2YNMA

Structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
b'ALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR
publication title Structure of Adp-Aluminium Fluoride-Stabilized Protochlorophyllide Oxidoreductase Complex.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Oxidoreductase
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ynmA00
4XD7D 3W9YA 5JJLA 4Q5IA 2GETA 2CEAA 4MRVA 4IDOA 4WVFA 4AWXA 3BORA 4M9XA 1V5WA 4KXFB 2G83A 5HE8A 3LX5A 2WKPA 3LBNA 4HDQB 4LC1A 4DLXA 2A7QA 3DZDA 3PUWA 4E5UA 3CR7A 1I4DD 1AKEA 1XMIA 1W2HA 1ZW6A 3GLGE 3UATA 4HDCA 1AA9A 4DXAA 4EJSA 3U3KA 1R0XA 1UBFA 4B6FA 3GJ4A 5JFGA 3U44B 1ZCAA 3B8HA 2OAQ1 4PPFA 5C18A 1ONBA 1OYYA 2CL6X 1X6VA 3KDSE 2ZVPX 4Q1AA 5DI3B 4HAVA 2FPLA 4MRNA 5IT5A 5EJEA 5DN6A 1Z83A 1NBMA 3SYKA 3FMPB 2W2VA 3T5GA 3CWZA 4EFNA 2HUPA 2PX0A 2VP9A 1VCIA 4OI2A 1UBGA 2YWHA 4AY2A 2P5SA 3WNCA 1E2EA 4E07A 5DHFA 4DCSA 3LH5A 3OIVA 3K9HA 4HAZA 1FUKA 2PMDA 4JL8A 1W44A 2AXNA 1N5LA 1U94A 2E1RA 3CWQA 4DDUA 1NNEA 4IOLA 2GXAA 3KQLA 4PZYA 2NPFA 2JLQA 3UANA 3RC3A 1KI3A 1Q57A 4B74A 3VQTA 4PFSA 1CJMA 4DLRA 1KYIA 4B3DA 1AK2A 2YOGA 2PT5A 4UNPA 1N6LA 4BLOA 2QGNA 4D0LB 4QBHA 1BMFD 3ZIAD 4RZ3A 3DOEA 3D8BA 3ZS8A 4MUBA 1VG9B 1E9AA 2NZ8A 1W36B 2IYQA 3TGPA 2JJ2A 3MFYA 3I61A 4DWJA 5EP1A 4BFZA 4BRWA 1M7GA 1TTTA 1G4UR 4B3BA 1W0JD 4OYHA 2IYRA 1FX0B 4LC0A 2W0SA 5GADl 4TTPA 1W36C 2YZ2A 1AS3A 4NHOA 3WYAA 3BFXA 1XTSA 2A5DA 5EP4A 1HUQA 4PO8A 1NY5A 4ZDWA 1R8QA 5L3SB 4H1UA 3RWOA 4AI6A 4D81A 4F4JA 1T0HB 5D3MB 4Q4JB 2W6JD 1EFUA 3KUDA 2X2EA 5TVKA 3BAFA 4LK2A 5CITA 1YZLA 3X1DA 1AGPA 3WMGA 4EIWA 4JYBA 1NP6A 1PZNA 3I32A 1XPUA 2B8TA 2DFLA 4URVR 2HLDA 4AC9A 3BB3A 3NWJA 4AURA 1J2JA 1C4OA 3O8DA 2VTKA 4BEBA 2JATA 1GKIA 1NMZA 5FPSA 2LCFA 1KSJA 1N0VC 2VSFA 3FB4A 3QF4B 5FOXA 5C4MA 4DLYA 2BCJQ 3WHKA 4ILEA 2EWVA 2G1KA 2ZIAA 1T6NA 1W5TA 2CE2X 2O8CB 1ESMA 1X1RA 2IYLD 4I99A 1ZU5A 3W8RA 4DCVA 1WQ1R 4IXMA 2Q9BA 3VKHA 2CJWB 3RABA 4MYTA 1AZSC 1XTIA 2B92A 2OEPA 1GL9B 4TTRA 4OHVA 5P21A 2E87A 4EPXA 3AVTA 1GP2A 1N6KA 1D2NA 4RD6A 2HDNB 4BLQA 3B1XA 4F92B 3TRFA 4TMVA 4QGGA 2GCOA 4LPSA 4QNRA 1A82A 1A7JA 2GF0A 4XOIA 2ODBA 5F9HA 4M1TA 2IS4A 1QZXA 2OCBA 4B73A 3SZRA 2YVUA 4S35A 1ZNWA 4C30A 1ZM4A 3ZJYA 2PLFA 2GCPA 3M0EA 5M04A 1G8PA 4HDOB 1E96A 1IBRA 3U61B 3DDCA 4KVGA 3KB1A 2A5YB 4LDJA 4DLWA 1XD2A 1XTQA 3LQRA 5J4VA 4O3MA 3CPEA 1TNDA 2N46A 3X1WA 5JEEA 4GT1A 5KTYA 3C41J 3MMPA 3AVVA 1QVRA 3BFKA 1P4SA 4ZO4A 4Q9IA 1DAIA 1KHTA 1XD8A 1QHSA 4FCTA 2ZS9A 4XTRA 4RZUA 4CYMA 4FI3C 1VYVA 2EFHB 2J7PD 2ZS7A 2G88A 4RD2A 2OO7A 5B64A 4AKIA 1EFCA 2YINC 2ZJZA 1JR3A 1E0JA 3Q3JB 2GWHA 1SVIA 1EFHA 3Q5DA 4BFYA 2WVJA 1T8TA 3CF2A 1NLYA 5CDFA 3UG7A 3T1TA 2K5UA 2EFGA 4XWOA 3GLIB 2Z0MA 3NEYA 4PSAA 4NYMQ 3T5DA 2VBCA 1ZMXA 3CZQA 1G21E 2ZYUX 4KYIB 4M2LA 2B8WA 2DBYA 2JDID 3EXAA 4L5BA 4G5RA 4EDHA 1II0A 1NY6A 1E2JA 1E94E 4XVUA 3O47A 3R9WA 1FNNA 2GJKA 1G20E 3NXSA 3EZ9A 2HJVA 4ASUD 1P2SA 4Q9HA 4EAQA 4XVRA 2ZE6A 3NHBA 2UKDA 2PJZA 4LOAA 4LYJA 2GVZC 5EXXA 2FU5C 4RKFA 1HURA 3MUFA 2IWHA 1OF1A 1OJLA 3KFVA 1E0SA 3HWSA 4I4LA 4HZUA 3VAAA 4RD3A 2JLUA 1OV4A 1KK3A 5FUXA 3K09C 4PC2A 4DJTA 3C4JA 4HB2A 1OFHA 3ZLJA 2FX3A 4HAWA 2IS1A 3U7HB 3LV8A 1AQYA 3AP1A 3NVAA 4BECA 3ZZ0A 4Q9KA 3LO5A 1W4CA 3B1YA 3EWAA 1W2GA 2QAGA 2QSYA 4A15A 421PA 3EX7C 2FSFA 4S2EA 5FR2A 3FVQA 3BH0A 3U3MA 1UBCA 2G3YA 2RGNC 2Q3FA 2IUTA 2JIZA 1WA5A 1W0KA 1O87A 3MAAC 2GKSA 4DVGA 3U3JA 3SBDA 3I62A 4B35A 3TQCA 2ZROA 1SHZA 2CNWD 3GLIE 2ZE7A 1U0JA 3LFUA 4JVNA 2ZETA 5ANRB 1KMHA 4LJ4A 3BD9A 4EJSB 1TF7A 2XSZA 2FH5B 3VU9B 4CEHB 1JNYA 1ZM2A 3BE4A 3GJ5A 1XTJA 4WZBE 4OI0A 1OIXA 3RRZA 3IPXA 4TT3A 4C2TA 2E9SA 1CXZA 4EJSC 1DBSA 4EUNA 5IRCD 2NIPA 1RVDA 2ZRDA 5C1BA 2IYYA 5EE0A 1W36D 2NG1A 4I1OA 1EX6A 1Q3TA 3ZH9B 3QE0A 4Q03A 4JBXA 2DFKB 5L3QA 3RS7A 3TR0A 2BJWA 1E0AA 1J99A 5JLJA 5KOYA 4CF7A 2VP6A 3SQWA 1NSTA 4MGKR 1YR7A 1F48A 3AUXA 3T15A 1IY1A 2AK3A 3TJZA 4Y0VA 1P2TA 4TTQA 4M8NE 3FKSA 1CP2A 1M6NA 4NTZA 5FTJA 4CGZA 1Z07A 3V4RA 2PL3A 3A37A 2ZRCA 4LPKA 3WYFA 3HP1A 4URUR 5AJVB 4MKHA 5BW8A 4I1VA 1WCV1 1TX4B 1N6NA 1TF5A 3TUZC 4C0HA 1JALA 1FTNA 3SE0A 2BV3A 2GCNA 3VX3A 1T4GA 4BEJA 1C9KA 3CX8A 1P60A 3LXRA 1NF3A 4HEJA 3AVQA 1KJYA 2X77A 1KJWA 2IXGA 2HV8A 1II8B 2KWIA 1P75A 4D4JA 1XMVA 1W46A 2FFBA 2JJ8A 3FYHA 3ASZA 5AUPB 4UJ5A 3FGNA 3TVDA 3QENA 1G18A 3D6TB 1G3UA 4NCIA 5GVRA 1LVGA 3WY9A 4GPTA 1AN0A 1S9HA 4KFUA 1FUUA 4UNRA 1XMJA 1G19A 3PENA 3THYA 1T9HA 1M7BA 3TBKA 4JLMA 2PBRA 2ZJ5A 4KLZA 3GLGA 3AF0A 4A0GA 2ZI4A 4TL6A 1NKTA 1M7HA 1Z28A 3SC3A 3FMOB 1QHIA 1PLKA 2BWJA 3P27A 4UXIA 1XNJA 2QBYA 1GILA 3OHMA 4H1VA 1CS4C 1Y63A 1PUIA 1DEKA 3BFVA 1N6RA 5L3VA 3K0FA 1KK0A 1PLLA 2V8OA 4NBSA 1E9FA 3E1SA 2QROA 3QBTA 1MV5A 2FE4A 2BJVA 2OZEA 4M53A 1XU4A 5FR1A 4PQRA 1FP6A 1OPXA 1R8SA 2QPOA 4D0NA 2JJ1A 1OKKA 4LX0A 2CLCX 4LJYA 4O2RA 5JWRA 3QQ5A 5G3YA 5GJVC 2V55B 1O3YA 3NH9A 1N2CE 3LBHA 4WZAE 1ZNXA 3OEEA 2B7BA 5FTKA 4U7DA 2KBEA 1QF9A 2F3TA 221PA 4RKEA 2FPMA 4HUQA 5TV2A 5DO9A 1DG1G 4E22A 1OXSC 2VP2A 1TEXA 2ZJ2A 2GCOB 2QTVB 1GM5A 1T3HA 2D2EA 3H0KA 4A82A 4A2PA 5A0FA 