWA 1OSNA 1ZM3A 2EU8A 2HYDA 3GFPA 4DCTA 4P3YA 2V9PA 2P6UA 2OG2A 2ZITA 5EP4A 1KZ7B 2IC5A 3THYA 2DBYA 3QKSA 5HZHA 1VYVA 3U44B 4Q4AA 5AUQA 4ZKDA 4IDNA 1KKMA 3MCAA 1KSHA 4EPWA 2ZANA 1CF4A 1R5OA 4YMTA 4EQ6A 4RD4A 1GP2A 2ODBA 2JJ2D 2O0HA 2GAOA 4PO9A 3SR0A 1G17A 4LBWA 5KDOA 1J90A 1W4CA 1G9XA 3THOA 1MV5A 1G3IA 4I1VA 1H65A 2WWYA 4Q7KA 2F3TA 1TQ2A 2WSSA 1BYIA 1S9DA 1HE1C 4UNPA 1GRQA 3RAPR 4POAA 1IN4A 3NEYA 4BWYA 4A8JA 3LVRE 1GL6A 2HUPA 3BB4A 2B7CA 4A0FA 4D25A 2F1IA 3GEEA 3QXCA 4JKIA 1GNQA 3LW7A 4PXAA 2VP9A 4LWZA 3CF6R 3RC8A 1ODFA 4OQLA 1YRBA 4CEIA 3VKHA 5JRZA 2G1KA 2FH5B 2A5FA 2IHYA 4AY2A 3FPAA 2HV8A 1BOFA 4HATA 4WVFA 1EG7A 1RPZA 4D0GA 3QVUA 3CLVA 5GJVC 3VNVA 1DO2A 4B3BA 1EFUA 4PO8A 5DYIA 4KVAA 2ZRPA 4FW9A 3NWJA 2WOJA 4ESVA 2BKEA 2ZRBA 5DN6A 3KTAB 4ZDKA 3AVPA 1Z08A 3QJYA 4Z51A 3BH7A 3ICQB 1NL3A 2R6FA 3P20A 4Q9LA 2FEOA 3WBKA 2FFBA 2JLZA 5FOXA 3B1YA 3K09C 4KXFB 3C41J 2WV9A 4D2IA 3FFBA 1SKYB 2ORVA 2ZUBA 5CM8B 4G5SA 4IKEA 1XTKA 2ONJA 3U6BA 2YOFA 4TLCA 1ZCBA 2BV3A 3CR8A 4DHEA 1KDOA 2YZ2A 4LPKA 5CK5A 3L0SA 3KXIA 4OQMA 4YMSA 1XZPA 3GQBA 4HLUC 1OE0A 4D4LA 5FPYA 3HP1A 4U7DA 1CIPA 1S0UA 1UKVY 3MWLA 3BH0A 1VG8A 1GITA 1XJCA 4URXR 121PA 1PV4A 4CEHA 5IT5A 5G53C 1W0JD 3ASYA 4PZZA 4M53A 5FFMA 2P5SA 4RKFA 1AK2A 1HEIA 4IOLA 3SNHA 4AIIA 1II8A 4DB2A 1R8QA 2QROA 3DPUA 3I4LA 4LUCA 1U9IC 1Z6YA 1P9RA 3TAHA 3GJ5A 4MYCA 2F9MA 4Z1MD 1P9NA 5FTKA 4Q66C 5DO9A 5L3QA 3MWKA 1PLLA 4KJZA 3EWAA 2GVDC 2OESA 4MYHA 2ZR0A 4FN5A 1D9XA 3D3QA 3ETLA 2LKDA 4PPQA 4R7ZA 5KSPA 1FX0A 1Z0AA 3PUVA 4FMDF 3Q7PA 4MQBA 2CE2X 4E03A 1FP6A 4ESHA 2J0UA 4TTPA 4DLTA 2AXPA 3T35A 2IHBA 1FUUA 2IEZA 2WJGA 1D6JA 3EIQA 1OV4A 4NONA 2QAGA 2DPXA 2PH1A 1NIJA 2RGDA 3H2YA 3MWJA 4UNNA 1KO4A 4ASUD 1Z5ZA 1KI7A 1Q1EA 4YXWA 2D2EA 1NNEA 1OIWA 3NBZC 4B6FA 1KAGA 1T8UA 1W36B 1XP8A 4PHFA 4LHWA 3KKPA 3IGFA 1W4RA 1WMSA 2IK8A 3OEHA 3UG6A 4EJSC 3QKRB 2CJWB 4PAQA 2ZEJA 3CONA 1NJFA 2VLIA 4ZDIA 4MRSA 2ZI5A 4NYIR 2BMJA 3DM5A 1X1RA 1YZGA 4JT2A 2EQBA 4M1YA 4WIAA 4A2QA 1Z6XA 2PLRA 4Q1AA 1MABB 2ZSDA 3TW8B 1W44A 1KY2A 1W0KD 3QPVA 2VSXA 1KZGB 1R10A 5FPKA 4H1VA 1DAFA 1LTQA 1ONBA 1W5SA 1ZW6A 5LD2B 4EPTA 4PAMA 1E1RA 3L0OA 1M8PA 5EXSA 3DMDA 2B8TA 4AKGA 2P5TB 2REBA 3M6AA 4QNRA 3IO3A 1JJVA 4V0OA 4AKIA 1G7RA 2ZS7A 3BH6A 1AS0A 1Z6AA 521PA 2G0TA 4C3ZA 5CJ2A 2J45A 2Z5FA 2BKUA 1JPNA 4IDQA 3T1TA 5AJYA 4AC9A 1SVKA 1XTSA 3CRQA 1NI3A 4AYXA 4ZIRB 4DLYA 3GEIA 3RS0A 1S9HA 5KPJA 4ABYA 3ZDQA 4F4CA 5AUOB 2TMKA 1X86B 1X8LA 3CW2A 1M7BA 2FSFA 1G1MA 4E07A 3SZRA 4JLJA 1A2BA 1NN0A 1OFHA 5CLLA 2CNWD 1QG2A 3EC2A 1AS2A 3ASZA 4MGZR 4PC7A 4S2EA 4FWTA 1F48A 4Q9HA 5D3MB 3GFTA 1DE0A 1HYQA 1WE2A 2RGGA 3OIYA 1NVUQ 4F92B 4CT5A 5L3RA 5K8UA 3R9WA 3AF2A 3AKDA 3O8BA 2OCPA 5B64A 2IS4A 1VDZA 3KKNA 3RDPA 2GDJA 1DAKA 1GOTA 1NVVQ 3BXZA 4DDUA 2HCBA 4XVRA 3AVWA 4N0EA 2VEDA 4GMXA 5EE5B 5KTYA 5EXXA 4NP6A 1VCNA 4B3DA 3GLFA 3ZVMA 5FL7D 2JLXA 4E5UA 5G3YA 4IOMA 4HAXA 1JXMA 4UJ3A 1EK0A 2YWHA 2ZR7A 5JHGB 2ZAOA 4K46A 1D9ZA 1E94E 1QDEA 3UWOA 4GI7A 3T34A 3PVSA 2VQSA 1OPXA 3WYFA 4HB4A 4RY2A 2VP5A 1KO7A 3P4YA 3QF4B 1TU3A 3KFXA 1WCV1 4QM7A 3KXLA 1E2MA 4W5HA 3I1FA 5JMTA 4V03A 1LY1A 3ZGXA 3KL4A 4TWZA 3SFZA 4MDEA 1OYYA 3SFVA 4DLRA 4CF7A 3SJCA 4EFMA 4AG6A 4N1AA 5JWHA 4EQ6B 1YZKA 1KMHB 2BBSA 3QBVA 1YR6A 4RFSB 4PZLA 1PUIA 1G3MA 1GWNA 1NMXA 4IDOA 2VIIA 4GZLA 4KBGA 3OE7D 1KY3A 1ZAKA 3LWNA 4XWAA 3BS4A 4KODA 2JLVA 1DG3A 4U02A 2ZRMA 1TQ4A 2KJQA 4O2LA 2ZE5A 1XXHA 1GL7A 2FX3A 5TY0A 3P4XA 1G41A 3BD9A 3W34A 4A8JB 3KJEA 3BERA 1S96A 2ZRJA 3B9QA 2WZQA 3CRRA 4B3CA 4IXNA 3U3MA 4MRVA 3AQ4A 1BYUA 1GILA 1TF7A 4CEIB 1R5BA 1E4YA 1XTRA 2W6ID 4X8OA 3KJHA 3WNDA 3ZS8A 2QTHA 4HI0E 3AGQA 1ZD1A 4V0ME 4O3MA 4KFTA 4JLVA 2BCJQ 4GBMA 3BFXA 4GL2A 4RFVA 4FCVA 3AUYA 3LXRA 4B34A 2W58A 4C7OA 3I3SR 4FCTA 3THWA 3K9NA 4JKYA 1E69A 2QE7D 3KDSE 1N5IA 4Q1FA 4AKHA 4TL8A 4DUGD 2O8CB 4QGHA 2WMNB 2J7PA 3EXAA 4HAYA 1NN1A 1E0JA 3SHWA 4TSFD 4C0JA 1N0UA 4DLVA 4OI0A 2GEDA 1JR6A 1FFHA 2FPLA 5KUTA 2PJRA 3OAAD 1SXJD 1CP2A 3CZPA 3BE4A 4C0SA 2ZETA 2V55B 3MWYW 2ZROA 1T0JB 2D4HA 3B9PA 1D8TA 1EFRD 4US2R 4NYJR 4F7WA 3K8YA 4CGZA 2B6HA 2XITA 1A1VA 2C98A 4MRRA 3UK6A 1MKYA 1NP6A 4BECA 1F2UA 4B3FX 3IHLA 1I2MA 