2YNMA

Structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
ALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Adp-Aluminium Fluoride-Stabilized Protochlorophyllide Oxidoreductase Complex.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Oxidoreductase
molecule keywords LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ynmA00
1Z0IA 3B1WA 3K0FB 2JATA 2CK3D 2GJ8A 3SN6A 2ZXUA 3ONWA 4H1VA 2KI5A 5L3RA 5SZIA 2Z5FA 1CS4C 1OSNA 1ZRHA 4JJKA 5CIQA 1VCOA 4CEIA 4WZ6A 3AF2A 5KU1A 3T1VA 5L3QA 1HUQA 4IDPA 3LW7A 2AXPA 2MMGA 5AUPB 1Z0JA 1L7VC 1L8QA 2BC9A 2VEDA 3UG6A 5LD2C 1JXOA 5FTNA 621PA 1S2MA 4HDOB 3F0TA 1NN5A 1R0WA 5KSYA 4N0EA 3QQ5A 2VTKA 2V3CC 2NO1A 5K8TA 3B85A 1G17A 521PA 2GK7A 4Z1MA 4DCUA 2NQ2C 1H8HD 1MKYA 3DZDA 3AM1A 2HJVA 2GNOA 3AH8A 2FMXA 2NPFA 4OKSA 3SJZA 4DLZA 5FFMA 3CO5A 4RVCA 3KKPA 3DMNA 2QRZA 1Q3TA 2WZQA 2P67A 1XMJA 3DOEA 1KK3A 3UWKA 2GXUA 1OH7A 2ONKA 2GJSA 2PLRA 2LCFA 2ODEA 1CULC 3BORA 3LNCA 3SQXA 4ACBA 2DFLA 1KDRA 3LY5A 4OI1A 4A82A 2ZRBA 2CXXA 2D4HA 1GAJA 4O0MA 4JKIA 1NSTA 5IDVA 1NLZA 3GLGE 2NO7A 2IBMA 3FMIA 4PAQA 1JBKA 2XTNA 1MABA 1U81A 1XMIA 3EC2A 4PXAA 2X19A 1NNEA 3SU8A 2REXB 1KKMA 1FQKA 3PIRA 2R9VA 3GLHB 4C0KA 4DDWA 3CX8A 1T5LA 3A6PC 1AQUA 1P72A 3RAPR 3LW8A 3LQQA 1N6NA 3B5JA 1TEVA 4HB3A 3THWA 2ZS9A 1XP8A 3EZ6A 1IHUA 2HXYA 2MMCA 5LBIA 3U61B 1JECA 4LC0A 2IS6A 3I62A 2F6RA 2WIBA 4OBEA 3A36A 4RZ3A 1FTSA 1AS2A 2PL3A 4B6FA 4FWIB 4KYUA 2B8TA 2DWQA 2WWWA 1JR3A 2WSSA 3G82C 2WPDA 3U2QA 3V9PA 1M2OB 1P62B 4KVGA 4O2LA 4DKXA 1Z0FA 2KB0A 4QNRA 1CJKC 3TIFA 4XSHA 1OF1A 4NP6A 4CW7A 5BN3A 1SVLA 1NVXQ 3S1AA 1TX4B 1XPUA 2J46A 4HSEA 3HYTA 4BPBA 2PT7A 1KMQA 4K8OA 3N70A 1G19A 4K46A 1E2HA 1Z83A 3D31A 2GJ9A 5KOYA 5F9HA 4TMZA 1ZNXA 2FU5C 3NEJA 1EFRD 1N0VC 2H1LA 4Q02A 4KXFB 4ZKEA 1F60A 1GFIA 2ZQ5A 3CZQA 5G3YA 3REGA 2ORVA 1U9IA 4TLDA 1T91A 4WXRA 2OAQ1 3C8UA 1ZVQA 1XCPA 4PZLA 2AWOA 2NMVA 1ZW6A 3PUXA 1U8YA 4TSFA 4MRNA 4DB4A 5FPYA 2AHOA 2RGDA 4BZQA 3F5FA 2W00A 3IQWA 4QOSA 3FOZA 1CJVC 2HV8A 1ZNYA 1E9BA 1US8A 2G3YA 3H86A 4PR0A 4I1UA 3TK1A 3QXHA 1SKYB 3L8ZA 3JVUA 3U3MA 3VR4A 1QDEA 2HF8A 1RJ9B 2QTFA 2CDNA 2EVWX 1E2IA 4LBVA 3T1TA 3THXB 3B9PA 1OXUA 1ANKA 1P73A 1CF4A 5CK4A 3RDPA 2ZRHA 4OK6A 4YDSA 2JLVA 3TW4A 1N6LA 3QKUA 1M74A 4W9MC 3TUIC 1S96A 3B1VA 3FTQA 3Q9LA 3ZVMA 2XOKD 3TR5A 2WPDD 5CDFE 3VTKA 1GNRA 4GPTA 1CU1A 3KTAB 3PUYA 1IAQA 3CPJB 5TMPA 4IDQA 1R5NA 1E9AA 4YC7A 3AF3A 2Z6VA 1SXJA 5C46F 4HDCA 2E87A 5AR1A 2BVNA 1E2GA 3LBNA 3C41J 1Q20A 2VIIA 2VP2A 1Q1BA 2G1KA 3M4YA 3IIJA 5GVRA 3C15C 3P26A 3EIQA 3KKNA 3SHWA 1IJEA 4US0R 2AWNA 3LLUA 1Q44A 2J3EA 1VG1A 4JSYA 1Q57A 2EYQA 4Z54A 2V4ZA 3SZRA 4LJ4A 1GRNA 2MSCB 1IY1A 3K09A 1JPJA 3UMFA 3KQKA 3W8NA 2CE7A 3IO3A 2QP9X 1AJEA 1G7RA 3EX7C 1W7AA 5D3MB 2J9RA 4M1OA 1Q21A 4Q01A 3R20A 2ZRAA 4Q7KA 4TMWA 3IPYA 1S4QA 2WWXA 4GBMA 4TN1A 2B7BA 2H16A 3ADDA 5DI3A 1CR2A 4B47A 3BXZA 2R6AA 4TTRA 3PFIA 3CX7A 4FCWA 4TT3D 1QF9A 2ZRIA 2WBLC 3TAHA 1W4BA 2ODWA 2OLKA 3AVXA 2NO9A 2X2EA 3LA6A 5LB4A 1KSHA 3K1JA 2PT5A 3BAFA 3V4FA 2O8DB 2O8BA 4OL0A 3HR8A 4Q4HB 4C0QC 1LFDB 1P5ZB 1XCGB 2A5JA 1ETUA 3NVAA 4XTCS 5A5GA 1OIWA 1XFAA 3QBTA 5AUOB 3GFPA 4DVGA 1IJFA 1YJ5A 4QHSA 4IVRA 4A6XA 2IYTA 3PEYA 4BECA 2OBNA 5LD2B 1J8MF 4FI3C 5CLLA 3QVVA 4KYIB 5GVSA 3R8CA 3L82B 3IKJA 2W83A 4RJLA 2FGJA 2GCOA 2VA8A 4AWXA 2E9SA 3AUXA 3EASA 3W6OA 4QHTA 1GZSA 4OQMA 1NJGA 4R98A 1DO2A 2CJWA 2VBCA 3VHLB 1W36D 3AVUA 4IDOA 2ZRKA 4JVLA 2BBSA 2CK3A 4ITRC 3E5HA 4LI0A 1GKYA 5SZHB 3ZD6A 2WV9A 2R65A 4FWTA 2WSMA 2ZUDA 2JGNA 3GD7A 2W0SA 1E2DA 2WJGA 5E3HA 1A7JA 1E0SA 5FOTA 3VU9A 3AP2A 4LHWA 1U98A 1XTQA 1P9WA 4XJXA 3SOPA 1ZCBA 2QM8A 2BBWA 4HLUC 4XSGA 5DNYB 1CLUA 4CYMA 1VMAA 5BW8A 3HJNA 1MO3A 2J87A 4RD3A 1XPRA 1SKQA 1OE0A 3B13B 4ZCMA 2C9CA 2ZS8A 3L8YA 3CX6A 4KU4A 2JLSA 2J0UB 1G7SA 4F4JA 1NBME 1YKSA 1KZ7B 2QMEA 3TVTA 1VG9B 1D9ZA 1W49A 1N6PA 421PA 2ZSBA 2HYIC 4B76A 1T8UA 1W44A 2JJ1A 2GF0A 4B2LA 1OV4A 2QPTA 3SJAA 1E9SA 3VR1A 4UNNA 1E9RA 3I72A 4KVAA 4LYHA 4RD2A 2FZ4A 3T34A 4LYJA 3GLGB 1DPFA 3A1VA 4NCNA 3PCRB 3QKRA 1P9NA 2QAGB 4MDFA 3MG9A 3K70B 2IYZA 4A0GA 1NMXA 1X1SA 2ATXA 1KO7A 2ZE5A 4LPKA 3O8RA 2DFKB 4QHYA 3PUZA 2IYRA 3NKVA 1SXJD 1JQJC 1OXXK 4V0NA 2GEDA 5DN6D 1OB5A 3S1AB 4M9ZA 1FMJA 1MOZA 4A2WA 4I99A 4XD7D 2XOKA 3QEJA 2IA5A 4JIMA 3PV0A 4M9QA 4LK2A 1RFLA 1EWRA 3VU9B 2FSHA 2F1IA 1H8EA 4AD8A 1YVDA 2A7QA 1T3SA 3LXRA 1E2QA 4NYJQ 4A9AA 5L3QB 3NH6A 4DUGA 1UBGA 3EPHA 5KNDA 1QHIA 2B21A 2NOAA 2P65A 3B60A 2OM2A 4LV5B 1DAMA 4A4DA 1TAGA 2JIZA 1E99A 2XNSA 1P4SA 2NTYC 4U02A 4P32A 1VIYA 1YR8A 3EWSA 5AJZA 5BN5A 2CL0X 1UEIA 2WJVA 2ZETA 1PVOA 1PLJA 2GILA 2H92A 4TSFD 4BEJA 3ND9A 2F1HA 3W3AA 2F1JA 2DYKA 4L16A 4IEEA 2BM0A 3X2SA 1VCIA 4PSKA 2QTVB 1IXRC 5G3ZA 1F2TA 2JLUA 3TH5A 2C98A 4KODA 4RZUA 3G0HA 2BV3A 2XNDA 2F3TA 5F2EA 5FUXA 4A15A 1G5RA 1HYQA 3OESA 4HLUA 2ZRNA 1XMSA 4OK3A 3D3QA 4ZV4A 2R6CA 4A8JC 1U8AA 2D62A 1E9DA 1SVWA 3KJIA 3DPUA 3GJ6A 2D2EA 1AQYA 4BZXA 3NBZC 4TTPA 4NYMQ 3EIEA 3SYKA 3K53A 2GF9A 1N6OA 2ZRPA 3UWOA 4PANA 2DCUA 3TRFA 2ZS7A 1CR4A 4ERNA 2ZJOA 1RYHA 4JL6A 1SXJE 4UJ3A 