3K70B 2VP4A 1BIFA 1G16A 1QHHB 2VF8A 3CO5A 1G8HA 3FTQA 4QGFA 5IF9A 2ZTSA 1LY1A 3WBJA 3K70C 1PJRA 4FXPA 4JLDA 2HEIA 1CIPA 2RGDA 3BC1A 1E2GA 4W5WA 1IN7A 3QNUA 2YWEA 5KNBA 4JMPA 4QM6A 2IX3A 4DSNA 3GPLA 5AUNB 4DIEA 2JLYA 4FWTA 1M34E 4BASA 2AKYA 2F1IA 2LKCA 1E9CA 2W6ID 1G7CA 2GJ8A 2NTYC 1ZNYA 2YHSA 3E2IA 2GJAA 3NBFA 4IFEA 5K8TA 1FMLA 2R65A 2CHVA 2CK3D 1RRFA 1D6JA 2OCPA 2QMEA 3K0AA 4TYNA 1CBUA 1GKUB 2V7QD 1COWA 3WMFA 4DBLC 4FMDB 2WSMA 3QKSB 3AVUA 1KSGA 2FSGA 4HB0A 4NZYA 2MMGA 1Q1ZA 2N1BA 1KJZA 2J59A 3H4MA 2RGGA 3NC0C 2PH1A 2O52A 4GP6A 1KDTA 4LHXA 3KKNA 5H68A 2H5EA 4FD2A 4B2IA 1GRRA 5G53C 5IK2D 2MSDB 3RS4A 2OBNA 4NU0A 4OHWA 1N0UA 1HQYE 2CVFA 5E7JA 3U3RA 1RFLA 1Q1EA 3SEAA 4IEIA 3LVRE 1UAAA 1KDOA 2ZRFA 1ZD8A 4MDFA 2EYUA 5KU1A 1YR8A 4PZZA 3LX8A 4PQYA 3ZZTA 3BOSA 3GEHA 4O0MA 4TLDA 1W1WA 3OIUA 5FUWA 1E1RA 2OFOA 1KSFX 1W4BA 5A4JA 1AS2A 3NBYC 1HV8A 1KGDA 1WXQA 3WYGA 5L3SA 4HZUB 4NYMR 3UG6A 4AYXA 4WAUA 3SFVA 1OYWA 5D3MA 2O8EB 2EQBA 4YLGA 1JXMA 1XZQA 2X19A 3IIMA 4ZKEA 3L0PA 3LDAA 5E7IA 1UEJA 1OHHA 2IYSA 2WIBA 1N5IA 3A36A 4YMWA 5HKKD 2WWWA 5FPYA 4NYJQ 5DN6D 1NBMD 2VH5R 4LZZA 5H1YA 1XXHB 2ZRIA 1P2VA 1S1CA 3EZ6A 1UJ2A 4HZIA 5BN3A 5EZ6B 4RCZA 3CF0A 5FI0B 4A0HA 1S0UA 2J41A 1SQ5A 5CDFE 5EUQB 2IK8A 3RSLA 4A1FA 2F1JA 1KI2A 3ZVMA 3F0TA 5FPHA 1DPFA 1KMHB 1QHNA 3AEZA 3LY5A 2O8CA 4ZPXA 1L2TA 4DSTA 4FCWA 4PTLA 3KJGA 3DMNA 4DSUA 2CJWA 4IDNA 4B71A 3UKDA 5FTLA 1R5NA 2O0HA 1WRBA 4N0EA 5EZ5A 4DDVA 3AVYA 3QKTA 1VTKA 2OLKA 3T12A 4DUGA 3ECCA 3AGPA 4LBWA 3EG5A 3IHLA 4G5OA 5CK4A 5J47A 2ZXUA 4IDHA 2WAYA 5EE3A 2J0SA 4MKIA 4M1SA 1AJEA 5H70A 5EQTA 4V0NA 3E5HA 1RRCA 1E4YA 2RHMA 1Z06A 4LBYA 2RH5A 4OQXA 1KI8A 4LWZA 3ZGXA 3A1TA 3SDZA 4YDHB 4TMXA 2BC9A 4LBZA 1JPNA 1ZUNB 3RVBA 5LB4A 5EUMA 1WDTA 3BS4A 4AYWA 2X1VA 1I4LD 4Q7LA 3Q8XB 4W5HA 4HUTA 2H18A 1KDPA 2YC4C 1KAGA 1MKYA 2REOA 1XXHE 4MGZR 4L9SA 4GMDA 4CIDA 2HLDD 3AF2A 1ZUIA 1IJFA 1XP8A 2A5FA 1NRJB 3R20A 4C0LA 3KKMA 4OHXA 3PEWA 1TUEA 4QXAA 2RCNA 1GL6A 4ZDIA 4HYYA 4OJQA 2J0UB 3C15C 1XJ0A 3W90A 3TR5A 3LAWA 2QPTA 1II9A 3EZFA 4NDZA 3IO5A 1ANKA 5J4HA 4JSYA 2GZHA 5DI9A 5SZIA 2VRWA 2XNDA 3TH5A 3DOFA 1JAHA 3I8XA 3OIWA 4BFWA 3A1SA 2I1QA 3W5IA 3CZPA 2QTFA 5AUOB 3HU3A 2CCKA 3I3SR 4G5GA 4W5JA 5CJ2A 4EPTA 2QT0A 2WSSA 2X2FA 4A9AA 4QM7A 1DARA 2YOFA 5LBIA 3H86A 1SVMA 5EE1A 4HLDA 4TLEA 4OQNA 2IF0A 3OZXA 4LYHA 3SHWA 4RD0A 2EU8A 2GILA 3CRRA 4D80A 4C9BA 1XRJA 3GJ8A 3K0FB 5HE9A 1YKSA 3P26A 4PSVA 3PCRB 4Q7KA 4PZLA 3QSYA 4G5SA 1P61B 3PXGA 3K70D 2FGKA 1GAJA 2J87A 3CIOA 3EAQA 4C0KA 3QUSA 4GP7A 4CT4B 3A6PC 2A5GA 1NL3A 2IHYA 1CJTC 3RC8A 3HR8A 1Z0IA 4PR0A 1OB5A 1Z6XA 5GJWC 4D2IA 3WP0A 2NPIA 1NKSA 2D7DA 1Z6GA 2FFAA 1XJCA 4HUQB 2BEKA 4FMDF 3CNOA 3QKRB 1WBDA 1AIPA 1K8RA 3CNNA 2HT6A 1SVSA 1CU1A 3B13B 3GFTA 1FOEB 3ND8A 4CRWB 1DELA 2CE7A 1OH6A 4PANA 1S2MA 1OXTA 3HR7A 3EPLA 2JLVA 3CONA 2GEDA 3L8YA 1C1YA 4Q7MB 1JR3D 4MYCA 1NMYA 1YZKA 5DGXA 4W7SA 2P5TB 1TU4A 5J40A 4EFMA 2IS6A 1XEWY 1GKYA 4N0DA 3GEIA 1MO3A 2BBOA 2GDJA 4LV5B 8OHMA 5GJBA 3VU9A 4CEHA 2OV2A 5KNDA 2GA8A 1A4RA 3NHAA 3T1OA 3T35A 3OF5A 5KSYA 3CX6A 2H7VA 2ZPTX 1EFTA 4YDSA 1YQTA 1G4AE 2GNOA 2FG5A 4UNSA 4Q18A 3K9GA 4WW0A 1YJ5A 3SJAA 4OQMA 1VECA 4Q21A 2ORWA 4QRHA 1QDEA 2I1VB 2QMUA 1FQJA 1TUIA 3K0AB 3FHOA 4KSCA 4CZ2A 1ZYUA 2REBA 4ZI3A 2IYXA 5HTKA 3Q72A 4CEJA 1CJVC 2QQEA 4XVQA 1I2MA 4B3CA 2D4HA 3CNLA 3PUVA 2WJYA 1XPOA 4WXPA 1DO0A 4IJMA 2AWOA 1NN3A 1ZM9A 4OI1A 4XWAA 3VR2A 4LHVA 1E2MA 4TYWA 2ERXA 5JWHA 3B78A 4IEEA 4MYHA 2ZI5A 1TPZA 4A0RA 4ZV4A 2BOVA 3U7FB 4A36A 2OXRA 2Z4SA 2JIZD 4QJ5A 1W7AA 4MRSA 3ZQ6A 1II8A 1HEIA 1L4YA 1W0KD 4JBYA 3RRYA 3GCGA 2JLZA 2QM8A 4YQFA 3DO6A 1E9BA 3KUCA 4JKYA 3KKOA 4PC3A 4QBIA 3ZD6A 3VNVA 3MG9A 4HLQB 2YKGA 2HYDA 3IO3A 1MRSA 2GXUA 2C8VA 3TE6A 4OKSA 3T1QA 2PMKA 3LW8A 2BBWA 3LBIA 4EKDA 2IEYA 2XSZD 2AR7A 2CLDX 1KO5A 2J46A 3B2EA 1AGRA 2Z4RA 4IDQA 3G0HA 4F38A 5FOVA 3MRSA 4TQUS 1L8QA 2Q9CA 1G3MA 4Z51A 4QOSA 4QC2A 3IUYA 4TT3D 1FFHA 2RB4A 4BRUA 5IHPA 1N5JA 1P9WA 3VR4A 4R2IA 3OEHA 3FFAA 2ANBA 3KQKA 4FW9A 4OL0A 3IEVA 4TZ0A 1X8KA 4ZCIA 2P0EA 3K0SA 5C4GB 3K53A 2C04A 1F2TB 2ZI3A 3VX4A 4M1OA 3U3OA 5H8WA 2VA8A 5DHAA 2R6DA 1JB1A 2XOKA 1VCNA 4D26A 3LWNA 2QP9X 4KU4A 3RSOA 2BVNA 3FKSD 1KY2A 4GOJA 2YWGA 1QHXA 4AK9A 1ODFA 3QBVA 1KK2A 3RAPR 2P6UA 3VNUA 2QA5A 1ZAKA 2QE7D 2WWXA 5G40A 4NE2A 3NBZC 3RWMB 2ZUCA 4XH9B 4OK6A 3AKDA 3WNBA 1RKBA 2QMHA 1ZNZA 1XMSA 3CPJB 1EFRA 1UKVY 1X3SA 3E70C 2RMKA 1US8A 1XEWX 1XWIA 1SVWA 4IRUB 3BRWD 4K8OA 1RZ3A 1CRQA 2UZIR 2WWIA 4BZQA 4RFVA 1Z2AA 2I4IA 1MO6A 3H84A 3QIAA 1P5ZB 1A2BA 1E2HA 5DE3A 1S1MA 1U81A 2HJGA 1QHHA 4G3XA 4IDPA 3HPRA 2ODWA 1DAKA 3NBXX 4DLSA 1R6BX 4H9GA 4L16A 3IQXA 5BXQC 1E99A 1XZPA 1MH1A 1D8TA 1BYIA 3HDTA 5HCIA 3GLHB 1GSIA 3MD0A 1E2FA 2Q21A 4Q1DA 5JHHB 5JS8A 4X8LA 2VHUA 1LFDB 3LVQE 3NIBA 5LD2B 4P0TA 4ESVA 2H92A 2OHFA 4KJZA 4P4SA 2QTHA 5TARA 1LS6A 4B2PA 2P2LA 2FSHA 4HAXA 1TF2A 2ZUBA 2ZUDA 2G0TA 2A5JA 3NH6A 3C5HA 2ODEA 1EGAA 2NGRA 1LB1B 3GJ0A 3AB3A 3DM5A 3Q7PA 4GNKA 5JMTA 1ZUHA 4M9SA 3CKLA 3OAAA 2Z43A 2NZJA 2FZLA 4XJXA 4M9ZA 2V6IA 3IHWA 3QKSA 4JVSB 