4OI4A 1G3QA 1LVGA 3J81k 1G64A 3QXSA 5FBWB 2A5GA 4TMXA 4DBLC 2PZFA 1HH4A 1SHZA 1CRQA 1GRNA 3WYAA 4CEHB 2AFHE 2V7QA 4MGIR 3R20A 2F7SA 5IHPA 4M4SA 5DE3A 1UPTA 1P2VA 1OFUX 4GNKA 3CX7A 2O8FA 1W48A 1II8B 1E9AA 4OI2A 4XVQA 3AV0B 3L82B 3TLXA 2V8OA 4NKRA 2VH5R 3VR4A 1N3BA 1CRPA 3GLIA 5EUMA 2VHJA 4XD7D 3GLHE 3F8TA 1XZQA 1E2FA 1G291 1XWIA 4X8HA 4DC9A 1QBKC 1KJYA 1JQLB 4RZ2A 3FOZA 3PG5A 1XD8A 5EE9A 1FX0B 2C9YA 1G5TA 1GNPA 3ND8A 3UANA 2J0UB 4DSUA 4LX0A 2W83A 4GZMA 3LBIA 3KUDA 3A4MA 2GBLA 1H8ED 1OW3B 1F6BA 2H1LA 1QHIA 4AK9A 3OIUA 1XFAA 4RCZA 1WBDA 1BMFD 3RC3A 1NRJB 4B44A 4A4DA 5K8IA 4RVCA 4P31A 4ACBA 2ERYA 2AWOA 2OV2A 3LNCA 3LQQA 1AGPA 3LH5A 4BRWA 1DOAA 2D06A 3A1TA 3RNLA 2ZPTX 4Q4JA 5L8VA 4B33A 2QQEA 2IYLD 1YU9A 4TMZA 4NCJA 4JBWA 4B73A 3EZFA 2WPDD 3LA6A 1XF9A 3CZQA 3CRVA 2V6JA 3A1WA 1CU1A 1C9KA 2DWQA 1NBME 2PJZA 2QP4A 3QENA 1SVWA 2DFTA 3RRNA 2Z6VA 1E2LA 2WWHA 2P0EA 2W2XA 5JS8A 4NCHA 1NMYA 1U98A 5L3SA 5LB4A 2GJSA 3FKSA 4KFUA 3U3OA 1VPLA 2F1HA 2WAXA 1M1YE 4TLEA 4UXHA 2YNMA 2FZ4A 2XNDA 1VECA 1VG9B 4P4UA 2DWOA 3MSXA 4G5RA 5UKDA 3L8ZA 4EKDA 1UBEA 1YZQA 3K0CA 2WJIA 5CIQA 3X1XA 5JJIA 3W8NA 3NIBA 4IVPA 4GP7A 1IXZA 1TF2A 2A5DA 3SYLA 2X1VA 3B2EA 3PJRA 3IUYA 1OFIA 1DG1G 2IXGA 5KPDA 1O3YA 3FHCB 4A0GA 3U3JA 1Z0FA 2CBZA 4FMDB 1RKBA 2XB2A 4A0RA 4HSEA 3QF7A 3O8DA 1UF9A 3AF3A 1O87A 4OKSA 2FOLA 3T06B 3T1VA 1VHLA 3L43A 1KK0A 1OJLA 5HCNA 1XPUA 2AD5A 4LRWA 2O0KA 3ZQJA 1ZNZA 3AP3A 3SYNA 3PEVA 1E9CA 721PA 5AR1A 4MUBA 5BN5A 2CCGA 1IXSB 1Q22A 4JBXA 3QXXA 1HT1E 4KFRA 3SS8A 1II9A 3QKUA 4TMTA 5TB5A 5HPYB 4HZUB 1GNRA 2YC2C 5TVKA 4EDHA 3NEJA 4F4JA 4UXIA 1E9DA 2NMVA 1M34E 2JEOA 1Q1ZA 3FVQA 3B6EA 1X8JA 2OHFA 1Z3IX 3PFIA 1WA5A 5EP3A 4BEBA 1OIXA 3W6OA 1UEJA 2XGJA 4XJXA 4LJAA 1HQCA 3VNUA 4JVLA 2WKPA 2QMHA 3UMFA 4DB4A 2QTVB 4XSGA 2QBYA 1T9HA 3AVTA 5G3ZA 2H8KA 4HAZA 5EE1A 3GLFB 1LFDB 1OXSC 3I73A 2UKDA 1VIYA 4Q7LA 2OM2A 4N0DA 2H7VA 5L3VA 1KK1A 421PA 2FNAA 2HF9A 4QGGA 5GJWC 5C2JB 1CR0A 2NO7A 2OSBA 4NYMR 3U2QA 1U8YA 2C9CA 1OXTA 5F9FA 3B82A 4JZKA 2G3YA 2BVNA 3TQCA 1KNQA 2BMDA 1P2TA 4WZ6A 5G40A 2G6BA 4TYWA 2XXAB 2EFCB 3QKRA 3TQFA 3WMFA 4PSVA 4KU4A 4LV5B 2GZDA 1AQYA 1UBFA 2R44A 4M0LA 2K5UA 3GJ8A 3IILA 4CVNA 5EJEA 1Q1QA 4ZKEA 1IAQA 2CMKA 2Z4SA 3A4NA 1RFLA 2MSEB 4I1OA 1XD2A 2E1RA 1IHUA 1K5GA 5DNYB 1VKJA 3E5HA 2Q9CA 2OCAA 4ZO4A 1E2PA 2QPAA 1H8HA 4PPFA 1KO1A 1N6PA 1B0UA 2RKOA 1ZM9A 2J3EA 3FE2A 5FR1A 3Q3JB 3CNOA 1ZC4A 2F1RA 2WMOB 3DOFA 3WNBA 3K70C 4R2IA 1YJ5A 4Q1DA 3TUIC 1OT3A 5B30A 2GA8A 1HTWA 5AJZA 2AD1A 1WQ1R 3X2SA 1TNDA 3PUWA 5H68A 1Y63A 1FP7A 1IONA 5J40A 3X1WA 4BASA 4YDHB 2DB3A 4LC0A 2O8DB 5EE3A 5KYKA 3CUEF 2VRWA 3IPYA 1TAGA 3LW8A 1Z83A 4JYCA 3UWKA 1MT0A 4C7OB 1V43A 1XCMA 2B8WA 2R6CA 4XH9B 4JLKA 3VR5A 1KMQA 5J5CA 1P73A 4ZCLA 1T91A 2DWPA 2UZIR 3K53A 2DR3A 1R4AA 4MGKR 3U4QB 3TW4A 2P6RA 1E79D 3FHTA 1RE0A 3FGNA 4HUQA 1UJ2A 4OK5A 3AGPA 4QBHA 4M1TA 2YOGA 3FYHA 2D3WA 4YMUA 1E2IA 4C30A 1Z2AA 2GXAA 3RWMB 2IW3A 3EWSA 2WHXA 2BEKA 3CNLA 1KIMA 4LC1A 5JBQA 1EWQA 2QENA 2QEQA 4MITA 3AUXA 1P6XA 5LBIA 4NYIQ 2BM1A 1RVDA 1W0JA 1GKIA 3RLFA 1FNNA 1XB2A 3K70D 3EX7C 2EYQA 1AS3A 1N6HA 2RB4A 1JEDA 2IF0A 1FNMA 1PUJA 2G88A 1ZD8A 3WBJA 5B57C 2OXRA 2QNRA 2P6NA 5CDFA 1YZLA 4TN1A 2EFHB 1E1QD 4MRNA 4U5XA 3CX6A 1QHSA 2AL7A 5HKKD 3QF4A 2WJYA 2ZRKA 1DAEA 1GKYA 4URVR 2O8FB 3SE0A 4I81A 5TV2A 2FPMA 4B2LA 4FD2A 3V00A 1ZUIA 4QHTA 3BB3A 3WXMA 2GXSA 3BOSA 4E22A 1WP9A 3DL0A 3ZVNA 2IL1A 4LV6A 2BHRA 1TUIA 4I1UA 3GLIB 1KMHA 3BWDD 4FMBB 2Q21A 4RD1A 4OBEA 2NO6A 4RFSA 3H86A 2C8VA 1SVSA 3K09A 1ZIOA 2ZUCA 4G5OA 3DM9B 1DAHA 2A5YB 3SHFA 3VU9A 4B74A 4Q4HA 1A82A 4ASUA 2KBFA 2WWIA 1MOZA 1CKEA 1IJFA 2IF2A 3BAFA 1FPMA 5FBLB 2F55A 2ERXA 2F6RA 5DSZA 4HLUA 1XJ0A 1LF5A 5SZJA 2YWGA 4A9AA 2QY9A 3KXKA 3GLGE 1S1CA 2ATXA 2NOAA 4YMVA 1I4LD 4Q02A 4W5WA 4OL0A 3E2IA 2IYQA 4QFMA 5TARA 3CBQA 4Q4JB 4AKEA 3T12A 2REXB 3EAQA 5HZKA 4LJ8A 3ZIAD 1W0KA 3OIVA 5EUQB 1P5ZB 4NL4H 4OK6A 4IRUB 1IN8A 4FMCF 4XWKA 1RYHA 3LO5A 2JIZD 5FTJA 2O8CA 5ELXA 2A78A 5L3SB 1T0HB 5JEEA 3QXJA 3UXMA 4A82A 1TQ6A 2XNSA 3IPXA 2BMEA 2FN4A 1NN3A 1P9WA 2VSOA 3C5HA 2QA5A 2Q3HA 4A6PA 1P7CA 5AJWA 1YRAA 1KK3A 2FFHA 4P4TA 3ZZUA 3RRMA 1NY6A 5J4LA 