1E69A 3CR8A 3EPLA 1L4UA 1JR3D 1MRNA 4TQ9A 1T3LA 1G3UA 1N5KA 1DS6A 1TPZA 3H2YA 2F3RA 3CF0A 2IT1A 5FBRB 3ZYCA 4JLKA 3ZVRA 3VKGA 1E2EA 1HA3A 1T5IA 1S9DA 2JEOA 2P0EA 4DCNA 2UKDA 1N3BA 5JJIA 1GSIA 2FH5B 3SYNA 5HE8A 4B2PA 1W36B 1R6BX 3SFZA 5KUTA 2ATVA 1RKBA 1CJUC 3SYLA 2J0QA 2JLZA 3HU1A 3IIMA 5J5CA 3LFUA 5TDHA 1Z07A 3RNLA 1LY1A 4OI4A 4ZI3A 4OHVA 1OH8A 2AR7A 2NZJA 2NG1A 3VFDA 1HH4A 3BBPA 3VR5A 3W34A 1JAHA 1E79D 1X8KA 3EPJA 4HATA 3FWYA 5FPKA 4F93B 2X2FA 2BMFA 2GXAA 4Q7MB 1Z0DA 1EFUA 1YZUA 1IOZA 2KBEA 4B3FX 3ZLJA 3DM5A 4DLUA 5JJLA 2QORA 2WMOB 3WP1B 1TNDA 3GJ4A 2WICA 2AL7A 2OT3B 3RYTC 2R8RA 2AKAB 4NZYA 5CJPA 1I2MA 4E5UA 2ERYA 5EXXA 2J7KA 4GRAA 2DFNA 5EP1A 2ZJ2A 2F7SA 5HCIA 5E4FA 1KHTA 2RCNA 4DEXA 1AA9A 1S3SA 1CXZA 4UJ5A 3HR7A 4U7DA 2WJJA 1G16A 2YWGA 3EZFA 3HPRA 4F91B 3B7GA 4GZMA 5H68A 1IN4A 3R7WA 3L0SA 2YOFA 3KKMA 4AKIA 5G41A 5AJXA 1G3MA 1FNMA 1P2SA 4A0FA 3BK7A 5TY0A 2GCOB 3GJ3A 3AVTA 4DSTA 3ZQ6A 5ELXA 4MRPA 4URYR 4D4LA 1JR3E 3PEVA 3FB4A 3KQNA 2BBTA 3RSOA 4QBHA 1KY3A 2OV2A 3K0AA 4JLJA 4UXHA 4NTZA 4QJ4A 2XJ4A 3RSLA 1TF5A 2DR3A 1E6CA 1OKKD 1W0JA 1S9HA 1W2HA 3K0CC 4GI7A 5FTJA 2YKGA 5H70A 1M6NA 3KQHA 2QI9C 2DWPA 5JZVA 4MQBA 3RRYA 5CITA 5JHGB 3ZVNA 1OXVA 4M21A 1HT2E 3O8CA 1DAIA 4BLTA 3KJHA 4JBYA 2ZU6A 2UZ3A 1U0LA 4ZIRA 1IBRA 2G83A 2QEQA 2R6GA 1ZUNB 2WWHA 3UMRA 2VYFA 1KI8A 4B3CA 1WMSA 5HZKA 3AP1A 1PUJA 4NDZA 5KDLA 2XJ9A 2EFGA 3WMEA 1WBBA 1GRQA 4YMSA 1AGRA 4TMKA 1T0JB 5C4GB 2ZM5A 1VYTA 1FQJA 4P3YA 2FG5A 1G3QA 1NIPA 3EA0A 2FEMA 4EPWA 2O0HA 3HWSA 1E9EA 4EUNA 2VP6A 3EIHA 4JBWA 4BFXA 3SJBA 4A8JA 3W90A 5EJEA 1JQLB 1N5JA 5ANRB 4F7WA 4B44A 3I8XA 1HT1E 4DLXA 1PLKA 3AVYA 2BBOA 3T1OA 1OFUX 5JEDA 2NGRA 1GUAA 1V5WA 2C95A 3WBJA 1NIJA 1W2GA 2IF2A 5EXPA 3PUWA 3ZZTA 4DXAA 4MRRA 3OEHA 3X1XA 3RWMB 2ZJZA 1RRFA 3QG1A 3THXA 4AI6A 221PA 4OHWA 4AC9A 3TW8B 1I4DD 3RS2A 1W5SA 4DHEA 1FW6A 1DG1G 3A4LA 3BH6A 1SULA 5K8UA 2ZROA 4HLCA 1II0A 1F6BA 3GLFA 4LJAA 3MJHA 1VHTA 1G8YA 2OFOA 2IS4A 1VPLA 2D06A 1XD8A 2CHGA 3KQUA 1CIPA 3DO6A 1Z6XA 4AG5A 2Q9BA 1ODFA 4A6PA 1TTTA 2OCYC 1P75A 4RFSB 1II9A 3EPKA 1ZD9A 4QFMA 5J47A 5DSZA 3U7EB 4DDTA 1XEXB 3KX2A 1P2UA 5CYPA 3C5HA 3ZS9A 5GADl 2WOJA 5FL7D 3CRVA 3B78A 1COWA 2Q9CA 3GEEA 4CEJB 4TMTA 3IIKA 3GLIE 3LH5A 2OESA 5DI3B 1OHHA 1QG2A 1TQ4A 2A5YB 1P3JA 3FPAA 4URVR 4DLRA 2AK2A 4BRUA 3P1JA 2AFIE 4ZDKA 3B1YA 4JLBA 3QEOA 2C9OA 1TQ2A 2BM1A 1ZM2A 1LVGA 3OIWA 2QRNA 2HT6A 1U99A 2IK8A 4TLBA 3T5DA 2FX3A 3CUEF 4M1MA 3TSOA 2XZOA 5JBQA 2FDCA 1Z47A 2FJUA 3MD0A 2WWGA 4WZAE 5AK0A 1P9RA 2YZ2A 1N25A 3AF4A 1B0UA 2C77A 1AM4D 2WVJA 4A1FA 4XOIA 4KCGA 5EE3A 2QT0A 5FOVA 4YMUA 4JLDA 2PX3A 4NONA 3GLIA 1QBKC 4G5GA 4LJYA 4P4SA 4OHXA 5JWHA 2IYXA 1XEWX 3K9NA 2ZITA 3EG5A 2V1XA 4QGHA 2BKUA 3NDBB 3VNUA 1Y3AA 2AKYA 3O8BA 5EUQB 4QGAA 2QGZA 2BKEA 5FTMA 4YXWD 2IYSA 1XD2A 1M34E 1OHHD 2LKCA 3AGPA 1EG7A 2BEKA 3NDPA 3BS4A 4M53A 4BZPA 1J7KA 1H65A 1KO5A 2ANCA 2WHXA 2PMDA 3K8YA 5FL7A 3GLFE 3RLFA 1NKSA 3RS3A 5C4MA 3VX4A 3ZIAD 2XSZD 4D80A 4GOKA 3CB4A 3B9QA 5KTYA 1KK1A 3FE2A 1QHNA 1YZGA 2D2FA 4BFWA 4F38A 3U4QA 4US1R 1J8YF 4EJSB 3I61A 1LS1A 5IK2A 2EFEB 3BB1A 1L4YA 1P61B 4I1SA 3VX3A 2J1LA 4HB4A 4W5HA 3AB3A 4BE7B 3RRZA 1XTKA 2WKPA 2A9KA 1OFTA 5DISB 1Z63A 3FKQA 1UDWA 3OE7D 1KI4A 1NP6A 2ZUCA 1JPNA 3LX8A 3QKRB 5EP3A 2QAGC 3U7HB 1ZNWA 3H84A 4TYNA 2N46A 4PHFA 4JYCA 1DELA 2ZI5A 2OE2A 1XTRA 4V0MA 4YLGA 4HAVA 4EFNA 1DADA 4Q1EA 4URUR 4NCKA 4PQFA 1SXJC 2ZI6A 3GJ5A 2NIPA 3HU2A 4BFZA 2ZI9A 3T12A 2J0SA 1OLOA 2V7QA 3LQRA 2GVDC 3A4MA 4QJ3A 1P60A 4M9SA 1YZLA 1U2RA 1G64A 3LV8A 1L2TA 4Q4LA 1BKDR 2CLDX 3GLGA 1ZIPA 4C4PA 2GBLA 4I1VA 2F9LA 1C4OA 2CNWA 3RS7A 4AG6A 4DCSA 3U5ZB 3VR2A 3UIEA 3SDZA 3U3RA 1DO0A 4NH0A 4MH0R 1BOFA 4M22A 4Q66C 4R2IA 1ESMA 3NEYA 2CBZA 2F43A 2Q6TA 3G5UA 2CVHA 1NL3A 1KI3A 3FVQA 1BMFA 1G3IA 3OF5A 3QVUA 4PAMA 3TJZA 4IXNA 4MKIA 3M1IA 1RRCA 3QI2A 1G8GA 3FDIA 4KV9A 4LYFA 5DO9A 1AS0A 2GVZC 5TV2A 4PSVA 1W0JD 4AURA 1E1QD 1QVAA 1XXHE 2C2HA 4P4TA 5FH9A 4I4LA 3EA5A 2WWFA 2C99A 1SVIA 1IY2A 5FPSA 4AIIA 3WXMA 4KITB 2ZI3A 5E95A 5B30A 2ONJA 1ZU4A 3P4YA 2O8CA 2QNRA 3K9GA 4Q5IA 2XITA 1X8JA 2CVFA 3H1TA 5B2ZA 4ZCIA 1X3SA 3TQCA 3GLHE 3NWJA 5CK5A 5HTKA 1E3MA 2LKDA 1KSJA 1BMFD 4Q4JB 1RVDA 3BFKA 2QTHA 3CR7A 4LJ8A 4OHYA 1W4RA 4M1SA 3U44A 4LYAA 3FMOB 1TQ6A 4IOJA 4MUBA 5GJCA 4L15A 3DVLA 4BFUA 1GP2A 2H5EA 4C3ZA 4C7OB 1AZTA 2JJ2D 3MFYA 3W5JA 2IYQA 1MO6A 4TYYA 4RD4A 1WF3A 5EE0A 2C8VA 2CNWD 4JZKA 4CGZA 4DLVA 4FMCF 3H4MA 4BFVA 3GQBA 1A5TA 1OT3A 1HQYE 5HR5A 4XWKA 8OHMA 5JSZA 4EFMA 1IM2A 2O5VA 2JDIA 4E03A 2F1RA 3HU3A 2OLJA 1NJFA 4EPRA 1BIFA 1NY6A 6Q21A 3F8TA 1ESNA 1CJTC 3P32A 4Q00A 3ICQB 4NMMA 4U00A 4RD6A 1NBMD 3Q5DA 4IOMA 5JRJA 5KSZA 4FINA 121PA 3WRYC 1FX0A 4OHZA 1DAKA 3ZZUA 4EQ6B 4O2RA 2RHDA 4TLCA 1S1CA 4D0NA 2P5SA 3B82A 4BEBA 4EPYA 3Q5EA 1YZNA 721PA 3ND8A 2IS1A 5FR2A 2FWRA 2QM7A 1E0KA 3AKYA 2F55A 1UM8A 4G5RA 2IHBA 3TBKA 1KSFX 2QZ4A 3B6EA 4QGGA 2BEJA 2CE2X 2FFBA 2RGCA 4LBZA 1VHLA 1OYWA 1XZQA 1A82A 5JEEA 2RHMA 2B6HA 3N5CA 1SVMA 2A2ZA 1Z2CA 2MSDB 4Q18A 2XSZA 1EWQA 3U6KA 4MGYR 4DIDA 1HURA 2RGAA 2QE7A 