1OKKD 4MKGA 1BS1A 3AV0B 1JEEA 2VSXA 5TXGA 3OEED 3EA5A 1NLFA 2NO6A 4BZPA 4XD7A 4D25A 4M22A 3FKQA 1T3LA 5FOUA 4C7OB 1OH7A 2ZVQX 2V6JA 2NMVA 1GRNA 4GZMA 3SNHA 5D3QA 2ZAMA 1R10A 1Z5ZA 2V1UA 4NONA 3AVOA 1EWQA 4Q7JB 3A4MA 4BZXA 5FFMA 1VIAA 1FTSA 3X2SA 3ND9A 4AD8A 2CL7X 4A92A 2B7CA 4DDTA 3CR8A 1G8YA 3CBQA 1Q3HA 4OQFA 3GD7A 521PA 1WMSA 3U7EB 1HE8B 4ACBA 4RY2A 5HR5A 1QVAA 2VHCA 3IDQA 4D4LA 3GLHE 2F7SA 1E2LA 1YZTA 3VKWA 4BLPA 4DEXA 4L4UA 4TMZA 3CRW1 1VYTA 2WHXA 1WE2A 4A6XA 3KKQA 2O8EA 2WJVA 4C2UA 4FWIB 5CLQA 3CRQA 2WOOA 2ZRLA 1YR6A 3TSWA 1V43A 4KSBA 1YVDA 4HB4A 2ZQ5A 4MH0R 3AKEA 4A0FA 2ZJ8A 1E9RA 4MA4A 2WKQA 3SN6A 2J0QA 1XXHA 2GJSA 2H8KA 3SBEA 4LJ7A 4UQOA 4X8OA 3DMDA 2CDNA 1DE0A 2JASA 3B60A 3MWYW 4EPVA 3DHWC 1TL7C 2TMKA 1FNMA 2FN4A 1GDDA 1YU9A 1LNZA 1COWD 4P3YA 1NG1A 1N6PA 3U6KA 3EPKA 3K8YA 3L82B 1R4AA 4EQ6B 2FDCA 3VFDA 1G6OA 3SHFA 4CW7A 4ARZA 4M1KA 1VMAA 1G3RA 2C78A 2ZI6A 1LS1A 3P4XA 1AQUA 3A4NA 2ORVA 3W5JA 3WRYC 2D62A 3AP3A 4PPGA 5EP2A 3BXZA 1S3SA 1J8YF 2WJIA 2ZRBA 3DKVA 2VIIA 1QG4A 3R7WB 4GDFA 4Q48A 3QXJA 3I73A 2Z5FA 1KZ7B 4MGYR 2VO1A 4FMBB 1L4UA 2VHJA 4KLNA 5KDOA 4QJ4A 3SQXA 2G1JA 1XCPA 2BMDA 2BIFA 4JBWA 4LRWA 1RYHA 4LY6A 4MUAA 5IDVA 3EPJA 1U8AA 3OFND 1E1RD 3CH5A 4CEJB 1IXZA 4TLBA 3TUJC 3CX7A 5F9FA 1N6HA 4JLNA 1U2RA 2QRNA 1Z47A 3U60B 3JVVA 4HI0E 3HYRA 5JRZA 3CRVA 4OHYA 2ZI9A 5KUTA 1DADA 4QL3A 1U0LA 1T91A 3CW2A 3HPQA 2ZAOA 1OHHD 3P32A 1EG7A 3V4FA 4BE7B 3DZ8A 1HA3A 1CR0A 5BN4A 3KXKA 4OQLA 3SOPA 3R9IA 3DEFA 1GL7A 5FL7A 2KE5A 1GTVA 3C16C 1RPZA 1H8HA 2WMNB 5CIQA 4DLVA 3WHLA 1Q1BA 2J9RA 2J0UA 1GFIA 1SKYB 3U4QB 3IQWA 5JS7A 2NQ2C 1ZD9A 4IW3B 3PUYA 4AKEA 2WAXA 1HT1E 4HLCA 1Z0DA 1D5CA 3QXHA 5CM9C 4AG6A 2IYZA 1GZSA 2FJUA 3MLEA 4PX9A 2QM7A 1FMJA 3SI7A 4IFBA 4XSGA 5FOTA 3IIJA 3ZZUA 3REGA 4B43A 3MGCA 4XIGS 2QAJA 4G01B 1KI6B 1OFTA 2XZOA 1G7RA 1MOZA 2WWYA 1QG2A 4DUGD 4WIAA 1TMKA 3OE7A 1XTKA 1VCOA 2AFIE 3W3ZB 1UKZA 4R2HA 2HCJB 2C77A 1BYUA 3PUZA 3L0IB 4DDWA 1QBKC 3ASYA 5AJWA 2WM9B 2VL7A 2Q0HA 5E95A 4IVPA 1KDRA 3BIFA 1ZCBA 1CKEA 4W9MC 2QPAA 3N2EA 3O8CA 2ZE5A 1H8EA 2EVWX 3KQHA 5KYKA 3B1WA 4JKIA 4WA7A 4GMXA 3MWJA 4DHEA 4HLUA 5EP3A 4Q1FA 2IYUA 2O8BB 1RYFA 2FEOA 3GP8A 3QG1A 2OE2A 1OIWA 1IAQA 3BWDD 4TSFA 3B5JA 4UJ3A 4QHYA 3RHFA 1YZGA 2IHBA 3QKRA 3TMKA 4LV6A 4KBGA 2ZRGA 1US8B 3TUIC 3ZD7A 1SKYE 4TMKA 1E69A 4ON9A 1E2DA 1EXMA 1Q12A 3GFOA 4C0SA 1P2UA 4BGDA 1J8MF 1RJ9A 5DSZA 3NDPA 2R6FA 2ZU6A 2DFNA 2D7CA 2XNDD 3P1JA 2V1XA 5JSZB 3AVPA 3O8RA 3ZQJA 1U99A 4M1YA 2OLJA 3WXMA 1JPJA 3V00A 1L7VC 4B75A 5FBWB 2IBMA 3FWYA 4PAOA 3D31A 1XJQA 2BMFA 2REXB 4NKRA 2B21A 3OIYA 4L15A 5B58C 1KKMA 5E7MA 2ZI7A 4QNMA 5DH9A 1UEIA 1Q0UA 3QVVA 4KCGA 4LUCA 4NCKA 1SXJE 4P4SB 4RCYA 2ORIA 3TW4A 2HYIC 3THXA 1G291 4U00A 2AWNA 5ELXA 2QUZA 3OESA 2OFXA 4QHSA 4A2WA 3TNFA 3UWKA 2F6RA 1OH5A 1HE1C 2H1LA 1KI1A 2IUUA 3KFXA 2C95A 2HT1A 3RS3A 3AVXA 5HPYB 1KI9A 1DO2A 2W2TA 1DVRA 1JR6A 1R0ZA 4II7A 3CPHA 2BMEA 3KZ1E 2PJRA 2EFDB 4MKFA 4HSEA 2F9MA 1NVWQ 3GEEA 2NO7A 1CR2A 3C5CA 3EZ2A 4FIDA 2O8DB 3F5FA 4KV9A 3V9PA 1JI0A 3A1UA 4PC6A 1OFUX 2DFTA 5J4KA 4I1UA 3SS8A 3Q5EA 3HU1A 4PO9A 4Q4HA 2C5LA 4DCNA 2ZJAA 1YZNA 1GG2A 2IF2A 4U5XA 121PA 2V4ZA 4MGIR 2ZR7A 4LHWA 1YZUA 3ZDQA 2UVQA 4IVQA 1SULA 1HT2E 1WBBA 3T06B 1VG0B 3UMFA 2FF7A 4LJ9A 3FDIA 2JCSA 1YRBA 1M8PA 3D3QA 5JZVA 3TSZA 2G6BA 4IHQA 1R0YA 3S1AA 4YMTA 1LW7A 2V54A 5HCNA 5CB6A 2R6AA 4JJKA 4CDGA 1X8JA 1FQKA 2VP0A 3Q9LA 4BFTA 5JEDA 1F2TA 3NTUA 3QG5A 2R6GA 3UWOA 3HJNA 2XZLA 1CR4A 2Z6VA 4BLTA 3THWA 3U7GA 2GVDC 2W83A 4M1WA 1J70A 2QG6A 1UF9A 3X1XA 2XB4A 3LQQA 4G5QA 1P7CA 2GESA 2Q3MA 5FOSA 3LNCA 4ARZB 3SFZA 2OAP1 4DCUA 2J3EA 3B9QA 2WPDA 4RZ2A 2RGBA 1P9NA 4GFDA 4NPHA 2WWGA 3VR3A 3W8NA 5GVSA 4C0JA 4HATA 2JJ2D 4Y0AA 1ZBDA 1NSFA 1P62B 5AR1A 2VLIA 1FZQA 2PZGA 3EIEA 1GVNB 2C9YA 1KMQA 2C96A 1G3QA 2Y8EA 4URYR 1LTQA 4UKDA 4R7ZA 5JRJA 3SJCA 3IBGA 1ZD1A 2LKDA 2G77B 2ZRNA 4GI7A 1U0HC 4Q19A 4JZKA 3RDPA 3A1WA 3W34A 1BO6A 2YYZA 5AK0A 3GLHA 2QGZA 5JJKA 1VIYA 2GZAA 4TWZA 2W2XA 3KL4A 3N5CA 4QGAA 3THOA 3OEHD 1JBKA 1YRAA 2QORA 1E2QA 4P31A 3ADBA 1JXOA 4A8JB 2FGJA 2PZEA 3G5UA 4DLUA 2PZFA 2IT1A 1Z0KA 3T61A 1QHGA 1G17A 2QEQA 3A4LA 4LGMA 3PJRA 2HF8A 2XOKD 1XBTA 3RS5A 2ZR0A 4KI0A 2QI9C 2C9CA 2XZPA 1D2MA 4LJ5A 4DKXA 3QOFA 2BKEA 4F4IA 5EXSA 2C2HA 3W3AA 3F8TA 4DRZA 5CYOA 4EPRA 4GZLA 2IWRA 1IONA 2JGNA 5C2JB 1GWNA 3MJHA 4YXWA 2H16A 1UBEA 2CHQA 3LA6A 4GOXA 4MQBA 1G5PA 3PEYA 3ZS9A 4URXR 4C7OA 1OE0A 1Q21A 3IEUA 4QHTA 1JAIA 1EFRD 5FI1B 1XD9A 2CCGA 3JZMA 2VQSA 2ONJA 1IM2A 1ZP6A 3CF6R 1GITA 3SYLA 4L9WA 2VP5A 1G41A 5GJCA 5TDHA 1WB9A 1D9ZA 3EC2A 4IOMA 4GL2A 2BEJA 4RJLA 1E79A 3PUXA 2PEYA 3GJXC 1IY2A 1E1QA 1YR9A 1TQ4A 4O25A 5BYJA 5DISB 1OLOA 1VHTA 1AS0A 2QN6A 2JAQA 1IN4A 5HZKA 5EE9A 3KQUA 5DIFA 4LI0A 2VSOA 4I81A 4JT2A 3W6NA 1VPLA 4URWR 2FV8A 4Q01A 2ZJOA 2ATVA 5B2ZA 4MRRA 1Z2CA 1T5IA 2IA5A 2RKOA 2W6IA 4HLUC 5AUQA 3TW8B 1MT0A 3ONWA 1NIJA 1UADA 1CJKC 4BFUA 2VHTA 1G1MA 1G8GA 5F3WB 2XB2A 4PSKA 1KO4A 5JWOA 3KTAB 2N42A 4I1SA 4D4KA 1W49A 2QP4A 3BJIC 4NL4H 1JECA 4TLCA 4BPBA 4YMVA 4D4MA 2DCUA 4KYUA 2LWIA 