2YNXA

Crystal structure of ancestral thioredoxin relative to last archaea common ancestor (laca) from the precambrian period
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
SVVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAMPKEALKERIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACA THIOREDOXIN
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ynxA00
5HFIA 1XFLA 3N5OA 4RQRA 2AYTA 2WS2A 1LJRA 2XBQA 4GQFA 2XBIA 2L4CA 1XOAA 1Z7RA 1SJ6A 1YZXA 5ABRA 2I81A 3QAWA 5G30A 2I3YA 2HNLA 4LMWA 3GHAA 1YEXA 8GSSA 2DMLA 3G7JA 2GSRA 3P8WA 4AF2A 4HQSA 1TK5B 1PSQA 4G10A 4EC0A 3APSA 4Q5FA 1FHEA 2OE1A 4ZBDA 5J41A 4DSRA 3EYTA 1T00A 4CDOA 2VIMA 2KHPA 2ON5A 3CRUA 1MTCA 4F0BA 4LMVA 4ZL7A 2IMIA 4RQXA 2VM2A 1Y25A 1ERUA 1XOBA 4NHZA 5DAKB 5LD0A 4K6XA 3DEXA 2KLXA 2L4QA 2VD0A 2X8CA 2AAWA 5COHA 2H73A 4WXTA 1JZRA 4HOJA 5DVBA 2VLVA 5CREA 2G0FA 1ERWA 1EP7A 1JZWA 3VK9A 5GZZB 5GAND 2EIQA 2YJ7A 4POLA 3EINA 3FY7A 5DCHA 5L71A 6GSXA 4XS6A 2NPBA 4TKYA 1GSUA 3A2XA 2C80A 5E59A 3ZZXA 2P5RA 4OMVA 1TI1A 5DJMA 3TJKA 2JZSA 4G2EA 3ED3A 2B1LA 4F2IA 4MF6A 3CXGA 4PURA 2OJLA 4GRFA 1F3BA 2H1AA 1F3AA 1N2AA 1BEDA 3WGXA 1W4VA 2V6OA 5DJLA 2YWNA 1V9WA 3M9JA 2K6VA 2C0FA 1OYJA 2OE3A 2LTKA 3C1SA 2FWFA 2R5GA 1GWCA 5J9BA 5ECLB 3IK9A 2L57A 2GQMA 3TJBA 4YAPA 2OACA 4IQAA 4NV2A 4K9ZA 2ALBA 2K9FA 1AQWA 1MDKA 2V2GA 3FEUA 9GSSA 1FAAA 4TOPA 3F4RA 4MJEA 2R2JA 3EMPA 4X43A 4G19A 2YOIA 3S9FA 1Z5YE 1FVKA 1U88A 1AQVA 1R4WA 3IK7A 4FH8A 3CTFA 4IGJA 5ENUA 3GX8A 3VWWA 2R37A 1B4QA 4HUAA 1HYUA 4KB3A 5IMZA 3BCKA 5DBQA 2H76A 2DSAA 4ECIA 2P5QA 4EUYA 4WR4A 4QL9A 5HFGA 1EP8A 5ECOB 3L78A 5CP1A 1SL0B 1I5GA 4Q5RA 2M46A 2VOCA 3H8QA 4TXVA 2B5XA 3KJYA 2PWJA 1FOVA 4NAXA 3DYRA 3EE2A 2DBCA 5AGYA 3HHVA 1SU9A 2FWEA 1SK1A 3QFBC 2MBSA 3CSHA 3OR5A 4WETA 3F4TA 4OWYA 3JCML 3ZL5A 4PGTA 2GQLA 1XXUA 4GCIA 4BL7A 1XWBA 3TKSC 2VL9A 1BJXA 2MMNA 1A24A 2CVKA 2C0EA 1O73A 5EY6A 4GQCA 6GSVA 1RK4A 3IAS2 1PX6A 2J9HA 1GSQA 3A2WA 2YCDA 2F8AA 2XC2A 3GA4A 1Q98A 4IN0A 1GTBA 4MJBA 2YWOA 4N11A 4DVCA 1K3OA 1SK0A 3IPZA 5JWRB 5ECRB 1EOHA 1TRWA 1GTIA 3UL3A 2VL2C 3HVVA 1G6WA 4RI7A 3U5RE 1A8YA 2O85A 3HVSA 4MPGA 3ZVJA 1DE2A 1GLPA 4K0GA 1M2AA 3CTGA 2JZRA 3BCIA 5DAKA 3ME8A 1K0MA 2JADA 2HFDA 1TJDA 1XZOA 1XW9A 3APQA 3FW2A 4YH2A 3IXRA 5D9XA 3L4NA 4ZXGA 3F3QA 1X0RA 3TCOA 2VL3A 3HY2A 2GT5A 3NOFA 2DLXA 5H5SA 1O6JA 2KOKA 1GSFA 1ACVA 4I2TA 4TRXA 3TKSE 1U87A 3P7XA 4FO5A 5KN3A 1SKSB 2YV9A 2CZ2A 4K0NA 5F06A 2XPDA 3TRXA 3LXTA 2VO4A 2LJKA 1ZYQB 4POKA 5DQSA 4O32A 1TOFA 5IOXA 2CQ9A 3W6GA 3PINA 2H0IA 1UC7A 1FB0A 1YF1A 1F9MA 4MK3A 3FYGA 5CO3A 3NZNA 3HXSA 1G7OA 4EE0A 4MCUA 1UVZA 4X1UA 2R3XA 4TVEA 5HR2A 4AJ7A 1X5CA 4L0UA 2WB9A 3LQ7A 1DSBA 2VCXA 1GL8A 2LQQA 1KTEA 4KDUA 3M0FA 2YNXA 2YV7A 2L5OA 4YAVA 4O92A 1ILOA 1RW1A 4NXIA 3GL3A 1XIYA 16GSA 1AQXA 3DKSA 3LGCA 1PN9A 1K0BA 1A0RP 1O7UA 3HYPA 4MH3A 3A5WA 2RLIA 3GV1A 2AHEA 2JACA 1EEMA 1V57A 3ZVJD 4CW9A 2TRCP 20GSA 3DGQA 1G0TA 1TTZA 1TU8A 1JZOA 1TRUA 3HZ8A 3IHQA 1AAZA 2F9SA 4V2LA 2GLRA 2REMA 1TKDB 3IDVA 4GSTA 3DRNA 2MBTA 1THXA 3MAKA 1VRSD 2N5AA 2CX4A 1PRXA 3Q74A 6GSSA 2G2QA 4MDCA 2QC7A 1MD3A 5JCGA 4ZILA 3ERFA 4LL1B 2XHFA 4TN8A 2H71A 3HVXA 1NHYA 3P2AA 3EMXA 1QXHA 1BAYA 2MYGA 3TRPA 3CBUA 1XWGA 2X99A 3RAZA 5INYA 2H6XA 2H01A 1O81A 1GSYA 2WGRA 1TK0B 2FY6A 4HU9A 3ME7A 4AGSA 5EPFA 2B7JA 1I9DA 3L0HA 4V1Ap 1QMVA 5IMAA 3RPPA 5GSTA 1FB6A 5KN1A 4TW5A 1K0OA 3VPTA 3UVHA 2CA8A 2R4VA 3H79A 4QL7A 3VWVA 3GFKA 2CVBA 4WR5A 2RUEA 4OFTA 4WF5A 6GSWA 2VCQA 3ZYWA 1R5PA 2VCVA 3C1RA 1SENA 5ID2A 3HD5A 4TXOB 3FR6A 3I69A 4ZL8A 1VF1A 2OA7A 5F07A 1TW9A 3QDNA 1SK2A 4MZCA 4IP6A 1TI3A 4OD7A 1AIUA 4YQVA 4NPBA 4KNDA 4OO5A 2A2RA 2H6ZA 2LUSA 2MMAA 3UIWA 3ZFBA 1AC1A 3GL5A 4JE1A 1T3BA 1ZOFA 3UEMA 3MDKA 3I6AA 5IMVA 3FR3A 2LRTA 5B6NA 1KNGA 4TR4A 2VLUA 4ZB8A 3TOTA 2H74A 1G7EA 4F82A 4PUFC 2YANA 2CX3A 2OE0A 3G7YA 4GXZA 2IWTA 1SKRB 2K8SA 2H75A 2E7PA 1PGTA 2LNSA 2OKAA 1K3LA 4N30A 4PQHA 1O85A 1XVQA 3ZTLA 5KEJA 2Z9SA 2GZZA 3ZRDA 4O7HA 5CRHA 2GS3A 1EWXA 2LRNA 2YP6A 3L9VA 5ECQB 1JHBA 4TR1B 3TDGA 3TKQA 2HRNA 1XPVA 5ECSA 1EEJA 1Z9HA 1ST9A 3TB2A 3FZ5A 3PR8A 4KE3A 3TUEA 2V32A 1A8LA 5AIVA 1R7HA 13GSA 2LRCA 2HXKA 4MF7A 5ECPB 3IBHA 1YDKA 1URMA 5HFKA 1GNWA 5FWGA 5H5RA 4JR4A 4FYBA 2IFQB 5IIZA 2VCTA 5D9TA 4WEYA 3KM6A 1XCCA 4PNGA 2C0DA 1FO5A 5A4VA 4K2DA 3WD6A 1V98A 3F8UA 2L6CA 4Q5QA 1HD2A 2OBKA 1IYHA 2C3TA 2EIOA 3VI5A 2HZFA 5EL8A 1VF3A 1BG5A 2LS5A 4HZ2A 1SL1B 3UJ1A 3Q18A 1K0AA 4EDYA 4KDYA 4ZIJA 3HKRA 3LYPA 1X9MB 2CT6A 2DIZA 5G1KA 3BBYA 1FW1A 3VI7A 3ZMKA 2RUFA 3KH7A 1HNBA 2GZYA 4HQZA 1ERTA 3HA9A 1SYXA 1SD9A 3D5JA 1Z7PA 2N5FA 3KTBA 1JFUA 3DWVA 5ECNB 5D9WA 2HI7A 4NMUA 1GUKA 1YY7A 1MDIA 3EU3A 2GSQA 2H66A 4GF0A 4L5OA 4PX1A 3ISOA 4MMMA 4YQMA 2X8HA 5HR3A 3GUSA 4Q5NA 3Q6OA 3KCMA 4K7OA 4E8EA 1A23A 3M9KA 3LXZA 2XPEA 4L0WA 3M3MA 2MZCA 2AB6A 4GWRA 4IS0A 4IJIA 1GNEA 4DSSB 1XWAA 4ML1A 1TP9A 2QSIA 3I43A 2C8UA 5ECHB 3RBTA 3WGDA 3LEFA 4MP4A 2GSTA 5J3RA 2BMXA 3O76A 4EDZA 3FRCA 1M9AA 3KMNA 1SL2B 4QQ7A 1U3IA 4N10A 5JCUA 3E9JB 2VCZA 3F4SA 2HT9A 4HJMA 5ECKB 1GTAA 2HSHA 2LKUA 1H4OA 1TDIA 2HZEB 2OADA 4I2UA 1X5DA 3RHCA 3LSZA 1X5EA 3ZMLA 3GTUB 2P31A 3FZAA 22GSA 3ZREA 4FYCA 1F2EA 2FCHA 3RHBA 2AV4A 5JWOB 5F8BA 2I4AA 3UAPA 2VM1A 2B5YA 2CAIA 4XS4B 4GSNA 1B9YC 2JU5A 4F9ZA 5HR1A 3E3EA 4EF0A 4MJCA 5ELAA 4K7NA 4N0VA 2H0GA 1J9BA 2DC5A 4TR1A 3LORA 2YZUA 2WULA 1HNCA 3H4KA 3UOMA 4HDEA 4IBPA 2WRTA 2YN1A 4ILFA 2NBSA 4KA0A 2B6MA 2RIIA 2GTUA 1XBSA 5IMDA 1QUWA 3ZLPA 1M0UA 5F0GA 3EC3A 4MZBA 2YWMA 3L9UA 2LNTA 2MMOA 5G1LA 1YJ6A 1M2DA 1EV4A 3QPMA 3KIJA 3GN3A 5DCGA 4I6XA 4FYUA 2DMMA 2V1MA 3IAM2 2E2GA 4ECCA 4IKHA 4MLYA 3FK8A 3GH6A 4WKWA 4Z7XA 5DQYA 2DJJA 3D4MA 4XHMA 1T7PB 4L8EA 3TJGA 5DALB 1K3YA 3IE3A 4FIWA 1UA5A 3PH9A 5IM9A 1AXDA 2H1BA 3QR6A 3UBLA 5AISA 4PQIA 1M2BA 3D21A 3TKSA 3KZQA 3ERGA 2IMFA 2L6DA 2C1YA 4I97A 2VUPA 1EGRA 1BYEA 4JBBA 2IIYA 2TRXA 3TRQA 1PD21 4J2FA 2GSSA 3WGEA 1Z3EA 3E0UA 1GP1A 2ZCTA 4P3YB 1XW5A 3DIEA 4RUVA 1OE8A 5G5FA 4EVMA 2B7KA 1DE1A 2VL2A 2H70A 1FVJA 2D2ZA 4ULXA 4KUNA 2WJUA 4DSQA 3BJ5A 5EVOA 1B8XA 1YEPA 5D73A 4DSSA 1R26A 4KSOA 1SYRA 3TJJA 5CAXA 1WRYA 3QCPA 5J5NA 3BOAA 2O8VB 5C00A 3LWAA 1QFNA 1GLQA 1TRVA 1K0CA 5LCZA 2X8GA 1AUCA 2YZHA 2M72A 5KN0A 2RM6A 4POBA 4V1Ag 11GSA 1USBA 4MJAA 3C8EA 1YQ1A 4V2MA 4OFMA 1EZKA 2B5EA 3DMLA 2FA8A 1K0NA 2IPAA 2PVOC 3C71A 2V41A 1E6BA 3W8JA 3KP8A 4JRRA 5JCWA 1KBNA 4KGIA 2HYXA 3IV4A 2PPTA 4GSSA 1OAZA 3N9JA 3M1GA 3G9BA 2WDUA 4IELA 5IQYA 1LU4A 3WYWA 4JR6A 3J7Yb 4KW6A 1E2YA 1GTUA 3ERWA 1RQMA 2V6KA 1T4ZA 1B4PA 3F6FA 4KSMA 14GSA 2TIRA 3LG6A 5CNWA 3WT2A 3GH9A 5LNKe 1ON4A 4XS1A 3TGZA 4TR0A 3Q19A 5GAPD 2VAFA 1H75A 2ON7A 1ZL9A 3VWXA 1XWCA 3D0ZA 3CSIA 12GSA 3C73A 3HJMA 3I9V2 2QGVA 1U3AA 1JZDA 4AJ8A 3UBKA 3P90A 1WJKA 1TRSA 3VFIA 3GKNA 2IMKA 3F63A 1OE7A 2YPMA 3F6DA 2C3QA 19GSA 4N0ZA 4K1FA 4ECJA 4NV5A 2JSYA 1OVNA 3MSZA 3QAGA 1OC3A 3NIVA 4OCFA 5E4WA 1A0FA 4K7IA 2IMDA 2CVDA 4RI6A 4E8HA 3GMFA 3KXOA 1R5AA 3D4TA 5DALA 7GSSA 5B8AA 4BVXA 1NHOA 3TJFA 2F8FA 1T8EB 1C72A 4YQUA 1WMJA 4J57E 4LLRA 3H1NA 2IMEA 4ID0A 3LJRA 1GH2A 1CQGA 4PUAA 3K8NA 4MABA 4F0CA 1TXXA 2YWIA 4XCSA 2NVLA 3ZIJA 4HS1A 2BJXA 4OO4A 2K18A 3IRAA 1MDJA 1NSWA 3FZ4A 5A5KA 4MZWA 1F6MC 4O5RA 1LBKA 5FHIA 4PQ1A 2GZPA 3HZ4A 3IR4A 5B7CA 3KH9A 2I1UA 1DUGA 1HNAA 1QGVA 3GURA 3TKRA 4IHUA 1PQNA 2FHEA 4ZBBA 4ISDA 3UVTA 3MWHA 2H0HA 1WP0A 4ECBA 2LQOA 3H93A 3BD2A 2WZ9A 3TOUA 2JSZA 1BX9A 3EU4A 3EWLA 1ZGNA 1PMTA 4ML6A 4EKZA 1HQOA 2R6KA 5ECMB 2FWGA 4NHWA 4V2NA 3KMOA 3KTLA 1JLVA 5AIXA 1ABAA 5H5QA 1YF0A 4IVFA 1NM3A 1GSSA 2KP2A 10GSA 2VCWA 4POMA 5FT3A 1M99A 3O6TA 3QD9A 1WPIA 2LV3A 4ZL9A 3GKMA 5IMCA 2JL4A 1JLWA 1SJZA 1V58A 1TU7A 1O8WA 2LJRA 4EL1A 4KAEA 1S3AA 2DJ1A 4OCEA 6GSYA 3RPNA 2GGTA 1PKZA 3GIXA 1AW9A 3FZ9A 1CQHA 3FKFA 1A2MA 4MF5A 4EO3A 5DDLA 1FG4A 4PXOA 1Z6MA 3LYKA 3F3RA 4ZBAA 5A4UA 1PL2A 4BWQA 3DXBA 5IPHA 2CAQA 4TXOA 1T4YA 2PVQA 2HRFA 18GSA 1QK8A 2FLSA 5CRGA 2FGXA 2GVPA 