2PEYA 2QT1A 4BLSA 4AKHA 4NCJA 4DSOA 2CCKA 4V0OA 2QAJA 2YOHA 1G9XA 1R0YA 4JMPA 5JI3E 4B43A 3KFXA 2ZRLA 3C14C 2ZSAA 3MSXA 3D7MA 1E0JA 1K5DA 3U3OA 2QGNA 1E4VA 4JVSB 2ZVQX 3BIFA 1CR1A 4QBGB 4URWR 2WWIA 1RZ3A 2NZ8A 2AX4A 5FBLB 4A2PA 4FMCB 2GKSA 4P4SB 3PVSA 4JL8A 1FFHA 3P4XA 5JWRA 2GETA 2BWJA 1Q1EA 2G77B 2BHRA 1W5TA 2ZE6A 4XTRA 3SJCA 5JWOA 1XD2B 3L2OB 1YR9A 2OEPA 3NHAA 3BOSA 3E70C 1XNJA 4JBXA 5JRZA 4Q1AA 1E0AA 1NSFA 1VCNA 3RRNA 4R71A 1KI6A 3ECCA 4DSNA 3OAAA 1XPOA 4L9WA 3HP1A 5JFGA 1KIMA 1NVVQ 1CR0A 3CLVA 4DLSA 4AK9A 4LBYA 5HKKD 1NVVR 4RKFA 5BYJA 1XCMA 1U9IC 2Q0HA 5FTLA 2XZLA 2C78A 3PEWA 3BB4A 4PC1A 2XGJA 1COWD 1E98A 1H8ED 1W48A 3PG5A 3JVVA 3Q7QA 4IKEA 4WXPA 4TMVA 4A0RA 4UKDA 2P5TB 2JAQA 4PC7A 1GIAA 1WE2A 4C0AC 4LHZA 3IO5A 2Z43A 3A58B 1BH2A 3K9LA 4ZIRB 1T9HA 4HZIA 1W4CA 1NMYA 3K09C 1G8HA 5AUQA 1R10A 2V54A 1VTKA 3RHFA 1N6IA 4EJSA 4X8LA 4A8JB 1AS3A 4G0NA 3U7GA 1G8PA 3SHFA 2BMJA 3RVBA 1DOAA 2DFTA 1EFCA 1KJYA 3LDAA 2KJQA 3U6BA 5EZ6B 2OBMA 4KI0A 1T0HB 3BE4A 4DSUA 3BJIC 3U3JA 1XTSA 4UNSA 1UEJA 3PR1A 3WYAA 3QOFA 3BRWD 3OIYA 2H8KA 4RY2A 5BYKA 4TYWA 1Z6YA 3WP0A 1G5TA 2K5UA 1YR6A 2W6JD 4L5BA 4Q19A 1E2NA 2J59A 2ZRCA 2CLCX 4NCIA 4CVNA 1XMVA 1R5OA 3R8FA 5JJKA 2Q3MA 1GNQA 3AVOA 5FPTA 2W58A 1JALA 2J0VA 4FW9A 1KO8A 4IW3B 5J40A 2W2TA 3LXXA 1B23P 5FPHA 1Z0AA 3TUZC 3RS4A 1OB2A 4M2LA 4DT1B 2C04A 4C0LA 1ZD8A 1N0WA 1K6MA 4NYMR 4MYTA 2JCSA 2RKOA 3TGPA 4MRSA 2WSSD 1XU4A 1M7HA 3EWAA 5F98A 4KBGA 1JNYA 2W0MA 3CRMA 3GJ8A 2FSGA 3MWKA 3ZQJA 5KYKA 2IWRA 4Q1FA 3NH9A 2WIAA 2GBLC 2QL6A 2X1VA 5CJ2A 2Z83A 5FOXA 4DBLC 1R8SA 2B92A 1RPZA 1KSGA 1OYYA 1XTJA 4ON9A 4GOXA 4WVFA 4HZUB 4GOJA 1KDOA 4C9BA 4CRWB 4AKEA 1UBCA 3KTAA 3TNFA 2D3WA 4MRVA 4KFRA 1ELOA 4V02A 5FI0B 1KOFA 2D74A 3E1SA 1G4AE 1FX0B 3NG1A 3GFOA 1YQTA 2WKQA 3QJYA 2OCPA 3IDQA 3QF7A 1KMHA 4M1KA 5CM8B 3KXKA 3QUSA 4TWZA 2EWVA 3CRQA 1W1WA 3BGWA 5FL3A 3GMTA 4AYTA 3IILA 4UXIA 1HE1C 3B1ZA 5LPNA 3I4LA 3THOA 3A1UA 3OEEA 4H9GA 3WHLA 1TF2A 5L3SA 4F92B 4MDEA 1G6HA 4KSBA 1OXSC 1YRAA 1P7CA 3PENA 4QG7A 4JVNA 3MJRA 4IOLA 2HT1A 1KKLA 1JJVA 1N6HA 3LVQE 4DCVA 1UF9A 5IF9A 2HXSA 4RCYA 2FFHA 4RZXA 5KDOA 5JSZB 3MWJA 1EGAA 3L0OA 1DVRA 3LO5A 4LC1A 1QHHA 1RW4A 2RGXA 5KSOA 2GEUA 4Q9HA 2C03A 4X8OA 2KBFA 1R7RA 1KAOA 1GOTA 2PX0A 1XJCA 3IHWA 1Q1QA 1NG1A 1ZINA 4QGFA 3ZS8A 1S8FA 2Z4SA 2ZPTX 2VSFA 4IDHA 2CL7X 2IX3A 1G4UR 1CTQA 3Q8XB 4GP6A 4W5JA 2GAAA 4PSAA 1QVRA 2RGNA 4HB0A 3OIUA 3W8RA 1ZUIA 1NVUQ 2HF9A 2V9PA 2Z4RA 2RGGA 4PHTA 1MABB 1XJQA 1G3RA 2GTPA 4EFLA 4LDJA 3GJXC 5FBWB 1FNNA 1R0XA 2CLSA 3JZAA 5E7IA 2F43B 3X1WA 2ZJ8A 5AJYA 4BLPA 1Y63A 1U0JA 5L3SB 2QP3A 3THWB 1OIXA 2A30A 4IEIA 1XF9A 2V8OA 1N5IA 3W6NA 1SHKA 4C2TA 1QHYA 1QZXA 2R6FA 3FMPB 3T06B 4B73A 1F2UB 1JEDA 1Q0UA 2FSIA 4RFSA 2G0TA 2VO1A 3CH5A 5JS7A 3QSYA 1II8B 2VLIA 3IBGA 4TLEA 1MO5A 3QE0A 2L0XA 1F3OA 1SVOA 2ANBA 4DC9A 2C5LA 4EPVA 1F48A 5KDDA 2VSXA 4QJ5A 2VP9A 3NBFA 4II7A 5CIWA 4XVRA 1NN1A 4EAQA 3GEIA 1ZM4A 3MCAA 2ZI4A 1LW7A 3D8BA 4NYJR 3JZMA 1RC8A 4RSGA 1IN6A 2ORIA 2QSYA 4CDGA 1MT0A 3KUCA 3A37A 3DKPA 1D2NA 3ETLA 5DYIA 4ZDJA 2OBLA 1SQ5A 2BJVA 2OG2A 2XB2A 4L9SA 4KBFA 1WCV1 2J0UA 2W6IA 3IUYA 5K8IA 3LVRE 2ASEA 4JKYA 2FZLA 2OCAA 2ZSEA 3QPWA 4IHQA 1W0KA 5FI1B 1T6NA 3AVVA 3A1SA 4W5WA 1C1YA 2H18A 4PC6A 3GLIB 4QM6A 3LLMA 1PLLA 5B64A 2GZHA 1GM5A 2Q9AA 2QAGA 2P3SA 3UANA 4WBSA 4G01B 3IQXA 3ZVLA 4A92A 4FXPA 4XD7A 5EZ5A 2GHIA 3SFVA 5JMTA 1TEXA 4E09A 4MKFA 3RABA 4M8NE 3OIVA 4HUQA 4E22A 2V6JA 4DWJA 4S35A 2W2XA 2FF7A 1SGWA 1Z5ZA 2QUZA 3R9WA 1GKIA 1CBUA 3C7KA 3QPVA 1OJLA 1Z8FA 3ZGXA 3U4QB 3A1WA 1QG4A 1VIAA 2QROA 2PZGA 4QC2A 2LWIA 4MGKR 4WAUA 2V55B 3N2IA 4EQ6A 4ZKDA 2AD1A 1G6OA 2CL6X 4GMDA 5EP2A 4YONB 2FPLA 4P31A 3TMKA 4WZBE 1OH5A 2FNAA 1R4AA 4Q4AB 2G6BA 4PC3A 3T1QA 4BFTA 1RE0A 4DLTA 4EDHA 1UBFA 5DLQC 3I32A 4B34A 5D3MA 2ZU0C 5FBQB 1LB1B 5GJBA 3NHBA 4TTQA 2GRJA 2PEZA 3IHLA 2RB4A 4MGZR 4ZPXA 3THYB 4NPHA 1KO4A 1C9KA 1IXZA 2A5GA 2REOA 2QE7D 2EU8A 4IVPA 5H8WA 2OZEA 4JT4A 4PHGA 3L43A 3RRMA 4WOPA 3LAWA 4Q1DA 1IN5A 1FTNA 3CBQA 1G20E 3SQWA 2P2LA 4W7SA 3LBHA 2IYLD 2EWWA 4GZLA 1XEWY 1XRJA 4QBIA 4XVUA 2UZIR 4Q4HA 1HE8B 5FR1A 4BQSA 3EARA 4PFSA 3KQLA 4D0GA 1XBTA 3OZXA 1G5PA 3L0PA 2OFXA 4PPGA 1S3GA 3QXXA 1T3HA 3CF2A 4MYUA 2CCGA 3IEVA 3EC1A 5CLQA 2WJHA 1YE8A 1ZP6A 1ZC3A 4Y0VA 1KI2A 1XJ0A 2AD5A 3KDSE 3UPUA 1RRPA 1YZQA 4LHYA 1MV5A 4FMDF 1NY5A 2O8EA 1TF7A 3KL4A 2ZREA 5C2JB 4B35A 2CJWB 1QHSA 2GCPA 4PO8A 4O3MA 1UPTA 4LWZA 1XXHA 1CKEA 1HTWA 1YZTA 3GFTA 3BC1A 4G5QA 1KI6B 5EXSA 1KMHB 5TVKA 3DDCA 1KI9A 1V43A 3W5IA 1UBEA 2G9NA 2P6NA 5SZJA 3T35A 3MGCA 2QPOA 5JECA 3VNVA 1EFTA 4BFSA 2A78A 2VHTA 1AIPA 2VP4A 2IYVA 4NU0A 4ASUA 1Z6TA 2V1UA 2XZPA 4H1UA 4TT3A 3W6PA 2VP0A 3LD9A 3OEED 5CM9C 5D3QA 3RC3A 821PA 5TXGA 1TQDA 1D5CA 4UNQA 3WYGA 1CRQA 5B58C 1PUIA 5HE9A 2HUPA 3ASZA 2IYWA 4MYHA 4DDUA 4G1UC 4Z1MD 1NN0A 2FFQA 2ZAOA 4JSTA 1XX6A 4FIDA 4ZO4A 1VG8A 4ESVA 1Z28A 2IC5A 2W6JA 4NYIR 5HZHA 5JI2E 3P20A 2GA8A 2WM9B 4F4CA 1KTVA 4BLQA 4M1TA 4X8MA 3KB1A 2A5DA 2BDTA 5CB8A 4B3GA 5GJWC 1YHNA 5FBVB 4EPTA 2GXQA 4DZZA 1EESA 4RFVA 1J99A 