1RJ9B 1I4TD 3CB4A 3JVUA 5DYGA 3TAHA 4R71A 4ZIRA 2XGJA 4Q02A 1NJGA 3OAAD 4M9QA 2ZSBA 5F98A 1P72A 3AQ4A 1E3MA 5LDDC 721PA 2P67A 2FFQA 2YOHA 2IXFA 1UPTA 4EQ6A 2OT3B 1ZC4A 2QQ0A 4DZZA 1G5RA 2VF7A 3GFPA 4LJ8A 4Z1MA 1UKYA 3TQFA 3KXLA 4O2LA 1T8UA 1Z0FA 4PHHA 1G6HA 3UIEA 1QRAA 4PPQA 1F2UB 3KX2A 2FNAA 3PV0A 2XTNA 2BM1A 3L2OB 1G7SA 5UKDA 2NO1A 3RYTC 4B33A 1CRPA 3R7WA 4RD1A 2GAAA 2FOLA 3THXB 2WIAA 4B32A 4NYIQ 1F3OA 5B30A 4ZI2A 1ZIPA 1D9XA 4U02A 3TLXA 4FMCF 1DOAA 5AWFC 4JLBA 4LSGA 2F43B 4G1UC 1XCGB 4ZCMA 5KHOC 3L0OA 1IJEA 2B6HA 1S3GA 3O8BA 1G64A 1OT3A 4V0KA 3I4LA 1ZVQA 1KI7A 2QNRA 2A9KA 5HKKA 4F91B 3AM1A 4DCTA 5B57C 1G8FA 5TMPA 1GIAA 2NOAA 4UXHA 1XEXB 1Z8FA 4DT1B 1P73A 1M74A 2DR3A 3I72A 1NN5A 2A30A 1KY3A 3G82C 4NCNA 2WV9A 2O8FB 3A58B 2YC2C 1E9DA 3AKCA 3EA0A 2AK2A 4TQ9A 4JSTA 5EXPA 4P32A 1OSNA 4KVAA 3LXXA 4TQAA 2DYKA 2XTZA 1OW3B 3IKJA 4QBGB 4XSHA 3U4QA 4NCJA 4V0LA 2GK7A 4Q4HB 4WBSA 4PC7A 1GNRA 4V0OA 1BH2A 2RHDA 1KSHA 1SHKA 2J0VA 1DG3A 4MYUA 2L0XA 1AZTA 1XF9A 3LLMA 3IGFA 3VR5A 1F6BA 3CH4B 1HH4A 2CL0X 2EYQA 1IHUA 1Z6AA 4V0MA 1LV7A 2HCBA 4KAXA 4N3NA 2GRJA 4ACAA 1N6OA 2WZQA 1A1VA 3MCAA 1KI6A 5DLQC 1MO5A 4JT4A 2J1LA 3S1AB 1SVOA 4FINA 3ETLA 1T5LA 5KSPA 2P3SA 1T0JB 4N1AA 1E32A 2WMOB 4K46A 1ZC3A 1VG1A 1SXJA 2RGCA 3PG5A 3VHLB 3Q85A 1NMXA 1R2QA 4EPWA 5SZHB 3N2IA 4ZDJA 2EFEB 4RFSA 3X1YA 4B48A 5L8VA 3THWB 2Q6TA 2ZANA 5FBQB 3MSXA 2XXAB 3I5YA 2ATXA 1E6CA 1F60A 2ZJBA 2ZITA 5AJXA 2BMJA 2ERYA 2IYTA 1E98A 1S8FA 1U9IA 1SZPA 4JLAA 3KKPA 4OK5A 3ZVRA 1RRPA 2O8BA 2R8RA 1DAMA 3R9XA 3H1TA 1G7TA 4NYJR 1ZM3A 2NO9A 2OG2A 5CJPA 4CT5A 4TL9A 5DNYB 3GQBA 1R7RA 1SKQA 3PVSA 2MSCB 4OK3A 4LCBA 4A6PA 5FL7D 4LYFA 1Q20A 1H8HD 2OM2A 4L8GA 1ZINA 3BB1A 2IEZA 2OILA 4ERNA 2MMCA 1X8LA 4PHTA 3B1ZA 5AJZA 4YONB 1EESA 5JSZA 1RRGA 2ZM5A 4FN5A 2D06A 3GLFB 1U8YA 2CBZA 4Q9JA 5F2EA 4JIMA 4V02A 3HU2A 3GMTA 2YWFA 4UNNA 1NI3A 3I8SA 1WP9A 3KJEA 3RRNA 3BGWA 4GSYA 2AHOA 2XNSA 2RGEA 4CVNA 4QJ3A 5CM8B 1RIFA 1GNPA 1TU3A 2C98A 3OE7D 4GRAA 1GOTA 1EWRA 5KSOA 3A1VA 2JLRA 4RSGA 4DLTA 3BB4A 2KBFA 2OXCA 4WXRA 2V3CC 3IBYA 4DB2A 2VPPA 1UDWA 3H2YA 2XEXA 1VG8A 1KZGB 5LD2C 5SZJA 4IOKA 5FBLB 4GOKA 3U6BA 1UM8A 3TAUA 4JVLA 5G3ZA 3I5XA 3EZ7A 1Q22A 1H8ED 4LJAA 3LD9A 4KFTA 4TYYA 3ZVLA 4LJ6A 1MABB 1FL9A 3I92A 1PVOA 2JJ1D 4M0LA 2G0NA 1N5KA 2OBMA 4QGHA 4B3FX 4E09A 4TZ6A 2F55A 3LLUA 4TSFD 1E2NA 2YV5A 3K0EA 2HXYA 1E0KA 1B23P 1BKDR 2WWHA 3FFBA 4JJZA 4F7WA 3QXXA 5JCPA 3BBPA 1UFQA 2YJTD 3UPUA 1PUJA 2O8DA 3LRPA 2FFHA 5JI2E 3EC1A 2QMOA 1KTVA 1JQLB 3FHTA 2CLSA 3HYTA 2WKRA 1IY0A 4F4CA 4TYPA 5FPTA 1MR3F 1U90A 2XJ4A 3GLFE 4B2LA 2GJ9A 2BBSA 1W47A 1XX6A 5AJYA 3AKYA 3CM0A 1VCMA 4EFLA 821PA 2FMXA 1W4AA 2FWRA 3SYNA 1E4VA 3TIFA 3NKVA 5EXTA 3NDBB 2BDTA 2OFWA 4MRPA 2I3BA 2ZRAA 5CK5A 4KODA 3X1ZA 1Z0AA 5C46F 1IXRC 2ZR9A 3VR6A 2ZYVX 4TL8A 1N0WA 4RD4A 1KO1A 2AX4A 3WMEA 1HQCA 2RGAA 1KO8A 1K5GA 4BUJA 4IKEA 3K0CA 4ZIRB 1LF0A 2BBTA 1ZU4A 3VR1A 1K5DA 2PCLA 4LYAA 4C0AC 3RNLA 2BCGY 2ZSFA 4GBMA 1XCMA 4ZDKA 3L0SA 1E2PA 1N25A 1BMFA 1VYUA 4ESHA 3L43A 1S4QA 5E4FA 3ZIAA 3ICQB 3QPVA 2ZSDA 4IVRA 5FBRB 3R8CA 1VHLA 2W58A 4G0NA 2QSZA 3QXSA 2WTUA 4IXNA 1NN0A 4KFSA 1W0JA 1XB2A 3T1VA 1X86B 2ASEA 3MWLA 5JECA 4BWYA 2D74A 5KO2A 2EWWA 4JLVA 2WJHA 4R9UC 2JA1A 3EWSA 3DM9B 4HAUA 4PXAA 1KKLA 1X1SA 3EIQA 4KFRA 5KDDA 4BFXA 2ZS8A 1ZIOA 4YC7A 2GXSA 2IW3A 2W6JA 1SGWA 1YZQA 4OHZA 2GZDA 2XX3A 2R44A 5JBQA 1FP7A 1ZJ6A 4PPNA 2FPKA 4TN1A 2A78A 5TY0A 1KNXA 2YNMA 1M2OB 4KITB 4XTCS 3RRMA 1ZRHA 3DPUA 3BH6A 1ESNA 2QU8A 3BH7A 5KSZA 2R9VA 5K8LA 3ADDA 5KNCA 3ADCA 4Q47A 3PIRA 4Q1BA 2J7KA 2VYFA 1RC8A 3AGQA 4Q1CA 2CXXA 1DAHA 4NYIR 2Z83A 5FL3A 2GEUA 5FUYA 2JLXA 2GBLA 2OCYC 4A8JA 1G5TA 4YMUA 4US2R 4XWKA 2IS2A 4R98A 4C0QC 3PEUA 5DYIA 3B82A 5K8IA 5JI3E 2XAUA 1KK1A 2QE7A 4URZR 5BYKA 3JZAA 3VHXA 4POAA 2WICA 3U5ZB 4Q4AA 5JJIA 1DS6A 3BK7A 4C3ZA 4C4PA 1GRQA 1AM4D 1G3IA 3GJ3A 4B76A 1Z08A 2IC5A 3AH8A 3QPUA 1JEDA 4Q66C 2EW1A 2WPDD 3LW7A 2OSBA 4BLRA 4ITRC 3KB2A 3VMFA 1NVUQ 3B7GA 4KHZA 2Q3HA 1Y3AA 2OESA 3TSOA 1I2DA 5LPNA 3B6EA 4M1MA 4B47A 3GLIA 3AVWA 5CB8A 1SXJB 3CUEF 2ZREA 4EPYA 3EASA 2DWQA 1NVXQ 2H57A 4D82A 4MDEA 2DPXA 1KNQA 1NVVQ 4RFSB 1R5BA 4CEIA 4ABYA 1QHYA 1E9SA 2GK6A 5CIWA 1NBME 1W5SA 1SXJC 2SHKA 1CTQA 4P4TA 2BKUA 2HF9A 1S96A 1CJUC 2D2FA 1GNQA 1R5OA 2EFCB 2GAOA 2ZYWX 3ADKA 1M1YE 4UNQA 4BFSA 1CULC 1G9XA 3ZYCA 3MJRA 3RS0A 2C9OA 2ZYTX 3AUYA 3QEOA 2OUKA 1K6MA 5KPJA 2ZE8A 1A5TA 1U9IC 2OBLA 2GXQA 3KJHA 2J7PA 2ZRPA 5G41A 1RW4A 3BERA 3KTAA 1N3BA 3A8TA 3RS2A 3TKLA 2XJ9A 3UMSA 5JCZA 1Z6TA 5FOWA 1PLJA 4B44A 4TMTA 5CYPA 2QRZA 2PLRA 1E2IA 3QJYA 1CF4A 1XFAA 4JL5A 3ZVNA 2FEMA 2QZ4A 4KO8A 4V0ME 1NN1A 1R0WA 1EK0A 2O5VA 2P6RA 3REFA 1UKEA 2JDIA 3KXIA 3ICEA 1BOFA 3FPAA 2J45A 3UK6A 4UXJA 3NG1A 4D6PA 4AYTA 2GF9A 3PR1A 3PEVA 3P4YA 3M6AA 4AIIA 1ETUA 4YXWD 2PCJA 1TQ2A 5K8UA 2WSSD 4ASUA 1F2UA 5FUVA 1UDXA 4J0QA 1WF3A 4RZXA 4ZCLA 1KO7A 3I1FA 3EIHA 2ANCA 1W48A 4P33A 5BN5A 1AKYA 1D2EA 4X8HA 3CLVA 3EARA 1E79D 2F43A 4B6EA 2AXPA 3DKPA 3UMRA 1E1QD 2DY1A 1XD2B 3FE2A 3EPHA 4JLKA 1Z3IX 3U44A 4TMWA 3J81k 2AFHE 