1ERVA 4IP1A 1NW2A 5HQPA 3R2QA 2GT6A 2PMTA 2I9HA 1GSEA 2HLSA 2LSTA 2L59A 4KX4A 2PN8A 2IN3A 2H6YA 3KEBA 5J4UA 1X9SB 4BWSA 2O89A 2CZ3A 2YJHA 1OKDA 2X64A 1V40A 3VWUA 3QAVA 2A4VA 3F9UA 3G7IA 1S3DA 2HE3A 3CMIA 3US3A 1WE0A 4WBRD 4ACSA 5B6MA 2F51A 3GKXA 3GSTA 1PL1A 3CSJA 3F0IA 2F3MA 2PGTA 3HJPA 5IOWA 2MMZA 3M8NA 4MPFA 2H72A 3VPQA 1J08A 4WF4A 1WWJA 2GQKA 1YKCA 4MA9A 1OC9B 1T1VA 2IL3A 3KD0A 2FUG2 2KP1A 3HCZA 2A2SA 3HJOA 2FNOA 4HJ2A 3QFAC 4JU5A 2VD1A 3C7MA 5IPGA 3DVWA 3ZITA 3AY8A 1U6TA 4EXJA 2EC4A 5ID2B 5KN2A 3APOA 4CHSA 1UN2A 1J0FA 5HR0A 3DVXA 2HSYA 1B48A 2N5BA 3GSSA 2H1GA 2IFQA 3O3TA 4XRAA 1F37A 2ES7A 3EVIA 4BPYA 5D9VA 2C4JA 4D73B 1GUHA 3ZFLA 1QQ2A 3LFLA 1Y6EA 2O87A 1XVWA 1M9BA 1G6YA 4J56E 2B1KA 17GSA 1M7TA 4HEA2 4ZB6A 1V2AA 3SWLA 5A4WA 3GNJA 3QMXA 1SD8A 1X9WB 3CRTA 2VLTA 4F03A 5C04A 4WBJA 1K0DA 2K8VA 2AJQB 4L5LA 2LJAA 4KCEA 2ZNMA 3J7Yk 2H8LA 2DJ0A 2FA4A 4BVYA 2DJ3A 5J9CA 2M80A 1WOUA 5F05A 1ML6A 1VGLA 2PBJA 3A2VA 1GSDA 2CV4A 5ELGA 2PU9C 2FD3A 1ZCPA 1EOGA 3IOSA 4TR3A 3UMAA 1DBYA 2H30A 5D96A 4KCAA 1VF4A 5G5EA 3PGTA 3TKPA 1S3CA 1N8JA 2JZTA 4G9HA 1OKTA 5IO2A 1SJIA 5CRDA 4PNFA 2DIYA 3SBCA 3DD3A 5CYYA 5G31A 1A2LA 2GDRA 2C3NA 2WCIA 4BA7A 2PUKC 4KDXA 5CRWA 1EGOA 2AUVA 2ZUPA 3IC4A 4HU7A 3EURA 3CYNA 4H86A 3UARA 2C0GA 1A2JA 5D8IA 3WT1A 2RM5A 1THOA 1VF2A 1W89A 2LEGA 4MH2A 1WIKA 3FR9A 3FHKA 3W8SA 2J23A 3V1WA 2KUCA 4K8MA 4KH7A 4HI7A 5ECIB 2EIRA 5IMFA 1XWKA 3MNGA 2HZEA 1OC8A 3IA1A 3GYKA 4NWYA 3GTUA 5GSSA 6GSTA 1GUMA 3U6VA 5G2ZA 1XW6A 4AJ6A 1TK8B 1PA3A 4ZB9A 4XIHA 5B8BA 1Q4JA 4LA1A 3A3TA 2NTOA 1SKWB 2FWHA 4GLTA 4X0XA 4XS4A 1B9XC 2DJKA 1BQ7A 1O8XA 2IJYA 4LL4B 1ZZYA 1IYIA 3GKKA 1KEBA 1MD4A 3RDWA 4OFNA 3VLNA 1OC9A 3VURA 2P0GA 5IO0A 1PKWA 1ZMAA 4I8BA 2WFCA 5AN1A 1MEKA 2H1DA 1GRXA 3GRXA 2B3SA 4IW9A 3QOUA 3KP9A 2L5LA 2E2MA 2PERA 4JZQA 4XTSA 3GX0A 2OBIA 4HZ4A 3ZIVA 1EV9A 3D22A 2NDOA 4GTUA 3KGKA 4I5QA 4JEDA 4DEJA 2O7KA 2QKEA 1Z6NA 4IJ3A 4D73A 3L9SA 5D93A 1ZYEA 2E0QA 3D6IA 6GSUA 4IQ1A 1GULA 1PX7A 2BTOT 1YKAA 4XRDA 5JWQB 2DJ2A 2H19A 3HDCA
chains in the Genus database with same CATH superfamily
5HFIA 1XFLA 3N5OA 4RQRA 2AYTA 2WS2A 1LJRA 2XBQA 4GQFA 2XBIA 2L4CA 1XOAA 1Z7RA 1SJ6A 4BL7B 1YZXA 5ABRA 2I81A 3QAWA 5G30A 2I3YA 2HNLA 4LMWA 4EIPA 3GHAA 1YEXA 8GSSA 2DMLA 3G7JA 2GSRA 3P8WA 4AF2A 4HQSA 1TK5B 1PSQA 4G10A 4EC0A 3APSA 4Q5FA 1FHEA 2OE1A 4ZBDA 5J41A 4DSRA 3EYTA 1T00A 4CDOA 2VIMA 2KHPA 2ON5A 4EIQA 3CRUA 1MTCA 4F0BA 4LMVA 4ZL7A 2IMIA 4RQXA 2VM2A 1Y25A 1ERUA 1XOBA 4NHZA 5DAKB 5LD0A 4K6XA 3DEXA 2KLXA 2L4QA 2VD0A 2X8CA 2AAWA 5COHA 2H73A 4WXTA 1JZRA 4HOJA 5DVBA 2VLVA 5CREA 2G0FA 1ERWA 1EP7A 1JZWA 3VK9A 5GZZB 5GAND 4O5QA 2EIQA 2YJ7A 4POLA 3EINA 3FY7A 5DCHA 5L71A 6GSXA 4XS6A 2NPBA 4TKYA 1GSUA 3A2XA 2C80A 5E59A 3ZZXA 2P5RA 4OMVA 1TI1A 5DJMA 3TJKA 2JZSA 4G2EA 3ED3A 2B1LA 2X49A 4F2IA 4MF6A 3CXGA 4PURA 2OJLA 4GRFA 1F3BA 2H1AA 1F3AA 1N2AA 1BEDA 3WGXA 1W4VA 2V6OA 5DJLA 3MYDA 2YWNA 1V9WA 3M9JA 2K6VA 2C0FA 1OYJA 1ZYNA 2OE3A 2LTKA 3C1SA 2FWFA 2R5GA 1GWCA 5J9BA 5ECLB 3IK9A 2L57A 2GQMA 3TJBA 4YAPA 2OACA 4IQAA 4NV2A 4K9ZA 2ALBA 2K9FA 1AQWA 1MDKA 2V2GA 3FEUA 9GSSA 1FAAA 4TOPA 3F4RA 4MJEA 2R2JA 3EMPA 4X43A 4G19A 2YOIA 3S9FA 1Z5YE 1FVKA 1U88A 1AQVA 1R4WA 3IK7A 4FH8A 3CTFA 4IGJA 5ENUA 3GX8A 3VWWA 2R37A 1B4QA 4HUAA 1HYUA 4KB3A 5IMZA 3BCKA 5DBQA 2H76A 2DSAA 4ECIA 2P5QA 4EUYA 4WR4A 4QL9A 1FOHA 5HFGA 1EP8A 5ECOB 3L78A 5CP1A 1SL0B 1I5GA 4Q5RA 2M46A 2VOCA 3H8QA 4TXVA 2B5XA 3KJYA 2PWJA 1FOVA 4NAXA 3DYRA 3EE2A 2DBCA 5AGYA 3HHVA 1SU9A 2FWEA 1SK1A 3QFBC 2MBSA 3CSHA 3OR5A 4WETA 3F4TA 4OWYA 3JCML 3ZL5A 4PGTA 2GQLA 1XXUA 4GCIA 4BL7A 1XWBA 3TKSC 2VL9A 1BJXA 2MMNA 1A24A 2CVKA 2C0EA 1O73A 5EY6A 4GQCA 6GSVA 1RK4A 3IAS2 1PX6A 2J9HA 1GSQA 3A2WA 2YCDA 2F8AA 2XC2A 3GA4A 1Q98A 4IN0A 1GTBA 4MJBA 2YWOA 4N11A 4DVCA 1K3OA 1SK0A 3IPZA 5JWRB 5ECRB 1EOHA 1TRWA 1GTIA 3UL3A 2VL2C 3HVVA 1G6WA 4MNNA 4RI7A 3U5RE 1A8YA 2O85A 3HVSA 4MPGA 3ZVJA 1DE2A 1GLPA 4K0GA 1M2AA 3CTGA 2JZRA 3BCIA 5DAKA 3ME8A 1K0MA 2JADA 2HFDA 1TJDA 1XZOA 1XW9A 3APQA 3FW2A 4YKGA 4YH2A 3IXRA 5D9XA 3L4NA 4ZXGA 3F3QA 1X0RA 3TCOA 2VL3A 3HY2A 3NOFA 2GT5A 3MIXA 2DLXA 5H5SA 1O6JA 2KOKA 1GSFA 1ACVA 4I2TA 4TRXA 3TKSE 2R0PA 2DKIA 1U87A 3P7XA 4FO5A 5KN3A 1SKSB 2YV9A 2CZ2A 4K0NA 5F06A 2XPDA 3TRXA 3LXTA 2VO4A 2LJKA 1ZYQB 2HRKA 4POKA 5DQSA 4O32A 1TOFA 5IOXA 2CQ9A 3W6GA 3PINA 2H0IA 1UC7A 4BVXB 1FB0A 1YF1A 1F9MA 4MK3A 3FYGA 5CO3A 3NZNA 3HXSA 1G7OA 4EE0A 4MCUA 1UVZA 4X1UA 2R3XA 4TVEA 5HR2A 4AJ7A 1X5CA 4L0UA 2WB9A 3LQ7A 1DSBA 2VCXA 1GL8A 2LQQA 1KTEA 4KDUA 3M0FA 2YNXA 2YV7A 2L5OA 4YAVA 4O92A 1ILOA 1RW1A 4NXIA 3GL3A 1XIYA 16GSA 1AQXA 3DKSA 3LGCA 1PN9A 1K0BA 1A0RP 1O7UA 3HYPA 4MH3A 3A5WA 2RLIA 3GV1A 2AHEA 2JACA 1EEMA 1V57A 3ZVJD 4CW9A 2TRCP 20GSA 3DGQA 1G0TA 1TTZA 1TU8A 1JZOA 1TRUA 3HZ8A 3IHQA 1AAZA 2F9SA 4V2LA 2GLRA 2REMA 1TKDB 3IDVA 4GSTA 3DRNA 2MBTA 3IHGA 1THXA 3MAKA 1VRSD 2N5AA 2CX4A 1PRXA 3Q74A 6GSSA 4K5RA 2G2QA 4MDCA 1S3RA 2QC7A 1MD3A 5JCGA 4ZILA 3ERFA 4LL1B 2XHFA 4TN8A 2H71A 3HVXA 1NHYA 3P2AA 3EMXA 1QXHA 1BAYA 2MYGA 3TRPA 3CBUA 1XWGA 2X99A 3RAZA 5INYA 2H6XA 2H01A 1O81A 3FMWA 1GSYA 4Z2RA 2WGRA 1TK0B 2FY6A 4HU9A 3ME7A 4AGSA 5EPFA 2B7JA 1I9DA 3L0HA 4V1Ap 1QMVA 5IMAA 4G0IA 3RPPA 5GSTA 1FB6A 5KN1A 4TW5A 1K0OA 2QA2A 3VPTA 3UVHA 2CA8A 2R4VA 3H79A 4QL7A 3VWVA 3GFKA 2CVBA 4WR5A 2RUEA 4OFTA 4WF5A 6GSWA 2VCQA 3ZYWA 1R5PA 2VCVA 3C1RA 1SENA 5KOXA 5ID2A 3HD5A 4TXOB 3FR6A 3I69A 4ZL8A 1VF1A 4X4JA 2OA7A 5F07A 1TW9A 3QDNA 1SK2A 4MZCA 4IP6A 1TI3A 4OD7A 1AIUA 4YQVA 4NPBA 4KNDA 4OO5A 2A2RA 2H6ZA 2LUSA 2MMAA 5BMUA 3UIWA 3ZFBA 1AC1A 3GL5A 4JE1A 1T3BA 1ZOFA 3UEMA 3MDKA 3I6AA 5IMVA 3FR3A 2LRTA 5B6NA 1KNGA 4TR4A 2VLUA 4ZB8A 3TOTA 2H74A 1G7EA 4F82A 4PUFC 2YANA 2CX3A 2OE0A 3G7YA 4GXZA 2IWTA 1SKRB 2K8SA 2H75A 2E7PA 1PGTA 2LNSA 2OKAA 1K3LA 4N30A 4PQHA 1O85A 1XVQA 3ZTLA 5KEJA 2Z9SA 2GZZA 3ZRDA 4O7HA 5CRHA 2GS3A 1EWXA 2LRNA 2YP6A 3L9VA 5ECQB 1JHBA 4TR1B 3TDGA 3TKQA 4G0LA 2HRNA 1XPVA 5ECSA 1EEJA 1Z9HA 1ST9A 3TB2A 3FZ5A 3PR8A 4KE3A 3TUEA 2V32A 1A8LA 5AIVA 1R7HA 13GSA 2LRCA 2HXKA 4MF7A 5ECPB 3IBHA 1YDKA 1URMA 5HFKA 1GNWA 5FWGA 5H5RA 4JR4A 4FYBA 2IFQB 5IIZA 2VCTA 5D9TA 4WEYA 3KM6A 1XCCA 4PNGA 2C0DA 1FO5A 5A4VA 4K2DA 3WD6A 1V98A 3F8UA 2L6CA 4Q5QA 1HD2A 2OBKA 1IYHA 2C3TA 2EIOA 3VI5A 2HZFA 5EL8A 1VF3A 1BG5A 2LS5A 4HZ2A 1SL1B 3UJ1A 3Q18A 1K0AA 4EDYA 4KDYA 4ZIJA 3HKRA 3LYPA 1X9MB 2CT6A 2DIZA 5G1KA 3BBYA 1FW1A 3VI7A 3ZMKA 2RUFA 3KH7A 1HNBA 4Z2TA 4BVYB 2GZYA 4HQZA 1ERTA 3HA9A 1SYXA 1SD9A 3D5JA 1Z7PA 2N5FA 3KTBA 1JFUA 3DWVA 5ECNB 5D9WA 2HI7A 4NMUA 1GUKA 1YY7A 1MDIA 3EU3A 2GSQA 2H66A 4GF0A 4L5OA 4PX1A 3ISOA 4MMMA 4YQMA 2X8HA 5HR3A 3GUSA 4Q5NA 3Q6OA 3KCMA 4K7OA 4E8EA 1A23A 3M9KA 3LXZA 2XPEA 4L0WA 2A4HA 3M3MA 2MZCA 2AB6A 3LW9A 4GWRA 4IS0A 4IJIA 1GNEA 4DSSB 1XWAA 4ML1A 1TP9A 2QSIA 3I43A 2C8UA 5ECHB 3RBTA 3WGDA 3LEFA 4MP4A 2GSTA 5J3RA 2BMXA 3O76A 4EDZA 3FRCA 1M9AA 3KMNA 1SL2B 4QQ7A 1U3IA 4N10A 5JCUA 3E9JB 2VCZA 3F4SA 2HT9A 4HJMA 5ECKB 1GTAA 2HSHA 2LKUA 1H4OA 1TDIA 2HZEB 2OADA 4I2UA 1X5DA 3RHCA 3LSZA 1X5EA 3ZMLA 3GTUB 2P31A 3FZAA 22GSA 3ZREA 4FYCA 1F2EA 2FCHA 3RHBA 2AV4A 3PPUA 5JWOB 5F8BA 2I4AA 3UAPA 2VM1A 2B5YA 2CAIA 4XS4B 4GSNA 1B9YC 2JU5A 4F9ZA 5HR1A 3E3EA 4EF0A 4MJCA 5ELAA 4K7NA 4N0VA 2H0GA 1J9BA 2DC5A 4TR1A 3LORA 2YZUA 2WULA 1HNCA 3H4KA 3UOMA 4HDEA 4IBPA 2WRTA 2YN1A 4ILFA 2NBSA 4KA0A 2B6MA 2RIIA 2GTUA 1XBSA 5IMDA 1QUWA 3ZLPA 1M0UA 5F0GA 3EC3A 4MZBA 2YWMA 3L9UA 2LNTA 2MMOA 5G1LA 1YJ6A 1M2DA 1M3IA 1EV4A 3QPMA 3KIJA 4USSA 3GN3A 5DCGA 4I6XA 4FYUA 2DMMA 2V1MA 3IAM2 2E2GA 4ECCA 4IKHA 4MLYA 3FK8A 4A5PA 3GH6A 4WKWA 4Z7XA 5DQYA 2DJJA 2DKHA 3D4MA 4XHMA 3EPTA 4L8EA 3TJGA 1T7PB 5DALB 1K3YA 3IE3A 4FIWA 1UA5A 3PH9A 5IM9A 1AXDA 2H1BA 3QR6A 3UBLA 5AISA 4PQIA 1M2BA 3D21A 3TKSA 3KZQA 3ERGA 2IMFA 2L6DA 2C1YA 4I97A 2VUPA 1EGRA 1BYEA 4JBBA 2IIYA 2TRXA 3TRQA 1PD21 4J2FA 2GSSA 3WGEA 1Z3EA 3E0UA 1GP1A 2ZCTA 4P3YB 1XW5A 3DIEA 4RUVA 1OE8A 5G5FA 4EVMA 2B7KA 