3THXB 1XMJA 3G5UA 1VMAA 1YZUA 5EZ5A 1IN5A 3MGCA 5FR2A 4W5JA 1GVNB 2ZXUA 2ONKA 3C14C 4NMMA 2IA5A 3BFKA 2CLSA 3CWZA 1SZPA 2G77B 3R9XA 4HZIA 1JQJC 1NG9A 2KB0A 2REOA 2ZS8A 2JLWA 2GCOA 3VTKA 1NLFA 2GF0A 2ZYWX 1N6OA 4PZYA 5JSZA 4V0NA 3I92A 4EJSA 5GVSA 3EASA 3ZD6A 2CNWA 3OFNA 3HYTA 4UNRA 1I4TD 3U3KA 1G6HA 1S8FA 4LYAA 1T3SA 1UKZA 3DEFA 2A30A 1Q20A 3SEAA 3SJAA 4DCNA 1CJMA 1DELA 1X6VA 2GILA 3PIRA 1DTSA 4JVNA 4WAUA 4EIWA 4IOJA 2GCNA 4FIDA 1G8HA 3EA0A 1AM4D 2IWHA 3EZ6A 5LDDC 3CB4A 3AVVA 4FWIB 1E6CA 1XEWY 2AWNA 3B5JA 4RSGA 4XIGS 5JHHB 4TYNA 1RRFA 3HU1A 4G5GA 1GFIA 1ZUNB 2IBMA 2VHQA 2JDID 2FEMA 4Z8YA 2QAJA 3HYRA 3KZ1E 3ADDA 1SKQA 1YKSA 4JVSB 2QBYB 3LBNA 3OIWA 2G1JA 4Q03A 4LCBA 4BLPA 821PA 2JAQA 2FGKA 3FMFA 2QT1A 5DYGA 4B43A 3BORA 4IEEA 4BFUA 4ZI3A 4L9WA 3O47A 4BLQA 1E9BA 4HUTA 1IY2A 1G4AE 4L15A 1B23P 3RS4A 1JPJA 1AQUA 1DPFA 1Q3TA 1Y3AA 5F3WB 1FMLA 1XMIA 4B48A 5DIFA 2ZJYA 3QNUA 4BZPA 4NU0A 1OF1A 1T3LA 2ZYUX 3QOFA 2ZJOA 4DT1B 5E3HA 5IK2A 5JJLA 1SXJE 4PC6A 1IBRA 1QHYA 2V54A 2IYYA 4JJZA 4PQRA 4I99A 3RHFA 3CF2A 2WSSD 1KDPA 4RD6A 1U8AA 2N1BA 2WKQA 2PZGA 3K0AB 4AD8A 3EW9A 1II0A 4BLRA 1HA3A 1XD2B 5JFGA 4Y0VA 4AYTA 2ZRNA 1D2MA 3IHWA 1Q3HA 2KSQA 2QT0A 2ZRAA 1CJVC 2ZSEA 3QIAA 3OESA 1UADA 1EESA 5CK4A 3QBTA 4UJ5A 3KJGA 1P75A 4Q7JB 2GK7A 2FGJA 3QG5A 1ZNWA 4JBYA 4PAOA 2QORA 2Q3FA 4URZR 4V0KA 2ZVQX 2CCJA 3CKLA 4ZCIA 2W6IA 3B13B 5JZVA 1ZC3A 4F38A 3BB1A 2YOHA 1U2RA 4EFLA 4OYHA 5JWRA 4RD3A 1VYTA 621PA 1A2KC 3IDQA 4M8NE 3SBEA 2ZRCA 1N2CE 2QL6A 1L2TA 4KITB 2QE7A 3DO6A 3IO5A 5DLQC 2PX3A 1UBCA 2D7CA 1TL7C 2ECKA 2ZYVX 4HLDA 3EPHA 5DN6D 1OKKA 3KFVA 4CDGA 3QVVA 1KNXA 1NG1A 1NN5A 5A4JA 2HYIC 4HZUA 4B6EA 3FTQA 2R62A 1J70A 5E4FA 2FG5A 3CX8A 1E0SA 1KKLA 2JCSA 2QAGC 3DDCA 4PR0A 4HUQB 3NC1C 1EFRA 2CCKA 4MA4A 4KYIB 3SYKA 3AB3A 3W3ZB 4Q7MB 1U0JA 1OIVA 2OO7A 2OZEA 2QMEA 2ASEA 1Z0IA 2JATA 2OE2A 4MYTA 1DEKA 5BQ5A 2DFKB 4DVGA 1CJKC 5TMPA 3H1TA 1FTSA 1N0VC 3MJHA 1TEVA 4NBSA 2OAP1 3QEJA 4OHZA 1SVMA 2RMKA 4BFTA 3O8RA 4A0HA 5SZHB 3LV8A 4JLMA 2C99A 3LQRA 1K8RA 4PSAA 2N42A 3ZVRA 1CS4C 2ODEA 1E4VA 1E3MA 2KWIA 1KSGA 2BBTA 4URUR 1G4UR 1X8KA 1XRJA 1Z2CA 2WICA 1TPZA 1UKYA 3ECCA 4HDCA 1S3GA 2XX3A 1YQTA 3OEED 1G18A 2WJJA 3R7WA 2O8EB 3VAAA 1WXQA 3BFVA 3MD0A 1G3RA 3ZH9B 3NKVA 4B2IA 3AKYA 5FOTA 4TLDA 4A1FA 2XXAA 4KSCA 3ND9A 1E96A 4M22A 3U7HB 1G8GA 2VHUA 1HY3A 4MKGA 2AKYA 3NHAA 1SXJC 2IXFA 3KUCA 1E2NA 3TGPA 3U61B 2RHMA 1KHTA 5K8TA 2PCJA 2YWFA 2WJVA 4IDHA 2IYUA 4WBSA 1N5LA 3ZJYA 4HB3A 3VU9B 1N5JA 4Q18A 5JLJA 4EFNA 3AF0A 3HR8A 4Q4HB 3B1WA 3ADKA 3B85A 3DMNA 3X1DA 4LBZA 4YXWD 1DARA 2OFXA 4PC1A 4TL6A 3MJRA 2AN9A 4IXMA 2ATVA 2HEIA 3PUXA 2JJ1D 1XPRA 1VTKA 1RJ9A 3I72A 5FBQB 3PXGA 2CL0X 4JLNA 3EPJA 5AWFC 4UNQA 1Z06A 4KI0A 2C77A 4O0MA 2WPDA 2YYZA 4OHVA 4Q9IA 3SI7A 3H84A 3F3YA 3MUFA 1ETUA 4L16A 1E0AA 1QF9A 5EQTA 2O8DA 2ZJ2A 4TYQA 3GD7A 1W1WA 1NJGA 1GKUB 5E7IA 5M04A 3ONWA 5BN3A 1IJEA 5GJBA 1GL9B 2GJAA 2XEXA 2KI5A 2XTNA 3QG1A 4GFDA 3GMTA 1F3OA 2ZE6A 2IUUA 2CL7X 2O0JA 1E1RD 3EG5A 4TT3D 2QTFA 3SC3A 5KNDA 4PFSA 3U4QA 4ILEA 5JI3E 4TQAA 1AN0A 2HXSA 4GP6A 5BW8A 4PO1A 4LYJA 2ZUDA 2X2FA 1KJZA 3PR1A 2FF7A 1NF3A 4MH0R 5JEDA 1Z63A 2W00A 3EZ9A 4JSTA 1E2KA 4TYPA 2X77A 4Q21A 4K81B 2OAQ1 3FMOB 2XZPA 3C16C 2ODWA 2V1XA 3LLUA 3T15A 2NO1A 2BEJA 3KQUA 2FSIA 1XJQA 2P2LA 2DFLA 2GZHA 2XTMA 1L4UA 3A4LA 2PEYA 3DZ8A 3N5CA 4XTRA 2CHQA 1XD9A 2GCOB 3GLGB 1AJEA 1TX4B 3N2EA 1U81A 4EJSB 5JSZB 3L0PA 5IDVA 1R0WA 2J0VA 1KK2A 2ZJAA 3MRSA 4B32A 2WM9B 3GJXC 1DAGA 4PHHA 1US8A 4V0MA 5FI1B 5LPNA 3X1ZA 4TTRA 3A58B 4BZQA 2V1UA 1GSIA 1TTTA 4NCIA 1E0KA 2I3BA 5HTKA 2IYWA 2BBOA 4HB0A 3SJZA 4B76A 1LNZA 1IQPA 3FMIA 4I4LA 2GHIA 4LHYA 4QRHA 4OQXA 3VKWA 1VG0B 2PLFA 3IEVA 3CM0A 3B60A 4I1SA 1K5DA 3JVVA 3EZ7A 4FMCB 4FI3C 4M9SA 1D2NA 3ZS9A 4DDVA 1EFCA 2YINC 2WWXA 3NBFA 3QPUA 3VR1A 1ZJ6A 1R8SA 1J99A 4A15A 1XEFA 3GJ3A 1IY1A 2AX4A 1QVRA 2ZQ5A 2W0MA 2BWJA 1E9RA 2XOKA 2R65A 4OK3A 2W2TA 3LY5A 2ZREA 1UFQA 3RS5A 4HDQB 4ZCMA 2XZOA 3T5DA 4PSKA 1L8QA 1UEIA 2IUSA 3PUYA 1CBUA 3WYGA 1ZU5A 3TVTA 4NZYA 1L7VC 1BO6A 1GTVA 2NPIA 4NDZA 2JLUA 5B2ZA 1Z0DA 4OJKA 2GNOA 2OFWA 3AF1A 2IYXA 1M6NA 2GCPA 4G01B 2YJTD 1KO8A 1E9EA 1UKEA 1YVDA 