2PX3A 5KDLA 2JLSA 5DI3A 1JJVA 1LF5A 2DWOA 4X8MA 4B3XA 1H65A 4PQFA 4V03A 4Z54A 1XEXA 2FZ4A 4PAMA 4DT1A 3QY0A 5A5GA 5BWMA 1KIMA 1E9EA 1IXSB 1F5NA 1ZM7A 4JLOA 3WP1B 2O8FA 4YMSA 3SJZA 2W00A 1P6XA 3DVLA 4D0GA 1E2KA 2OCAA 2O0KA 2CNWA 4BQSA 5E3HA 2H17A 1S9DA 2J5XA 4DSOA 1KI4A 4AKGA 3WNDA 4MITA 3AF1A 2CMKA 2Q9AA 3FHCB 4BLSA 2IL1A 1XPRA 4OJKA 3RLFA 2GEVA 4DIDA 1TADA 2X8AA 1TQ6A 4Q1EA 4QFMA 2CVHA 1W4RA 1B0UA 4Z1MD 3VKGA 1TQDA 4NP6A 6Q21A 4B3GA 4FMCB 1P9RA 5FTNA 2IYWA 1RE0A 3QI2A 4B34A 1DAGA 1Q44A 1FX0A 3C14C 3U2QA 5SZKB 3NEJA 2VHQA 4OBEA 1NG9A 3OFNA 1J90A 3GJ6A 2ZU0C 1DAEA 2IUSA 1EX7A 3IIKA 2UZ3A 1Z6YA 2RGXA 4Q4JA 4US0R 4Z8XA 3PITA 2P65A 2QL6A 2XXAA 1OXUA 2WWFA 4LHZA 2QENA 2KSQA 1TAGA 2ONKA 2ZRHA 3K0CC 4JLJA 1KOFA 1U98A 2QAGB 3KQNA 1T3SA 4NCHA 4US1R 4A2QA 2KI5A 1SVKA 1U8ZA 3DL0A 2WJJA 1N6IA 2XITA 3F3YA 1JR3E 4AG5A 4JVMA 2R6CA 4M21A 3K9LA 4Q00A 2QAGC 1OB2A 3FOZA 1DAFA 2F3RA 2VEDA 3SU8A 2F1HA 4RVCA 1IN5A 3QF4A 4PAQA 5KPDA 4C0BA 5J4YA 3K9NA 3Q7QA 1TEVA 4WOPA 3WRXC 5HZHA 3PQCA 3CRMA 3D7MA 2XTMA 4F93B 5FH9A 621PA 3W6OA 1YE8A 4TL7A 2C99A 3UXMA 2ODNA 5FBVB 2QP3A 3GLFA 1SVLA 2QY9A 2ZRJA 2G9NA 1Z22A 2JEOA 4PHGA 2BHRA 5L3QB 1Z63A 3B9PA 4JLPA 4K81B 4Q9LA 4ZKDA 5EE5B 1NJFA 3C7KA 2F1RA 3QF7A 4Z8YA 5J5CA 4DB4A 3AP2A 2AN9A 3AF4A 5BQ5A 4LHYA 1SXJD 3IPYA 2V9PA 3WBKA 3M4YA 4JS0A 3SR0A 3R8FA 3SJBA 2CCJA 2GBLC 4P4UA 4OI4A 4TYQA 4A8JC 1JJ7A 2FA9A 2DWPA 1FW6A 1MABA 1IQPA 4Q4AB 3PFIA 4JYCA 4BFVA 4DLZA 1OFIA 2C03A 1J7KA 2GTPA 3GJ7A 1XEFA 3B85A 2R62A 2ZSAA 3QEJA 5CLLA 5L3RA 3RANA 2ZRMA 2AD5A 3TVTA 1MO4A 4LV8B 3AF3A 2DB3A 3L8ZA 1OH8A 4FCVA 4NMMA 5FTMA 4QG7A 1KAOA 4QBFA 1A2KC 5LB2A 2F9LA 1XDBA 2AKAB 2WOJA 3THYB 1OXVA 3KJIA 4CEIB 2AD1A 1Z0JA 3M1IA 3QKUA 1JQJC 2A2ZA 1IOZA 2GHIA 2ZRKA 3IILA 4PC1A 4A4DA 3GLGB 2HXSA 1CLUA 3N70A 2IYVA 2R2AA 3FMIA 4LBVA 1NIPA 5FPKA 1VKJA 3W6PA 2FSIA 3K1JA 2MSEB 4Q4LA 2QBYB 2CHGA 3P20A 3EW9A 3MWKA 3NC1C 4NH0A 2ZEJA 3FMFA 4E03A 1VDZA 1PV4A 2BM0A 3QPWA 3TK1A 4DEYA 1CEEA 1NLZA 2PT7A 3QVUA 4HB3A 2QT1A 2WBLC 4QKQA 1YHNA 2KJQA 4PHFA 1OXXK 2PEZA 2CK3A 1XTRA 2D3WA 1HYQA 5J4LA 2KB0A 1HTWA 4KBFA 1IN6A 2O0JA 2P6NA 3QXCA 4AKHA 2IXEA 2V7QA 4HAYA 3K09A 1MRNA 3VTKA 1NVVR 2ZSEA 1FPMA 3T34A 4JL6A 4TLAA 2NO0A 1CR1A 1Q1QA 4IOJA 5TB5A 1DTSA 2ECKA 2RAPA 1Z29A 5JHGB 2ZJYA 4PO1A 4DC9A 3B1VA 1IN8A 2AL7A 2JLWA 4M4SA 3C8UA 2RGNA 1HY3A 2DHRA 2WJGA 4WZ6A 1ELOA 2W0MA 5IK2A 1OIVA 2A3RA 1GUAA 1P3JA
chains in the Genus database with same CATH superfamily
3ZKWB 2M32A 4RYDA 4XD7D 4RK0A 2J3IA 4UBMA 2SCUB 1FRZA 1QWOA 4IDOA 2VKQA 1V1RB 4AWXA 2VNIA 1KAEA 1L9XA 2LXNA 1LKZA 2XXJA 3BORA 4ID9A 4J7XA 3FI0A 4KXFB 2WKPA 1N4DA 2KPOA 4P35A 3WQQA 1UINA 3PUWA 4YGYA 3IDSA 1QXSA 2HIHA 3O5AA 5E6SA 1C7FA 1N1GA 5BUQA 5CYGA 3F90A 4KRGA 1UWCA 4M0DA 1R0XA 4KC0A 4PIPA 1J25A 1OOEA 2AZXA 1B73A 4M9UA 1ZK2A 2VTVA 5KYUA 4EMUA 2OAQ1 2X1MA 4GE3A 3KDSE 3ZHZA 5DI3B 1F20A 4F4HA 2FPLA 5ALRA 2AJBA 5IT5A 1D2HA 1NBMA 3I34X 3MIZA 1VFPA 4KE7A 1PSZA 3CWZA 4IUYA 1I2CA 1TC2A 2XIQA 2ZIVB 3KWJA 2GARA 5LL6P 3VTAA 2H08A 2ZATA 1ZOOA 1V71A 3VR6D 1E2EA 4DCSA 1LK7A 4HAZA 3K9HA 1YT5A 4JL8A 2AXNA 2Z3ZA 2E1RA 4OCZA 3DBLB 4IOLA 4PYIA 2JKVA 3O7WA 3C7CB 2BFFB 4PZYA 4UBIA 4RMIA 3RC3A 4E21A 2ZDGA 1CUJA 1V8ZA 2FPXA 3VQTA 2FRVA 1UFOA 2BFCA 4PFSA 1AD2A 4G1VA 3WB9A 4DLRA 3FA2A 4TKZA 4B3DA 2B25A 1FDTA 3HY4A 3L0ZA 3M6VA 5D7BA 5EZSA 2IBTA 4QODA 5K1ZA 3BE6A 3DVAA 2AH5A 1KZ4A 3K9CA 1N6LA 1CWUA 1KA9H 4JT9A 2DHCA 1YQEA 1PGQA 1E9AA 1R6TA 3FUVA 4REQA 3HBNA 1W36B 1Y8RA 3TGPA 5KTRA 2JVKA 4DWJA 5EP1A 1ABEA 4BFZA 1ZJWA 4J1NA 4UATA 4UM7A 2JHFA 3G2IA 4B3BA 2QDXA 1FX0B 5LOVA 2HGZA 4D9HA 1CETA 3VMMA 1W36C 5I4IA 2WG1A 4HH1A 3WYAA 2A5DA 2HM7A 1RI5A 4IZ6A 5EP4A 1FJHA 1HUQA 1SQGA 4PO8A 1NY5A 3H5WA 3PNOA 1THMA 2BGUA 2E0IA 5FO0A 4ZDWA 4BMXA 3IAM1 2EQAA 3NO4A 2PZ8A 2P2NA 1PJ2A 3WE7A 4KWHA 3TQHA 3VYWA 2Z6QA 5GV8A 1ULSA 1YS2X 2QLLA 2W6JD 2YS7A 3KUDA 4J03A 3IUJA 1ULUA 1P7ZA 2HA4A 3BWMA 1HQDA 3IA7A 3X1DA 3GRAA 3HBMA 3BT7A 4XPZA 1LSUA 4JMLA 1OI3A 1WB4A 2Y71A 5IM4F 1T43A 1DTWB 3ZWQA 3PGVA 4EG0A 4R8LA 4G97A 2DFLA 4IMJB 4YB8A 3BB3A 1C4OA 2BEWB 1E7MA 2GNAA 1GZDA 4MQ6A 5DGDA 2E5FA 4C4TA 3JQ9A 1IOWA 2ODQA 5K8JB 3MELA 1ISJA 2VSFA 3FB4A 3QF4B 1SBYA 2A1UB 3QKWA 4TS1A 2HBQA 3V3TA 4UEQA 1O94C 5IDWA 3GMIA 4F8JA 5C8XA 2OAEA 3HWX1 1RQGA 1L5HB 1T6NA 2ZIAA 4WMLA 3TL3A 1WCXA 1JKFA 4HOYA 1C80A 4Q3KA 4EKNB 1VE1A 2WIKA 1OGYA 5C7LO 2PA0A 4EKYA 4IXMA 1EAMA 2Q9BA 3GROA 4AUMA 1JT2A 1JHYA 2PKEA 4MYTA 5DBOA 2PKQP 4IX1A 4E2FA 1G5FA 5IDQA 4O2BB 2C4TA 1EX1A 1OWMA 2ID8A 2Q2OA 1CUSA 4FNGA 4KMOA 4TMYA 4TTRA 1Z0SA 4AKTA 4DW8A 3AVTA 3CUTA 5HNKA 5BW5A 3U40A 2HDNB 4F9EA 2IIQA 2ABWA 3PNMA 4W5QA 2WIFA 3UJCA 1BMTA 3A26A 1C0KA 3L8CA 3OZWA 4M1EA 4BIIA 4EA6A 5BWLA 2K7ZA 1OLXB 5E6RB 3MRTA 4QGGA 2XUFA 4Y2XA 3ZY3A 3IX7A 4XOIA 3WKAA 3LS2A 3AR5A 3HSKA 3CLSC 3DNMA 5THXA 5JE8A 4I5DA 1CUDA 2BR4A 2CC2A 1ZNWA 4ZQEA 1ZM4A 2L18A 4C30A 3ZJYA 3L07A 3RVPA 3U7QB 3ZLUA 4MJLA 4QTXA 1GT6A 4YACA 3NHRA 5BMVA 1U3GA 3M0EA 4MLCA 1G8PA 3PXUA 1NDHA 4IDDA 3RR2A 3SX0A 1E96A 2HJ9A 2YN2A 3SMQA 4BZWA 4D79A 3AESA 