2HRAA 1DE1A 2X4AA 2VL2A 2H70A 1FVJA 2D2ZA 4ULXA 4KUNA 2WJUA 4DSQA 3BJ5A 5EVOA 1B8XA 1YEPA 5D73A 4DSSA 1R26A 4KSOA 1SYRA 3TJJA 5CAXA 1WRYA 3QCPA 4YKFA 5J5NA 3BOAA 2O8VB 3R3EA 3LWAA 5C00A 1QFNA 1GLQA 1TRVA 1K0CA 5LCZA 2X8GA 1AUCA 2YZHA 2M72A 5KN0A 2RM6A 4POBA 4V1Ag 11GSA 1USBA 4MJAA 3C8EA 1YQ1A 3HVNA 4V2MA 4OFMA 1EZKA 2B5EA 3DMLA 2FA8A 1K0NA 2IPAA 2PVOC 3C71A 2V41A 1E6BA 3W8JA 3KP8A 4JRRA 5JCWA 1KBNA 4KGIA 2HYXA 3IV4A 2PPTA 4GSSA 1OAZA 3N9JA 3M1GA 3G9BA 2WDUA 4IELA 5IQYA 1LU4A 4KF9A 3WYWA 4JR6A 2UZ8A 3J7Yb 4KW6A 1E2YA 1GTUA 3ERWA 1RQMA 2V6KA 3A5IA 1T4ZA 1B4PA 3F6FA 4KSMA 14GSA 2TIRA 3LG6A 5CNWA 3WT2A 3GH9A 5LNKe 1ON4A 4XS1A 3TGZA 4TR0A 3Q19A 5GAPD 2VAFA 1H75A 2ON7A 1ZL9A 3VWXA 1XWCA 3D0ZA 3CSIA 12GSA 3C73A 3HJMA 3I9V2 2QGVA 1U3AA 1JZDA 4AJ8A 3UBKA 3P90A 1WJKA 1TRSA 3VFIA 3GKNA 2IMKA 3F63A 1OE7A 2YPMA 3F6DA 2C3QA 19GSA 4N0ZA 4K1FA 4ECJA 4NV5A 2JSYA 1OVNA 3CQFA 3MSZA 3QAGA 1OC3A 3NIVA 4OCFA 5E4WA 1A0FA 4K7IA 2IMDA 2CVDA 4RI6A 4E8HA 3GMFA 3KXOA 1R5AA 3D4TA 5DALA 7GSSA 5B8AA 4BVXA 1NHOA 3TJFA 2F8FA 1T8EB 1C72A 4YQUA 1WMJA 4J57E 4LLRA 3H1NA 2IMEA 4ID0A 3LJRA 1GH2A 1CQGA 4PUAA 3K8NA 4HSCX 4MABA 4F0CA 1PFOA 1TXXA 2YWIA 4XCSA 2NVLA 3ZIJA 4HS1A 2BJXA 4OO4A 2K18A 3IRAA 1MDJA 1NSWA 3FZ4A 5A5KA 4MZWA 1F6MC 4O5RA 1LBKA 5FHIA 4PQ1A 2GZPA 3HZ4A 3IR4A 5B7CA 3KH9A 2I1UA 1DUGA 4CY8A 1HNAA 1QGVA 3GURA 3TKRA 4IHUA 4G0KA 1PQNA 2FHEA 4ZBBA 4ISDA 3UVTA 3MWHA 2H0HA 1WP0A 4ECBA 2LQOA 3H93A 3BD2A 2WZ9A 3TOUA 2JSZA 4K2XA 1BX9A 3EU4A 3EWLA 1ZGNA 1PMTA 4ML6A 4EKZA 1HQOA 2R6KA 5ECMB 2FWGA 4NHWA 4V2NA 3KMOA 3KTLA 1JLVA 5AIXA 1ABAA 5H5QA 1YF0A 4IVFA 1NM3A 1GSSA 2KP2A 10GSA 2VCWA 4POMA 5FT3A 1M99A 3O6TA 3QD9A 1WPIA 2LV3A 4ZL9A 3GKMA 5IMCA 2JL4A 1JLWA 1SJZA 1V58A 1TU7A 1O8WA 2LJRA 4EL1A 4KAEA 1S3AA 5KOWA 2DJ1A 4OCEA 6GSYA 3RPNA 2GGTA 1PKZA 3GIXA 1AW9A 3FZ9A 1CQHA 3FKFA 1A2MA 4MF5A 4EO3A 5DDLA 1FG4A 4PXOA 1Z6MA 3LYKA 3F3RA 4ZBAA 5A4UA 1PL2A 4BWQA 3DXBA 5IPHA 2CAQA 4TXOA 1T4YA 2PVQA 2HRFA 18GSA 1QK8A 2FLSA 5CRGA 2FGXA 2GVPA 1ERVA 4IP1A 1NW2A 5HQPA 3R2QA 2GT6A 2PMTA 2I9HA 1GSEA 2HLSA 2LSTA 2L59A 4KX4A 2PN8A 2IN3A 2H6YA 3KEBA 5J4UA 1X9SB 4BWSA 2O89A 2CZ3A 4Z2UA 2YJHA 1OKDA 2X64A 1V40A 3VWUA 3QAVA 2A4VA 3F9UA 3G7IA 1S3DA 2HE3A 3CMIA 3US3A 1WE0A 4WBRD 4ACSA 5B6MA 2F51A 3GKXA 3GSTA 1PL1A 5BRTA 3CSJA 3F0IA 2F3MA 2PGTA 3HJPA 5IOWA 2MMZA 3M8NA 4MPFA 2H72A 3VPQA 1J08A 4WF4A 1XG8A 2R0GA 1WWJA 2GQKA 1YKCA 4MA9A 1OC9B 1T1VA 2IL3A 3KD0A 2FUG2 2KP1A 3HCZA 4JU5A 2A2SA 3HJOA 2FNOA 3QFAC 4HJ2A 2VD1A 3C7MA 5IPGA 3DVWA 3ZITA 3AY8A 1U6TA 4EXJA 2EC4A 4PTSA 5ID2B 5KN2A 4CY6A 4K5SA 3APOA 4CHSA 1UN2A 1J0FA 5HR0A 3DVXA 2HSYA 1B48A 2N5BA 2QA1A 3GSSA 2H1GA 2IFQA 3O3TA 4XRAA 1F37A 2ES7A 3EVIA 4BPYA 5D9VA 2C4JA 4D73B 1GUHA 3ZFLA 1QQ2A 3LFLA 1Y6EA 2O87A 1XVWA 1M9BA 1G6YA 4J56E 2B1KA 17GSA 1M7TA 4HEA2 4ZB6A 1V2AA 3SWLA 5A4WA 3GNJA 3QMXA 1SD8A 1X9WB 3CRTA 2VLTA 4F03A 5C04A 4ICYA 4WBJA 2R0CA 1K0DA 2K8VA 2AJQB 4L5LA 2LJAA 4KCEA 2ZNMA 3J7Yk 2H8LA 2DJ0A 2FA4A 4BVYA 1M3JA 2DJ3A 5J9CA 2M80A 1WOUA 5F05A 1ML6A 1VGLA 2PBJA 3A2VA 1GSDA 2CV4A 5ELGA 2PU9C 2FD3A 1ZCPA 1EOGA 3IOSA 4TR3A 3UMAA 1DBYA 2H30A 5D96A 4KCAA 1VF4A 5G5EA 3PGTA 3TKPA 1S3CA 1N8JA 2HSMA 2JZTA 4G9HA 1OKTA 5IO2A 1SJIA 5CRDA 4PNFA 2DIYA 3SBCA 3DD3A 5CYYA 5G31A 1A2LA 2GDRA 2C3NA 2WCIA 4BA7A 2PUKC 4KDXA 3IC8A 5CRWA 1PN0A 1EGOA 2AUVA 2ZUPA 3IC4A 4HU7A 3EURA 3CYNA 4H86A 3UARA 2C0GA 1A2JA 5D8IA 3WT1A 4O5UA 2RM5A 1THOA 1VF2A 1W89A 2LEGA 4MH2A 1WIKA 3FR9A 3FHKA 4BIKA 3W8SA 2J23A 3V1WA 2KUCA 4K8MA 4KH7A 4HI7A 5ECIB 2EIRA 5IMFA 1XWKA 3MNGA 2HZEA 1OC8A 3IA1A 3GYKA 4NWYA 3GTUA 5GSSA 6GSTA 1GUMA 3U6VA 5G2ZA 1XW6A 4AJ6A 1TK8B 1PA3A 4ZB9A 4XIHA 5B8BA 1Q4JA 2A2PA 4LA1A 1ZYPA 3A3TA 2NTOA 1SKWB 2FWHA 4GLTA 4X0XA 4XS4A 1B9XC 2DJKA 1BQ7A 1O8XA 2IJYA 4LL4B 1ZZYA 1IYIA 3GKKA 1KEBA 1MD4A 3RDWA 4OFNA 4FQUA 3VLNA 1OC9A 3VURA 2P0GA 5IO0A 1PKWA 1ZMAA 4I8BA 2WFCA 5AN1A 1MEKA 2H1DA 1GRXA 3GRXA 2B3SA 4IW9A 3QOUA 3KP9A 2L5LA 2E2MA 2PERA 4JZQA 4XTSA 3GX0A 2OBIA 4HZ4A 3ZIVA 1EV9A 3D22A 2NDOA 4GTUA 3KGKA 4I5QA 4JEDA 4DEJA 2O7KA 2QKEA 1Z6NA 4IJ3A 4D73A 3L9SA 5D93A 1ZYEA 2E0QA 3D6IA 6GSUA 4IQ1A 1GULA 1PX7A 2BTOT 1YKAA 4XRDA 5JWQB 2DJ2A 2H19A 3HDCA
chains in the Genus database with same CATH topology
5HFIA 1XFLA 3N5OA 4RQRA 2AYTA 2WS2A 1LJRA 2XBQA 4GQFA 2XBIA 2L4CA 1XOAA 1Z7RA 1SJ6A 4BL7B 1YZXA 5ABRA 2I81A 3QAWA 5G30A 2I3YA 2HNLA 4LMWA 4EIPA 3GHAA 1YEXA 8GSSA 2DMLA 3G7JA 2GSRA 3P8WA 4AF2A 4HQSA 1TK5B 1PSQA 4G10A 4EC0A 3APSA 4Q5FA 1FHEA 2OE1A 4ZBDA 5J41A 4DSRA 3EYTA 1T00A 4CDOA 2VIMA 2KHPA 2ON5A 4EIQA 3CRUA 1MTCA 4F0BA 4LMVA 4ZL7A 2IMIA 4RQXA 2VM2A 1Y25A 1ERUA 1XOBA 4NHZA 5DAKB 5LD0A 4K6XA 3DEXA 2KLXA 2L4QA 2VD0A 2X8CA 2AAWA 5COHA 2H73A 4WXTA 1JZRA 4HOJA 5DVBA 2VLVA 5CREA 2G0FA 1ERWA 1EP7A 1JZWA 3VK9A 5GZZB 5GAND 4O5QA 2EIQA 2YJ7A 4POLA 3EINA 3FY7A 5DCHA 5L71A 6GSXA 4XS6A 2NPBA 4TKYA 1GSUA 3A2XA 2C80A 5E59A 3ZZXA 2P5RA 4OMVA 1TI1A 5DJMA 3TJKA 2JZSA 4G2EA 3ED3A 2B1LA 2X49A 4F2IA 4MF6A 3CXGA 4PURA 2OJLA 4GRFA 1F3BA 2H1AA 1F3AA 1N2AA 1BEDA 3WGXA 1W4VA 2V6OA 5DJLA 3MYDA 2YWNA 1V9WA 3M9JA 2K6VA 2C0FA 1OYJA 1ZYNA 2OE3A 2LTKA 3C1SA 2FWFA 2R5GA 1GWCA 5J9BA 5ECLB 3IK9A 2L57A 2GQMA 3TJBA 4YAPA 2OACA 4IQAA 4NV2A 4K9ZA 2ALBA 2K9FA 1AQWA 1MDKA 2V2GA 3FEUA 9GSSA 1FAAA 4TOPA 3F4RA 4MJEA 2R2JA 3EMPA 4X43A 4G19A 2YOIA 3S9FA 1Z5YE 1FVKA 1U88A 1AQVA 1R4WA 3IK7A 4FH8A 3CTFA 4IGJA 5ENUA 3GX8A 3VWWA 2R37A 1B4QA 4HUAA 1HYUA 4KB3A 5IMZA 3BCKA 5DBQA 2H76A 2DSAA 4ECIA 2P5QA 4EUYA 4WR4A 4QL9A 1FOHA 5HFGA 1EP8A 5ECOB 3L78A 5CP1A 1SL0B 1I5GA 4Q5RA 2M46A 2VOCA 3H8QA 4TXVA 2B5XA 3KJYA 2PWJA 1FOVA 4NAXA 3DYRA 3EE2A 2DBCA 5AGYA 3HHVA 1SU9A 2FWEA 1SK1A 3QFBC 2MBSA 3CSHA 3OR5A 4WETA 3F4TA 4OWYA 3JCML 3ZL5A 4PGTA 2GQLA 1XXUA 4GCIA 4BL7A 1XWBA 3TKSC 2VL9A 1BJXA 2MMNA 1A24A 2CVKA 2C0EA 1O73A 5EY6A 4GQCA 6GSVA 1RK4A 3IAS2 1PX6A 2J9HA 1GSQA 3A2WA 2YCDA 2F8AA 2XC2A 3GA4A 1Q98A 4IN0A 1GTBA 4MJBA 2YWOA 4N11A 4DVCA 1K3OA 1SK0A 3IPZA 5JWRB 5ECRB 1EOHA 1TRWA 1GTIA 3UL3A 2VL2C 3HVVA 1G6WA 4MNNA 4RI7A 3U5RE 1A8YA 2O85A 3HVSA 4MPGA 3ZVJA 1DE2A 1GLPA 4K0GA 1M2AA 3CTGA 2JZRA 3BCIA 5DAKA 3ME8A 1K0MA 2JADA 2HFDA 1TJDA 1XZOA 1XW9A 3APQA 3FW2A 4YKGA 4YH2A 3IXRA 5D9XA 3L4NA 4ZXGA 3F3QA 1X0RA 3TCOA 2VL3A 3HY2A 3NOFA 2GT5A 3MIXA 2DLXA 5H5SA 1O6JA 2KOKA 1GSFA 1ACVA 4I2TA 4TRXA 3TKSE 2R0PA 2DKIA 1U87A 3P7XA 4FO5A 5KN3A 1SKSB 2YV9A 2CZ2A 4K0NA 5F06A 2XPDA 3TRXA 3LXTA 2VO4A 2LJKA 1ZYQB 2HRKA 4POKA 5DQSA 4O32A 1TOFA 5IOXA 2CQ9A 3W6GA 3PINA 2H0IA 1UC7A 4BVXB 1FB0A 1YF1A 1F9MA 4MK3A 3FYGA 5CO3A 3NZNA 3HXSA 1G7OA 4EE0A 4MCUA 1UVZA 4X1UA 2R3XA 4TVEA 5HR2A 4AJ7A 1X5CA 4L0UA 2WB9A 3LQ7A 1DSBA 2VCXA 1GL8A 2LQQA 1KTEA 4KDUA 3M0FA 2YNXA 2YV7A 2L5OA 4YAVA 4O92A 1ILOA 1RW1A 4NXIA 3GL3A 1XIYA 16GSA 1AQXA 3DKSA 3LGCA 1PN9A 1K0BA 1A0RP 1O7UA 3HYPA 4MH3A 3A5WA 2RLIA 3GV1A 2AHEA 2JACA 1EEMA 1V57A 3ZVJD 4CW9A 2TRCP 20GSA 3DGQA 1G0TA 1TTZA 1TU8A 1JZOA 1TRUA 3HZ8A 3IHQA 1AAZA 2F9SA 4V2LA 2GLRA 2REMA 1TKDB 3IDVA 4GSTA 3DRNA 2MBTA 3IHGA 1THXA 3MAKA 1VRSD 2N5AA 2CX4A 1PRXA 3Q74A 6GSSA 4K5RA 2G2QA 4MDCA 2QC7A 1MD3A 5JCGA 4ZILA 3ERFA 4LL1B 2XHFA 4TN8A 2H71A 3HVXA 1NHYA 3P2AA 3EMXA 1QXHA 1BAYA 2MYGA 3TRPA 3CBUA 1XWGA 2X99A 3RAZA 5INYA 2H6XA 2H01A 1O81A 3FMWA 1GSYA 4Z2RA 2WGRA 1TK0B 2FY6A 4HU9A 3ME7A 4AGSA 5EPFA 2B7JA 1I9DA 3L0HA 4V1Ap 1QMVA 5IMAA 4G0IA 3RPPA 5GSTA 1FB6A 5KN1A 4TW5A 1K0OA 2QA2A 3VPTA 3UVHA 2CA8A 2R4VA 3H79A 4QL7A 3VWVA 3GFKA 2CVBA 4WR5A 2RUEA 4OFTA 4WF5A 6GSWA 2VCQA 3ZYWA 1R5PA 2VCVA 3C1RA 1SENA 5KOXA 5ID2A 3HD5A 4TXOB 3FR6A 3I69A 4ZL8A 1VF1A 4X4JA 2OA7A 5F07A 1TW9A 3QDNA 1SK2A 4MZCA 4IP6A 1TI3A 4OD7A 1AIUA 4YQVA 4NPBA 4KNDA 4OO5A 2A2RA 2H6ZA 2LUSA 2MMAA 5BMUA 3UIWA 3ZFBA 1AC1A 3GL5A 4JE1A 1T3BA 1ZOFA 3UEMA 3MDKA 3I6AA 5IMVA 3FR3A 2LRTA 5B6NA 1KNGA 4TR4A 2VLUA 4ZB8A 3TOTA 2H74A 1G7EA 4F82A 4PUFC 2YANA 2CX3A 2OE0A 3G7YA 4GXZA 2IWTA 1SKRB 2K8SA 2H75A 2E7PA 1PGTA 2LNSA 