3CNNA 5FOSA 1KDTA 4WA7A 1O87A 1WQ1R 2YINC 4K81B 3FHTA 3WNCA 3QKSB 4LPSA 1YR7A 1GTVA 3AKEA 1Z29A 4TL6A 4Y0AA 1BYIA 1ONBA 3AVWA 3FKSA 4XWAA 3OFND 4A2QA 1ZM3A 2ZYUX 1RRGA 3T15A 2XXAA 4XIGS 1JI0A 4PHHA 4KHZA 4UNRA 1OFIA 3TE6A 4CT4B 4NKRA 4XVQA 4TL9A 1US8B 2C96A 1XWIA 1W36C 2FEOA 5G40A 3PXGA 3AUYA 2YYZA 4OQNA 3UMSA 1IN7A 1D9XA 1NRJB 3DZ8A 3LX5A 4ESHA 4YMVA 2WOOA 5L8VA 1P2TA 5B57C 4TMXA 1NKTA 4F4IA 2ODNA 1E1RD 1PV4A 4PAOA 1NN3A 1Z3IX 1KGDA 3CW2A 4DT1A 3TKLA 5KPJA 5EE9A 4BLOA 5JCPA 4PZZA 2Q3HA 1AK2A 3Q85A 3I1FA 4D4MA 5IHPA 1W0KD 3VQTA 4HLQB 3FGNA 2O8DA 3W9YA 1UKEA 4PPFA 5IT5A 2BCGY 3CWQA 4QL3A 3CF6R 2O0KA 2OAP1 2W6ID 1LTQA 3BFXA 1I2DA 3QPUA 4HAUA 5HPYB 1IY0A 3WY9A 1NG9A 2QP4A 1FOEB 3GJ0A 1CJMA 4JYBA 2IXEA 5AWFC 2VHJA 2WMNB 1ZJ6A 2EFCB 3ZJYA 2GESA 2GDJA 3NBXX 3TVDA 3HDTA 3TQFA 3O47A 5LB2A 3VR6A 1XD9A 4CIDA 1E96A 1VECA 1KYIA 5KNCA 3I8SA 3KXLA 4MITA 5JHHB 1VYUA 2QMHA 4I1OA 1T4GA 4IDNA 1D6JA 4TQUS 3WBKA 2JLXA 4M1YA 5EE1A 4NL4H 2VSOA 4WW0A 4KO8A 4LSGA 2TMKA 5EUMA 4GFDA 2YWEA 4IVQA 4ILEA 3A4NA 2SHKA 4AY2A 2O8BB 3DHWC 3O8DA 1S1MA 1X86B 3NC0C 4HB2A 3CONA 1TUEA 3TAUA 3NC1C 3UG7A 4BASA 4RCZA 4RZ2A 2OO7A 1KO1A 4NHOA 4QXAA 3REFA 3IEUA 3LWNA 3QG5A 4PX9A 2IS2A 1R2QA 4R7ZA 5EP4A 3CH4B 2CHQA 2BMDA 1RYFA 1W46A 4BRWA 4CEHA 4P0TA 3WMFA 3K70C 5HKKA 2Z0MA 4YXWA 1VYVA 2BIFA 4QBFA 3PJRA 2QG6A 3KJEA 3ZZ0A 2J7PD 2C9YA 4AYWA 4D81A 4YMWA 2QMUA 2PBRA 4LUCA 4HUQB 4JJZA 1MO4A 1U94A 2QENA 4CEJA 1BYUA 3ASYA 1E2LA 1O3YA 3P27A 2HEIA 4ARZA 2IWHA 1Q1ZA 1J70A 3EW9A 4KLZA 4BLRA 1E2PA 1Z6AA 1CEEA 4LJ9A 2QA5A 3B2EA 3B8HA 4C0JA 1WDTA 3UXMA 4KFSA 1GITA 4HDQB 2ODBA 4LJ5A 4R9UC 1G18A 5DYGA 3GJ7A 3TUJC 4YMTA 2ECKA 3BH7A 2GEVA 3MUFA 3CWZA 3K0SA 2Q3FA 1BS1A 3R7WB 1J90A 2J45A 2JDID 1IONA 5A0FA 2XB4A 3QXCA 5C18A 5FOWA 3K0FA 1XXHB 4QNMA 4C2UA 3W3ZB 3CNOA 4HUTA 4TL7A 1RIFA 4B32A 4LHXA 3OHMA 4NE2A 4TZ6A 1S0UA 4M0LA 2IL1A 4OJQA 4MYCA 3E2IA 2JJ2A 3WYFA 3FMFA 5L3VA 4CF7A 4L4UA 3QBVA 4IJMA 2IXFA 2EW1A 4JL5A 2ZVPX 1TL7C 4I81A 4DLWA 3J81k 2ZAMA 1ZNZA 1H8HA 2PJZA 4OI2A 4V03A 2IXGA 4CT5A 4KSCA 1ZBDA 4XH9B 1DAEA 2ZJYA 4FD2A 1ZD1A 4RKEA 1CP2A 1G7CA 2H17A 2OXRA 1G7TA 4FMDB 2O8EB 2OXCA 3SNHA 4OJKA 3H0KA 3QXSA 1UAAA 4MGIR 1D2MA 2QQ0A 3DEFA 3KFVA 1X1RA 5UKDA 3RC8A 3UATA 2D7CA 2VF8A 2QSZA 2I1QA 3BERA 4D26A 3WHKA 4YQFA 1UFQA 1NBMA 4HZUA 1ZUHA 3SE0A 3CRW1 1E9FA 1A2BA 1QHXA 3CNLA 4S2EA 2HYDA 4OYHA 3U60B 2Q21A 1F2UA 1ZIOA 3QNUA 1II8A 5CB6A 1TU4A 4LV8B 4C30A 5FUYA 5AUNB 3PUVA 2XX3A 2O52A 4QM7A 1WB9A 3BFVA 1T8TA 2OSBA 1I4LD 3FYHA 3CZPA 4LZZA 4V0LA 3KXIA 1K5GA 4BUJA 3CPEA 4M9XA 3WMGA 2XTZA 1EX7A 1D2EA 1DBSA 2R6DA 2ZR0A 2O8FB 4HAXA 4Q48A 1GDDA 2HLDA 3NTUA 1E32A 3DKVA 2GJKA 1X8LA 2IW3A 3AVQA 4JLAA 4LGMA 2HCBA 2WAXA 2V7QD 1FP6A 4M4SA 1FP7A 4B74A 4PO9A 2YWFA 4JLMA 4DIEA 5EE5B 1GG2A 4TYPA 4A36A 4Q03A 2PZEA 1NI3A 1IQPA 4C0BA 2ZYVX 1G41A 3MWYW 1FMLA 1KK0A 3DM9B 3THYA 1KJWA 4MKHA 2PLFA 5KSPA 1E1QA 4US2R 5K8LA 5KPDA 3GPLA 3CIOA 1UJ2A 4G5OA 5H1YA 3R9XA 3OE7A 3AP3A 1JEEA 2ORWA 2OHFA 4Q4JA 3AF0A 2KSQA 4X8HA 4NCHA 5DHAA 2BJWA 2J5XA 5IK2D 2P6RA 3TSZA 3EAQA 3R9IA 1DG3A 1DAHA 1TUIA 1UADA 2ZRFA 4TZ0A 1R8QA 1R0ZA 2IUSA 1MR3F 4JT2A 1Z6GA 5DGXA 2ZRJA 4DEYA 4IRUB 5BQ5A 4QKQA 1W4AA 2W2VA 2XTMA 4HI0E 4L8GA 2ZYTX 1DARA 2JLWA 1UDXA 2CMKA 2IYUA 3DMDA 4IFBA 1M7BA 2YC2C 4HEJA 3U44B 1SKYE 2GAOA 4D6PA 2JASA 2ZSDA 3C4JA 1QHHB 3C5CA 1VG0B 2B8WA 1OFHA 3K0CA 4C0HA 2ZANA 3OAAD 3WRXC 4Q4AA 3BH0A 5FOUA 3T61A 1U8ZA 2R2AA 1E79A 2QPAA 2ZR9A 3AQ4A 4J0QA 4BFYA 5C1BA 2IF0A 1AN0A 1U90A 4Q7LA 1G291 1FUKA 1WBDA 4QRHA 2BCJQ 1WP9A 2OUKA 3K0AB 3SC3A 2ZE7A 2FOLA 2WAYA 3FHOA 4E07A 1AKEA 2AFHE 1Z06A 4B3DA 3SBEA 2OCBA 5IRCD 2J7PA 4PQYA 1Q22A 1ZCAA 3LRPA 4PC2A 4D2IA 2AK3A 4RD0A 1A1VA 1AGPA 2ZTSA 4EKDA 1OIVA 1G21E 4UXJA 2O0JA 1A4RA 1UKZA 2OFWA 4EJSC 2PCLA 4OQXA 3ADKA 4HAWA 2ZYWX 4KJZA 2HDNB 4O25A 2KWIA 4D25A 2RGEA 2D7DA 1AKYA 3MAAC 4EIWA 4DLYA 2EFDB 1XDBA 1GRRA 2GCNA 3QXJA 4PQRA 5JS8A 4Z8XA 1QRAA 1KNXA 4ABYA 2R44A 2A5FA 2FA9A 4KFUA 1JR6A 3GCGA 2RH5A 2ZRDA 3VAAA 4HAYA 3AF1A 4Q21A 2ZI7A 1HV8A 1UKVY 1KAGA 3VR3A 4MA4A 1X6VA 2G88A 1PZNA 4N1AA 3I5XA 1ZC4A 2PMKA 1GL6A 5F9FA 3QKSA 3CKLA 1A2KC 4DDVA 2ZRGA 1EX6A 3EXAA 4Q9LA 1PJRA 2XNDD 1ZU5A 3ADBA 3U3KA 4UNPA 2I1VB 2P6UA 2FE4A 5SZKB 2JA1A 1KI1A 2WJYA 4LY6A 1LNZA 5JCZA 1N6RA 2VF7A 4B3XA 1WA5A 1E2FA 3CRRA 1AZSC 2FV8A 1HQCA 2AXNA 1Z0KA 1W47A 2VQSA 4V0KA 3SR0A 2DY1A 4AYXA 4FMBB 4D82A 4GSYA 3KUDA 2ERXA 1GKUB 1M1YE 1GWNA 3GLFB 2PJRA 4G5SA 4GDFA 3I73A 2FFAA 1NLYA 4HYYA 1XB2A 4GMXA 4KFTA 3TR0A 3PEUA 4IOKA 4URZR 5BN4A 2X8AA 1MRSA 1GILA 4PO1A 1SVSA 1XEFA 2RGNC 5J4VA 2QQEA 3KZ1E 4IXMA 1OW3B 1VKJA 2VP5A 1M7GA 4LV6A 3KB2A 4OK5A 2JLRA 4TL8A 4JVMA 3M6AA 2FPKA 3K70D 2XEXA 2KE5A 2GJAA 3GP8A 1OPXA 3NBYC 1MH1A 2IEYA 3IBYA 5DIFA 1EK0A 2NO0A 4XWOA 4ZCLA 3FKSD 3K0EA 5DH9A 3K9HA 4Q9IA 2X77A 2XXAB 2CCJA 4WIAA 1E94E 5G53C 5J4YA 2O8CB 1BO6A 2FSFA 2EYUA 3DOFA 3KKQA 5P21A 1ZM9A 2JJ1D 3X1ZA 1Z2AA 4B6EA 1Q3HA 1QHGA 3V4RA 5EQTA 2OILA 2NO6A 3TSWA 4KLNA 1JAIA 5KNBA 2ZEJA 1TU3A 3QF4B 1OXTA 3RS0A 4B71A 2YC4C 1DAFA 3QY0A 4LHVA 4ACAA 