4KVGA 3UMVA 4QE3A 4MIOA 1KJ8A 1E4OA 1Z38A 3OQVA 3WLLA 1Z88A 3CPEA 1TNDA 2I55A 1UMDA 3WAKA 5I7FA 2J3MA 2C9BA 4C20A 1PWEA 1TK3A 2A1IA 4HVLA 4XEHA 3UCFA 4MV9A 1HE2A 3MYRA 2ZYHA 4G2TA 1QHSA 2Q4TA 1EVIA 1JLLB 2P6PA 2ZS9A 2OCIA 4FCTA 4S3MA 4XGRA 4MINA 4XJVA 4FI3C 3GP3A 3ZWMA 4DR5B 3KT6A 3DA8A 3TZQA 2G88A 1EFCA 2IOYA 2YINC 4EG4A 3G0OA 1XDWA 4E4TA 4MA5A 1LWOA 3Q5DA 4UUNA 3SKVA 3JXEA 4C4XA 2G0AA 1T8TA 4L5JA 3UG7A 3TNJA 1XVLA 3VPSA 3GLIB 1YI8A 1XI2A 4NYMQ 1XZNA 3DVRX 2DPGA 2XD9A 3TPZA 2XVYA 4JP2A 4FOOA 5M5BA 1YR3A 2OSVA 3AIKA 1G21E 1L1EA 2I2XB 1JU9A 4M2LA 2B8WA 4L5BA 4EDHA 1II0A 4KACA 1T9KA 2G5GX 2PGXA 4BB6A 4YHBA 1A4UA 1YR1A 4WZBB 3LWZA 4JBHA 4UTOA 1CY2A 1RXCA 1G20E 2RAVA 3BTUA 2AX3A 2O3TA 1SK8A 2HJVA 4XVRA 5EFZA 2ZE6A 4RPKA 1Z15A 2UKDA 4GLFA 2QX7A 3KWMA 4X9XA 3ANNA 1CUBA 4F5WA 1E8MA 4YJDA 5C0OE 3C3KA 3O94A 1HURA 4HEHA 4KR6A 2IWHA 1NFRA 4AT1A 1OJLA 1XTPA 3ILXA 1VZ2A 3AXTA 4OF4A 4OH7A 8LDHA 1ZL0A 4ZTUB 4KE8A 2IXTA 4YRAA 4UARA 3AUKA 1YXMA 1Z5VA 4J0IA 1V95A 3ZTTA 4HZUA 3VAAA 4EMBA 4PNEA 1QFSA 4M89A 3VNBA 4DJTA 4HB2A 3ZLJA 3RF6A 4EHIA 3CUYA 3U7HB 3KXPA 1Z25A 3C8ZA 3OCWA 3MS4A 3L0CA 3UMGA 1Q7RA 1M2HA 3LO5A 3W2FA 2UXBB 4DWVA 2EW8A 3B1YA 1EE9A 2FWMX 1TLFA 4U7TB 4BNUA 1VKRA 2WE8A 1AUVA 3OZFA 421PA 4BO1A 4CKEB 3BGVA 2FSFA 4S2EA 5FR2A 3DLIA 2G3YA 2RGNC 5TJ9A 4RAQA 2Q3FA 1SK9A 2O2HA 1T1JA 3U39A 2R0QC 1PVVA 2XEDA 1VJ0A 3MILA 4E46A 4C4ZA 1W0KA 1QMGA 4KW7A 2YRWA 5ALMA 3O90A 4D7AA 1GV0A 4DVGA 2FMHA 2MT9A 1ATIA 2II6A 1Q19A 1RWNA 3TQCA 2ZROA 2NVUB 1BDIA 3TQRA 1HNWB 1U0JA 3K6SA 2GWRA 5ANRB 4LJ4A 5A6VA 4Y9UA 5JH7F 2B2NA 1OJ7A 1V8PA 2XSZA 5DLEA 4EJSB 4OHUA 1VMEA 3EQZA 4U2KA 1CB0A 3EVNA 3SHOA 4MPJA 5F4ZA 4B8WA 1VJTA 5GZ6A 5LMUB 1KJIA 4HFRA 3VU9B 4CEHB 1VPDA 2IPNA 3BE4A 3GJ5A 4CFSA 3DFFA 3A28A 4YBZA 4TT3A 2PUDA 4B0OA 4C2TA 4EJSC 1NT2A 2AW5A 2PPVA 4EUNA 5IRCD 4YJ2B 3I37X 1GCAA 3QH4A 4O4HA 1MOPA 3ELBA 4PZAA 5C1BA 2ZIXB 2NG1A 1Q3TA 1JHPA 1ZLYA 4Q03A 3KSDO 1A2OA 4BKRA 4CQJA 1E0AA 3TR0A 4FQ7A 2D5IA 5KOYA 3NTQA 1NSTA 3ELWA 4MVJP 3RFUA 1SIBE 4QWMA 3ZDXB 1W94A 3JASA 5IKPA 4K9SA 1JT9A 2AK3A 3TJZA 4G0VA 3CE9A 2IOFK 2ACKA 4C7MA 1L7QA 3AR4A 3L1JA 2VTEA 2HHJA 3TLMA 4EFKA 5F1YA 1NZDA 1I7SB 3LQ4A 1T8WA 2ACEA 3GV0A 3OIFA 3ENQA 4IXDA 4NTZA 5FTJA 4E5NA 4NMHA 4UBOA 4F8EA 3A37A 5ALOA 1HG0A 3BMCB 4G6ZA 3I6BA 1U2SA 3RAFC 2OB2A 3DOCA 5IKEA 4R2XA 4B3MB 1J33A 2YQ4A 3S6JA 2QLBA 3TUZC 3IOCA 4R8KA 1FTNA 5EWLA 4LZPA 4DUYB 1LPNA 1NUTA 2HIMA 2BFEB 2YV3A 3GLVA 3N5KA 4DGSA 4N54A 2IXGA 4Z86A 4WEQA 4A1OA 1BDHA 1P75A 1QX4A 2ODPA 1W46A 4JEHA 4QUHA 4K40A 1TU0A 1N92A 2YHBA 1J0DA 3NLLA 3STUA 2AEEA 1UZNA 1RAIA 2QVGA 2X9QA 5GVRA 3RLIA 4WBNA 4BNGA 1FUIA 3DB1A 2ZSKA 1J0BA 1GQSA 1XMJA 4W5RA 4MDYA 4Q9AA 1WDWB 5DLDA 1KFCB 3SE7A 1DC4A 3OJLA 4LY0A 1B0ZA 1U28C 4PVDA 4MMYB 1HLDA 5I9LA 2Z5VA 3IERA 3CLTC 4TL6A 3TEFA 1M7HA 3L4BC 3T9DA 3SC3A 3IL2A 1KJQA 3ZWYA 2REQA 4PPYA 5C1PA 7GPBA 3W5BA 1PLKA 2BGRA 2BWJA 1MQAA 1OROA 1JXAA 2H0AA 2QM0A 1OMOA 2ZVJA 3ABRB 3D0QA 3ES9A 1GILA 1Y37A 3MJVA 4MCJA 3WLPA 3V4VB 1A8HA 2PFSA 5JSKA 4CM3A 2ECQA 1Y63A 2YRFA 4L4SA 1PUIA 4M3NA 3PZBA 3ROXA 1QQBA 1MPTA 5L3VA 1N6RA 1NMEA 4QOGA 1M0SA 1TFUA 2BJVA 3G0DA 3JD4A 9MHTA 3GGDA 4RZSA 2IH2A 5FR1A 4X84A 3D3EA 3F97A 1T6XA 3OZEA 3WG9A 2AKEA 5CD1A 1SBZA 4JJ4A 3UFBA 3AY7A 2W6ZA 4I55B 2FMUA 4LXTA 1IBCA 4XXHA 1RACA 3H1AA 5G3YA 3WK8A 2C2WA 3H7AA 3HO1A 3NHSA 1P7YA 2JGAA 3GYGA 2QHXA 3TQIA 1YASA 5KKNB 2B7BA 2QNIA 1C3LA 5FTKA 4NFHA 1YVRA 2A88A 1QF9A 4EW2A 221PA 3HN7A 2F8MA 2COEA 2NVBA 4HUQA 3UB3A 3TOZA 2OO3A 1W88B 4M83A 1DG1G 4IIJF 4YMGA 1V5EA 5I51A 1OXSC 4MS3A 4Y2VA 1E6WA 1TEXA 2YXEA 3JPWA 2GCOB 3EWIA 3VVMA 3OETA 4CF6A 3FR7A 1YCHA 4DWWA 5KOHB 3HCEA 1Z8DA 1Q0QA 4UTRA 1E8NA 2ORYA 2QE6A 2R25B 5IEBA 1G16A 2RFLA 3ZCQA 2WW8A 2VF8A 3U4IA 1YHZA 3GZJA 1J42A 1XQVA 4J49A 4WWHA 5HMLA 4AO7A 2YQZA 4QT4A 1KU6A 4KL8S 4QGFA 5IF9A 3BD6A 2HA3A 4I2VA 5I6DA 3W2GA 2AF3C 2ZZKA 3AI7A 3BC1A 1U9CA 2Q7XA 4IO0A 3RG2A 2XUKA 3K0HA 4YUAA 2FSUA 5KNBA 3FOAA 2I6SA 3GNTA 2C7VA 3NIGB 4UAUA 3QYPA 2ZIEA 4BASA 1AURA 2F1IA 3H5LA 3ZV3A 2A0KA 2P91A 4CV2A 1E9CA 4C7JA 5IYZB 2NTYC 4OP1A 2FZEA 3NBFA 4IFEA 1NUHA 2AQIA 2NU6B 2PR7A 5EMNA 1NVFA 4PFJA 1KFBB 3THRA 5A4DA 4LQLA 2CHVA 1M6VA 3M83A 4JN6B 2CK3D 3SZOA 4EYEA 1D6JA 1XZ8A 2HHLA 2Y68A 3A1DA 3A6JA 3HNRA 1Q83A 3O1LA 3KE8A 3K8QA 1C9DB 4LWOA 1S02A 1COWA 1LDGA 3CY6A 4F06A 3E22B 1T9GS 4FMDB 4KK4A 3EXG1 3ZU2A 2FSGA 4HB0A 1GLGA 3QVKA 4YRLA 3ZG6A 2MMGA 1Q1ZA 2Z56A 1SCJA 4MS1B 3KKKA 2RGGA 2FFJA 2XCIA 4OLJA 1IG0A 1KDTA 2JD1A 3PS9A 1IG3A 5CA0F 5JU6A 4S0ZA 3WSVA 4EJ6A 5ILOA 1GLVA 2EQ5A 4ZTZB 1ENYA 5IJAA 5FWYA 3RS4A 1G8SA 1P4RA 4COOA 2GN2A 2OBNA 1TECE 4FDTA 4GOLD 4NU0A 2PL9A 4I6GA 1HQYE 4ZVQA 2YX1A 4PW0A 1L6IA 2PFKA 4KN8A 4Q6WA 4N8DA 4B5KA 4P34A 1DCFA 1KMNA 5EMLA 5JYDA 3BIXA 1UAAA 1DSSG 4DG8A 1FE8A 2VBFA 1H2EA 1QQAA 3ETJA 4DYDA 3AHEA 5JYBA 3IUMA 1JU3A 1GZ6A 1IRXA 1ONSA 1U8UA 1W1WA 2V6FA 3GB9A 2OFOA 3E35A 3OIUA 1VI2A 2PD4A 1KSFX 4TZKA 1AS2A 4X45A 5CHEA 3MJDA 8MHTA 4W9NA 4UDXX 1KGDA 2G76A 2GPWA 3ZYZA 5BW4A 3UG6A 4RE5A 5AVTA 5JJCA 2HCFA 