2OKAA 1K3LA 4N30A 4PQHA 1O85A 1XVQA 3ZTLA 5KEJA 2Z9SA 2GZZA 3ZRDA 4O7HA 5CRHA 2GS3A 1EWXA 2LRNA 2YP6A 3L9VA 5ECQB 1JHBA 4TR1B 3TDGA 3TKQA 4G0LA 2HRNA 1XPVA 5ECSA 1EEJA 1Z9HA 1ST9A 3TB2A 3FZ5A 3PR8A 4KE3A 3TUEA 2V32A 1A8LA 5AIVA 1R7HA 13GSA 2LRCA 2HXKA 4MF7A 5ECPB 3IBHA 1YDKA 1URMA 5HFKA 1GNWA 5FWGA 5H5RA 4JR4A 4FYBA 2IFQB 5IIZA 2VCTA 5D9TA 4WEYA 3KM6A 1XCCA 4PNGA 2C0DA 1FO5A 5A4VA 4K2DA 3WD6A 1V98A 3F8UA 2L6CA 4Q5QA 1HD2A 2OBKA 1IYHA 2C3TA 2EIOA 3VI5A 2HZFA 5EL8A 1VF3A 1BG5A 2LS5A 4HZ2A 1SL1B 3UJ1A 3Q18A 1K0AA 4EDYA 4KDYA 4ZIJA 3HKRA 3LYPA 1X9MB 2CT6A 2DIZA 5G1KA 3BBYA 1FW1A 3VI7A 3ZMKA 2RUFA 3KH7A 1HNBA 4Z2TA 4BVYB 2GZYA 4HQZA 1ERTA 3HA9A 1SYXA 1SD9A 3D5JA 1Z7PA 2N5FA 3KTBA 1JFUA 3DWVA 5ECNB 5D9WA 2HI7A 4NMUA 1GUKA 1YY7A 1MDIA 3EU3A 2GSQA 2H66A 4GF0A 4L5OA 4PX1A 3ISOA 4MMMA 4YQMA 2X8HA 5HR3A 3GUSA 4Q5NA 3Q6OA 3KCMA 4K7OA 4E8EA 1A23A 3M9KA 3LXZA 2XPEA 4L0WA 2A4HA 3M3MA 2MZCA 2AB6A 3LW9A 4GWRA 4IS0A 4IJIA 1GNEA 4DSSB 1XWAA 4ML1A 1TP9A 2QSIA 3I43A 2C8UA 5ECHB 3RBTA 3WGDA 3LEFA 4MP4A 2GSTA 5J3RA 2BMXA 3O76A 4EDZA 3FRCA 1M9AA 3KMNA 1SL2B 4QQ7A 1U3IA 4N10A 5JCUA 3E9JB 2VCZA 3F4SA 2HT9A 4HJMA 5ECKB 1GTAA 2HSHA 2LKUA 1H4OA 1TDIA 2HZEB 2OADA 4I2UA 1X5DA 3RHCA 3LSZA 1X5EA 3ZMLA 3GTUB 2P31A 3FZAA 22GSA 3ZREA 4FYCA 1F2EA 2FCHA 3RHBA 2AV4A 3PPUA 5JWOB 5F8BA 2I4AA 3UAPA 2VM1A 2B5YA 2CAIA 4XS4B 4GSNA 1B9YC 2JU5A 4F9ZA 5HR1A 3E3EA 4EF0A 4MJCA 5ELAA 4K7NA 4N0VA 2H0GA 1J9BA 2DC5A 4TR1A 3LORA 2YZUA 2WULA 1HNCA 3H4KA 3UOMA 4HDEA 4IBPA 2WRTA 2YN1A 4ILFA 2NBSA 4KA0A 2B6MA 2RIIA 2GTUA 1XBSA 5IMDA 1QUWA 3ZLPA 1M0UA 5F0GA 3EC3A 4MZBA 2YWMA 3L9UA 2LNTA 2MMOA 5G1LA 1YJ6A 1M2DA 1EV4A 3QPMA 3KIJA 4USSA 3GN3A 5DCGA 4I6XA 4FYUA 2DMMA 2V1MA 3IAM2 2E2GA 4ECCA 4IKHA 4MLYA 3FK8A 4A5PA 3GH6A 4WKWA 4Z7XA 5DQYA 2DJJA 2DKHA 3D4MA 4XHMA 3EPTA 4L8EA 3TJGA 1T7PB 5DALB 1K3YA 3IE3A 4FIWA 1UA5A 3PH9A 5IM9A 1AXDA 2H1BA 3QR6A 3UBLA 5AISA 4PQIA 1M2BA 3D21A 3TKSA 3KZQA 3ERGA 2IMFA 2L6DA 2C1YA 4I97A 2VUPA 1EGRA 1BYEA 4JBBA 2IIYA 2TRXA 3TRQA 1PD21 4J2FA 2GSSA 3WGEA 1Z3EA 3E0UA 1GP1A 2ZCTA 4P3YB 1XW5A 3DIEA 4RUVA 1OE8A 5G5FA 4EVMA 2B7KA 2HRAA 1DE1A 2X4AA 2VL2A 2H70A 1FVJA 2D2ZA 4ULXA 4KUNA 2WJUA 4DSQA 3BJ5A 5EVOA 1B8XA 1YEPA 5D73A 4DSSA 1R26A 4KSOA 1SYRA 3TJJA 5CAXA 1WRYA 3QCPA 4YKFA 5J5NA 3BOAA 2O8VB 3R3EA 3LWAA 5C00A 1QFNA 1GLQA 1TRVA 1K0CA 5LCZA 2X8GA 1AUCA 2YZHA 2M72A 5KN0A 2RM6A 4POBA 4V1Ag 11GSA 1USBA 4MJAA 3C8EA 1YQ1A 4V2MA 4OFMA 1EZKA 2B5EA 3DMLA 2FA8A 1K0NA 2IPAA 2PVOC 3C71A 2V41A 1E6BA 3W8JA 3KP8A 4JRRA 5JCWA 1KBNA 4KGIA 2HYXA 3IV4A 2PPTA 4GSSA 1OAZA 3N9JA 3M1GA 3G9BA 2WDUA 4IELA 5IQYA 1LU4A 4KF9A 3WYWA 4JR6A 2UZ8A 3J7Yb 4KW6A 1E2YA 1GTUA 3ERWA 1RQMA 2V6KA 3A5IA 1T4ZA 1B4PA 3F6FA 4KSMA 14GSA 2TIRA 3LG6A 5CNWA 3WT2A 3GH9A 5LNKe 1ON4A 4XS1A 3TGZA 4TR0A 3Q19A 5GAPD 2VAFA 1H75A 2ON7A 1ZL9A 3VWXA 1XWCA 3D0ZA 3CSIA 12GSA 3C73A 3HJMA 3I9V2 2QGVA 1U3AA 1JZDA 4AJ8A 3UBKA 3P90A 1WJKA 1TRSA 3VFIA 3GKNA 2IMKA 3F63A 1OE7A 2YPMA 3F6DA 2C3QA 19GSA 4N0ZA 4K1FA 4ECJA 4NV5A 2JSYA 1OVNA 3MSZA 3QAGA 1OC3A 3NIVA 4OCFA 5E4WA 1A0FA 4K7IA 2IMDA 2CVDA 4RI6A 4E8HA 3GMFA 3KXOA 1R5AA 3D4TA 5DALA 7GSSA 5B8AA 4BVXA 1NHOA 3TJFA 2F8FA 1T8EB 1C72A 4YQUA 1WMJA 4J57E 4LLRA 3H1NA 2IMEA 4ID0A 3LJRA 1GH2A 1CQGA 4PUAA 3K8NA 4MABA 4F0CA 1TXXA 2YWIA 4XCSA 2NVLA 3ZIJA 4HS1A 2BJXA 4OO4A 2K18A 3IRAA 1MDJA 1NSWA 3FZ4A 5A5KA 4MZWA 1F6MC 4O5RA 1LBKA 5FHIA 4PQ1A 2GZPA 3HZ4A 3IR4A 5B7CA 3KH9A 2I1UA 1DUGA 4CY8A 1HNAA 1QGVA 3GURA 3TKRA 4IHUA 4G0KA 1PQNA 2FHEA 4ZBBA 4ISDA 3UVTA 3MWHA 2H0HA 1WP0A 4ECBA 2LQOA 3H93A 3BD2A 2WZ9A 3TOUA 2JSZA 4K2XA 1BX9A 3EU4A 3EWLA 1ZGNA 1PMTA 4ML6A 4EKZA 1HQOA 2R6KA 5ECMB 2FWGA 4NHWA 4V2NA 3KMOA 3KTLA 1JLVA 5AIXA 1ABAA 5H5QA 1YF0A 4IVFA 1NM3A 1GSSA 2KP2A 10GSA 2VCWA 4POMA 5FT3A 1M99A 3O6TA 3QD9A 1WPIA 2LV3A 4ZL9A 3GKMA 5IMCA 2JL4A 1JLWA 1SJZA 1V58A 1TU7A 1O8WA 2LJRA 4EL1A 4KAEA 1S3AA 5KOWA 2DJ1A 4OCEA 6GSYA 3RPNA 2GGTA 1PKZA 3GIXA 1AW9A 3FZ9A 1CQHA 3FKFA 1A2MA 4MF5A 4EO3A 5DDLA 1FG4A 4PXOA 1Z6MA 3LYKA 3F3RA 4ZBAA 5A4UA 1PL2A 4BWQA 3DXBA 5IPHA 2CAQA 4TXOA 1T4YA 2PVQA 2HRFA 18GSA 1QK8A 2FLSA 5CRGA 2FGXA 2GVPA 1ERVA 4IP1A 1NW2A 5HQPA 3R2QA 2GT6A 2PMTA 2I9HA 1GSEA 2HLSA 2LSTA 2L59A 4KX4A 2PN8A 2IN3A 2H6YA 3KEBA 5J4UA 1X9SB 4BWSA 2O89A 2CZ3A 4Z2UA 2YJHA 1OKDA 2X64A 1V40A 3VWUA 3QAVA 2A4VA 3F9UA 3G7IA 1S3DA 2HE3A 3CMIA 3US3A 1WE0A 4WBRD 4ACSA 5B6MA 2F51A 3GKXA 3GSTA 1PL1A 5BRTA 3CSJA 3F0IA 2F3MA 2PGTA 3HJPA 5IOWA 2MMZA 3M8NA 4MPFA 2H72A 3VPQA 1J08A 4WF4A 2R0GA 1WWJA 2GQKA 1YKCA 4MA9A 1OC9B 1T1VA 2IL3A 3KD0A 2FUG2 2KP1A 3HCZA 4JU5A 2A2SA 3HJOA 2FNOA 3QFAC 4HJ2A 2VD1A 3C7MA 5IPGA 3DVWA 3ZITA 3AY8A 1U6TA 4EXJA 2EC4A 4PTSA 5ID2B 5KN2A 4CY6A 4K5SA 3APOA 4CHSA 1UN2A 1J0FA 5HR0A 3DVXA 2HSYA 1B48A 2N5BA 2QA1A 3GSSA 2H1GA 2IFQA 3O3TA 4XRAA 1F37A 2ES7A 3EVIA 4BPYA 5D9VA 2C4JA 4D73B 1GUHA 3ZFLA 1QQ2A 3LFLA 1Y6EA 2O87A 1XVWA 1M9BA 1G6YA 4J56E 2B1KA 17GSA 1M7TA 4HEA2 4ZB6A 1V2AA 3SWLA 5A4WA 3GNJA 3QMXA 1SD8A 1X9WB 3CRTA 2VLTA 4F03A 5C04A 4ICYA 4WBJA 2R0CA 1K0DA 2K8VA 2AJQB 4L5LA 2LJAA 4KCEA 2ZNMA 3J7Yk 2H8LA 2DJ0A 2FA4A 4BVYA 2DJ3A 5J9CA 2M80A 1WOUA 5F05A 1ML6A 1VGLA 2PBJA 3A2VA 1GSDA 2CV4A 5ELGA 2PU9C 2FD3A 1ZCPA 1EOGA 3IOSA 4TR3A 3UMAA 1DBYA 2H30A 5D96A 4KCAA 1VF4A 5G5EA 3PGTA 3TKPA 1S3CA 1N8JA 2HSMA 2JZTA 4G9HA 1OKTA 5IO2A 1SJIA 5CRDA 4PNFA 2DIYA 3SBCA 3DD3A 5CYYA 5G31A 1A2LA 2GDRA 2C3NA 2WCIA 4BA7A 2PUKC 4KDXA 3IC8A 5CRWA 1PN0A 1EGOA 2AUVA 2ZUPA 3IC4A 4HU7A 3EURA 3CYNA 4H86A 3UARA 2C0GA 1A2JA 5D8IA 3WT1A 4O5UA 2RM5A 1THOA 1VF2A 1W89A 2LEGA 4MH2A 1WIKA 3FR9A 3FHKA 3W8SA 2J23A 3V1WA 2KUCA 4K8MA 4KH7A 4HI7A 5ECIB 2EIRA 5IMFA 1XWKA 3MNGA 2HZEA 1OC8A 3IA1A 3GYKA 4NWYA 3GTUA 5GSSA 6GSTA 1GUMA 3U6VA 5G2ZA 1XW6A 4AJ6A 1TK8B 1PA3A 4ZB9A 4XIHA 5B8BA 1Q4JA 2A2PA 4LA1A 1ZYPA 3A3TA 2NTOA 1SKWB 2FWHA 4GLTA 4X0XA 4XS4A 1B9XC 2DJKA 1BQ7A 1O8XA 2IJYA 4LL4B 1ZZYA 1IYIA 3GKKA 1KEBA 1MD4A 3RDWA 4OFNA 4FQUA 3VLNA 1OC9A 3VURA 2P0GA 5IO0A 1PKWA 1ZMAA 4I8BA 2WFCA 5AN1A 1MEKA 2H1DA 1GRXA 3GRXA 2B3SA 4IW9A 3QOUA 3KP9A 2L5LA 2E2MA 2PERA 4JZQA 4XTSA 3GX0A 2OBIA 4HZ4A 3ZIVA 1EV9A 3D22A 2NDOA 4GTUA 3KGKA 4I5QA 4JEDA 4DEJA 2O7KA 2QKEA 1Z6NA 4IJ3A 4D73A 3L9SA 5D93A 1ZYEA 2E0QA 3D6IA 6GSUA 4IQ1A 1GULA 1PX7A 2BTOT 1YKAA 4XRDA 5JWQB 2DJ2A 2H19A 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFI A;  1XFL A;  3N5O A;  4RQR A;  2AYT A;  2WS2 A;  1LJR A;  2XBQ A;  4GQF A;  2XBI A;  2L4C A;  1XOA A;  1Z7R A;  1SJ6 A;  1YZX A;  5ABR A;  2I81 A;  3QAW A;  5G30 A;  2I3Y A;  2HNL A;  4LMW A;  3GHA A;  1YEX A;  8GSS A;  2DML A;  3G7J A;  2GSR A;  3P8W A;  4AF2 A;  4HQS A;  1TK5 B;  1PSQ A;  4G10 A;  4EC0 A;  3APS A;  4Q5F A;  1FHE A;  2OE1 A;  4ZBD A;  5J41 A;  4DSR A;  3EYT A;  1T00 A;  4CDO A;  2VIM A;  2KHP A;  2ON5 A;  3CRU A;  1MTC A;  4F0B A;  4LMV A;  4ZL7 A;  2IMI A;  4RQX A;  2VM2 A;  1Y25 A;  1ERU A;  1XOB A;  4NHZ A;  5DAK B;  5LD0 A;  4K6X A;  3DEX A;  2KLX A;  2L4Q A;  2VD0 A;  2X8C A;  2AAW A;  5COH A;  2H73 A;  4WXT A;  1JZR A;  4HOJ A;  5DVB A;  2VLV A;  5CRE A;  2G0F A;  1ERW A;  1EP7 A;  1JZW A;  3VK9 A;  5GZZ B;  5GAN D;  2EIQ A;  2YJ7 A;  4POL A;  3EIN A;  3FY7 A;  5DCH A;  5L71 A;  6GSX A;  4XS6 A;  2NPB A;  4TKY A;  1GSU A;  3A2X A;  2C80 A;  5E59 A;  3ZZX A;  2P5R A;  4OMV A;  1TI1 A;  5DJM A;  3TJK A;  2JZS A;  4G2E A;  3ED3 A;  2B1L A;  4F2I A;  4MF6 A;  3CXG A;  4PUR A;  2OJL A;  4GRF A;  1F3B A;  2H1A A;  1F3A A;  1N2A A;  1BED A;  3WGX A;  1W4V A;  2V6O A;  5DJL A;  2YWN A;  1V9W A;  3M9J A;  2K6V A;  2C0F A;  1OYJ A;  2OE3 A;  2LTK A;  3C1S A;  2FWF A;  2R5G A;  1GWC A;  5J9B A;  5ECL B;  3IK9 A;  2L57 A;  2GQM A;  3TJB A;  4YAP A;  2OAC A;  4IQA A;  4NV2 A;  4K9Z A;  2ALB A;  2K9F A;  1AQW A;  1MDK A;  2V2G A;  3FEU A;  9GSS A;  1FAA A;  4TOP A;  3F4R A;  4MJE A;  2R2J A;  3EMP A;  4X43 A;  4G19 A;  2YOI A;  3S9F A;  1Z5Y E;  1FVK