4B2IA 2YV5A 4ZI2A 3A1TA 2PZFA 4ZDWA 4D4JA 4KAXA 4TYQA 5KHOC 1WXQA 3I3SR 1ZAKA 3MWLA 4NBSA 3AKCA 1XZPA 1KI7A 1JXMA 3MLEA 1DE0A 1N6KA 4LOAA 3U7FB 4D4KA 2VRWA 5FUVA 3ADCA 2RGBA 2IEZA 3AVPA 4FCTA 4GP7A 1XEXA 4B75A 2G1JA 2QY9A 4N3NA 3BWDD 2ZIAA 4M1WA 2I4IA 2PCJA 4B33A 3SI7A 1I4TD 4D0LB 3ZD7A 4JLOA 3D6TB 4CEIB 2GK6A 3AKDA 2ZRMA 2E1RA 1K8RA 1KZGB 1J2JA 3V00A 2WWYA 2ZE8A 2VHQA 4PZYA 1G1MA 3T5GA 1YU9A 4TQAA 5EXTA 5KO2A 1NLFA 1OKKA 2FN4A 4URXR 3B1XA 2HCJB 5FTKA 1N5LA 3HYRA 4RD1A 3IPXA 5JLJA 1U0HC 3FFBA 2WTUA 2N1BA 4C7OA 2Y8EA 2VPPA 3WNDA 4IFEA 1HEIA 4A0HA 1N2CE 4ARZB 4HAZA 3C16C 1DEKA 3FFAA 2YJTD 4B48A 4Z51A 2ZR7A 2ZJBA 5CDFA 3GLHA 3RS5A 4ZDIA 1R5BA 2BOVA 3CM0A 1EXMA 2ZSFA 4TLAA 1E2MA 4HLDA 3QIAA 1GL7A 3KJGA 4BGDA 3DL0A 4AKGA 4FCVA 1E4YA 2BMEA 1IN8A 3RANA 4Q9KA 3RWOA 5M04A 4FN5A 1GL9B 4CEHB 2QU8A 1Q12A 1HY3A 1LV7A 4MUAA 1FL9A 1XTIA 4N0DA 4R2HA 3ZIAA 1VDZA 1ZM7A 1Z08A 4Q1BA 4UQOA 4Q9JA 1KK2A 3VKHA 3UKDA 2B7CA 1M8PA 4P33A 2EQBA 2YNMA 2GWHA 2J41A 1NVWQ 5CYOA 5BWMA 4JS0A 2DHRA 1VCMA 4PPQA 1YRBA 2I3BA 2RAPA 4B3BA 3AV0B 1LS6A 1NF3A 2CEAA 1KNQA 3FHCB 5J4HA 4GNKA 2YWHA 3IGFA 5E7MA 3VMFA 3NXSA 1EFHA 1FUUA 2EFHB 3MMPA 2DBYA 3QKTA 4LJ7A 5DE3A 2DPXA 1JJ7A 4LX0A 3GEHA 3CPHA 1OH6A 2REBA 2UVQA 5GJVC 2JLYA 1FZQA 2XAUA 5DI9A 2VL7A 4CZ2A 4DJTA 2QBYA 3EZ9A 1DAGA 2H57A 1IXSB 5F3WB 4GL2A 4Q7JB 1E9CA 2VHUA 1D8TA 3AGQA 4Q1CA 2QN6A 4DRZA 2VHCA 3ICEA 3QENA 4EPXA 3PITA 4NYIQ 3KKOA 4MKGA 3UK6A 3X1DA 1KY2A 5TARA 4GT1A 4LCBA 3VHXA 2WJIA 4U5XA 1E2KA 2H7VA 2ZUBA 3MRSA 2JIZD 4LJ6A 4V0ME 1UKYA 2GZAA 3Q7PA 3SEAA 2CHVA 1NMZA 2V6IA 4JLPA 1CRPA 2JJ8A 4C0SA 4DUGD 1YZKA 3VKWA 1TADA 2WKRA 4POAA 4YDHB 3SBDA 4DCTA 4P4UA 2YOGA 3Q72A 4BWYA 5FUWA 2IHYA 3A8TA 1DTSA 1F5NA 1GVNB 4DB2A 3TLXA 3BB3A 1RJ9A 2VH5R 2NPIA 2ZJ5A 1WRBA 5DHFA 5J4LA 4PPNA 2FGKA 5DN6A 3L0IB 1SZPA 2FPMA 2N42A 2DB3A 1LF0A 5HCNA 2HJGA 1G8FA 3OFNA 1N0UA 1P6XA 1KJZA 1P2VA 3F3YA 2JLQA 4OI0A 3N2EA 2O8FA 4OQLA 2QBYB 4LRWA 2IUUA 3SS8A 3HPQA 3ZH9B 3OEHD 3Q3JB 3ZDQA 1FPMA 4JLVA 3EZ7A 2R62A 2AN9A 2DWOA 1ZMXA 1EFRA 5TB5A 1ZYUA 1Z22A 4LBWA 1SHZA 1LF5A 3M0EA 1SVKA 4JLNA 2G0NA 1SXJB 5J4KA 2GZDA 2YHSA 2F9MA 3AEZA 4Z8YA 1GNPA 1JB1A 2IYYA 3I5YA 1E2JA 2PH1A 1TMKA 3I92A 2ZJAA 1KDPA 2HLDD 2RMKA 3BD9A 3QF4A 2YVUA 5AJWA 4Q47A 3EZ2A 5A4JA 1F2TB 4PTLA 3WNBA 3PQCA 2QMOA 2GXSA 4G3XA 5LDDC 3NIBA 3X1YA 5BXQC 4ASUD 1E1RA 2MSEB 5AJVB 4OQFA 5E7JA 2A3RA 2IUTA 3LBIA
chains in the Genus database with same CATH superfamily
1Z0IA 1Y3HA 5COQA 3CG4A 4RA6A 1OI7A 3TWOA 2GJ8A 3N6RA 3RT7A 2PSSA 1CVRA 1LTKA 3N87A 3DOJA 3MTAA 1W5EA 4J1TC 5KYUA 3ONWA 4FFSA 4MLDA 2JJQA 4I4NA 4UATA 4F4UA 5KYYA 3PDHA 4HJRA 2G9VA 1NUUA 2Z5FA 2VDUE 3EAFA 3F9IA 3KG2A 4YYZA 5DJ5A 3CJRA 4ZHQB 4F5WA 1PZHA 2CEKA 4C4OA 3AF2A 3SS9X 3T1VA 5FWYB 4TZTA 4MZXA 4CCYB 2RSLA 1GT6A 3EH1A 3L79A 3PFGA 3LW7A 4ZT3A 3HN2A 1FS4A 3GAAA 2RG7A 4DKJA 1PFUA 2BC9A 2RHLA 4M55A 4NV0A 2PMWB 1WHTB 3LLCA 4UASA 2R8XA 5FTNA 3WKEA 4G63A 1P7YA 2J30A 5F9MA 2J4DA 3DE4X 3WNQA 3ZIUA 621PA 2I0FA 4HDOB 5K4HA 3K5HA 2ZJ7A 3ZJTA 3Q2OA 3V8QA 3A1CA 1FS6A 4YECA 2VTKA 3WWZA 3ZWWA 2RH8A 1RYDA 1NOJA 4GBED 1A9PA 4Z1MA 2C8JA 2IU3A 3FW1A 3EWNA 2ZT7A 2K7ZA 4HVCA 1J9EA 1PWZA 1XZHA 4OP1A 5IUNC 1HDGO 2WJWA 4RLQA 3NXKA 3ZGZA 2O07A 3AUSA 4OKSA 4F3TA 2J07A 1L5RA 3OF3A 2ECFA 2MIIA 2QRVA 3CO5A 3MOIA 4AKTA 4OL9A 1IK6A 2VNAA 3D0RA 4PZDA 2LZ0A 2V7VA 2WZQA 3UXEA 1Z4IA 2GA9A 3NHPA 2BGUA 2EBUA 1KK3A 4DR5B 4LRYA 4JLWA 1UK8A 3C1AA 4TS3A 5A1JA 1T8RA 2W2MA 2ORED 2PUGA 1UXOA 4ACBA 2SICE 1KDRA 1VKOA 4RMHA 4A82A 2CMHA 2WIDA 1JYFA 2FK8A 1TVMA 5T8KC 4NFLA 2FFJA 2J8ZA 2IBMA 4PAQA 1XALA 4E2XA 1DB3A 1NNEA 3P2OA 1E1DA 1FQKA 2QLFA 3K5WA 3PIRA 3I45A 1G63A 2M6KA 4DA8A 2NUTB 3CX8A 4BATA 5LA6F 3DOHA 3WNCA 1T5LA 4DJDC 1AQUA 1TCBA 4ISBA 2JBAB 1JIKA 3CGGA 3LW8A 7GPBA 3B5JA 1GAEO 2ZG6A 1TEVA 2ZS9A 1L3CA 1Z13A 2MMCA 1YFKA 4JI1B 3C3KA 3AJ9A 3KP1A 1IWBB 1VSVA 1QBGA 3D6FA 2IS6A 4I9HA 3I62A 2I55A 3UK2A 3T3HA 4XA8A 1MEJA 2Q6OA 1JT2A 3IUMA 4PYRA 4BVAA 4PGHA 2WNSA 5BW6B 2XE4A 2PD4A 2C2GA 5AVJA 4WOCA 4H7KA 1AS2A 1Y3CE 4B6FA 1IPEA 4FWIB 1T10A 3G02A 1IIRA 3JV7A 5JVDF 3KUKA 3G59A 2NO5A 2QX8A 1Z4PX 3JRNA 2Z5VA 3KVVA 4RJ2A 3T9CA 3CVOA 4BTEA 3V9PA 1J5EB 2A6PA 4CF6A 1M2OB 3S1SA 1X1DA 4PYMA 4LI3X 3VDQA 2KB0A 2YRFA 3TIFA 4CTNA 2P2CA 1ZVJA 3VM6A 1P5FA 1M1UA 2GFIA 4G0OA 1H0KA 4L4XA 3S1AA 2QL9A 2V7XA 4ESOA 3KHKA 4F8EA 2RI1A 3I2JA 4V38A 3IBFA 4W1QA 1BWPA 3SK0A 5KCZA 3HKBB 4L8FA 4BPBA 1W93A 1Z34A 2RH4A 4K8OA 1Q3KA 1G19A 3OSZA 3RU9A 2GJ9A 2K2WA 4X20B 2NV6A 3G2PA 4EB3A 4TMZA 1A5AB 1PR9A 1ZNXA 5DM0A 1XPJA 5ULLA 1EFRD 2H1LA 4C43A 8MHTA 2AOTA 3N9IA 4Q02A 4KXFB 1GFIA 3JZIA 1NMQA 4JFAA 1T5BA 4PCUA 3SZ3A 4A0SA 3C8UA 3QHPA 1ZVQA 1XCPA 1YE5A 3DA8A 4PZLA 5CA0F 2WD9A 4IIJF 4GX1A 2ECOA 2VWPA 4FJ0A 5U9CA 3V6LA 3DBIA 3JSAA 4JC5A 4XDHA 3CCCA 2YV2A 3FNFA 1A8HA 1UJNA 1GEGA 2BAGA 4UFOA 3VZCA 1F8YA 5EKTA 4PR0A 3TK1A 3G8YA 1E3EA 3GG9A 2J6IA 3L8ZA 3U3MA 1SIBE 3DAFA 3FYUC 3JVUA 4MRMA 1JMYA 1QDEA 5MFZA 4JXXA 4IDCA 2QTFA 2EVWX 1B8UA 2WU0A 3A6EA 1VJ0A 4WMLA 3A26A 5E6RB 2J3KA 1XA3A 2VF4X 3ABIA 