2ZRIA 4BRUA 4LPSA 4QNMA 3AVQA 1G3UA 1W4BA 4ZPXA 2J41A 3UMSA 2CK3A 3VFDA 4JLBA 3B1XA 2R6AA 2C04A 1OB5A 3SQXA 3BK7A 3FB4A 5P21A 2OCBA 1M7HA 4Q1BA 1ZINA 3KQHA 3NDPA 4TMVA 3BC1A 3WMGA 1E2DA 2CEAA 3GLHA 2I1QA 4Z8XA 4HLCA 2FFAA 3N2IA 5BWMA 1NVVR 5LB2A 4IVRA 4CZ2A 5GVRA 1C4OA 1W47A 3VKGA 2IXEA 4RD2A 1SGWA 3I8XA 1HE8B 3THXA 3F5FA 4K8OA 5BXQC 2ZI9A 1CR1A 1W4AA 2GEVA 1COWA 1PLKA 3CH4B 3WMEA 1DVRA 2HXYA 3CO5A 4TL9A 2JLQA 2W6JD 1RYFA 3L8YA 1VCIA 3RWOA 4RD0A 3WNCA 1KI6B 1XX6A 4PPNA 6Q21A 4M1WA 4Q48A 3T1QA 5AK0A 3QUSA 2EFEB 2P3SA 2W2VA 4S35A 3I5XA 3CPHA 3PEUA 3SQWA 3SN6A 3GP8A 3A1SA 1NVWQ 1XDBA 2ZE8A 1SQ5A 1KI4A 1SXJB 4TLBA 3MMPA 1SVIA 2VPPA 2PL3A 4WXRA 4D0NA 3HJNA 5KSZA 1GG2A 1QHGA 1YZNA 4Q00A 3RVBA 1NBMA 2GBLC 4QBGB 1OYWA 3CF0A 2VYFA 5FOVA 4MGYR 5EP1A 2HJVA 2CVHA 4BLOA 2ZYTX 4LHVA 2HLDD 5JECA 1XEXB 2NPFA 1EGAA 1AIPA 2IEYA 1Z0JA 4JYBA 4LSGA 2V7QD 3ZZTA 5CITA 3RS2A 4IHQA 4IOKA 2O52A 4P4SB 2NG1A 4NHOA 1RIFA 2C78A 2PX0A 4R2HA 4B75A 4PC2A 2ZI6A 4RZUA 5D3QA 4EAQA 2IS2A 4AI6A 1OXXK 4M21A 3R7WB 2JJ2A 4WA7A 1JAIA 4DT1A 2AK2A 4F91B 3KB2A 1R2QA 2FV8A 5KO2A 3WY9A 4YDSA 1IOZA 2ZM5A 2QN6A 4FCWA 1CULC 4HDOB 1ZM4A 3E70C 2QQ0A 1KGDA 2Q6TA 3K0AA 2BJWA 1GIAA 2WIAA 3C7KA 2FFQA 3Q5EA 5FBVB 2CXXA 3SDZA 1D5CA 2CL6X 4AWXA 4QJ5A 1R0XA 4JSYA 1C1YA 3RSOA 3KKMA 1KAOA 1N6NA 3FKQA 3T5GA 3VR6A 3WRXC 3V4FA 2QP3A 4URWR 1J8MF 3RRYA 4KO8A 1F2TB 1Q0UA 5FUYA 2PCLA 2GZAA 3A8TA 3CNNA 5AUPB 1E99A 1ZIPA 1RJ9B 3B8HA 4Q1CA 4KFSA 1ZM2A 4LJ6A 1PZNA 3TBKA 4IFBA 2EFGA 1RRPA 4HAVA 2IUTA 4Q47A 3ZIAA 1FOEB 1E32A 1Z6TA 2F9LA 2BOVA 2OBLA 1UM8A 3DVLA 3GJ6A 4NCKA 1NSTA 2JIZA 3L0IB 1J2JA 2EW1A 3CH5A 3DKPA 3QPWA 4QHYA 5K8LA 1XTQA 2A5JA 1G5PA 2XNDD 3K0SA 1RRCA 2KBEA 1G21E 1NLZA 3U7FB 1VIAA 1T5LA 1Z8FA 3A1VA 1JECA 3KB1A 5IF9A 2BC9A 1Z47A 3DOEA 1ZP6A 3MLEA 3P32A 2J59A 1TADA 4GOXA 4IJMA 4OI1A 2RHDA 1ZNXA 4FINA 3DZDA 4BGDA 2VP6A 2OXCA 4DLXA 3AVUA 3WHLA 4YONB 2ZSBA 1QHNA 1W36C 2VO1A 1QVAA 3LFUA 2H57A 4B3GA 4O2RA 1J7KA 1XCGB 1D2EA 2DCUA 3VHXA 3BGWA 1BH2A 5FUVA 3IIJA 2H17A 3VR2A 4EPYA 4PHTA 1FQJA 4C0BA 1RRGA 4QXAA 2EWVA 2ZR9A 3HR7A 3NH6A 4DSOA 5C18A 3EPLA 1WDTA 1PJRA 4TTQA 2ZAMA 5FUXA 2IS6A 3AP1A 1R0ZA 4D80A 1US8B 4Z1MA 4JL6A 5KU1A 5LD2C 2O8BB 1MRSA 5HE9A 4ARZB 2O8EA 2AKAB 2F43A 2BMFA 3TRFA 1ZUHA 1R5NA 4Q5IA 4IVQA 1G8YA 5DH9A 2OEPA 3GFOA 2JDIA 1ZM7A 1W49A 5FOUA 4YLGA 3K0FB 3KQLA 2NGRA 5AJVB 4A2PA 3IIMA 2NZJA 2RGNC 1ZBDA 4BFYA 2LWIA 2ZRLA 3Q72A 4BZXA 8OHMA 2XSZD 1ESNA 1Q21A 1X1SA 2QUZA 1HUQA 5SZKB 2ZSFA 2BDTA 1TMKA 3A1UA 2QGZA 2WWGA 3GEHA 4UNSA 1MO4A 3H4MA 2X8AA 2P65A 3IBGA 3C5CA 2ORIA 2FSHA 3HU2A 2ORWA 1W36D 1KDRA 3FHOA 1ZVQA 4C4PA 3KKQA 4ERNA 4M1OA 1P62B 2W0SA 3JVUA 5E7JA 2VHTA 4E09A 1X3SA 4OQFA 3MG9A 1CTQA 1ZNYA 2C5LA 5EXTA 4A36A 1N5KA 3VHLB 4BLTA 2A7QA 2OFOA 4V0LA 4CEJB 1AKEA 4LY6A 4G1UC 3AVYA 3PEWA 3Q9LA 1U9IA 1WB9A 1YR8A 1BIFA 4D4KA 2CLDX 5J4VA 1KI8A 1OH8A 2ZJBA 1OLOA 2ZJ8A 1H8HD 1YZTA 3V4RA 2BBWA 2J87A 3AF4A 2QRNA 3MFYA 3KQNA 1CXZA 1ZD9A 1V5WA 2C03A 4QG7A 4DRZA 1KO5A 5JI2E 4DEXA 3GLHB
chains in the Genus database with same CATH superfamily
3F1KA 2B3DA 1DO0A 1X38A 4XX1A 1N2IA 3G88A 1LW7A 4WESB 1GZSA 3DC2A 1OA0A 3BJEA 3FDIA 4DIUA 3H8WA 1NI5A 2A9KA 3CPEA 4YAEA 1JEYA 4LE0A 4XD2A 3Q3IA 1ICIA 1BHQ1 4MWGA 5F2KA 3VPBA 4D0LB 1P72A 1U1FA 1YNSA 1RM3A 2XT6A 5I7SA 3Q8XB 3C6BA 3INYA 5E2IA 1PO7A 1BD3A 3NTRA 3GXOA 1WR8A 4CG0A 2I87A 3M1IA 2B37A 4RIIA 4C0HA 5TXGA 4L7VA 4GT1A 3UJCA 2Q2WA 3DONA 3AFOA 4YQFA 5FKJA 2P67A 1FBTA 3A36A 2GWHA 2WJHA 1Z22A 2GBCA 3ELWA 1Z0KA 2WSYB 4AROA 3AOEA 3IC5A 4YROA 1Y4AE 5KCMA 1YI1A 3NM6B 3T7IA 3FNFA 1MG0A 4YRQA 4S04A 1WMFA 1TB4A 4EB0A 1SVOA 1M6VB 4V0RA 3O95A 5JTTA 2OXTA 5BUSA 1CR4A 1E9SA 1K92A 1TQDA 4JQZA 2IPXA 2Z9DA 3O90A 4UDOA 5ALJA 5EWLA 1JEJA 2PM8A 4KR0A 2QI9C 1EX6A 3RJMA 4H35A 1V95A 3EY9A 1MN6A 4ZOEA 3Q7EA 3ENZA 3HLYA 5LLSA 4GOJA 1QZTA 2LKCA 3R0XA 4A8JC 3I30X 3I2HA 1A4UA 3NO4A 3L02A 2KYRA 3JARB 3FSRA 3LPCA 4RL6A 3WLTA 4C0KA 4Z54A 1EPUA 4V1CI 4BNJA 3I0ZA 4MRPA 4FZJA 2OK7A 2N75A 4O4JF 3QJGA 1EAMA 1EP1B 1TU4A 4IV8A 2P3LA 2Z43A 3C3MA 4XVUA 1Z4MA 1CJUC 1F4VA 2E87A 5EL0A 1L3CA 1R88A 2FUNB 1WHTA 1NU6A 1IVYA 2PPLA 3BXHA 1ZI6A 2WAMA 4Y2TA 