A;  1U88 A;  1AQV A;  1R4W A;  3IK7 A;  4FH8 A;  3CTF A;  4IGJ A;  5ENU A;  3GX8 A;  3VWW A;  2R37 A;  1B4Q A;  4HUA A;  1HYU A;  4KB3 A;  5IMZ A;  3BCK A;  5DBQ A;  2H76 A;  2DSA A;  4ECI A;  2P5Q A;  4EUY A;  4WR4 A;  4QL9 A;  5HFG A;  1EP8 A;  5ECO B;  3L78 A;  5CP1 A;  1SL0 B;  1I5G A;  4Q5R A;  2M46 A;  2VOC A;  3H8Q A;  4TXV A;  2B5X A;  3KJY A;  2PWJ A;  1FOV A;  4NAX A;  3DYR A;  3EE2 A;  2DBC A;  5AGY A;  3HHV A;  1SU9 A;  2FWE A;  1SK1 A;  3QFB C;  2MBS A;  3CSH A;  3OR5 A;  4WET A;  3F4T A;  4OWY A;  3JCM L;  3ZL5 A;  4PGT A;  2GQL A;  1XXU A;  4GCI A;  4BL7 A;  1XWB A;  3TKS C;  2VL9 A;  1BJX A;  2MMN A;  1A24 A;  2CVK A;  2C0E A;  1O73 A;  5EY6 A;  4GQC A;  6GSV A;  1RK4 A;  3IAS 2;  1PX6 A;  2J9H A;  1GSQ A;  3A2W A;  2YCD A;  2F8A A;  2XC2 A;  3GA4 A;  1Q98 A;  4IN0 A;  1GTB A;  4MJB A;  2YWO A;  4N11 A;  4DVC A;  1K3O A;  1SK0 A;  3IPZ A;  5JWR B;  5ECR B;  1EOH A;  1TRW A;  1GTI A;  3UL3 A;  2VL2 C;  3HVV A;  1G6W A;  4RI7 A;  3U5R E;  1A8Y A;  2O85 A;  3HVS A;  4MPG A;  3ZVJ A;  1DE2 A;  1GLP A;  4K0G A;  1M2A A;  3CTG A;  2JZR A;  3BCI A;  5DAK A;  3ME8 A;  1K0M A;  2JAD A;  2HFD A;  1TJD A;  1XZO A;  1XW9 A;  3APQ A;  3FW2 A;  4YH2 A;  3IXR A;  5D9X A;  3L4N A;  4ZXG A;  3F3Q A;  1X0R A;  3TCO A;  2VL3 A;  3HY2 A;  2GT5 A;  3NOF A;  2DLX A;  5H5S A;  1O6J A;  2KOK A;  1GSF A;  1ACV A;  4I2T A;  4TRX A;  3TKS E;  1U87 A;  3P7X A;  4FO5 A;  5KN3 A;  1SKS B;  2YV9 A;  2CZ2 A;  4K0N A;  5F06 A;  2XPD A;  3TRX A;  3LXT A;  2VO4 A;  2LJK A;  1ZYQ B;  4POK A;  5DQS A;  4O32 A;  1TOF A;  5IOX A;  2CQ9 A;  3W6G A;  3PIN A;  2H0I A;  1UC7 A;  1FB0 A;  1YF1 A;  1F9M A;  4MK3 A;  3FYG A;  5CO3 A;  3NZN A;  3HXS A;  1G7O A;  4EE0 A;  4MCU A;  1UVZ A;  4X1U A;  2R3X A;  4TVE A;  5HR2 A;  4AJ7 A;  1X5C A;  4L0U A;  2WB9 A;  3LQ7 A;  1DSB A;  2VCX A;  1GL8 A;  2LQQ A;  1KTE A;  4KDU A;  3M0F A;  2YNX A;  2YV7 A;  2L5O A;  4YAV A;  4O92 A;  1ILO A;  1RW1 A;  4NXI A;  3GL3 A;  1XIY A;  16GS A;  1AQX A;  3DKS A;  3LGC A;  1PN9 A;  1K0B A;  1A0R P;  1O7U A;  3HYP A;  4MH3 A;  3A5W A;  2RLI A;  3GV1 A;  2AHE A;  2JAC A;  1EEM A;  1V57 A;  3ZVJ D;  4CW9 A;  2TRC P;  20GS A;  3DGQ A;  1G0T A;  1TTZ A;  1TU8 A;  1JZO A;  1TRU A;  3HZ8 A;  3IHQ A;  1AAZ A;  2F9S A;  4V2L A;  2GLR A;  2REM A;  1TKD B;  3IDV A;  4GST A;  3DRN A;  2MBT A;  1THX A;  3MAK A;  1VRS D;  2N5A A;  2CX4 A;  1PRX A;  3Q74 A;  6GSS A;  2G2Q A;  4MDC A;  2QC7 A;  1MD3 A;  5JCG A;  4ZIL A;  3ERF A;  4LL1 B;  2XHF A;  4TN8 A;  2H71 A;  3HVX A;  1NHY A;  3P2A A;  3EMX A;  1QXH A;  1BAY A;  2MYG A;  3TRP A;  3CBU A;  1XWG A;  2X99 A;  3RAZ A;  5INY A;  2H6X A;  2H01 A;  1O81 A;  1GSY A;  2WGR A;  1TK0 B;  2FY6 A;  4HU9 A;  3ME7 A;  4AGS A;  5EPF A;  2B7J A;  1I9D A;  3L0H A;  4V1A p;  1QMV A;  5IMA A;  3RPP A;  5GST A;  1FB6 A;  5KN1 A;  4TW5 A;  1K0O A;  3VPT A;  3UVH A;  2CA8 A;  2R4V A;  3H79 A;  4QL7 A;  3VWV A;  3GFK A;  2CVB A;  4WR5 A;  2RUE A;  4OFT A;  4WF5 A;  6GSW A;  2VCQ A;  3ZYW A;  1R5P A;  2VCV A;  3C1R A;  1SEN A;  5ID2 A;  3HD5 A;  4TXO B;  3FR6 A;  3I69 A;  4ZL8 A;  1VF1 A;  2OA7 A;  5F07 A;  1TW9 A;  3QDN A;  1SK2 A;  4MZC A;  4IP6 A;  1TI3 A;  4OD7 A;  1AIU A;  4YQV A;  4NPB A;  4KND A;  4OO5 A;  2A2R A;  2H6Z A;  2LUS A;  2MMA A;  3UIW A;  3ZFB A;  1AC1 A;  3GL5 A;  4JE1 A;  1T3B A;  1ZOF A;  3UEM A;  3MDK A;  3I6A A;  5IMV A;  3FR3 A;  2LRT A;  5B6N A;  1KNG A;  4TR4 A;  2VLU A;  4ZB8 A;  3TOT A;  2H74 A;  1G7E A;  4F82 A;  4PUF C;  2YAN A;  2CX3 A;  2OE0 A;  3G7Y A;  4GXZ A;  2IWT A;  1SKR B;  2K8S A;  2H75 A;  2E7P A;  1PGT A;  2LNS A;  2OKA A;  1K3L A;  4N30 A;  4PQH A;  1O85 A;  1XVQ A;  3ZTL A;  5KEJ A;  2Z9S A;  2GZZ A;  3ZRD A;  4O7H A;  5CRH A;  2GS3 A;  1EWX A;  2LRN A;  2YP6 A;  3L9V A;  5ECQ B;  1JHB A;  4TR1 B;  3TDG A;  3TKQ A;  2HRN A;  1XPV A;  5ECS A;  1EEJ A;  1Z9H A;  1ST9 A;  3TB2 A;  3FZ5 A;  3PR8 A;  4KE3 A;  3TUE A;  2V32 A;  1A8L A;  5AIV A;  1R7H A;  13GS A;  2LRC A;  2HXK A;  4MF7 A;  5ECP B;  3IBH A;  1YDK A;  1URM A;  5HFK A;  1GNW A;  5FWG A;  5H5R A;  4JR4 A;  4FYB A;  2IFQ B;  5IIZ A;  2VCT A;  5D9T A;  4WEY A;  3KM6 A;  1XCC A;  4PNG A;  2C0D A;  1FO5 A;  5A4V A;  4K2D A;  3WD6 A;  1V98 A;  3F8U A;  2L6C A;  4Q5Q A;  1HD2 A;  2OBK A;  1IYH A;  2C3T A;  2EIO A;  3VI5 A;  2HZF A;  5EL8 A;  1VF3 A;  1BG5 A;  2LS5 A;  4HZ2 A;  1SL1 B;  3UJ1 A;  3Q18 A;  1K0A A;  4EDY A;  4KDY A;  4ZIJ A;  3HKR A;  3LYP A;  1X9M B;  2CT6 A;  2DIZ A;  5G1K A;  3BBY A;  1FW1 A;  3VI7 A;  3ZMK A;  2RUF A;  3KH7 A;  1HNB A;  2GZY A;  4HQZ A;  1ERT A;  3HA9 A;  1SYX A;  1SD9 A;  3D5J A;  1Z7P A;  2N5F A;  3KTB A;  1JFU A;  3DWV A;  5ECN B;  5D9W A;  2HI7 A;  4NMU A;  1GUK A;  1YY7 A;  1MDI A;  3EU3 A;  2GSQ A;  2H66 A;  4GF0 A;  4L5O A;  4PX1 A;  3ISO A;  4MMM A;  4YQM A;  2X8H A;  5HR3 A;  3GUS A;  4Q5N A;  3Q6O A;  3KCM A;  4K7O A;  4E8E A;  1A23 A;  3M9K A;  3LXZ A;  2XPE A;  4L0W A;  3M3M A;  2MZC A;  2AB6 A;  4GWR A;  4IS0 A;  4IJI A;  1GNE A;  4DSS B;  1XWA A;  4ML1 A;  1TP9 A;  2QSI A;  3I43 A;  2C8U A;  5ECH B;  3RBT A;  3WGD A;  3LEF A;  4MP4 A;  2GST A;  5J3R A;  2BMX A;  3O76 A;  4EDZ A;  3FRC A;  1M9A A;  3KMN A;  1SL2 B;  4QQ7 A;  1U3I A;  4N10 A;  5JCU A;  3E9J B;  2VCZ A;  3F4S A;  2HT9 A;  4HJM A;  5ECK B;  1GTA A;  2HSH A;  2LKU A;  1H4O A;  1TDI A;  2HZE B;  2OAD A;  4I2U A;  1X5D A;  3RHC A;  3LSZ A;  1X5E A;  3ZML A;  3GTU B;  2P31 A;  3FZA A;  22GS A;  3ZRE A;  4FYC A;  1F2E A;  2FCH A;  3RHB A;  2AV4 A;  5JWO B;  5F8B A;  2I4A A;  3UAP A;  2VM1 A;  2B5Y A;  2CAI A;  4XS4 B;  4GSN A;  1B9Y C;  2JU5 A;  4F9Z A;  5HR1 A;  3E3E A;  4EF0 A;  4MJC A;  5ELA A;  4K7N A;  4N0V A;  2H0G A;  1J9B A;  2DC5 A;  4TR1 A;  3LOR A;  2YZU A;  2WUL A;  1HNC A;  3H4K A;  3UOM A;  4HDE A;  4IBP A;  2WRT A;  2YN1 A;  4ILF A;  2NBS A;  4KA0 A;  2B6M A;  2RII A;  2GTU A;  1XBS A;  5IMD A;  1QUW A;  3ZLP A;  1M0U A;  5F0G A;  3EC3 A;  4MZB A;  2YWM A;  3L9U A;  2LNT A;  2MMO A;  5G1L A;  1YJ6 A;  1M2D A;  1EV4 A;  3QPM A;  3KIJ A;  3GN3 A;  5DCG A;  4I6X A;  4FYU A;  2DMM A;  2V1M A;  3IAM 2;  2E2G A;  4ECC A;  4IKH A;  4MLY A;  3FK8 A;  3GH6 A;  4WKW A;  4Z7X A;  5DQY A;  2DJJ A;  3D4M A;  4XHM A;  1T7P B;  4L8E A;  3TJG A;  5DAL B;  1K3Y A;  3IE3 A;  4FIW A;  1UA5 A;  3PH9 A;  5IM9 A;  1AXD A;  2H1B A;  3QR6 A;  3UBL A;  5AIS A;  4PQI A;  1M2B A;  3D21 A;  3TKS A;  3KZQ A;  3ERG A;  2IMF A;  2L6D A;  2C1Y A;  4I97 A;  2VUP A;  1EGR A;  1BYE A;  4JBB A;  2IIY A;  2TRX A;  3TRQ A;  1PD2 1;  4J2F A;  2GSS A;  3WGE A;  1Z3E A;  3E0U A;  1GP1 A;  2ZCT A;  4P3Y B;  1XW5 A;  3DIE A;  4RUV A;  1OE8 A;  5G5F A;  4EVM A;  2B7K A;  1DE1 A;  2VL2 A;  2H70 A;  1FVJ A;  2D2Z A;  4ULX A;  4KUN A;  2WJU A;  4DSQ A;  3BJ5 A;  5EVO A;  1B8X A;  1YEP A;  5D73 A;  4DSS A;  1R26 A;  4KSO A;  1SYR A;  3TJJ A;  5CAX A;  1WRY A;  3QCP A;  5J5N A;  3BOA A;  2O8V B;  5C00 A;  3LWA A;  1QFN A;  1GLQ A;  1TRV A;  1K0C A;  5LCZ A;  2X8G A;  1AUC A;  2YZH A;  2M72 A;  5KN0 A;  2RM6 A;  4POB A;  4V1A g;  11GS A;  1USB A;  4MJA A;  3C8E A;  1YQ1 A;  4V2M A;  4OFM A;  1EZK A;  2B5E A;  3DML A;  2FA8 A;  1K0N A;  2IPA A;  2PVO C;  3C71 A;  2V41 A;  1E6B A;  3W8J A;  3KP8 A;  4JRR A;  5JCW A;  1KBN A;  4KGI A;  2HYX A;  3IV4 A;  2PPT A;  4GSS A;  1OAZ A;  3N9J A;  3M1G A;  3G9B A;  2WDU A;  4IEL A;  5IQY A;  1LU4 A;  3WYW A;  4JR6 A;  3J7Y b;  4KW6 A;  1E2Y A;  1GTU A;  3ERW A;  1RQM A;  2V6K A;  1T4Z A;  1B4P A;  3F6F A;  4KSM A;  14GS A;  2TIR A;  3LG6 A;  5CNW A;  3WT2 A;  3GH9 A;  5LNK e;  1ON4 A;  4XS1 A;  3TGZ A;  4TR0 A;  3Q19 A;  5GAP D;  2VAF A;  1H75 A;  2ON7 A;  1ZL9 A;  3VWX A;  1XWC A;  3D0Z A;  3CSI A;  12GS A;  3C73 A;  3HJM A;  3I9V 2;  2QGV A;  1U3A A;  1JZD A;  4AJ8 A;  3UBK