2WQ7A 5CK4A 1PR1A 4YAOA 5AW6A 3QK7A 4K05A 1TAQA 1X7XB 1BE0A 1U2GA 1V4NA 4N0QA 3WHPA 3NQ41 4KMMA 1F38A 2FWPA 2ZYGA 1M33A 2XOKD 2Y1CA 5GZ3A 2WPDD 1F7UA 2NW6A 1MJFA 3FXAA 3KTAB 2VDQB 3PUYA 1NXVA 5BN1A 3VYTB 1E9AA 1L5LA 1JAYA 3AF3A 3N28A 2BISA 2EAUA 5C46F 2Y9PB 3AU9A 3WB2A 4JELA 4Q24A 2E87A 1E2GA 1EB8A 3FDJA 3LBNA 1J23A 4OXYA 3WGTA 1XRQA 3NHFA 3UGJA 5BPFA 2G1KA 4YHBA 1FSSA 1ZR2A 4AM8A 2C2WA 1RWXA 1BJKA 3VOSA 5CEFA 3SHWA 4US0R 1Q44A 1LU9A 3U62A 3QYFA 1VG1A 2I6QA 4JSYA 5KQRA 2DOKA 4RTRA 3Q7TA 4FFRA 1Q0ZA 2I80A 2I29A 1PT6A 2PKXA 1J56A 2SECE 1XO1A 2V4ZA 3I6YA 4ZYTA 1U7XA 4QODA 4LZOA 3LFTA 3UMFA 4KR3A 2CE7A 3CN7A 3D4OA 3PHGA 4H3VA 1G7RA 1JEAA 4G2TA 2QKYA 2C59A 4KR6A 4PSUA 4Q01A 2ZKIA 3UMJA 1UMDA 1CRWG 1NYRA 1Q7EA 1U1IA 2I99A 4MCAA 4E5MA 1NBEA 4TN1A 1YB7A 2XWPA 4MVCA 4DMFA 3LGAA 1Q14A 1KXJA 3OPXA 4B8WA 1CDDA 1UXKA 4PF1A 1WQ3A 3R3UA 2A57A 3KOWA 3CF4A 5AICA 5D7NA 5AHRA 2DP4E 1RXVA 1PTJC 3CZRA 1GPNA 3CVVA 1UBKS 2ODWA 1N3IA 3AVXA 3QFFA 1MRZA 3CH7A 1CRZA 1L4HA 5K0BA 4NFSA 3EGWA 1TM4E 2YJ3A 3CW9A 4FGJA 1ZJZA 4MVYA 4WZZA 4XYMA 3VZSA 3NBQA 4OL0A 5U1PA 4B0OA 3FPCA 1IN1A 5JAZA 1PX2A 4OLBA 3PKJA 3NVAA 4J6FA 4UDXX 5AOAA 1EQAA 1I4WA 3QBTA 1QYWA 4Y2YA 3GHHA 2UUCB 5B1IA 3HFSA 3ZCVA 1IJFA 4QHSA 3W4JA 1T3ZA 1IZYA 1X7DA 4U8GA 4A6XA 2IYTA 4I9UA 4BECA 1Y7HA 2OBNA 2FSVA 5LD2B 5D5QA 4EG5A 1LC3A 4XIIA 1KFJB 1NUAA 2IDZA 3QMWA 2AJLI 4MQUA 4OO3A 4W1PA 2X0RA 1PP4A 1DWUA 1RM0A 1KMCA 3DFKA 3LT2A 3MTGA 3IKJA 1AA6A 2FGJA 3H3JA 3G9QA 2GCOA 3OD5A 1KVRA 3I64A 4INPA 4ZYZA 2DTEA 3H8VA 1I8TA 2A1IA 2RB5A 3PYLA 4WJLA 1TKBA 3BCSA 1V16B 1NJGA 3NPMA 2QX7A 1DCTA 5C7IO 1OMOA 5AVZA 1D04A 1JA0A 2QXYA 3AUTA 1S2IA 3HWWA 3L7MA 1BDHA 4EYQA 2VZLA 3H19A 3SSMA 4CLRB 1UP4A 1ZL2A 3NDIA 3NFYA 1SCJA 1N92A 1Y4UA 3PHCA 3VI4B 1JNXX 4FWTA 4ZZ3A 1R3DA 2H7YA 1WXDA 3RCBA 3PFBA 1A7JA 1VGRA 3UMVA 3VU9A 2VI5A 5DGHA 1OC4A 4LHWA 4EWLA 1RKQA 2NUTA 1SM4A 1NLUA 3OZSA 3ZU4A 4HK4A 3UY4A 3W9UA 4CYMA 3HJNA 5B6IA 2J87A 4ZAVA 4FFMA 3O38A 5KYGA 3R44A 3B13B 3K1AA 1KBZA 2C9CA 4ZCMA 3ZN2A 4KN8A 1HL3A 2CJPA 2C5BA 2QX4A 3OQJA 1G7SA 3ICOA 3M5PA 2BZSA 1I7DA 4JV5B 3V5NA 4WK6A 2X6RA 1N6PA 421PA 4B82A 4DMRA 1EE2A 1BD3A 1T8UA 1JKMA 1H6CA 4RE5A 2GF0A 4WJZA 3H65A 2QPTA 1R50A 1ZBQA 4CU5A 1G4HA 3AEXA 4A8TA 1GPUA 3B3QA 3I9V1 2P5UA 2VJKA 2YMLA 3GLRA 4LYJA 4P22A 4QYTA 4Z6KA 2QN8A 5H80A 4BMVA 4EKNB 4P5EA 1P9NA 3EEIA 1NTOA 4I14A 2IYZA 4H16A 2RHHA 1X1SA 2GTHA 4TKVB 3OUUA 1Z4LA 3CHYA 2DG2A 2B1GA 2ZE5A 4W6QA 4OKNA 1J6UA 5EZYF 3PGKA 3CNHA 3D0OA 2GEDA 4J1TA 3VC1A 2C5EA 3TPCA 1ESEA 2VDNB 3S1AB 3T0GA 2R2GA 1FMJA 1TJ5A 4ETMA 3I4CA 5A7HA 4GSKA 1JAXA 1GYRA 1J22A 1GLNA 2EARA 2XOKA 3BDVA 1TRKA 4JIMA 3PV0A 4KUGA 2PY6A 2POCA 4LK2A 1LJLA 1EWRA 1RFLA 3PUHA 4D92A 3KQLA 3VU9B 4EFDA 3D2LA 1VA4A 1H8EA 2VSQA 2LW7A 1GJRA 2EQ5A 4S1WA 5JQGB 1EBFA 1H9AA 1P1CA 2W11A 4NYJQ 5C5EA 4QECA 3TLCA 2J9YB 1SK8A 3FTNA 4DUGA 4MV0A 5L9AA 5KNDA 1L5MA 2P65A 1NE2A 3VR4D 2JIZA 2VA9A 1G8AA 1L6IA 2W2NA 2Z8XA 4K9SA 4O4JF 4U02A 5H7XA 1OOEA 5EC8A 3SQXA 2W9XA 4L72A 3T4UA 5LKAA 1NQAO 4EHDA 4LYEA 4HX9A 2X8WA 3EWSA 5HMLA 2WJVA 2H8GA 2PUVA 2RBKA 1YS6A 1EMDA 1JQ3A 1PLJA 2H1FA 2JEYA 4TSFD 1KEEB 1GU0A 3ND9A 2GDZA 4O4LA 5CPFA 1VKNA 2DRIA 2FFRA 2R6HA 3ZUPA 5BSGA 3H1GA 4AUMA 2IPNA 2F1JA 2UVPB 4AUNA 2EJUA 1IXRC 4B0PA 1TYCA 3HTXA 3TH5A 1CF9A 4KODA 5IJXA 2TMDA 2XNDA 4HWRA 2BMWA 5FUXA 1YNSA 2HU8A 3RR2A 4D6YA 4CKBB 3QYJA 3C1OA 4V2IA 4HLUA 3D8HA 3ZIDA 3P45A 2ZIUB 2P0AA 4GW3A 4FDVA 2DVMA 4NPCA 3WL3A 2R6CA 4GUAA 2HA7A 1SVWA 4X90A 3KJIA 1ZH2A 3AQIA 4ZVNA 2D2EA 1RR6A 3L6BA 1PL6A 3PC8C 1SBIA 1U3FA 4HQFA 3H2JA 3U4IA 2ZCUA 4NYMQ 1LD3A 4RV5A 4TTPA 4FM9A 2GF9A 1N6OA 3K05A 4PANA 4S1TA 2ZS7A 1RYHA 2F59A 1L8XA 4UJ3A 1BXRB 3CR8A 1L4UA 1NJ5A 2PUWA 4E2ZA 1MRNA 4NBWA 1T3LA 1C2TA 3T94A 4F4HA 1PGQA 1DS6A 3A3YA 3H2YA 3KPWA 4U2FA 5HFNA 4ZC1A 3RD5A 1BTOA 4FSDA 4EUKA 3W2IA 1EWVA 1PUXA 5FBRB 1M6YA 1U28C 4EZIA 4ZCSA 4Z4HA 2RHRA 4YRKA 2Y4OA 1NZJA 2JEOA 2EGHA 4DCNA 2UKDA 1N3BA 4BKMA 3ETHA 1NW7A 1JZSA 2YXLA 3DXFA 3SFZA 4AJ1A 2BGNA 2C0PA 3UNXA 3VKUA 4QA9A 3IIMA 3OEYA 2WUDA 1NNUA 3SX2A 2XDAA 4OI4A 1E66A 1Y7PA 2HNBA 2W8ZA 2F90A 4C87A 4ZI3A 1OH8A 2AR7A 2O0MA 3FCXA 4DR1B 2YWBA 3BBPA 1QU3A 4UAUA 3ESCA 3S2GA 4AFNA 4H59A 3DW1X 4OXXA 3FWYA 3KDAA 5FEUA 2X2FA 1V1RA 2BMFA 2QOEA 3BKXA 4IDBA 4WNYA 4WN9A 1GRCA 1QIKA 2O7QA 2XA1A 4BNWA 1Z0DA 3LX4A 1UCFA 1Y4AE 5B37A 3VPCA 1SA0A 3HV2A 3ZJUA 5JJLA 5HIAA 4ND1A 3HCPA 1H4VB 3V7WA 2ODPA 3M6XA 3OQPA 1XELA 1V8PA 1ISJA 1QO0D 2DFVA 2OGZA 3RYTC 1I2MA 4J0GA 3SXUA 1NUTA 1HNWB 4QU5A 1ISGA 4X24A 2QQGA 4C1BA 3IKTA 3RVJA 3GHYA 5BWBA 2RI6A 3G7SA 5EP1A 3UT5A 4IHJB 3U1VA 1KHTA 1CZNA 2RCNA 1AA9A 1S3SA 3O26A 3H6GA 1H5NA 3HR7A 3IIIA 3JD4A 1G16A 4GOMD 4UJ5A 1QTQA 3HPRA 3LYUA 4F91B 1Q74A 3B7GA 5ESXA 4JN6B 5H68A 3RUCA 3CISA 3O4HA 4JB2A 5K5EA 2WHQA 2Y1DA 4AKIA 1V8DA 1NJ6A 5EJMA 5K7SA 2XIJA 4UEJA 4KP7A 4DG9A 5EUBA 3HNOA 1MGPA 1P2SA 4R83A 3WGVA 3BK7A 1DGQA 2GCOB 1C0PA 1BDBA 4LX8A 1I2AA 3ZQ6A 4YS6A 5CB0A 3AFGA 4URYR 5H4GA 1YTLA 3AJDA 2QMQA 4ID9A 3U09A 3BZWA 2BBTA 5EMLA 1MOQA 2VRBA 4QBHA 5LOVB 