2GCEA 3PE3A 4IUBS 3UVEA 1H0HA 2P2NA 4JR1A 3CUSA 1WW3A 3DOJA 4LOAA 3WGUA 4IF6A 3B6ZA 1CQJA 1FFGA 4RELA 3UJBA 3IKVA 4BPBA 4XYGA 1N2ZA 1P5HA 3SXUB 5HE8A 3ET5A 1YK0A 5IRCD 5B6JA 5LMCA 3KK0A 3UAVA 1ZVMA 2BMVA 2H5IA 2X0EA 5IDQA 5FPSA 1X1BA 4N6OA 3DHWC 1KI9A 2OHJA 3OQVA 2MDTA 3CMCO 3OVMA 5HM8A 3EFOB 4L8GA 3TL3A 4HNAB 3JZMA 4CFZA 2G9ZA 4IMRA 1ICEA 1XKQA 3H1PA 3NONA 3R3XA 5I5GA 3RS3A 3SWWA 3C15C 5A5VA 3K32A 2QW8A 3A31A 3LUDA 4OHXA 2VHCA 4RZXA 1XVUA 4IHKA 2F3QA 4X8LA 4HY3A 4X41A 4GGOA 3W77A 2J6IA 4WJLA 4C2TA 4CT0A 3CU5A 2HWYA 1KVSA 2D8MA 3R6TA 3ORSA 2BCGY 2P5YA 3ZC3A 5LQJA 1R8JA 1MV8A 2DY1A 3IVMA 4HGNA 2JJ1A 1NV8A 1EHIA 1SULA 2XJ9A 2BRUA 3CPJB 4K7JA 4CM3A 5HM6A 1TD9A 2QVZX 2WI8A 1XZLA 2VEOA 3QZUA 4EM6A 1NX6A 3KWJA 4PX3A 1R5JA 1C50A 1KJQA 5THKA 3ZY3A 5KKAA 4ZZ3A 1JBKA 2WFZA 3NRBA 2Z30A 3L0YA 5D6OA 5E1MA 4Q15A 2H9YA 4LJ5A 3TQQA 5EXEA 3J81A 3EXHC 5HCIA 1KI1A 3QI2A 3HCWA 4DUZB 1IU9A 4QXQA 5JO9A 4Z1OA 1HL3A 2FI1A 3EVBA 3B1ZA 4UHJA 5GZ3A 2HA7A 4PX9A 2DUNA 2RK4A 3HGMA 3EEOA 3FYSA 4AKTA 1KYYA 5BQOA 4M9QA 2OG1A 4NTZA 3U9LA 2FE4A 3S2IA 5E0KB 1ZJ4A 1P1HA 5FBZA 1QBGA 4YLYA 3BXPA 4AX8A 2F8LA 1RRMA 4IHAA 2YWBA 4FFBA 2X8JB 3UKDA 1CUZA 1XVIA 2NLOA 3BL6A 3ICCA 4DLUA 4LBVA 4Q4LA 4WH0A 1QU2A 3FWHA 2WT4A 3SLGA 1OLSA 1A69A 1QZXA 1JHRA 1KAHA 1Y98A 3D6AA 3RS7A 3LP6A 4IW3B 4WFIA 1POWA 4YAGA 3A2KA 3P2YA 3A9TA 1QNLA 1UBGA 4NY1A 1WCWA 3DPSA 2BZSA 2E4VA 4IILA 2P7IA 3HVRA 1CUVA 3TIFA 4DRXA 4EJMA 3DVRX 3OOJA 3CHYA 5EG5A 2IDJA 4G09A 4D6XA 3REQA 2XZLA 2X40A 4KR2A 1ONNA 5JNWA 1MX3A 3PENA 4F5ZA 5J4HA 3AZQA 1THGA 1DINA 4M55A 2I66A 3TXXA 1H2ZA 3GRUA 3JAKB 5M7EA 1T6ZA 3G2KA 3WIUA 2ANBA 2Q3EA 3DNMA 1P4RA 4G26A 4M9XA 4XDZA 2OM6A 2CE7A 1EDEA 1HZZC 1O8BA 3EF0A 3FR7A 4AJ1A 2AUMA 1JKXA 2KLHA 2QHXA 4LJ7A 4MARA 4INPA 1OD6A 4R3NA 2JFZA 1F51E 1G7CA 4CTJA 2R1ZA 4TQUS 1P18A 2Y27A 2VTEA 4DQ0A 3ADCA 4W5NA 2XOEA 3EIWA 2P79A 3OOSA 1LBTA 4NOKA 4WUTA 2XRZA 1N2CA 3P1JA 5H1YA 4N8EA 4QUDA 4LDJA 4GMHA 1N6LA 4C6HA 1P8AA 1PG2A 5KHLB 2NU7B 3NBMA 5ALDA 5EZQA 1UP7A 4RV4A 5FTNA 3UUWA 1N7HA 3H5AA 4PWYA 1EWRA 2NP7A 2HT6A 5JYEA 1G21B 3CLKA 3KSZO 5JBNA 3L4BA 1FFXB 4IY1A 1VI5A 3SSAA 2CXPA 1FP1D 1OXBB 3WGIA 3IELA 3GA0A 5EZYF 2RKWA 1Q0HA 4F93B 4PONA 1G8JA 5JADA 2ZE7A 5EIWA 5HS6A 2WILA 3AY6A 1QPGA 1VIVA 1RWXA 2PSHA 3ITEA 4RHYA 4JJ8A 5DHAA 3QX3A 2XWSA 3ESCA 2RI0A 1BMFA 3EC1A 3ZCTA 3NOOA 3TSYA 7ADHA 3HCFA 1MB0A 4Q4AB 2QD3A 4EH1A 2PBRA 1KU6A 3RKRA 4RU1A 3W90A 5KSYA 2IS1A 1TM5E 2RGYA 4HGPA 1W4LA 3JW8A 4YNBA 3D7SA 5KQPA 2QG6A 3IS3A 3GCDA 4RCYA 1X1CA 1R6BX 3C5VA 4CTOA 2BJVA 2OBYA 4QU9A 4U6NA 1FQOA 3DO5A 4IH9A 5FNZA 5IK2D 2ZYHA 3IBYA 3UZUA 2DVMA 3WZLA 1VGQA 2HSGA 3H0KA 5ICCA 2QRVB 2J0SA 3ZWOA 4BZZA 2WC1A 3OT1A 3BT7A 1DCFA 5DISB 4YEDA 2PXCA 2OC4A 4JL8A 1KSFX 5DCUA 1YGYA 2LR0A 1PVOA 4JVMA 4II7A 4OGKA 5K6RA 3R4VA 4YJ2B 2GRAA 4XASA 1AQNA 4EBFA 3UJ3X 3AXSA 1RM0A 4QODA 2VVTA 3R9IA 4ZVNA 4ZK2A 2C1XA 2JF0A 3HZRA 3VO1A 3M5PA 1SC9A 4QSHA 3K5IA 2UYYA 3FDFA 2FK8A 4W8OA 2VXCA 1U04A 3DFIA 4FCCA 4MMYB 5A5DA 1VPVA 4QJBA 1LS1A 1VBFA 5C4MA 5D51S 3LZ6A 2AFIE 1OBFO 3QP9A 5DI9A 1TIBA 1AXRA 2OHIA 4EJ2A 3JQ9A 3W5BA 4XEUA 1OZHA 2PEZA 3QH4A 4JBNA 3RKSA 3KOOA 2WOOA 1PZHA 1ADCA 4QULA 5J1TB 4AICA 4ZI7B 4W99A 5LQKA 2UVQA 1PAUA 1KMMA 1WY7A 2QSJA 3D8SA 2AHOA 5HKLA 1W88A 4W7SA 4CODB 5EZYA 1HE4A 1E60A 4XPIA 4F2HA 1JALA 1QUEA 2GD0A 4IUDS 1J9EA 4OP2A 4Y2VA 1A2OA 4I7EA 4JC4A 1L5WA 1DKNA 1NXTA 3LL7A 3WIOA 5C1BA 4RJLA 4DZTA 2DHRA 3RC9A 3K1AB 4E4TA 3ZIDA 2BGGA 1X8XA 3L6EA 3K16A 5KVQA 2D0IA 1OB2A 1GZ7A 1BMQA 3KRTA 4I8DA 5F1KA 1Q1AA 2VP0A 5LU9A 2QN1A 1BCRA 3H3JA 3R7LA 5JCZA 4MUXA 1GNVA 4FYIA 3B70A 3PHBE 4PGMA 4UW9A 1QO9A 2PGNA 3W06A 2YKGA 1YU6A 5EWLB 1HSOA 1Y6QA 3B7GA 3DGFC 4Q9DA 4H15A 3WGMA 4E5SA 1ZMXA 1RTTA 2JGNA 4BNVA 4LHXA 1Q5PA 3HDHA 1JRLA 2HLDA 3JTMA 4GSLA 3HN7A 2FZLA 1L4HA 4HBGA 1GUYA 4GX1A 3GQBB 5LJIA 2PJDA 4PHGA 4G56A 4R7TA 4YI5A 5JCJA 1QIMA 1VCMA 1R3UA 2CJFA 5FORA 2DHDA 1JNXX 3BXFA 5DGXA 4M8KA 2QVBA 5E6SA 4AWAA 2Z2ZA 3AH8A 3F2IA 2RGBA 4MKHA 2Y1KA 5EMHA 8ADHA 3R8FA 2DMRA 2BIFA 3QHQA 5IM5A 3EQ8A 1RHJA 1WBJB 5CIWA 3B1VA 1J7JA 1XEWX 1EU1A 2GUWA 3DCYA 2ZS9A 1BE0A 3OLZA 5DHSA 4DIEA 3O8CA 1JG1A 3C6ZA 