1OYWA 4HDSA 2F3UA 4GAEA 3S2GA 2PQ2A 2EQBA 3EGOA 3FROA 4NG5A 2XODA 1XZQA 3IIMA 3LDAA 4CQLB 5TQJA 4O4JB 3ZIUA 5HKKD 5A0TA 1EM8A 3OY7A 4DBLE 2WD7A 4HL6A 5B1DA 1WCWA 1XXHB 2QD5A 3OX2A 1ORDA 2PZAA 2ZRIA 5IDYA 1EB8A 4B81A 5BN3A 4XM2A 1UPAA 2FPPB 1N0IA 3PNBA 3LKVA 4DNXA 3ZBQA 1N8NA 2ZUUA 3HKDA 1L7DA 2Z3WA 2J5BA 3QUCA 3L6RA 2C3MA 4FFNA 3RSLA 3SLRA 1RPNA 4GVPA 1QRUA 5AQEA 1QHNA 3GFBA 1X7XB 3AM5A 3G6KA 2ZQYA 3IQDB 1HORA 4XDYA 5E3JA 2V7GA 5J1TB 1BHJA 2AOUA 1L2TA 1NQAO 2ES4A 3SSOA 4D99A 1H0KA 1ZN7A 3DMNA 4DUZB 2BHTA 2CJWA 1ZJZA 2VF5X 3G8DA 4GOMD 4B71A 4RIFA 2PXHA 1HEYA 1HLPA 1NJ6A 1R5NA 2B4AA 2BTQB 3OZDA 5EZ5A 3TS1A 1CYDA 5DNVA 4LDPA 4FJ2A 2OLKA 3UXHA 1NJ2A 3PRYA 1KFEB 3AGPA 1SXPA 3M6LA 4QQNA 2BP7A 2GZ2A 5LVAA 4BNNA 1NJ1A 3U5ZB 1UJ4A 2J9XB 3PFHA 3E9QA 1D2AA 2QW8A 4KUGA 3NFYA 4MHOA 1FNSA 4M1SA 4U3JA 4BJ6A 5H70A 1M1NB 3KHSA 3KDPA 2Q6LA 2IYFA 1CUWA 1FYXA 4WT7A 5EQTA 1FYDA 1B41A 3FBWA 3UMBA 3RRFA 3E5HA 1E4YA 1Z06A 4B4UA 2A0YA 5BNTA 2P2DA 4OQXA 3R74A 2VH1A 1WV0A 4LWZA 1E64A 1A8UA 1MFPA 4N5HX 3DLHA 3RSQA 3SDZA 4YDHB 4QUJA 3W5CA 2I4RA 2R8ZA 5TRTA 3GAMA 1WABA 1CQJB 4JI0B 5LB4A 3BS4A 3ABQB 3ZGNA 3DT6A 4R84A 2EBFX 1L8AA 4HMQA 4BO7A 2CB9A 2YC4C 2XVXA 4CL8A 5BQXA 1ZVMA 2O14A 1J9GA 3P19A 4QDZA 1RQRA 4GMDA 4L9SA 1R0CA 4TRJA 1KZ6A 1T9DA 4E12A 3QUTA 3NZEA 3MYYA 5SV2A 2R79A 2RK6A 2WKWA 2JAPA 3GN1A 2RCNA 2EEPA 2V6MA 1VPWA 4HYYA 4OJQA 1XJ0A 3UPTA 2JGRA 2QRHA 3OOSA 1EHCA 3PRKE 4KPGA 2QPTA 1II9A 4O8CA 5KVSA 1BQEA 5J4HA 1PNQA 2IU0A 5DI9A 2A4MA 2LV8A 3COPA 1PNOA 3QEKA 5EIFA 1EEHA 4CLEA 3I8XA 3OIWA 1WM1A 3A1SA 1F6DA 1A4IA 2W2LA 4D0RA 4Q3LA 1L5VA 2I1QA 3FZEA 4WNCA 2V5VA 3W5IA 5IU6A 4CKBB 3EVFA 2B5VA 1ZRSA 3I3SR 1U9YA 2PX5A 3WLEA 1ZICA 5D7NA 2Q7OE 4BQRA 4EPTA 4K1LA 2X2FA 5I7RA 5FEUA 1YZHA 2COKA 1V4NA 1J2YA 2HWYA 1GKLA 2YOFA 2G25A 4F1KA 1M54A 2VJMA 3LA8A 4H15A 4HLDA 1KARA 2IF0A 1XAIA 4LYHA 4RHCA 4M0FA 1JEYB 4NCBA 4FXOA 4B4VA 3A6GA 3GJ8A 4Y1FA 4JI7B 4EVRA 2IDMA 3P26A 4PSVA 3DH0A 3QSYA 1CUHA 3IMGA 3PXGA 2FGKA 1GAJA 2YV1A 4GI1A 1ZSVA 3OKCA 3P9PA 3ZU5A 1FFCA 4CT4B 2OV6A 3OLCX 3I64A 4R4JA 5AVKA 4ZJZA 3B3FA 4JWTA 3GUVA 2GCGA 3INNA 3AJRA 3N74A 1I4OA 1IIRA 2HU8A 4KRYA 1OB5A 3WHPA 2V97A 5GJWC 4KXMA 1Z7GA 1JHAA 1EYZA 3WP0A 2XA9A 5BSRA 3CIFA 4WLEA 1KERA 1K3FA 1XJCA 1ECCA 3L0YA 5DPMA 1R6VA 4K6HA 3GFSA 3ZU6A 4CPDA 5KYWA 4JIGA 4CLRB 2HT6A 3B13B 1CU1A 2C8LA 4MB6A 4QU9A 1KH1A 1PJAA 4L50A 1QRRA 4CJXA 1X80A 3OA0A 1S2MA 4YRJA 1OXTA 5FIUA 1K88A 2FEPA 4LQDA 3EPLA 3KYCA 2TMDA 4MGHA 4KGVA 2GEDA 1E5DA 3E0QA 3A4IA 2DFVA 3HA2A 3PD1A 3QLUA 3P2EA 3KEQA 3L8YA 3TNDA 1C1YA 1JR3D 1NMYA 3GO4A 4W7SA 1Y6ZA 4OQYA 1OLUB 2IS6A 2WHQA 3M3DA 4PLWA 1GKYA 1KZ1A 2Y93A 4NECA 1S2OA 2BBOA 4LV5B 2HKIA 3JQ7B 4WADA 4LQ4A 3V2IA 1XKLA 5TT0A 1P91A 1X14A 1GG5A 2YW9A 3NHAA 1A4RA 3T1OA 3VH1A 4FGKA 3T35A 3OF5A 1W19A 4ZC8A 1YQTA 4QSMA 1JP7A 2VZ0A 2AZTA 2GNOA 3FDJA 5F9MA 2AV6A 3M1YA 3TLGA 2D0DA 3UJ3X 4BNXA 4N40A 1O97C 4UDNA 4NAVA 5B58T 3NVDA 2ENUA 1HEUA 3DTNA 4D9NA 4Q21A 3ZIDA 4LMPA 5DWDA 2O6HA 1QDEA 3ZGVA 1GRCA 1FQJA 1TUIA 2D1TA 2LIVA 3AR8A 3D2BA 3FHOA 1RWOA 3K0AB 4TV8B 1LQUA 1NKVA 4F3YA 4ZI3A 5HTKA 3A10A 1IN1A 3Q72A 5JQGF 1QV9A 4INPA 3WAJA 4I4IA 2QQEA 4J4BA 4ZYLA 2WABA 1J0XO 3EPRA 4L6AA 3FUWA 3CNLA 2JK1A 1DO0A 3FJYA 1IIBA 3HB7A 2Q62A 4IJMA 4UZFA 2JVIA 2OXTA 2RGUA 3DE5X 3DMYA 5AW2A 4CM8B 2BSAA 4OI1A 4JBGA 1N2HA 2H1IA 1N32B 2BT4A 3VR2A 2PNJA 1YC5A 1GZVA 2HIGA 5KKAA 1H1TA 1CNMA 1RXYA 1GD1O 3B78A 1TPZA 3DWFA 3I58A 3LPMA 4IEEA 4Y2UA 2BOVA 3DS8A 4YT8A 1W5FA 1DEOA 2W2PA 2OXRA 3U7FB 1MGPA 2NSLA 1I3OA 4QJ5A 2JIZD 1W7AA 2WQZA 2O3QA 2WU3A 4KO3S 5E9WA 4EM6A 2QLTA 1YQWA 4IILA 4EF4A 2ETVA 3KLOA 4RK4A 1DQRA 3RRYA 3EY4A 3VPGA 2JLZA 1E9BA 1THGA 2FQXA 3KKOA 4PGFA 4FB5A 3AJAA 3MG9A 3FNHA 3NFRA 1MRSA 2HSZA 2Y0BA 1UJ5A 3ICVA 3R3XA 4G0QA 3TE6A 2FDXA 3U9LA 3T1QA 3HXOA 3U56A 4KR7A 2CLDX 2ODAA 2Z4RA 3Q3IA 2DKFA 1T9ZA 3BBLA 4HH0A 4S1WA 4WJKB 5FOVA 2BKAA 3H04A 3MRSA 2N9UA 4LYGA 2PSHA 1BXRA 4D4HA 2EKBA 1YBAA 2RB4A 4GGOA 2YNMD 3OBIA 1P9WA 4IX9A 2ANBA 2R751 3DE6X 4CM7A 1BJKA 2FWAA 3I12A 4PV7A 3LRTA 4YCAA 3IEVA 4FZVA 4TZ0A 4MUEA 1X8KA 4OOFA 1LUAA 4D9BA 5C4GB 1SUEA 3K92A 2C04A 1M34A 2ZI3A 3EF3A 3OQBA 3PVCA 3AZQA 4A3SA 1DQNA 2PBLA 5PGMA 2VA8A 3G0CA 1PFUA 4G4SO 2XOKA 1VCNA 4BKMA 5ADHA 2XUPA 3OP1A 3PXEA 4P3NA 4RPLA 3EF1A 3V55A 5EHZA 5ICMA 1J39A 4KU4A 2BVNA 2YJGA 3KJNA 3W3AH 2OK8A 4ITVA 2PYIA 1YIOA 2PJUA 3CS3A 3DZIA 3N2GB 4OD0A 2PE5A 2WWXA 5G40A 2PZLA 1ZCJA 3NBZC 2ZUCA 1DINA 3RWMB 1XMXA 3WNBA 4FPXA 4GKJB 1ZNZA 2DM6A 2QZJA 4N39A 4AZVA 4DCJA 4ME6A 3VKUA 4DV0B 1W29A 1Y1LA 2DMRA 3DDZX 4D0NA 1FXUA 4G8DA 4Q0MA 2QGFA 2CZQA 3FYUB 4ETNA 2HPAA 4K8OA 3BRWD 4WFQA 1M8FA 1RAHA 5P8WA 1F7VA 3IEKA 1CRQA 1U2GA 4V2UA 5HG0A 2WKSA 4RFVA 2I4IA 3JD3A 3Q5GA 4GI2A 1K92A 3FYUC 4DQVA 2LPMA 2LR0A 3FLAA 3N07A 1S1MA 3AR7A 4G3XA 3HPRA 2ODWA 1DAKA 2PDAA 3NBXX 4E5SA 1RNLA 1O6FA 1WOMA 4GS5A 4H9GA 4L16A 4BP8A 5B12A 2XI4A 1E99A 5IVKA 4E5DA 5KNLA 5TQVA 4ARBA 5AI8A 1BYIA 4ZQHA 4ZI7B 4MW5A 1KPGA 4KX3A 4Q1DA 5JHHB 1I32A 2OZLA 1NOIA 2IHJA 2YL2A 3NP9A 4J7UA 3ZZ1A 5JS8A 1YI1A 