A;  3P90 A;  1WJK A;  1TRS A;  3VFI A;  3GKN A;  2IMK A;  3F63 A;  1OE7 A;  2YPM A;  3F6D A;  2C3Q A;  19GS A;  4N0Z A;  4K1F A;  4ECJ A;  4NV5 A;  2JSY A;  1OVN A;  3MSZ A;  3QAG A;  1OC3 A;  3NIV A;  4OCF A;  5E4W A;  1A0F A;  4K7I A;  2IMD A;  2CVD A;  4RI6 A;  4E8H A;  3GMF A;  3KXO A;  1R5A A;  3D4T A;  5DAL A;  7GSS A;  5B8A A;  4BVX A;  1NHO A;  3TJF A;  2F8F A;  1T8E B;  1C72 A;  4YQU A;  1WMJ A;  4J57 E;  4LLR A;  3H1N A;  2IME A;  4ID0 A;  3LJR A;  1GH2 A;  1CQG A;  4PUA A;  3K8N A;  4MAB A;  4F0C A;  1TXX A;  2YWI A;  4XCS A;  2NVL A;  3ZIJ A;  4HS1 A;  2BJX A;  4OO4 A;  2K18 A;  3IRA A;  1MDJ A;  1NSW A;  3FZ4 A;  5A5K A;  4MZW A;  1F6M C;  4O5R A;  1LBK A;  5FHI A;  4PQ1 A;  2GZP A;  3HZ4 A;  3IR4 A;  5B7C A;  3KH9 A;  2I1U A;  1DUG A;  1HNA A;  1QGV A;  3GUR A;  3TKR A;  4IHU A;  1PQN A;  2FHE A;  4ZBB A;  4ISD A;  3UVT A;  3MWH A;  2H0H A;  1WP0 A;  4ECB A;  2LQO A;  3H93 A;  3BD2 A;  2WZ9 A;  3TOU A;  2JSZ A;  1BX9 A;  3EU4 A;  3EWL A;  1ZGN A;  1PMT A;  4ML6 A;  4EKZ A;  1HQO A;  2R6K A;  5ECM B;  2FWG A;  4NHW A;  4V2N A;  3KMO A;  3KTL A;  1JLV A;  5AIX A;  1ABA A;  5H5Q A;  1YF0 A;  4IVF A;  1NM3 A;  1GSS A;  2KP2 A;  10GS A;  2VCW A;  4POM A;  5FT3 A;  1M99 A;  3O6T A;  3QD9 A;  1WPI A;  2LV3 A;  4ZL9 A;  3GKM A;  5IMC A;  2JL4 A;  1JLW A;  1SJZ A;  1V58 A;  1TU7 A;  1O8W A;  2LJR A;  4EL1 A;  4KAE A;  1S3A A;  2DJ1 A;  4OCE A;  6GSY A;  3RPN A;  2GGT A;  1PKZ A;  3GIX A;  1AW9 A;  3FZ9 A;  1CQH A;  3FKF A;  1A2M A;  4MF5 A;  4EO3 A;  5DDL A;  1FG4 A;  4PXO A;  1Z6M A;  3LYK A;  3F3R A;  4ZBA A;  5A4U A;  1PL2 A;  4BWQ A;  3DXB A;  5IPH A;  2CAQ A;  4TXO A;  1T4Y A;  2PVQ A;  2HRF A;  18GS A;  1QK8 A;  2FLS A;  5CRG A;  2FGX A;  2GVP A;  1ERV A;  4IP1 A;  1NW2 A;  5HQP A;  3R2Q A;  2GT6 A;  2PMT A;  2I9H A;  1GSE A;  2HLS A;  2LST A;  2L59 A;  4KX4 A;  2PN8 A;  2IN3 A;  2H6Y A;  3KEB A;  5J4U A;  1X9S B;  4BWS A;  2O89 A;  2CZ3 A;  2YJH A;  1OKD A;  2X64 A;  1V40 A;  3VWU A;  3QAV A;  2A4V A;  3F9U A;  3G7I A;  1S3D A;  2HE3 A;  3CMI A;  3US3 A;  1WE0 A;  4WBR D;  4ACS A;  5B6M A;  2F51 A;  3GKX A;  3GST A;  1PL1 A;  3CSJ A;  3F0I A;  2F3M A;  2PGT A;  3HJP A;  5IOW A;  2MMZ A;  3M8N A;  4MPF A;  2H72 A;  3VPQ A;  1J08 A;  4WF4 A;  1WWJ A;  2GQK A;  1YKC A;  4MA9 A;  1OC9 B;  1T1V A;  2IL3 A;  3KD0 A;  2FUG 2;  2KP1 A;  3HCZ A;  2A2S A;  3HJO A;  2FNO A;  4HJ2 A;  3QFA C;  4JU5 A;  2VD1 A;  3C7M A;  5IPG A;  3DVW A;  3ZIT A;  3AY8 A;  1U6T A;  4EXJ A;  2EC4 A;  5ID2 B;  5KN2 A;  3APO A;  4CHS A;  1UN2 A;  1J0F A;  5HR0 A;  3DVX A;  2HSY A;  1B48 A;  2N5B A;  3GSS A;  2H1G A;  2IFQ A;  3O3T A;  4XRA A;  1F37 A;  2ES7 A;  3EVI A;  4BPY A;  5D9V A;  2C4J A;  4D73 B;  1GUH A;  3ZFL A;  1QQ2 A;  3LFL A;  1Y6E A;  2O87 A;  1XVW A;  1M9B A;  1G6Y A;  4J56 E;  2B1K A;  17GS A;  1M7T A;  4HEA 2;  4ZB6 A;  1V2A A;  3SWL A;  5A4W A;  3GNJ A;  3QMX A;  1SD8 A;  1X9W B;  3CRT A;  2VLT A;  4F03 A;  5C04 A;  4WBJ A;  1K0D A;  2K8V A;  2AJQ B;  4L5L A;  2LJA A;  4KCE A;  2ZNM A;  3J7Y k;  2H8L A;  2DJ0 A;  2FA4 A;  4BVY A;  2DJ3 A;  5J9C A;  2M80 A;  1WOU A;  5F05 A;  1ML6 A;  1VGL A;  2PBJ A;  3A2V A;  1GSD A;  2CV4 A;  5ELG A;  2PU9 C;  2FD3 A;  1ZCP A;  1EOG A;  3IOS A;  4TR3 A;  3UMA A;  1DBY A;  2H30 A;  5D96 A;  4KCA A;  1VF4 A;  5G5E A;  3PGT A;  3TKP A;  1S3C A;  1N8J A;  2JZT A;  4G9H A;  1OKT A;  5IO2 A;  1SJI A;  5CRD A;  4PNF A;  2DIY A;  3SBC A;  3DD3 A;  5CYY A;  5G31 A;  1A2L A;  2GDR A;  2C3N A;  2WCI A;  4BA7 A;  2PUK C;  4KDX A;  5CRW A;  1EGO A;  2AUV A;  2ZUP A;  3IC4 A;  4HU7 A;  3EUR A;  3CYN A;  4H86 A;  3UAR A;  2C0G A;  1A2J A;  5D8I A;  3WT1 A;  2RM5 A;  1THO A;  1VF2 A;  1W89 A;  2LEG A;  4MH2 A;  1WIK A;  3FR9 A;  3FHK A;  3W8S A;  2J23 A;  3V1W A;  2KUC A;  4K8M A;  4KH7 A;  4HI7 A;  5ECI B;  2EIR A;  5IMF A;  1XWK A;  3MNG A;  2HZE A;  1OC8 A;  3IA1 A;  3GYK A;  4NWY A;  3GTU A;  5GSS A;  6GST A;  1GUM A;  3U6V A;  5G2Z A;  1XW6 A;  4AJ6 A;  1TK8 B;  1PA3 A;  4ZB9 A;  4XIH A;  5B8B A;  1Q4J A;  4LA1 A;  3A3T A;  2NTO A;  1SKW B;  2FWH A;  4GLT A;  4X0X A;  4XS4 A;  1B9X C;  2DJK A;  1BQ7 A;  1O8X A;  2IJY A;  4LL4 B;  1ZZY A;  1IYI A;  3GKK A;  1KEB A;  1MD4 A;  3RDW A;  4OFN A;  3VLN A;  1OC9 A;  3VUR A;  2P0G A;  5IO0 A;  1PKW A;  1ZMA A;  4I8B A;  2WFC A;  5AN1 A;  1MEK A;  2H1D A;  1GRX A;  3GRX A;  2B3S A;  4IW9 A;  3QOU A;  3KP9 A;  2L5L A;  2E2M A;  2PER A;  4JZQ A;  4XTS A;  3GX0 A;  2OBI A;  4HZ4 A;  3ZIV A;  1EV9 A;  3D22 A;  2NDO A;  4GTU A;  3KGK A;  4I5Q A;  4JED A;  4DEJ A;  2O7K A;  2QKE A;  1Z6N A;  4IJ3 A;  4D73 A;  3L9S A;  5D93 A;  1ZYE A;  2E0Q A;  3D6I A;  6GSU A;  4IQ1 A;  1GUL A;  1PX7 A;  2BTO T;  1YKA A;  4XRD A;  5JWQ B;  2DJ2 A;  2H19 A;  3HDC A; 
#chains in the Genus database with same CATH topology
 5HFI A;  1XFL A;  3N5O A;  4RQR A;  2AYT A;  2WS2 A;  1LJR A;  2XBQ A;  4GQF A;  2XBI A;  2L4C A;  1XOA A;  1Z7R A;  1SJ6 A;  4BL7 B;  1YZX A;  5ABR A;  2I81 A;  3QAW A;  5G30 A;  2I3Y A;  2HNL A;  4LMW A;  4EIP A;  3GHA A;  1YEX A;  8GSS A;  2DML A;  3G7J A;  2GSR A;  3P8W A;  4AF2 A;  4HQS A;  1TK5 B;  1PSQ A;  4G10 A;  4EC0 A;  3APS A;  4Q5F A;  1FHE A;  2OE1 A;  4ZBD A;  5J41 A;  4DSR A;  3EYT A;  1T00 A;  4CDO A;  2VIM A;  2KHP A;  2ON5 A;  4EIQ A;  3CRU A;  1MTC A;  4F0B A;  4LMV A;  4ZL7 A;  2IMI A;  4RQX A;  2VM2 A;  1Y25 A;  1ERU A;  1XOB A;  4NHZ A;  5DAK B;  5LD0 A;  4K6X A;  3DEX A;  2KLX A;  2L4Q A;  2VD0 A;  2X8C A;  2AAW A;  5COH A;  2H73 A;  4WXT A;  1JZR A;  4HOJ A;  5DVB A;  2VLV A;  5CRE A;  2G0F A;  1ERW A;  1EP7 A;  1JZW A;  3VK9 A;  5GZZ B;  5GAN D;  4O5Q A;  2EIQ A;  2YJ7 A;  4POL A;  3EIN A;  3FY7 A;  5DCH A;  5L71 A;  6GSX A;  4XS6 A;  2NPB A;  4TKY A;  1GSU A;  3A2X A;  2C80 A;  5E59 A;  3ZZX A;  2P5R A;  4OMV A;  1TI1 A;  5DJM A;  3TJK A;  2JZS A;  4G2E A;  3ED3 A;  2B1L A;  2X49 A;  4F2I A;  4MF6 A;  3CXG A;  4PUR A;  2OJL A;  4GRF A;  1F3B A;  2H1A A;  1F3A A;  1N2A A;  1BED A;  3WGX A;  1W4V A;  2V6O A;  5DJL A;  3MYD A;  2YWN A;  1V9W A;  3M9J A;  2K6V A;  2C0F A;  1OYJ A;  1ZYN A;  2OE3 A;  2LTK A;  3C1S A;  2FWF A;  2R5G A;  1GWC A;  5J9B A;  5ECL B;  3IK9 A;  2L57 A;  2GQM A;  3TJB A;  4YAP A;  2OAC A;  4IQA A;  4NV2 A;  4K9Z A;  2ALB A;  2K9F A;  1AQW A;  1MDK A;  2V2G A;  3FEU A;  9GSS A;  1FAA A;  4TOP A;  3F4R A;  4MJE A;  2R2J A;  3EMP A;  4X43 A;  4G19 A;  2YOI A;  3S9F A;  1Z5Y E;  1FVK A;  1U88 A;  1AQV A;  1R4W A;  3IK7 A;  4FH8 A;  3CTF A;  4IGJ A;  5ENU A;  3GX8 A;  3VWW A;  2R37 A;  1B4Q A;  4HUA A;  1HYU A;  4KB3 A;  5IMZ A;  3BCK A;  5DBQ A;  2H76 A;  2DSA A;  4ECI A;  2P5Q A;  4EUY A;  4WR4 A;  4QL9 A;  1FOH A;  5HFG A;  1EP8 A;  5ECO B;  3L78 A;  5CP1 A;  1SL0 B;  1I5G A;  4Q5R A;  2M46 A;  2VOC A;  3H8Q A;  4TXV A;  2B5X A;  3KJY A;  2PWJ A;  1FOV A;  4NAX A;  3DYR A;  3EE2 A;  2DBC A;  5AGY A;  3HHV A;  1SU9 A;  2FWE A;  1SK1 A;  3QFB C;  2MBS A;  3CSH A;  3OR5 A;  4WET A;  3F4T A;  4OWY A;  3JCM L;  3ZL5 A;  4PGT A;  2GQL A;  1XXU A;  4GCI A;  4BL7 A;  1XWB A;  3TKS C;  2VL9 A;  1BJX A;  2MMN A;  1A24 A;  2CVK A;  2C0E A;  1O73 A;  5EY6 A;  4GQC A;  6GSV A;  1RK4 A;  3IAS 2;  1PX6 A;  2J9H A;  1GSQ A;  3A2W A;  2YCD A;  2F8A A;  2XC2 A;  3GA4 A;  1Q98 A;  4IN0 A;  1GTB A;  4MJB A;  2YWO A;  4N11 A;  4DVC A;  1K3O A;  1SK0 A;  3IPZ A;  5JWR B;  5ECR B;  1EOH A;  1TRW A;  1GTI A;  3UL3 A;  2VL2 C;  3HVV A;  1G6W A;  4MNN A;  4RI7 A;  3U5R E;  1A8Y A;  2O85 A;  3HVS A;  4MPG A;  3ZVJ A;  1DE2 A;  1GLP A;  4K0G A;  1M2A A;  3CTG A;  2JZR A;  3BCI A;  5DAK A;  3ME8 A;  1K0M A;  2JAD A;  2HFD A;  1TJD A;  1XZO A;  1XW9 A;  3APQ A;  3FW2 A;  4YKG A;  4YH2 A;  3IXR A;  5D9X A;  3L4N A;  4ZXG A;  3F3Q A;  1X0R A;  3TCO A;  2VL3 A;  3HY2 A;  