3VYRB 1WHTB 1UAGA 3S4YA 3RFVA 1C7QA 4NPHA 3H0CA 4QRIA 2QVLA 3CSSA 1NM5C 1U99A 1AKUA 1OV6A 1SELA 5H70A 4BO4A 4CKEA 2R2AA 5AQ1A 2W5UA 3SHTA 3D54D 1H1LB 1VZ3A 4GG1A 1Y1KE 4DEYA 5L3QB 5C52B 4OHYA 4G0YA 1IPHA 4KV7A 4X5OA 1R1DA 2OCYC 3QV2A 4NXNB 2MMCA 1NMEA 1J09A 4JUFA 5K51A 2PA0A 4PVDA 2ZI4A 2P75A 2PK3A 3ENKA 4KFCA 5AI8A 4I4NA 1IQUA 5BV7A 1XKTA 1MLDA 5FF9A 1TUEA 1IEQA 4LHZA 5FOWA 1KH2A 1VE6A 1KFJB 2ISSD 2VPIA 4X6LA 5DZSA 1CUYA 1BS1A 2QAGB 3PGJA 4ZTBA 4OBXA 5TLSA 2FFJA 4H3HB 2OUKA 4GMDA 2YYYA 4KPFC 3ROMA 4BEWA 221PA 4XUEA 1GDTA 2I4IA 2RIRA 2FWNA 3QFRA 4DCVA 5JAHA 4BWGA 4ITVA 2G9UA 1ZVKA 3JQDA 2WT9A 3HJCA 4ZRDA 1KRXA 1I0LA 3AKEA 1HLPA 2B2XA 2NVBA 2EYUA 2J9RA 2E9SA 5J58A 2X19A 3IE2A 3KKOA 3TJMA 3KFLA 4ALLA 2Q50A 3ZZ0A 3DT9A 3MGKA 5U9CA 1NW6A 3GGDA 2EBHX 2AC4A 3LZCA 3A9SA 3WLJA 3CKYA 1OH5A 2SBTA 1K7XB 2ODNA 3T4UA 2WHRA 3O9ZA 2UZ1A 2CV0A 1DC7A 1IFXA 1IE3A 1MC1A 2OBNA 2YVLA 4HN2A 3V1TC 4E3WA 3FDZA 1WXGA 4O4JB 2VSQA 1C41A 1U0GA 4U0JA 1JQEA 1NKSA 4DLKA 1QH0A 4DWVA 4R8KA 2Y92A 1O6BA 4YMHA 1GG8A 2MJLA 2R97A 3PGLA 3L7YA 1J97A 2HFKA 3OG9A 4MHTA 4JYPA 1I7LA 3EEIA 2O3UA 1CEEA 1IZYA 4F5EA 3TI7A 2DJ5A 3OA2A 3EVFA 2AX3A 3CNHA 3QX7A 4Y9UA 5CYOA 2JGLA 1HBJA 4AG5A 3KT8A 5CXUA 3F6EX 3RVLA 3RVMA 1QO0A 2VUSA 2ZZMA 5BOSB 3K9WA 4QNNA 2DQYA 1O57A 1YFZA 2QMOA 3PP8A 2C0PA 1E77A 4B17A 3MZ0A 4PYJA 2MT9A 1Y7IA 4J91A 1OLSB 2CHVA 3NJRA 2ZIEA 1BDIA 2EBFX 3BD7A 3B78A 1WF6A 3A1FA 3KZNA 3T3MB 5A0FA 4CMAA 3BTVA 1T9DA 4KDEA 3SQDA 1TM4E 4MGEA 3QY0A 3FPEA 1UBRS 3FTNA 4X7RA 3LI2A 1T6XA 3KHTA 4DXHA 3AVOA 2IEDA 2Q6VA 3REQB 5E1BA 3NIDB 4J43A 3B51X 3N8IA 3JXEA 4RPHA 1DV2A 3FTPA 4M0DA 1QP4A 1CQPA 1QYXA 2HL6A 3DZGA 2Y93A 2YZ7A 5K3OA 4QU0A 4ZP1A 1NW4A 1E1QA 2JFOA 4NHEA 5HKKA 5AKGA 4QXMA 1E66A 2H51A 3EARA 3QE9Y 4J1SA 1DAOA 1RJWA 2D1QA 4ROSA 2I4NA 2V6IA 3MAAC 1RPTA 2C42A 2CYCA 1A71A 2GNPA 2Y2VA 4KACA 1PFVA 1XROA 1S89A 2JHCA 3AFGA 3N05A 5CX4A 3RB8A 3SU8A 2I6FA 1T8TA 1DWUA 3CG4A 4EPVA 2PX8A 4UTXA 4JJ4A 4GPBA 1ZR2A 7MDHA 1GDDA 2J30A 4M1KA 2XB4A 1TJ5A 3KZMA 3Q2KA 2O3SA 2PUBA 2YXDA 4QX6A 3ZKWB 3MNFA 3WJ2A 3JQRA 5FI0B 4DMUB 1P17A 3K0CC 5TSDA 2XMPA 1KQFA 1SC3A 3GLTA 3HDTA 4IWYA 1IMJA 2ZU6A 4PYMA 4Q3DA 2HPHA 2PMEA 4A0SA 1JKIA 4TLLB 3TMAA 5B7QA 4LWOA 1MFZA 1YGPA 3LXXA 2ZU0C 4Z9FA 4PZ9A 3M6WA 1C3VA 5HYVA 3DE7X 2DXIA 1JHOA 1G63A 1DWQA 4MQFB 1PFQA 1Q12A 4R5MA 5EQJB 4MA0A 2R8ZA 2ONZA 3V80A 2JFWA 4FD3A 4B3IA 3SBDA 4WLFA 2VF8A 4GLFA 2ANCA 1P74A 5IBCA 1SC6A 4C4XA 4OJQA 5TMPA 3A37A 2BL4A 4P0QB 1OAOA 1DDGA 1JJIA 4ZT6A 4AULA 4Y2YA 2JFPA 4V3BA 2PT5A 5B7PA 4M54A 4CM1A 2NXJA 4D4MA 1YL6A 4H0CA 3D4PA 4N65A 1J8DA 4PBRA 3EQ2A 4U00A 4P32A 2UU9B 4GI2A 4YC7A 1KC3A 3NDBB 4M2LA 1ESCA 1M2OB 3TNFA 1WBBA 1XRMA 2H4WA 3EMVA 3VX4A 1NQAO 3AQIA 1FXWF 3B3QA 3OT1B 2J5XA 3OPNA 4HUJA 4N5HX 2WHQA 4XOIA 4ZMSA 4FP9A 1QPZA 2G9NA 1RKQA 2EJCA 1HQKA 2EKQA 3ZI4A 3HKCA 1RRVA 4CM7A 4XOUA 5SZIA 2WZBA 2B4KA 4MW4A 3PXXA 4GECA 4KXVA 4DLNA 3G0HA 1DJMA 1K7CA 4O59O 4J2TA 5H02A 3D2BA 1RQXA 4LBYA 2QF7A 2EJBA 3GUVA 4X3CA 4ZICA 1NUPA 3FCUB 2D1FA 3FPGA 4M6WA 3FWYA 5FL3A 2M9MA 3PKZA 4E11A 1S1MA 3OZAA 3LZDA 4LZZA 1VJ0A 3T5CA 4KL8S 2QMZA 1RC8A 1KGSA 4FYMA 2NTNA 3CRW1 4KVGA 1JI0A 3QNWA 1B74A 1LF0A 3S28A 4CU5A 1WZ2A 2DFDA 2JLSA 3CIOA 1UJ4A 3HXLA 3IMFA 3E7PA 4F3YA 1PR5A 1JIIA 1LB1B 1IJKA 3GG9A 5IZCC 1FW6A 1ECLA 1QIDA 3OM8A 4UTVA 3KDAA 4GXRA 4QXPA 1ZK2A 2JFNA 4WOPA 1CUIA 2HMAA 1W88B 1CR2A 1KERA 5EZYB 3THWB 1FFEA 3GRYA 1JIXA 1Q3KA 1T5DX 1YFKA 3G79A 3CF4G 4UDNA 1RMYA 4XPIB 5EPEA 3Q85A 2WVGA 3BIJA 3PR3A 5CX1A 5HILA 4EEKA 2XB8A 2V0NA 4TRRA 1E8DA 4D3SA 3PFKA 3CH6A 2MSDB 1RC0A 2RC6A 1XTIA 1SUWA 3H5NA 4YALA 4WZAE 3T7DA 3ONEA 1G60A 4MUHA 5D3MA 1E2HA 3MJDA 3QWBA 3ZJUA 3SYTA 1PJTA 3QW2A 3TR5A 2WG0A 3ZD9A 3NTLA 3D1LA 4JOSA 3BZWA 4M0CA 2GN6A 2EFDB 2VH1A 3K9HA 4GRAA 3VV3A 2DFNA 1FVXA 2J3IA 3RRZA 2JLRA 3FIUA 3OKCA 2ZJZA 2W8ZA 5ANRB 3LC0A 3PQDA 2VCEA 3ZW7A 4D42A 3IL2A 3OCVA 5CLFA 1EX7A 5FBHA 3H0EA 5I6DA 3VPGA 4LNAA 4GMKA 1FZTA 1PN3A 3I2JA 1FXWA 3TZKA 4G4SO 2AFRA 4EW6A 1BN6A 1IUKA 3Q7SA 1JIKA 5HDQA 2EW8A 1WX1A 1K89A 3BAZA 2HDOA 3EPKA 3PEYA 3X1YA 4GPD1 5KAMA 3MW8A 4A91A 3QVKA 3LL4A 5E4TA 4YRNA 2QDKA 4RKEA 5JS2A 1JAHA 