1YR2A 4GSLA 4GW3A 4P54A 5ECDA 2OHFA 3OE1A 3MBIA 3GA7A 1A98A 4I1RA 2VPWA 4UC0A 4JCOA 2IXDA 4FZJA 3L6OO 4FR2A 4L08A 3BXHA 4JJGA 5EJ7A 3JQ8B 1JLHA 3QVGA 3UW1A 1LB1B 3ERCA 4NJMB 3WKCA 3U0BA 4I7EA 1YL6A 5J1SB 3CKLA 1EG2A 3B36A 3PA6A 4AL4A 2EARA 4R9VA 1IJBA 3UZUA 4OQPA 3ZD8A 4C21A 3ZV6A 3F7OA 4I1YA 2OG1A 4FGSA 3EHEA 3O83A 3KDAA 1GXSA 3V1UA 5CM2Z 3H8SA 1JEEA 1TFRA 4JQSA 1P1RA 4ZEXA 1FQWA 3FXAA 3GY0A 1ZK0A 1GPBA 4IJUA 2EOAA 3F7MA 3SKXA 2X8WA 4RSHA 1OH7A 2ZVQX 1ZHFA 2QIPA 2V6JA 4HD8A 2NMVA 4U2FA 1GRNA 2HHAA 4HDKA 4O2AB 4U7WA 2G80A 3I9NA 4OMUA 1MQSA 2CVQA 3NCTA 4EI2A 1R10A 1Z5ZA 3A3NA 4LXYA 1XFDA 5HQTA 2V1UA 1JA9A 3A04A 1A9ZA 2DH5A 3A4MA 4JI4B 2H8GA 3WLHA 1SMKA 1CRLA 3C39A 3L7BA 3Q7RA 3NBQA 4NBRA 4RQUA 3ZJTA 2B7CA 4X20B 2FR8A 1A9RA 3CZAA 3O3MB 4DMUB 4F60A 2ZB3A 3CN7A 1E3WA 2B6NA 5E8JA 3DONA 1ZO8A 4HQ0A 4UVDA 1KVSA 1HE8B 4IIEA 5JCJA 4RY2A 4UEKA 4V3CA 5JIBA 1DIOB 3DDWA 3IDQA 3SS7X 1E2LA 1MEEA 1ONNA 2CEKA 3A25A 4K87A 3RYHB 4CMEC 4DEXA 4FOLA 4FM9A 1WE2A 1EFDN 4FWIB 1U7WA 2NAPA 3AL2A 3VYSB 1XU9A 2V4UA 1JMVA 4CM5A 4KSBA 1YVDA 4HB4A 4R68A 2ZQ5A 3R6GA 1QWSA 4HVAA 5ADUS 3SN6A 1HQKA 1SOAA 3AINA 2NU8B 3ZWWA 9LDBA 2XKAA 4X8OA 1NC3A 3MWYW 2O3JA 3PGKA 5I5GA 5CX1A 3CLUD 1TL7C 3DO8A 3S99A 1HFKA 4OFZA 4L5AA 5DWQA 4TKVA 1H66A 3N0TA 4P3YA 2JFNA 1NG1A 2AI1A 3U6KA 3EPKA 3W1EA 3HCOA 1ZPDA 3W1VA 4N01A 2OGSA 4EQ6B 2J6IA 4ZK2A 4DR6B 1JMKC 1FVOA 2P30A 1I5EA 4P5EA 2VXYA 3ZXXA 4MSUA 3AF6A 3SHFA 4KSYA 1EDOA 1PQPA 2ZT6A 2MR5A 2C78A 4G8JA 4AZTA 4W5TA 5BQFA 1TO1E 1JJBA 3A4NA 3AM4A 3D4IA 3AP3A 1T2AA 2ILTA 1IH8A 3WV4A 2WJIA 5CW2A 2C4VA 3WA7A 1G5QA 1M10A 5IXYA 1KZ7B 4MGYR 1V8OA 3SVTA 3T4UA 2VH2A 4ZC1A 2WYHA 4MW9A 2P0AA 2IYAA 3ACCA 5KDOA 2G1JA 2BIFA 2PRIA 1Q0LA 5IDVA 1RYHA 3LOUA 1U8AA 1GQ2A 1IM5A 3LQ1A 1IEQA 5A04A 2O2GA 4GPD1 1RTKA 2R7KA 1ZOSA 2RDMA 2RJNA 3BREA 3I3OA 4NJEA 5E9QA 1CS0B 5JVDB 5CFPA 4CEJB 1RC1A 3EG9B 4PYMA 2VZ9A 1JQKA 3OEYA 5HQ3B 4PYJA 3NWEA 3INTA 1Z47A 4NU6A 4FE7A 1EVKA 1ZBQA 1GN8A 2R11A 5B6PA 1YBMA 4B82A 2K87A 2X42A 2QK4A 1U0OC 2J5QA 3CZ9A 1DADA 4B31A 1U0LA 2TRSB 3CW2A 2NQ8A 3HPQA 1OHHD 3MUNA 1EG7A 3COZA 4BE7B 4DCOA 1UC4B 2I2CA 3Q9NA 3SKYA 3AO0B 1V2GA 4EZBA 1FFXA 2E7ZA 2JGLA 4UPDA 4MKRA 2FPGB 4WNYA 4OSPA 2V3WA 4OQLA 5HF5A 1AQJA 2NV2B 5AW0A 2Y1XA 1XROA 1OAOC 2WMNB 3DV0A 3VHQA 5CIQA 2PGLA 3WHLA 2J9RA 2DE0X 4EUSA 4AMUA 5KZMB 2FX5A 1JJFA 1UXGA 3IPAA 1ZD9A 4IW3B 3FCSB 3PUYA 4Q24A 2WAXA 5DULA 1Y42X 1D5CA 4HLCA 5CM9C 3MHTA 1DUIA 4IF6A 3ND5A 1ZXXA 2Q1WA 1JFVA 3B3GA 3A3OA 3ONNA 2VK4A 3KT8A 1L1FA 4DADA 1PDOA 2H85A 1IOLA 2JIDA 4HYEA 4Y6QA 4XDHA 3TGLA 5FOTA 1L7BA 1AQLA 1Y3IA 2XCLA 3REGA 4B43A 3MGCA 4XIGS 1XXLA 3NT5A 4KQJA 1POXA 4G86A 1NLMA 3DE0X 3DQQA 2M9MA 4DUGD 2J0SA 4WIAA 3V8MA 4RA9A 4IMPA 1XTKA 1C1DA 4O08A 3I9JA 1ZJJA 1VBFA 3UC9A 4KR0A 3HKCB 2LZ0A 3MF4A 4P36A 4QECA 2C77A 5KYYA 4DDWA 2WNIA 3MQFA 1QBKC 3ASYA 3L7MA 3CVUA 5E95A 3T9AA 3N2KA 3JVDA 3KSUA 2PRYA 3PC7A 3OPYA 4I4CA 2C2MA 3EXEA 4GR5A 3D6JA 4LOIA 4WN9A 4JKIA 3MWJA 3NBKA 4DHEA 1JHXA 2JBWA 1C7JA 2PKYX 3BMNB 4HLUA 5EP3A 3H16A 3WV5A 4AJNA 5HGXA 3KEMA 5HW0A 4DPKA 1X8XA 1PSDA 3RU7A 4EB0A 2H4HA 4TGLA 4I46A 2QR5A 4E32A 4ETMA 3HKBA 5H82A 1Z33A 4ZVMA 3R9XB 1ZLXA 1OIWA 1IAQA 1FY2A 1PT7A 2B2CA 3B5JA 1DMSA 4JVOA 4KQGA 4DA9A 1X13A 5JAOA 3TMKA 4JI1B 2B1QA 2ZRGA 3IQGX 1VJ5A 3U37A 3TUIC 3AW8A 4KXUA 2P2GA 4TV9A 4P9NA 4U9HS 3DW1X 3QVJA 1XPJA 2P41A 5K3AA 2C54A 2AG6A 3GFOA 3ZXUB 3OHSX 4C0SA 2JH9A 4J1QA 3GDGA 1J8MF 4UXIA 1RJ9A 4KN5A 4QICA 2ZU6A 1EP9A 1T1IA 2JRLA 3SQNA 2Y1WA 3ANYB 2D7CA 3S55A 4BYGA 5C7YA 1IBKB 5IVDA 5JSZB 3AVPA 3FWHA 4KBYA 5LIPA 1A7KA 2OLJA 4RPCA 5K3OA 4KAJA 3IELA 3D31A 4EYQA 3RIHA 2REXB 4M0UA 4NQRA 3Q6IA 4LC9A 2IYPA 3C6BA 4L15A 5GZ3A 4A6DA 1V5IA 4YJHB 1PJCA 4QNMA 1ONOA 2DQSA 2JCXA 5JAPA 5L4SA 1Q0UA 1VMDA 4KCGA 4J2HA 1BMDA 1SXJE 5B3AA 4D9MA 4PINA 1ZQ9A 2VTBB 2OYRA 4E13A 4RF2A 4U00A 5ELXA 4U2BA 3ITEA 1SKMA 2PTHA 1JW9B 3BTSA 3BD7A 4OVKA 3P5BA 4QHSA 3RASA 1MPXA 1JQEA 3BHNA 3KZNA 3OD1A 3IE1A 1O95C 1SEVA 4M36A 4TTIA 3PC3A 4Y6SA 3FPEA 3GUCA 1T35A 2F6RA 3QELB 2WUEA 1RBZA 3JATA 3TTUA 1PAUA 3GZNA 5D5PA 1KQNA 1OH5A 1KI1A 2CKDA 4H0NA 2IUUA 5C3MA 2BUBA 4PSDA 5LBTA 4D57A 3MXTA 3KQSA 3KTOA 3BL5A 4HRXA 3DF9A 4OQQA 1KIAA 5AOCA 1DVRA 3OF2A 5DU2A 5C1IA 1JR6A 1R0ZA 4II7A 3LO8A 3CPHA 3KZ1E 4UHBA 3JQGB 3NQ41 2V7TA 2EFDB 3AEUB 4MKFA 5D85A 5KI6A 4RVOA 2KS6A 1BHSA 2P68A 2PGNA 3GEEA 3AFGA 4WQMA 5AKEA 4YO8A 3OPMA 3U48A 5HKOA 2IHNA 3C5CA 1DLJA 3Q10A 2QPLA 4P5PA 3KOUA 2QTAA 1ZS9A 3N2ZB 4HGPA 1RCTE 4KV9A 1CJCA 4GYJA 1HBJA 4RHUA 2YCBA 1JI0A 4X97A 4JT8A 1F1JA 4BEVA 1X70A 3FY4A 5JUWA 2BZGA 4Q4HA 1CUVA 2C5LA 2HWWA 4HO1X 4JX8A 3TJRA 4F84A 2QMQA 1LLUA 3D6MA 1YZNA 1GG2A 1XZDA 2IF2A 121PA 3GPBA 3O8NA 3JALB 2NU7A 4GXNA 4MGIR 5U4QA 1A5ZA 5A06A 4IVQA 2KX7A 3IE0A 1SULA 2X5KO 5HF9A 2PKXA 1HT2E 3I2YX 1R9JA 4ZN6A 1FEZA 1PKXA 2GPNA 3A3KA 1HE3A 3FDIA 4LJ9A 3VZQA 4LDZA 1YRBA 1M8PA 2RGWA 3D3QA 3T9CA 4FLMA 4F6LA 3TSZA 3D1LA 4X3CA 1H23A 1ZN2A 1R0YA 3S1AA 2QRKA 1JKXA 1LW7A 3AETB 3PB3A 4JELA 1IHOA 3CC8A 4XE5A 4MTLA 4AVYA 4EYKA 2BGJA 1X8JA 1FQKA