3NOF A;  2GT5 A;  3MIX A;  2DLX A;  5H5S A;  1O6J A;  2KOK A;  1GSF A;  1ACV A;  4I2T A;  4TRX A;  3TKS E;  2R0P A;  2DKI A;  1U87 A;  3P7X A;  4FO5 A;  5KN3 A;  1SKS B;  2YV9 A;  2CZ2 A;  4K0N A;  5F06 A;  2XPD A;  3TRX A;  3LXT A;  2VO4 A;  2LJK A;  1ZYQ B;  2HRK A;  4POK A;  5DQS A;  4O32 A;  1TOF A;  5IOX A;  2CQ9 A;  3W6G A;  3PIN A;  2H0I A;  1UC7 A;  4BVX B;  1FB0 A;  1YF1 A;  1F9M A;  4MK3 A;  3FYG A;  5CO3 A;  3NZN A;  3HXS A;  1G7O A;  4EE0 A;  4MCU A;  1UVZ A;  4X1U A;  2R3X A;  4TVE A;  5HR2 A;  4AJ7 A;  1X5C A;  4L0U A;  2WB9 A;  3LQ7 A;  1DSB A;  2VCX A;  1GL8 A;  2LQQ A;  1KTE A;  4KDU A;  3M0F A;  2YNX A;  2YV7 A;  2L5O A;  4YAV A;  4O92 A;  1ILO A;  1RW1 A;  4NXI A;  3GL3 A;  1XIY A;  16GS A;  1AQX A;  3DKS A;  3LGC A;  1PN9 A;  1K0B A;  1A0R P;  1O7U A;  3HYP A;  4MH3 A;  3A5W A;  2RLI A;  3GV1 A;  2AHE A;  2JAC A;  1EEM A;  1V57 A;  3ZVJ D;  4CW9 A;  2TRC P;  20GS A;  3DGQ A;  1G0T A;  1TTZ A;  1TU8 A;  1JZO A;  1TRU A;  3HZ8 A;  3IHQ A;  1AAZ A;  2F9S A;  4V2L A;  2GLR A;  2REM A;  1TKD B;  3IDV A;  4GST A;  3DRN A;  2MBT A;  3IHG A;  1THX A;  3MAK A;  1VRS D;  2N5A A;  2CX4 A;  1PRX A;  3Q74 A;  6GSS A;  4K5R A;  2G2Q A;  4MDC A;  1S3R A;  2QC7 A;  1MD3 A;  5JCG A;  4ZIL A;  3ERF A;  4LL1 B;  2XHF A;  4TN8 A;  2H71 A;  3HVX A;  1NHY A;  3P2A A;  3EMX A;  1QXH A;  1BAY A;  2MYG A;  3TRP A;  3CBU A;  1XWG A;  2X99 A;  3RAZ A;  5INY A;  2H6X A;  2H01 A;  1O81 A;  3FMW A;  1GSY A;  4Z2R A;  2WGR A;  1TK0 B;  2FY6 A;  4HU9 A;  3ME7 A;  4AGS A;  5EPF A;  2B7J A;  1I9D A;  3L0H A;  4V1A p;  1QMV A;  5IMA A;  4G0I A;  3RPP A;  5GST A;  1FB6 A;  5KN1 A;  4TW5 A;  1K0O A;  2QA2 A;  3VPT A;  3UVH A;  2CA8 A;  2R4V A;  3H79 A;  4QL7 A;  3VWV A;  3GFK A;  2CVB A;  4WR5 A;  2RUE A;  4OFT A;  4WF5 A;  6GSW A;  2VCQ A;  3ZYW A;  1R5P A;  2VCV A;  3C1R A;  1SEN A;  5KOX A;  5ID2 A;  3HD5 A;  4TXO B;  3FR6 A;  3I69 A;  4ZL8 A;  1VF1 A;  4X4J A;  2OA7 A;  5F07 A;  1TW9 A;  3QDN A;  1SK2 A;  4MZC A;  4IP6 A;  1TI3 A;  4OD7 A;  1AIU A;  4YQV A;  4NPB A;  4KND A;  4OO5 A;  2A2R A;  2H6Z A;  2LUS A;  2MMA A;  5BMU A;  3UIW A;  3ZFB A;  1AC1 A;  3GL5 A;  4JE1 A;  1T3B A;  1ZOF A;  3UEM A;  3MDK A;  3I6A A;  5IMV A;  3FR3 A;  2LRT A;  5B6N A;  1KNG A;  4TR4 A;  2VLU A;  4ZB8 A;  3TOT A;  2H74 A;  1G7E A;  4F82 A;  4PUF C;  2YAN A;  2CX3 A;  2OE0 A;  3G7Y A;  4GXZ A;  2IWT A;  1SKR B;  2K8S A;  2H75 A;  2E7P A;  1PGT A;  2LNS A;  2OKA A;  1K3L A;  4N30 A;  4PQH A;  1O85 A;  1XVQ A;  3ZTL A;  5KEJ A;  2Z9S A;  2GZZ A;  3ZRD A;  4O7H A;  5CRH A;  2GS3 A;  1EWX A;  2LRN A;  2YP6 A;  3L9V A;  5ECQ B;  1JHB A;  4TR1 B;  3TDG A;  3TKQ A;  4G0L A;  2HRN A;  1XPV A;  5ECS A;  1EEJ A;  1Z9H A;  1ST9 A;  3TB2 A;  3FZ5 A;  3PR8 A;  4KE3 A;  3TUE A;  2V32 A;  1A8L A;  5AIV A;  1R7H A;  13GS A;  2LRC A;  2HXK A;  4MF7 A;  5ECP B;  3IBH A;  1YDK A;  1URM A;  5HFK A;  1GNW A;  5FWG A;  5H5R A;  4JR4 A;  4FYB A;  2IFQ B;  5IIZ A;  2VCT A;  5D9T A;  4WEY A;  3KM6 A;  1XCC A;  4PNG A;  2C0D A;  1FO5 A;  5A4V A;  4K2D A;  3WD6 A;  1V98 A;  3F8U A;  2L6C A;  4Q5Q A;  1HD2 A;  2OBK A;  1IYH A;  2C3T A;  2EIO A;  3VI5 A;  2HZF A;  5EL8 A;  1VF3 A;  1BG5 A;  2LS5 A;  4HZ2 A;  1SL1 B;  3UJ1 A;  3Q18 A;  1K0A A;  4EDY A;  4KDY A;  4ZIJ A;  3HKR A;  3LYP A;  1X9M B;  2CT6 A;  2DIZ A;  5G1K A;  3BBY A;  1FW1 A;  3VI7 A;  3ZMK A;  2RUF A;  3KH7 A;  1HNB A;  4Z2T A;  4BVY B;  2GZY A;  4HQZ A;  1ERT A;  3HA9 A;  1SYX A;  1SD9 A;  3D5J A;  1Z7P A;  2N5F A;  3KTB A;  1JFU A;  3DWV A;  5ECN B;  5D9W A;  2HI7 A;  4NMU A;  1GUK A;  1YY7 A;  1MDI A;  3EU3 A;  2GSQ A;  2H66 A;  4GF0 A;  4L5O A;  4PX1 A;  3ISO A;  4MMM A;  4YQM A;  2X8H A;  5HR3 A;  3GUS A;  4Q5N A;  3Q6O A;  3KCM A;  4K7O A;  4E8E A;  1A23 A;  3M9K A;  3LXZ A;  2XPE A;  4L0W A;  2A4H A;  3M3M A;  2MZC A;  2AB6 A;  3LW9 A;  4GWR A;  4IS0 A;  4IJI A;  1GNE A;  4DSS B;  1XWA A;  4ML1 A;  1TP9 A;  2QSI A;  3I43 A;  2C8U A;  5ECH B;  3RBT A;  3WGD A;  3LEF A;  4MP4 A;  2GST A;  5J3R A;  2BMX A;  3O76 A;  4EDZ A;  3FRC A;  1M9A A;  3KMN A;  1SL2 B;  4QQ7 A;  1U3I A;  4N10 A;  5JCU A;  3E9J B;  2VCZ A;  3F4S A;  2HT9 A;  4HJM A;  5ECK B;  1GTA A;  2HSH A;  2LKU A;  1H4O A;  1TDI A;  2HZE B;  2OAD A;  4I2U A;  1X5D A;  3RHC A;  3LSZ A;  1X5E A;  3ZML A;  3GTU B;  2P31 A;  3FZA A;  22GS A;  3ZRE A;  4FYC A;  1F2E A;  2FCH A;  3RHB A;  2AV4 A;  3PPU A;  5JWO B;  5F8B A;  2I4A A;  3UAP A;  2VM1 A;  2B5Y A;  2CAI A;  4XS4 B;  4GSN A;  1B9Y C;  2JU5 A;  4F9Z A;  5HR1 A;  3E3E A;  4EF0 A;  4MJC A;  5ELA A;  4K7N A;  4N0V A;  2H0G A;  1J9B A;  2DC5 A;  4TR1 A;  3LOR A;  2YZU A;  2WUL A;  1HNC A;  3H4K A;  3UOM A;  4HDE A;  4IBP A;  2WRT A;  2YN1 A;  4ILF A;  2NBS A;  4KA0 A;  2B6M A;  2RII A;  2GTU A;  1XBS A;  5IMD A;  1QUW A;  3ZLP A;  1M0U A;  5F0G A;  3EC3 A;  4MZB A;  2YWM A;  3L9U A;  2LNT A;  2MMO A;  5G1L A;  1YJ6 A;  1M2D A;  1M3I A;  1EV4 A;  3QPM A;  3KIJ A;  4USS A;  3GN3 A;  5DCG A;  4I6X A;  4FYU A;  2DMM A;  2V1M A;  3IAM 2;  2E2G A;  4ECC A;  4IKH A;  4MLY A;  3FK8 A;  4A5P A;  3GH6 A;  4WKW A;  4Z7X A;  5DQY A;  2DJJ A;  2DKH A;  3D4M A;  4XHM A;  3EPT A;  4L8E A;  3TJG A;  1T7P B;  5DAL B;  1K3Y A;  3IE3 A;  4FIW A;  1UA5 A;  3PH9 A;  5IM9 A;  1AXD A;  2H1B A;  3QR6 A;  3UBL A;  5AIS A;  4PQI A;  1M2B A;  3D21 A;  3TKS A;  3KZQ A;  3ERG A;  2IMF A;  2L6D A;  2C1Y A;  4I97 A;  2VUP A;  1EGR A;  1BYE A;  4JBB A;  2IIY A;  2TRX A;  3TRQ A;  1PD2 1;  4J2F A;  2GSS A;  3WGE A;  1Z3E A;  3E0U A;  1GP1 A;  2ZCT A;  4P3Y B;  1XW5 A;  3DIE A;  4RUV A;  1OE8 A;  5G5F A;  4EVM A;  2B7K A;  2HRA A;  1DE1 A;  2X4A A;  2VL2 A;  2H70 A;  1FVJ A;  2D2Z A;  4ULX A;  4KUN A;  2WJU A;  4DSQ A;  3BJ5 A;  5EVO A;  1B8X A;  1YEP A;  5D73 A;  4DSS A;  1R26 A;  4KSO A;  1SYR A;  3TJJ A;  5CAX A;  1WRY A;  3QCP A;  4YKF A;  5J5N A;  3BOA A;  2O8V B;  3R3E A;  3LWA A;  5C00 A;  1QFN A;  1GLQ A;  1TRV A;  1K0C A;  5LCZ A;  2X8G A;  1AUC A;  2YZH A;  2M72 A;  5KN0 A;  2RM6 A;  4POB A;  4V1A g;  11GS A;  1USB A;  4MJA A;  3C8E A;  1YQ1 A;  3HVN A;  4V2M A;  4OFM A;  1EZK A;  2B5E A;  3DML A;  2FA8 A;  1K0N A;  2IPA A;  2PVO C;  3C71 A;  2V41 A;  1E6B A;  3W8J A;  3KP8 A;  4JRR A;  5JCW A;  1KBN A;  4KGI A;  2HYX A;  3IV4 A;  2PPT A;  4GSS A;  1OAZ A;  3N9J A;  3M1G A;  3G9B A;  2WDU A;  4IEL A;  5IQY A;  1LU4 A;  4KF9 A;  3WYW A;  4JR6 A;  2UZ8 A;  3J7Y b;  4KW6 A;  1E2Y A;  1GTU A;  3ERW A;  1RQM A;  2V6K A;  3A5I A;  1T4Z A;  1B4P A;  3F6F A;  4KSM A;  14GS A;  2TIR A;  3LG6 A;  5CNW A;  3WT2 A;  3GH9 A;  5LNK e;  1ON4 A;  4XS1 A;  3TGZ A;  4TR0 A;  3Q19 A;  5GAP D;  2VAF A;  1H75 A;  2ON7 A;  1ZL9 A;  3VWX A;  1XWC A;  3D0Z A;  3CSI A;  12GS A;  3C73 A;  3HJM A;  3I9V 2;  2QGV A;  1U3A A;  1JZD A;  4AJ8 A;  3UBK A;  3P90 A;  1WJK A;  1TRS A;  3VFI A;  3GKN A;  2IMK A;  3F63 A;  1OE7 A;  2YPM A;  3F6D A;  2C3Q A;  19GS A;  4N0Z A;  4K1F A;  4ECJ A;  4NV5 A;  2JSY A;  1OVN A;  3CQF A;  3MSZ A;  3QAG A;  1OC3 A;  3NIV A;  4OCF A;  5E4W A;  1A0F A;  4K7I A;  2IMD A;  2CVD A;  4RI6 A;  4E8H A;  3GMF A;  3KXO A;  1R5A A;  3D4T A;  5DAL A;  7GSS A;  5B8A A;  4BVX A;  1NHO A;  3TJF A;  2F8F A;  1T8E B;  1C72 A;  4YQU A;  1WMJ A;  4J57 E;  4LLR A;  3H1N A;  2IME A;  4ID0 A;  3LJR A;  1GH2 A;  1CQG A;  4PUA A;  3K8N A;  4HSC X;  4MAB A;  4F0C A;  1PFO A;  1TXX A;  2YWI A;  4XCS A;  2NVL A;  3ZIJ A;  4HS1 A;  2BJX A;  4OO4 A;  2K18 A;  3IRA A;  1MDJ A;  1NSW A;  3FZ4 A;  5A5K A;  4MZW A;  1F6M C;  4O5R A;  1LBK A;  5FHI A;  4PQ1 A;  2GZP A;  3HZ4 A;  3IR4 A;  5B7C A;  3KH9 A;  2I1U A;  1DUG A;  4CY8 A;  1HNA A;  1QGV A;  3GUR A;  3TKR A;  4IHU A;  4G0K A;  1PQN A;  2FHE A;  4ZBB A;  4ISD A;  3UVT A;  3MWH A;  2H0H A;  1WP0 A;  4ECB A;  2LQO A;  3H93 A;  