1MR3F 4DMMA 4DA8A 2XUAA 2E85A 4KB5A 4EYKA 5IN5A 2B78A 5BURA 5ENDA 2OG2A 5EP4A 7ABPA 1ZJZA 3HO8A 3PPYA 1T4MA 2IC5A 3THYA 1LDNA 1T34A 1YIOA 2DBYA 3QKSA 2J3HA 3HVJA 5TMEA 1NE7A 3WISA 2XDQB 3MCAA 4CKEB 2CT8A 1P80A 2ZANA 3F9IA 3RYHA 5AH0A 3VH3A 3R41A 4RIEA 1JKFA 2GN2A 5DTIA 1AT1A 3GPIA 3IHKA 1E4EA 1GCUA 1UT6A 2O0HA 2GAOA 3CG0A 5DNCA 2CWDA 1CNMA 1NLUA 4PO9A 4YJFB 4Z99A 1ZVVA 3TTXA 1U1DA 3QVGB 1UDAA 1G3IA 2WWYA 2I2BA 4R1UA 4LI3X 2F3TA 3DMTC 3P9NA 2GVNA 3AESA 1BYIA 3S2SA 1S9DA 3INTA 1TM1E 3DTNA 1GRQA 2YIDA 1AZWA 2VJKA 1HRDA 1T2CA 1PT7A 3DVQX 4ENPA 4J07A 3WA6A 2X6QA 3L8DA 3AI1A 4XE5A 2F4NA 1XIVA 4FDAA 1SG0A 1YE5A 2EX1A 2J8ZA 3BB4A 4D25A 1ILWA 2F1IA 3V7YA 1U7ZA 4PXAA 5C1IA 1GZHB 3GT0A 3ZK9A 3L46A 4OQLA 1QHFA 1YRBA 1LKZA 1VL5A 4LA4A 2O3TA 5EEGA 5EPUA 3VKHA 4CM9A 1A04A 2PUHA 4F1JA 4R2WA 4RM3A 2ODAA 3ZTWA 1MVOA 1NXXA 3TXAA 2IHYA 2X4IA 3FPAA 3PF9A 2HFJA 4MUNA 1NA5A 1XCBA 1EG7A 3CR3C 5KC9A 1XQ6A 3QVUA 4L5AA 1DO2A 1TYCA 3QHPA 4UUBA 1B15A 5AVZA 4LFCB 3HJRA 1CC1S 3E27A 3SC2A 4FW9A 3PLNA 2ZQZA 1FLVA 4JBIA 4KRYA 1G66A 2C9ZA 3PPVA 4LZWA 3TS1A 2GSDA 1TK2A 1LCIA 4Z51A 1MC8A 2A0FA 4GI3A 3VUEA 4Q9LA 5J2TF 2FLKA 3L93A 1B2RA 3C1AA 4GL4A 3WBKA 2JLZA 5BSUA 1EFVA 4JCCA 4KXFB 4Y1RA 5ALSA 5HDBB 3SLRA 2AZXA 1D7AA 1DC6A 2D6FA 3FLAA 4E1AA 2WV9A 2M6RA 4WK4B 4D2IA 1LTHR 3FFBA 4HN9A 3DR3A 2ORVA 2FMHA 4DIOA 4JEIA 2UVPA 4E5VA 3HM9A 2YOFA 1BHSA 4AJKA 3CXRA 2FCAA 1XZJA 4I1IA 1TQ8A 4DHEA 1YI0A 3N3AC 4DQLA 1VI6A 1EP2B 5CK5A 4IJVA 4NS1A 4YMSA 5ITSA 1U0SY 4Z3DA 5JZMA 5JC8A 1OE0A 4D4LA 5FPYA 3HP1A 3KG2A 3PPWA 1VHDA 1S0UA 1TC1A 3EDYA 2PKWA 3LGSA 1UKVY 4EFKA 5K0FA 4CEHA 1VG8A 1XJCA 4URXR 121PA 4C7MA 1O6FA 1EVZA 3PC8C 3G2OA 1JV2B 1XQ9A 3DZFA 3NS7A 4M88A 5FFMA 4M53A 4G5FA 1AK2A 4AIIA 1Y4DE 3U4AA 3Q40A 2UYQA 4O2BF 2QROA 1VPEA 4BATA 8ABPA 4CFSA 2VDVE 2CYAA 2PDAA 3E05A 2FF5A 4Z1MD 1RYMA 3H13A 3GMSA 3MLAA 4G4JA 2WIJA 3GO4A 3MWKA 2O2CA 4B83A 2ZIXB 1EWTA 3PYLA 4KJZA 4OKIA 4DZRA 2D2IA 2ZR0A 1PWZA 1AK9A 4L27A 4M86A 5L4SA 2R7NA 4XLLA 5CHEA 1L4MA 3FNBA 3NNDA 1FP6A 3W04A 1W6RA 3T35A 3JWHA 2IHBA 1FUUA 1C80A 1M9NA 1D6JA 2VPTA 3VAZA 4BJ3A 3OQIA 1N78A 1NIJA 4CMJA 3MWJA 3FSGD 3MTAA 2JANA 1QYIA 4EVRA 2HMSA 1KO4A 4OHPA 4UAUA 5H59A 2ZJ3A 1Q1EA 3OOYA 2G28A 1IIRA 1PD1A 4KQ2A 2I22A 2XIQA 3NBZC 3KAQA 4R8MA 5FNVA 2XA2A 3LUHA 4LVCA 4PHFA 2OL4A 4LHWA 3KPJA 3KVOA 4ZOCA 2C8KA 2VWHA 3IGFA 1CUGA 4G67A 3ABQB 5CDSA 1OASA 1UPXA 1G38A 1O4WA 2IK8A 1DUSA 1RWBA 2LCIA 2PX4A 4OGFA 5B3AA 4ZHQB 2QRLA 3QKRB 3C7AA 4PAQA 4EG8A 1F0PA 2FMUA 2EHJA 2FR1A 4ZDIA 1NUQA 1JI3A 3CEMA 5K03A 1YZGA 4BQOA 4M1YA 1GGKA 4H7IA 3BHIA 4M1EA 1HFEL 2QJFA 2C20A 3GX1A 2JBHA 3BWVA 2GM4A 3FBGA 3PGKA 2W2OA 3SIXA 1W0KD 1QK5A 1G98A 1YVUA 3HLKA 4H1VA 4PY2A 1LTQA 4O2BA 1W5SA 4R0VA 2CXOA 4YRSA 1ZL0A 2CFIA 2VCHA 3STHA 1TCCA 3OOHA 4PAMA 4EPTA 4H2DA 2GS9A 2R8BA 2VQFB 2X58A 1M8PA 5BV2P 1D4OA 2VNHA 2P9CA 4YFVA 4B87A 1A9RA 2P5TB 1HDZA 2REBA 4KTVE 4IPTA 2IIQA 2ZS7A 2ZT7A 4G97A 1AS0A 1Z6AA 3ACDA 1CJBA 4M6WB 5CJ2A 2PBFA 2PNFA 3N2GA 3SZOA 4F9TA 1NW3A 4AZSA 5T3YA 2RHTA 4IDQA 1Q7EA 1SVKA 1OILA 2A5LA 5KTKA 1WULS 1YMQA 3JQAD 2FWBA 1ES9A 1FP2A 3TL2A 1Y6JA 3CZ5A 1T29A 2GPNA 3BMXA 3GEIA 2GBGA 3UPTA 1LEHA 2IHZA 1Y9AA 4EVSA 5KPJA 5DSXA 3LC2O 2FEAA 3A7EA 4F4CA 4U2EA 3AG6A 4JJ7A 1X86B 3RVQA 3PT5A 2O4UX 5B2EA 1X14A 2MINA 3FSEA 4UU0A 2WF5A 3QBJA 3HADA 5P8WA 5U1PA 5IUNC 1NQ5A 3EXG1 3EC2A 1AS2A 4PC7A 3PNOA 4ZAWA 3VPAA 4A6EA 4YV2A 5A06A 5D3MB 2SCUA 4D9GA 3DLAA 3OIYA 1NVUQ 3KO8A 2POQX 2MU1A 2YVKA 4G5XA 4IDBA 1KS9A 13PKA 3E3OA 3NNSA 3OLQA 3PD1A 5IULC 2OCPA 1C8VB 2PH7A 2V7GA 4RDIA 1L9KA 1VDZA 4WEOA 2BMWA 5IC5A 5BQFA 4DJEC 5L95A 4TS1A 1UR5A 3TZCA 3IUEA 1WU8A 4XVRA 3AVWA 3RQSA 3TL6A 1ZBQA 2VEDA 5EGNA 3JVIA 2VI5A 5FWNA 2WSLA 5EXXA 1OWMA 1VCNA 2PWAA 1Z26A 1EJ6A 4R6WA 3R77A 4D74A 1EIWA 1B1CA 2AMYA 3PRHA 4HAXA 1E5VA 2YWHA 2ZR7A 3A9UA 5JHGB 5E2BA 4WCFC 2BPOA 3GG2A 1I0IA 4OH1A 3UWOA 1EI9A 1GQFA 3T34A 2JIMA 1XLVA 4J9UE 4RY2A 5B4TA 1H2FA 3G5TA 3JYOA 5HHTA 4ENQA 3KFXA 1WCV1 3AZPA 2X23A 4W5HA 5HZGA 1PT9A 2IYEA 2A86A 3RUDA 3A2LA 2H3HA 4X97A 1OYYA 3UB3A 2D5LA 2OCXA 4M0KA 3RYHB 2CUNA 3ZE0B 4AG6A 4N1AA 1K8ZB 3RU7A 2CLOB 1YZKA 2KM1A 1E4EB 1T9BA 