2WTEA 4JLJA 9LDTA 3JCZA 4UXHA 2C7PA 1ZI9A 4Y1RA 4QUBA 3RSLA 4IUCS 1TF5A 3H5VA 2MJLA 2O1SA 3KJZA 2DR3A 1H2ZA 3WV5A 4YJ2A 1NR5A 2X1LA 3EQ2A 4IDDA 4UBIA 3I04M 1W2HA 1I3LA 4MRAA 1A2QA 3TD9A 3NIWA 1FFWA 4Y2HA 4HN4B 2JIDA 3Q3EA 2WD7B 3H9UA 4MQBA 4QIHA 4X7BA 4NULA 1OXVA 2X2PA 3CZCA 1BD4A 5I8ZA 1V1JA 1T5TA 1HT2E 4M21A 1G20B 4HNAA 2H5JA 2UZ3A 2BUAA 4ZIRA 2G83A 2WWHA 1PG0A 3UMRA 3HKBA 5AVXA 4KE8A 1KI8A 2JAHA 3SZLA 1H3EA 3JR3A 1WBBA 1JF8A 4QPZA 5KDLA 4DIBA 4EB8A 3ZV4A 1E1CB 2IZ1A 4TMKA 3RUHA 1G8MA 3EMKA 1T0JB 3GDHA 1YRYE 4RPHA 4UM9B 3A9CA 4PTZA 3WZMA 1K6EA 3VU1A 2FEMA 1S2OA 4QUHA 5KTMA 4YAJA 2QIOA 3LZ6A 1PQ4A 3RT1A 3WKCA 3SVZA 3OE1A 3O90A 5TPZA 1Q0PA 3EHEA 1WZIA 1JQLB 1N5JA 2W6NA 4XFJA 5HQJA 1AGXA 1EXNA 5KWVA 4X62B 3QKWA 5KZMB 1B74A 5DTRA 1N0IA 1U7DA 1AMUA 2Y93A 5DP1A 1GUAA 3AIMA 1EFVB 1NIJA 1VLLA 2HNAA 2IF2A 3T7SA 3UHJA 1U2SA 3JTEA 2V6FA 2XVMA 3HCFA 3TLGA 1PYOA 1TJNA 3CLRD 3X1XA 3GOHA 3N6VA 2PAFA 4F84A 1GEEA 3D54D 5IVKA 1CEYA 2QVLA 2IQIA 5JXHA 1I4DD 2JGDA 3S28A 1FW6A 1X7WB 1DG1G 2PZBA 2EX4A 7ADHA 1KAEA 1SULA 3FUWA 4LF6B 1BCSB 3MJHA 1VHTA 3M33A 1G8YA 2VAXA 3KTOA 2JFFA 2IS4A 2PH3A 1C0EA 3I6MA 3L8GA 2FPGB 4Z9AA 2NM0A 3MINA 1BGVA 4LISA 1EINA 1CIPA 3DO6A 3ZU2A 2HAEA 4AG5A 5DSTA 4WY5A 2MSKA 1ADFA 1ODFA 2Q9BA 4OCZA 4AICA 1P75A 4BMYA 2J9FA 1C7QA 1ZD9A 4QFMA 5GPBA 4F3YA 5J47A 1RYYA 5DSZA 5JAHA 2FR0A 3VUEA 2XCTB 2XGMA 4DDTA 1M54A 4GVLA 2OCLA 4HWKA 3PNYA 1CY2A 4HRYA 2UAGA 4E1VA 3VSBA 5HQ3A 1JIXA 2W71A 2UXBB 3WWPA 3B78A 1COWA 4B79A 4LW8A 1E7WA 4NZZA 1XQ6A 3LHSA 4TVBA 2OESA 3KR1A 4ZVLA 5TPWB 5JD3A 4URVR 2BGLA 1ZJYA 3EMDA 4Q12A 4TX1A 4DLRA 3P0FA 1UXIA 2GYWA 1GKKA 2P27A 3P1JA 2AFIE 3TLMA 3V1KA 1RKXA 1UQRA 1X0XA 3HEAA 4LGVA 3PLNA 2HEGA 1ACLA 2QUBA 1LCIA 2EDAA 1D6SA 2X8JB 1FE8A 2Z9DA 1CE8A 2NU8B 1ZO8A 2NACA 2QRNA 4ZT6A 6AT1A 3IJEB 4URHA 4K9DA 1NNSA 1U99A 2FX3A 1IOLA 4M1MA 1D2CA 4R2XA 3TSOA 1U0TA 4IIXA 1GQSA 1P9RA 3ZW7A 1EM8A 1Y5LA 2PG3A 2G0AA 4U2KA 4A1FA 3V8VA 1AM4D 4JD5A 4KCGA 3K96A 4C76A 4M1QA 2PX3A 1A4IA 3RAFC 1GU7A 4YB8A 1KMMA 3R5TA 4JLSA 1O96B 1AQ6A 5JWHA 1BHQ1 3E0XA 4L0QA 2VNHA 2V1XA 4LTDA 3PGXA 3UH0A 5C3MA 3OCVA 2CYCA 2N47A 3DP9A 4XCXA 3SSAA 2AQHA 4QGAA 1Y9AA 3EQ7A 2J32A 4JQSA 4QNNA 4Z3KA 5D2CA 4JVOA 1M34E 3DG9A 1YUNA 2LKCA 1XTTA 3AGPA 1FB5A 4R6XA 2BEKA 4RHXA 1W1UA 3CLTD 4M53A 3W5VA 3P2IA 2IV2X 4D1YA 3LT1A 1J7KA 1H65A 2ANCA 4JA0A 5FL7A 2PVCA 2H0QA 2QRGA 1Z36A 3GLFE 3DQQA 1GN8A 1KYQA 3RS3A 4B6JA 1PV2A 2C20A 3VX4A 1OAOC 3RC7A 2XSZD 4D80A 2OM6A 5AMXA 2H59A 3OMWA 4RUKA 2FN3A 1YZGA 1CNFA 3NBAA 4NDNE 4BFWA 4F38A 4US1R 4AJ2A 1J8YF 4EJSB 3BVPA 4CIVA 1SR8A 1QIIA 3QVGA 1D2AA 3BB1A 4KDEA 4L8WB 1L4YA 3VX3A 3PDCA 4W5HA 3AB3A 3RRZA 3E9DA 1OFTA 2GPWA 5EMMA 5F1YA 1MH9A 3OE7D 1KI4A 1NP6A 3PDIA 3FNBA 1IWOA 5HF9A 1JMVA 1DRVA 2QAGC 2I33A 1KP9A 4BAGA 3KYBA 3KHUA 3KWMA 3ZCUA 2Q27A 5FQNA 2X4LA 4RLHA 2VJCA 1KE2A 4DR2B 4F21A 3IR7A 4V0MA 5AK4A 3T7DA 3M9XA 5HOEA 2XT6A 2CB0A 2AYYA 3O91A 3AHDA 3HEBA 5K3SA 4BVFA 5ARDA 4BP1A 1OCEA 2LXNA 3GJ5A 2NIPA 1VE9A 1XMQB 1YWGO 2VTDA 1EP9A 2H4ZA 5LZ5A 3A06A 4RTKA 4R8SA 1TQHA 1ULAA 3T12A 2J0SA 1OLOA 1TYEB 2XRFA 4ZARA 2DH6A 1NHWA 1UOEA 3SF8A 4FKMA 5B1EA 4BXOA 4FGSA 1B14A 1WXGA 1BKDR 2JB9A 2GASA 1IB0A 1CX9B 2Q5EA 1ZIPA 3BWCA 4OUDB 3V8BA 2F9LA 1CDZA 2I1LA 5TQ2A 4NK4A 3RS7A 3WRXA 4AG6A 6ABPA 2O7RA 1SBCA 2BEWB 2IZ6A 4DCSA 1Z38A 2YQ5A 2DQSA 1P31A 3PRHA 3U7JA 1DO0A 3QLVC 1RJFA 4RH3A 1TMOA 5B3JA 1ZH0A 4M22A 3ZHOA 1YFZA 3DVSX 3LUFA 2F43A 4GNRA 2O6LA 4IIFA 4RZSA 2CVHA 3EVEA 3GYBA 4PWYA 2ORYA 4X1KA 5CHYA 1MX5A 3GJQA 1NVDA 1HL7A 3PRJA 2VJOA 4ZOCA 4P54A 1D7OA 2I4TA 1VRWA 5CEEA 1R3UA 3KQMA 2C61A 4FGZA 3EPRA 4OHPA 1LWNA 3D4IA 3HVJA 1QGUB 2GVZC 3VSAA 4R0VA 3B36A 4XIFA 4NEQA 4I4LA 4JWTA 4R8LA 2C99A 2DU8A 3OCWA 4R2WA 3KKKA 4BN0A 3LQ1A 4EG4A 3CS3A 3KOZA 4D56A 1YS7A 1G98A 5E95A 3DJFA 4C6TB 3B2QA 4K6OA 5K6AA 3Q8LA 4ZHQF 5GOTA 1PW5A 3KT8A 3W77A 4FUQA 4FYHA 1TA9A 4BUZA 1Y3DE 1ZHHA 2LKDA 5IJ0B 2FJPA 2Q6LA 5BMVB 1RWPA 2FW8A 4IGIA 3WRWA 4Q4JB 3OE4A 3SF8B 1RVDA 2QTHA 2VCYA 1W4RA 4JEMA 4N7JA 1TQ6A 1V4BA 2VJNA 1YR3A 3FJOA 4NSNA 4TV9A 3A0RB 4X1OA 4Z9FA 4DABA 5LQMA 2AI3A 4IOJA 4FFOA 4MUBA 3S2EA 4L15A 5FFFA 5I7SA 4C7OB 3ZR4B 4BB0A 2JJ2D 2WAAA 1LXCA 1JLRA 2UZ0A 3L0YA 2YHBA 1SMKA 2PA3A 5EE0A 1X87A 4ZQBA 2GB4A 4YUXA 2AIRA 1UDRA 4DLVA 4BFVA 2Y1LA 1JEOA 4WBNB 2NXWA 6GPBA 4JUCA 4O6VA 3QMPA 4CM9A 1I3CA 3N86A 2OBBA 4O1HA 4R1LA 5JSZA 4BTVA 5T3YA 3T7AA 2QW1A 4CLOA 2OLJA 3GMSA 4QYSA 4EPRA 3HRHA 4O5AA 4DUYB 1T35A 1OFGA 4CKEB 3F8TA 1ESNA 1CJTC 1I2CA 2VS1A 3P32A 1YKFA 3ICQB 4NMMA 4U00A 2M2IA 2AS0A 3STWA 1ZOPA 3ECAA 4TM7A 4OHZA 1IOWA 1DAKA 4E33A 1X7HA 1A5BB 2PGNA 2YQ4A 1IATA 3QNWA 4KQKA 4O2RA 3ZDRA 5BSFA 4TLCA 4D9NA 1ZMBA 2ZIFA 2YDXA 1XRSB 4P3NA 4G5HA 4H6VA 3A28A 5TJHA 3O4JA 2IS1A 4CM6A 1A1SA 1PS0A 2Z1DA 3W5CA 2P35A 4W7IA 2F55A 5TR9A 1T6YA 1UM8A 4QYMA 4G5RA 3TBKA 4JJ4A 2C8KA 1T13A 2BEJA 5P8WA 1SWWA 1OLXA 1PG5A 2FFBA 4LBZA 3W7AA 3ENQA 5TPWA 4E4YA 1TB4A 2EEZA 821PA 2B6HA 2OHXA 3GRVA 1BFDA 2AI2A 4X3PA 4RANA 2IU6A 1CFJA 5CG1A 2XSZA 2D3TA 4MGYR 2Q2QA 5AKEA 2H2DA 