2P27A 4KW7A 2BBSA 2Q49A 4FGWA 2I8CA 5GOZA 4RFSB 3TRDA 2R1VB 4PZLA 1QG6A 2V7XA 4Q39A 1H6BA 4IRMA 3T95A 1YBMA 4DMRA 4J6FA 4DV6B 4G0WA 4XEHA 1OLXA 1T5HX 1RWQA 1DG3A 1WMEA 2FQQA 3AESB 1L5HA 1CEYA 2KJQA 1CZOA 2HF7A 3E3MA 4EKGA 6LDHA 3K8ZA 2A92A 2FX3A 2WIKA 3GOQA 5TY0A 2O05A 3AERA 4I5DA 3P4XA 2I2AA 3K92A 3VVLA 3WRYA 4QUIA 3I8OA 1GO2A 3B9QA 4V3CA 3S81A 4Q7QA 1NBOA 2D5BA 5DM4A 1PYOA 1ZONA 2WZQA 5H82A 4ZRMA 2P6OA 3PNYA 5B6IA 3AQ4A 4YCDA 1GILA 1JVBA 1OI2A 1W9MA 2A1IA 3P52A 4P22A 4YVFA 5JAQA 4X84A 4D8XA 4C6TA 5IMSA 2DEUA 1XTRA 3OZCA 5KKCA 3R7DA 3ZS8A 1ZGAA 3W7VA 1ZD1A 3A27A 4ZMRA 1R9MA 4JLVA 2BCJQ 4GBMA 3UHAA 3BFXA 4RFVA 4H6PA 1MX5A 4LNUA 1HZJA 3LXRA 3UENA 4C7OA 1JZQA 2R00A 3I3OA 4FCTA 1RXCA 4JJGA 1OA1A 2GN4A 2V6FA 4JKYA 3TKYA 4Q1FA 3EBPA 4LMRA 3SC2B 3KC2A 4CIBA 2CLLB 1NN1A 1E0JA 4Z49A 2OBXA 4OB8A 4GE3A 4TSFD 2CNDA 4EI8A 3QLJA 4NENB 4RTRA 3HJTA 5E6UB 3LRTA 1GXSA 2FPLA 3CNBA 5HJEA 3SVZA 2CDAA 3O7WA 1SXJD 1RAHA 3CZPA 1UZLA 3C3JA 3WQRA 4DOMA 1A0OA 2ZROA 3G0DA 5F33A 1CUHA 2D4HA 4GOLD 2DG2A 4UREA 3OJOA 1W5BA 2GA9A 1D8TA 1B3BA 2P9GA 3EEYA 3M8KA 2O2IA 3H9QA 3O4VA 4FNGA 3HRHA 1B6RA 1T0UA 2Q07A 2XITA 4GAEA 5L7TA 1XJ5A 3DG9A 4MIEA 4MRRA 1XQ1A 5LBTA 4K26A 4M7RA 2CLHB 2WG1A 2QX6A 3TAXA 3L1HA 2OWDA 1TKAA 2DT5A 3W4JA 1WEHA 4BNFA 4EGAA 3J81k 4DA7A 2RB5A 2A5GA 3WDMA 5DM70 4TMXA 2P2ZA 5KHAA 1HH4A 1SHZA 1LDMA 4DR1B 2Q41A 1GRNA 4CEHB 3IKLA 3O92A 2CXHA 1C0PA 4UHBA 5AM5A 1ZOIA 4RXMA 1WCIA 4TROA 3G7SA 3R3JA 1G2OA 4BP1A 3CX7A 3A26A 5A62A 3RASA 1Q0ZA 1ZXLA 2I6UA 4NBWA 4QTUB 4UUMA 3WSWA 3DE2X 3VKVA 1E9AA 1MAUA 3KSRA 5B5SA 4Y2XA 2G04A 3TLXA 4UUAA 4EF6A 2ATEA 1QIFA 5ECDA 4ENSA 3T4PA 3OJEA 3BYZA 4JZYA 5EUMA 4B4WA 3EAGA 4KXMA 1RXVA 2PH5A 1XZQA 3AJRA 2H1OA 3T4XA 1XWIA 1XTUA 4DC9A 4DMFA 5ITVA 1JQLB 4ALJA 4CUJA 2TS1A 1OWNA 3AEKA 1GNPA 2A67A 1IDN1 5GAJA 5BVHA 2ZYSA 2WA2A 3A4VA 4DSUA 4GMGA 1PGNA 1M0SA 3PYMA 5IUJC 3CXUA 3NAMA 4MAMA 5E3IA 1AA6A 2R4TA 1Z2OX 2C9BA 5J2TB 3GFBA 1OW3B 1F6BA 1VJGA 1QHIA 1DIRA 2H1LA 3K94A 3OIUA 1JEYB 3RC2A 4BO1A 1GG5A 4MW0A 4P4LA 1I3CA 2OVFA 1WBDA 3R5SA 5BR8B 1DDOA 2JFBA 4X6XA 4D9BA 4BNHA 1Y9ZA 2GN8A 2AWOA 4AN1A 3DDNA 2PXAA 4LZPA 4MQ4A 3LQQA 1O8CA 3LH5A 1DOAA 1LPBB 1WPGA 2P77A 1KYQA 3V7UA 5L8VA 4X66B 3WLAA 2QQEA 1SBHA 2IYLD 3ZGOA 4MEAA 1EAYA 4NCJA 3EZFA 2QRMA 1A9TA 3STYA 3OZSA 2G6TA 3A1WA 5KJ6A 4YP0A 3OJ0A 1ZJJA 1SVWA 2VFAA 4FXOA 1NYLA 2W2XA 3IKMB 4NCHA 1NMYA 5AVVA 1NNUA 1U98A 2HV9A 1MDFA 2VDJA 4IJQA 4TX1A 5LB4A 1K2VN 4CM5A 4O2BB 2BHNA 2R48A 1GSAA 1M1YE 3KVYA 5BNZA 3FAKA 4EO9A 2FZ4A 2XNDA 1VG9B 1BU5A 3JQGA 3NYWA 3PFCA 5TPWB 3ST7A 3KHUA 4OF4A 1JJBA 1TFUA 2Q2VA 4NBVA 4BCBA 4EKDA 2WJIA 3VVBA 3KOZA 3GRVA 3NIBA 2GZ2A 4BN0A 4F45A 1ACJA 1BFUA 4MYDA 1LA2A 4KMMA 2JGKA 3R0QA 2IOQA 3E61A 3EJWA 3UEOA 2IXGA 2VKQA 2RHGB 2YTZA 4ZOLF 1DMSA 1YOBA 3EW7A 3R76A 5JASA 4D4IA 3GHHA 4C08A 1ZR4A 3NIGB 2RAUA 4HR7A 3T3HA 1YA6A 3FBTA 4HSEA 5KC8A 1UF9A 1G2IA 4L72A 5K20A 2YWDA 2NT4A 3E9YA 4N9WA 3TZHA 5BV0A 1KU0A 5EMNA 1Z4NA 4UFPA 1N7JA 1TOAA 2B20A 4M9RA 4D3DA 4ZWNA 3CNEA 3AP3A 3DUFA 3N7UA 1TW2A 3TQIA 1TEZA 721PA 5AR1A 3F46A 1WOYA 3N59A 4MUBA 2PLWA 3O1HB 5F1PA 3T3OA 5F4ZA 3T0FA 3ZXUB 2A9OA 4NH4A 5K2OA 4OSOA 3PSAA 2HQBA 2WU4A 3QXXA 4JBXA 1KZ1A 4KFRA 5F9MA 3SS8A 2MINB 3D6VA 2G9QA 3QKUA 4KN8A 2FR8A 1JSCA 2W6PA 4TMTA 5HK8A 1GNRA 1QDUA 4DG8A 4ZJPA 2YC2C 5T6BA 4EDHA 2VUIB 4MVXA 4KPYA 1EQAA 4UXIA 3G2JA 1HDEA 5IXYA 2R11A 5ALMA 2NMVA 2JEOA 2QW1A 2WHPB 2TSYB 2Y68A 1V8ZA 4E5DA 5K9ZA 4X1YA 5T41A 3MWDB 1BW9A 1OOEA 1FRNA 3NHSA 1I3KA 5KSWB 1LSJA 5EJ7A 1R0SA 2RIPA 3W6OA 4XX0B 5ERYA 1HQCA 3OX1A 1Z62A 3ZCVA 3FCYA 3RFFA 3LK6A 3A4TA 2QMYA 3Q8KA 3HCBA 3NJ4A 3AVTA 4KQFA 1R3DA 3K5HA 3R5JA 1QTQA 5DGCA 4ESEA 1DZIA 3IIEA 4NG4A 1OAAA 4YJHA 1OXSC 4ZT2A 1QLHA 3EODA 3I73A 3QGMA 3RG2A 1VIYA 3G9TA 4N0DA 1BN7A 5L3VA 1KK1A 2CD9A 2PIDA 2FNAA 421PA 3PXDA 2ORYA 3FCOA 2JJQA 3VOSA 4BNXA 4DJFC 2JHFA 5DXAA 3N2KA 5KBYA 1QX3A 4RPIA 2H4YA 2BVNA 3HXPA 4I46A 2IDMA 4R1OA 1T3ZA 1P2TA 1XAGA 4DG9A 5B37A 2XXBA 3H1BA 5FI5A 4QTYA 5AXBA 1EG2A 3P2OA 3WL6A 4CJXA 1L4KA 5AKIA 4UHEA 4X1IA 2EFCB 2PMBA 3RHZA 3FFTA 3SZUA 4P5EA 3T5MA 2V03A 2HJSA 3LKDA 5TT0A 2K5UA 4YAUA 1L5SA 3IILA 4CVNA