3ND5A 2PEYA 5K0ZA 4BLSA 1B15A 4FLFA 1L4GA 2G04A 4NCJA 4TWIA 2AKEA 4QOHA 5K3FA 4MULA 3LLSA 1PVDA 5JI3E 1L5VA 3KZXA 4B43A 2QLLA 3CUSA 2ZRLA 1FJHA 2ZSAA 1VJGA 7AT1A 4EX7A 2QGNA 3JATB 4DMKA 2ZVQX 2DLNA 4WDQA 4CLOB 3A14A 3PPXA 6LDHA 5AXCA 5E1BA 1WMDA 2YVAA 1YQDA 1DFHA 1N1MA 2WWIA 1RZ3A 2NZ8A 1GCIA 1WIWA 1KQ3A 5EERA 5FBLB 4A2PA 4D02A 3EOAI 3VAYA 2V5UA 3PVSA 1JA9A 4JQYA 3EYWA 3O4IA 3PFHA 1UK9A 3FM9A 5IPFA 1B4DA 2JAOA 5JWRA 1U2QA 3I6ZA 4LJRA 1BVRA 5J58A 3CJTA 4OHRA 4Z53A 1UAGA 4K87A 2PO7A 4GZ3A 2Z8YA 3SJCA 5KYWA 2AEEA 3NHAA 1FU4A 4GPIB 1BWRA 1FF9A 3FF1A 3MGAA 3QVLA 3QWBA 4TSRA 4CPDA 8AT1A 3TTSA 3H4VA 1VCNA 3NPAA 3RRNA 2GEKA 1KI6A 4DMMA 4DSNA 4L9WA 4EI9A 3HI4A 3BSSA 1VFPA 3MOSA 1FDTA 1IZ8A 1CR0A 4N3AA 3CLVA 1DKRA 1KEUA 4AK9A 4ITUA 3RFVA 3GGOA 1TT5B 1Q7BA 4IRXA 3LXUX 4HNSA 1XCMA 2Q0HA 4GI2A 4DRXB 2C78A 1FDOA 1IU9A 3FWPA 1IG0A 4CCSA 1YOBA 4DOMA 5EJ8A 1UT6A 4JBIA 3RVDA 3PC3A 4P7GA 4A0RA 4MQEB 4UKDA 3TSAA 2JAQA 4PC7A 1DDGA 2Y6UA 3FX2A 3OZAA 4PRLA 2MYPA 2NPOA 3K9LA 3EZLA 4N82A 4P4NA 2QW0X 3GWZA 3G89A 3L77A 2A1TR 2ACEA 1R10A 2WDZA 4P81A 4RKQA 1VTKA 1QHFA 4A8JB 5LXTB 1AC5A 3M82A 1AHNA 3L9XA 4NU6A 1B6TA 1MXFA 3RVBA 2D2VA 2X6QA 3FOWA 1O54A 2DFTA 3IQZA 5JH7B 3LDAA 4CM4A 3IV6A 1WHSA 2D1RA 4BQIA 1WW8A 3BJIC 3AEKA 3ZNPA 4YVFA 5DNWA 3QOFA 1BKYA 2AOUB 3BK1A 2CXUA 3BRWD 1KVQA 1V8OA 1XI2A 4I6JA 4RY2A 1K7FB 3K20A 2O2SA 1RD4A 1YR6A 1RZVA 3NONA 2WZCA 1E2NA 5EVCA 2J59A 4L5YA 4NZ9A 4CVNA 1L5QA 1K7YA 1XZJA 3AVOA 3COVA 3UJ8A 2IPOA 2W58A 1JALA 4FW9A 5FPTA 3VKFA 2HPHA 5J40A 3OQOA 1XA4A 3AW9A 3CV3A 3M83A 5GM1A 1IPHA 4BJ3A 5F23A 1POXA 1TU0A 1YDHA 5HJEA 1W1IA 1R4NA 3L7NA 4ZAXA 1X7XA 4XLTA 4TVOA 1GZ4A 3RS4A 2J4FA 1XNQB 1O5OA 4C0LA 2HCRA 1EVKA 1K6MA 5JPIA 5D6NA 1EZ1A 4ZN6A 2R87A 2QJOA 3C3WA 3IIEA 4MYTA 1JPUA 3T3GA 1QGUA 4RZHA 1SA0B 3IMEA 3DMPA 2OZVA 3W5DA 3EBLA 1NF9A 1Z2PX 4ZODA 3OFKA 5G2OA 5BMOA 3V46A 3OWXA 4G56A 1Y1SA 2NZWA 3CLUC 1E58A 3O2NA 4Q1FA 2D1SA 2P68A 4KRYA 4BN5A 1MA0A 5HGXA 1MJGM 3EGIA 2GBLC 1PQYA 2PZJA 2X1VA 3RU2A 3ZHXA 2OHJA 1VYHA 2A33A 2E21A 2B92A 2JAPA 4DBLC 1JQKA 2ADMA 3S5UA 1LI4A 1VLJA 1JG1A 4GOXA 4HZUB 3WGLA 4GOJA 2VQ6A 1C1XB 2VWGA 3JQBA 3K92A 4QD3A 4C9BA 4MEJA 3FFTA 2D3WA 5HS4A 3F74A 4N8EA 1P29A 5FI5A 4AWAA 1ELOA 1Z5UA 2H9IA 2UDPA 1EFDN 3EJ6A 4V02A 5KWIA 3E1SA 1G4AE 1OFVA 1SXPA 1FSZA 4G85A 4DANA 4TV9B 3RKRA 3QA3E 2XLBA 4II3A 1GADO 2Q29A 5DGDA 4ZTBA 1CC1S 4FSXA 4TWZA 3A05A 1NRIA 3LKDA 1YS9A 1V1MA 3GMTA 3L6CA 3BL6A 4AYTA 3D1JA 1XRPA 3IILA 1HE1C 1OTYA 4UHFA 4I4TF 2RDMA 4CMIB 4HFRA 3BAZA 1GY8A 3IESA 3KR9A 3NU1A 4PLFA 1BDIA 1XQ1A 3QTTA 1TF2A 2QD5A 3D4PA 4IDAA 5CCDA 5L3SA 4F92B 4MDEA 1G6HA 1O5TA 4YPVA 1BQEA 1P7CA 3D02A 3A1NA 1L1EA 3ESDA 3H5RA 1ORTA 4QG7A 4B6QA 1ICIA 2XDQA 4LGCA 4UE6A 4BMCA 2HT1A 1P80A 1SELA 3R3WA 4X3CA 1UF9A 4JBNA 1Q17A 5E4TA 2X7XA 2B36A 1V5GA 2O2EA 1Y3FE 1DC4A 3FY4A 5KDOA 5B4VA 3L0OA 1NBIA 2Z04A 3MF4A 1JIIA 2B5VA 2H7XA 1CUZA 1SUAA 2MINA 4Q9HA 4D8VA 4P3XA 3U4AA 3M6MD 2KBFA 3HJFA 4JI8B 3B20A 4Y9SA 4FJ2A 2V6BA 1QQ5A 3GIWA 1Q1QA 1ZXLA 1SCKA 1GA6A 1S8FA 4Y7CA 1ZZEA 2ZPTX 3DUFA 3IB6A 1G4UR 4MVJD 3ZI7A 4B4DA 3R0JA 5KCMA 2RGNA 3OIUA 3DLCA 1EFVA 1ZUIA 2HF9A 3N74A 4PM4A 2RGGA 1CUGA 1JUDA 2PGLA 3CZ5A 1BE1A 4MEBA 2VATA 1MABB 2VQDA 3CT4A 4WNCA 4E94A 1DDIA 2AG0A 5CYOA 3GU3A 3GR6A 3A6DA 3LCRA 1QIDA 1AKRA 4L75A 4AU1A 4EFLA 2CLSA 2JS7A 2C9ZA 1HLFA 1A2OA 5AJYA 5AVKA 2XECA 3T5CA 4IV5A 4R16A 5L3SB 2QP3A 2WWRA 4BV3A 2A30A 3JVIA 4P98A 2XUQA 3H9QA 1H2FA 2V8OA 3G17A 2XV1A 4RGBA 1GG8A 1YA4A 5LQKA 3ERCA 3IBYA 2P3OA 5IXJA 1AQJA 1P39A 2CV0A 3KJXA 3FMPB 4K9OA 4F9TA 1JEDA 1M0SA 1R0BA 2W2QA 3F3SA 4Y67A 3RVPA 3SZOA 2VLIA 3K35A 4MR9B 4REQB 4TLEA 2O3UA 3QE0A 3B6JA 4L85A 4ZCLA 4QEZA 1Q83A 5KDDA 2VSXA 3NBFA 1BE6A 4BV2A 1AURA 2OC4A 1NN1A 4YRPA 3MCAA 2ZI4A 3MZ0A 1GCGA 2O4UX 3VU8A 3GRPA 5CB4B 1BC5A 1H05A 2P4SA 2ORIA 2QSYA 4X91A 4CDGA 3AR7A 2P1RA 5KMGA 1SEPA 3A37A 2C2MA 4DLKA 2OBLA 1F51E 1WU7A 3WQRA 4JYMA 4FFNA 1PR3A 3LF1A 4KBFA 4GH5A 3LVRE 3GROA 1NONA 2HA5A 1RTKA 2FZLA 3H5LA 4KO4S 3KZKA 3UFXB 5M7EA 1UZLA 1FTWA 4R54A 1S3IA 1VHWA 2ZSEA 3KZOA 5DWQA 3CC8A 3TZKA 4IJKA 3TW0A 4EGQA 1QYCA 3DMRA 3SOZA 3S4YA 2VJQA 4I5DA 3D7SA 1AXRA 1RZUA 1WNFA 2CLHB 1TZ2A 2H18A 2OGUA 3E81A 3R24A 4QM6A 1BS9A 5DNAA 1PLLA 1TVKA 4DJAA 1ZIYA 3QA9A 3FOAA 4UDYX 1GM5A 4BCCA 5DXAA 2GN6A 1R64A 1UBTS 1XCOA 3ASVA 3UZUA 3BXOA 4F86A 4WBSA 1BMQA 3IQXA 5F5LA 2I54A 4ENSA 3ZJ5A 2DPGA 7MDHA 2AXEA 3DE6X 2ATEA 4D3ZA 4P80A 2YICA 4HLNA 4XD7A 4YIKA 2AJTA 5JMTA 1TEXA 3U0BA 2H4XA 5KOHA 1B76A 3E35A 2DBVO 4GYWA 4JROA 2WD8A 5K05A 1WV0A 3LL7A 1ADCA 3EVFA 3WI7A 4C4TA 4E22A 5ALWA 4S35A 3J81k 2YMPA 5SY4A 4KQEA 3KM0A 1K88A 4CV2A 3IUEA 4RM3A 3R9WA 4HCJA 2XQFA 1CBUA 2FI1A 2ZIWB 4R2JA 1OJLA 4Y8VA 1Z8FA 1BXKA 2PX8A 2I7DA 5B3LA 1KEPA 4MVJA 5AKXA 3K31A 2QROA 2Z1MA 2PZGA 3A32A 5CFZA 4P0PB 4JUFA 2LWIA 4UPVA 4H60A 4KACA 4AIRA 4GQIA 4WAUA 2RAVA 3NI2A 5GIOE 3N2IA 4GMDA 4OP2A 3LOUA 5EP2A 1UEXC 4P31A 4MIYA 5F4ZA 2B34A 3ZNQA 4Q4AB 4MS4A 1QH0A 4RZQA 3JQDA 3FTFA 4JXZA 4BFTA 2LUOA 4XGKA 4RVUA 4WSOA 2PIDA 5F3DA 5CVCA 1EHIA 1DKMA