3BD2 A;  2WZ9 A;  3TOU A;  2JSZ A;  4K2X A;  1BX9 A;  3EU4 A;  3EWL A;  1ZGN A;  1PMT A;  4ML6 A;  4EKZ A;  1HQO A;  2R6K A;  5ECM B;  2FWG A;  4NHW A;  4V2N A;  3KMO A;  3KTL A;  1JLV A;  5AIX A;  1ABA A;  5H5Q A;  1YF0 A;  4IVF A;  1NM3 A;  1GSS A;  2KP2 A;  10GS A;  2VCW A;  4POM A;  5FT3 A;  1M99 A;  3O6T A;  3QD9 A;  1WPI A;  2LV3 A;  4ZL9 A;  3GKM A;  5IMC A;  2JL4 A;  1JLW A;  1SJZ A;  1V58 A;  1TU7 A;  1O8W A;  2LJR A;  4EL1 A;  4KAE A;  1S3A A;  5KOW A;  2DJ1 A;  4OCE A;  6GSY A;  3RPN A;  2GGT A;  1PKZ A;  3GIX A;  1AW9 A;  3FZ9 A;  1CQH A;  3FKF A;  1A2M A;  4MF5 A;  4EO3 A;  5DDL A;  1FG4 A;  4PXO A;  1Z6M A;  3LYK A;  3F3R A;  4ZBA A;  5A4U A;  1PL2 A;  4BWQ A;  3DXB A;  5IPH A;  2CAQ A;  4TXO A;  1T4Y A;  2PVQ A;  2HRF A;  18GS A;  1QK8 A;  2FLS A;  5CRG A;  2FGX A;  2GVP A;  1ERV A;  4IP1 A;  1NW2 A;  5HQP A;  3R2Q A;  2GT6 A;  2PMT A;  2I9H A;  1GSE A;  2HLS A;  2LST A;  2L59 A;  4KX4 A;  2PN8 A;  2IN3 A;  2H6Y A;  3KEB A;  5J4U A;  1X9S B;  4BWS A;  2O89 A;  2CZ3 A;  4Z2U A;  2YJH A;  1OKD A;  2X64 A;  1V40 A;  3VWU A;  3QAV A;  2A4V A;  3F9U A;  3G7I A;  1S3D A;  2HE3 A;  3CMI A;  3US3 A;  1WE0 A;  4WBR D;  4ACS A;  5B6M A;  2F51 A;  3GKX A;  3GST A;  1PL1 A;  5BRT A;  3CSJ A;  3F0I A;  2F3M A;  2PGT A;  3HJP A;  5IOW A;  2MMZ A;  3M8N A;  4MPF A;  2H72 A;  3VPQ A;  1J08 A;  4WF4 A;  1XG8 A;  2R0G A;  1WWJ A;  2GQK A;  1YKC A;  4MA9 A;  1OC9 B;  1T1V A;  2IL3 A;  3KD0 A;  2FUG 2;  2KP1 A;  3HCZ A;  4JU5 A;  2A2S A;  3HJO A;  2FNO A;  3QFA C;  4HJ2 A;  2VD1 A;  3C7M A;  5IPG A;  3DVW A;  3ZIT A;  3AY8 A;  1U6T A;  4EXJ A;  2EC4 A;  4PTS A;  5ID2 B;  5KN2 A;  4CY6 A;  4K5S A;  3APO A;  4CHS A;  1UN2 A;  1J0F A;  5HR0 A;  3DVX A;  2HSY A;  1B48 A;  2N5B A;  2QA1 A;  3GSS A;  2H1G A;  2IFQ A;  3O3T A;  4XRA A;  1F37 A;  2ES7 A;  3EVI A;  4BPY A;  5D9V A;  2C4J A;  4D73 B;  1GUH A;  3ZFL A;  1QQ2 A;  3LFL A;  1Y6E A;  2O87 A;  1XVW A;  1M9B A;  1G6Y A;  4J56 E;  2B1K A;  17GS A;  1M7T A;  4HEA 2;  4ZB6 A;  1V2A A;  3SWL A;  5A4W A;  3GNJ A;  3QMX A;  1SD8 A;  1X9W B;  3CRT A;  2VLT A;  4F03 A;  5C04 A;  4ICY A;  4WBJ A;  2R0C A;  1K0D A;  2K8V A;  2AJQ B;  4L5L A;  2LJA A;  4KCE A;  2ZNM A;  3J7Y k;  2H8L A;  2DJ0 A;  2FA4 A;  4BVY A;  1M3J A;  2DJ3 A;  5J9C A;  2M80 A;  1WOU A;  5F05 A;  1ML6 A;  1VGL A;  2PBJ A;  3A2V A;  1GSD A;  2CV4 A;  5ELG A;  2PU9 C;  2FD3 A;  1ZCP A;  1EOG A;  3IOS A;  4TR3 A;  3UMA A;  1DBY A;  2H30 A;  5D96 A;  4KCA A;  1VF4 A;  5G5E A;  3PGT A;  3TKP A;  1S3C A;  1N8J A;  2HSM A;  2JZT A;  4G9H A;  1OKT A;  5IO2 A;  1SJI A;  5CRD A;  4PNF A;  2DIY A;  3SBC A;  3DD3 A;  5CYY A;  5G31 A;  1A2L A;  2GDR A;  2C3N A;  2WCI A;  4BA7 A;  2PUK C;  4KDX A;  3IC8 A;  5CRW A;  1PN0 A;  1EGO A;  2AUV A;  2ZUP A;  3IC4 A;  4HU7 A;  3EUR A;  3CYN A;  4H86 A;  3UAR A;  2C0G A;  1A2J A;  5D8I A;  3WT1 A;  4O5U A;  2RM5 A;  1THO A;  1VF2 A;  1W89 A;  2LEG A;  4MH2 A;  1WIK A;  3FR9 A;  3FHK A;  4BIK A;  3W8S A;  2J23 A;  3V1W A;  2KUC A;  4K8M A;  4KH7 A;  4HI7 A;  5ECI B;  2EIR A;  5IMF A;  1XWK A;  3MNG A;  2HZE A;  1OC8 A;  3IA1 A;  3GYK A;  4NWY A;  3GTU A;  5GSS A;  6GST A;  1GUM A;  3U6V A;  5G2Z A;  1XW6 A;  4AJ6 A;  1TK8 B;  1PA3 A;  4ZB9 A;  4XIH A;  5B8B A;  1Q4J A;  2A2P A;  4LA1 A;  1ZYP A;  3A3T A;  2NTO A;  1SKW B;  2FWH A;  4GLT A;  4X0X A;  4XS4 A;  1B9X C;  2DJK A;  1BQ7 A;  1O8X A;  2IJY A;  4LL4 B;  1ZZY A;  1IYI A;  3GKK A;  1KEB A;  1MD4 A;  3RDW A;  4OFN A;  4FQU A;  3VLN A;  1OC9 A;  3VUR A;  2P0G A;  5IO0 A;  1PKW A;  1ZMA A;  4I8B A;  2WFC A;  5AN1 A;  1MEK A;  2H1D A;  1GRX A;  3GRX A;  2B3S A;  4IW9 A;  3QOU A;  3KP9 A;  2L5L A;  2E2M A;  2PER A;  4JZQ A;  4XTS A;  3GX0 A;  2OBI A;  4HZ4 A;  3ZIV A;  1EV9 A;  3D22 A;  2NDO A;  4GTU A;  3KGK A;  4I5Q A;  4JED A;  4DEJ A;  2O7K A;  2QKE A;  1Z6N A;  4IJ3 A;  4D73 A;  3L9S A;  5D93 A;  1ZYE A;  2E0Q A;  3D6I A;  6GSU A;  4IQ1 A;  1GUL A;  1PX7 A;  2BTO T;  1YKA A;  4XRD A;  5JWQ B;  2DJ2 A;  2H19 A;  3HDC A; 
#chains in the Genus database with same CATH homology
 5HFI A;  1XFL A;  3N5O A;  4RQR A;  2AYT A;  2WS2 A;  1LJR A;  2XBQ A;  4GQF A;  2XBI A;  2L4C A;  1XOA A;  1Z7R A;  1SJ6 A;  4BL7 B;  1YZX A;  5ABR A;  2I81 A;  3QAW A;  5G30 A;  2I3Y A;  2HNL A;  4LMW A;  4EIP A;  3GHA A;  1YEX A;  8GSS A;  2DML A;  3G7J A;  2GSR A;  3P8W A;  4AF2 A;  4HQS A;  1TK5 B;  1PSQ A;  4G10 A;  4EC0 A;  3APS A;  4Q5F A;  1FHE A;  2OE1 A;  4ZBD A;  5J41 A;  4DSR A;  3EYT A;  1T00 A;  4CDO A;  2VIM A;  2KHP A;  2ON5 A;  4EIQ A;  3CRU A;  1MTC A;  4F0B A;  4LMV A;  4ZL7 A;  2IMI A;  4RQX A;  2VM2 A;  1Y25 A;  1ERU A;  1XOB A;  4NHZ A;  5DAK B;  5LD0 A;  4K6X A;  3DEX A;  2KLX A;  2L4Q A;  2VD0 A;  2X8C A;  2AAW A;  5COH A;  2H73 A;  4WXT A;  1JZR A;  4HOJ A;  5DVB A;  2VLV A;  5CRE A;  2G0F A;  1ERW A;  1EP7 A;  1JZW A;  3VK9 A;  5GZZ B;  5GAN D;  4O5Q A;  2EIQ A;  2YJ7 A;  4POL A;  3EIN A;  3FY7 A;  5DCH A;  5L71 A;  6GSX A;  4XS6 A;  2NPB A;  4TKY A;  1GSU A;  3A2X A;  2C80 A;  5E59 A;  3ZZX A;  2P5R A;  4OMV A;  1TI1 A;  5DJM A;  3TJK A;  2JZS A;  4G2E A;  3ED3 A;  2B1L A;  2X49 A;  4F2I A;  4MF6 A;  3CXG A;  4PUR A;  2OJL A;  4GRF A;  1F3B A;  2H1A A;  1F3A A;  1N2A A;  1BED A;  3WGX A;  1W4V A;  2V6O A;  5DJL A;  3MYD A;  2YWN A;  1V9W A;  3M9J A;  2K6V A;  2C0F A;  1OYJ A;  1ZYN A;  2OE3 A;  2LTK A;  3C1S A;  2FWF A;  2R5G A;  1GWC A;  5J9B A;  5ECL B;  3IK9 A;  2L57 A;  2GQM A;  3TJB A;  4YAP A;  2OAC A;  4IQA A;  4NV2 A;  4K9Z A;  2ALB A;  2K9F A;  1AQW A;  1MDK A;  2V2G A;  3FEU A;  9GSS A;  1FAA A;  4TOP A;  3F4R A;  4MJE A;  2R2J A;  3EMP A;  4X43 A;  4G19 A;  2YOI A;  3S9F A;  1Z5Y E;  1FVK A;  1U88 A;  1AQV A;  1R4W A;  3IK7 A;  4FH8 A;  3CTF A;  4IGJ A;  5ENU A;  3GX8 A;  3VWW A;  2R37 A;  1B4Q A;  4HUA A;  1HYU A;  4KB3 A;  5IMZ A;  3BCK A;  5DBQ A;  2H76 A;  2DSA A;  4ECI A;  2P5Q A;  4EUY A;  4WR4 A;  4QL9 A;  1FOH A;  5HFG A;  1EP8 A;  5ECO B;  3L78 A;  5CP1 A;  1SL0 B;  1I5G A;  4Q5R A;  2M46 A;  2VOC A;  3H8Q A;  4TXV A;  2B5X A;  3KJY A;  2PWJ A;  1FOV A;  4NAX A;  3DYR A;  3EE2 A;  2DBC A;  5AGY A;  3HHV A;  1SU9 A;  2FWE A;  1SK1 A;  3QFB C;  2MBS A;  3CSH A;  3OR5 A;  4WET A;  3F4T A;  4OWY A;  3JCM L;  3ZL5 A;  4PGT A;  2GQL A;  1XXU A;  4GCI A;  4BL7 A;  1XWB A;  3TKS C;  2VL9 A;  1BJX A;  2MMN A;  1A24 A;  2CVK A;  2C0E A;  1O73 A;  5EY6 A;  4GQC A;  6GSV A;  1RK4 A;  3IAS 2;  1PX6 A;  2J9H A;  1GSQ A;  3A2W A;  2YCD A;  2F8A A;  2XC2 A;  3GA4 A;  1Q98 A;  4IN0 A;  1GTB A;  4MJB A;  2YWO A;  4N11 A;  4DVC A;  1K3O A;  1SK0 A;  3IPZ A;  5JWR B;  5ECR B;  1EOH A;  1TRW A;  1GTI A;  3UL3 A;  2VL2 C;  3HVV A;  1G6W A;  4MNN A;  4RI7 A;  3U5R E;  1A8Y A;  2O85 A;  3HVS A;  4MPG A;  3ZVJ A;  1DE2 A;  1GLP A;  4K0G A;  1M2A A;  3CTG A;  2JZR A;  3BCI A;  5DAK A;  3ME8 A;  1K0M A;  2JAD A;  2HFD A;  1TJD A;  1XZO A;  1XW9 A;  3APQ A;  3FW2 A;  4YKG A;  4YH2 A;  3IXR A;  5D9X A;  3L4N A;  4ZXG A;  3F3Q A;  1X0R A;  3TCO A;  2VL3 A;  3HY2 A;  3NOF A;  2GT5 A;  3MIX A;  2DLX A;  5H5S A;  1O6J A;  2KOK A;  1GSF A;  1ACV A;  4I2T A;  4TRX A;  3TKS E;  2R0P A;  2DKI A;  1U87 A;  3P7X A;  4FO5 A;  5KN3 A;  1SKS B;  2YV9 A;  2CZ2 A;  4K0N A;  5F06 A;  2XPD A;  3TRX A;  3LXT A;  2VO4 A;  2LJK A;  1ZYQ B;  2HRK A;  4POK A;  5DQS A;  4O32 A;  1TOF A;  5IOX A;  2CQ9 A;  3W6G A;  3PIN A;  2H0I A;  1UC7 A;  4BVX B;  1FB0 A;  1YF1 A;  1F9M A;  4MK3 A;  3FYG A;  5CO3 A;  3NZN A;  3HXS A;  1G7O A;  4EE0 A;  4MCU A;  1UVZ A;  4X1U A;  2R3X A;  4TVE A;  5HR2 A;  4AJ7 A;  1X5C A;  4L0U A;  2WB9 A;  3LQ7 A;  1DSB A;  2VCX A;  1GL8 A;  2LQQ A;  1KTE A;  4KDU A;  3M0F A;  2YNX A;  2YV7 A;  2L5O A;  4YAV A;  4O92 A;  1ILO A;  1RW1 A;  4NXI A;  3GL3 A;  1XIY A;  16GS A;  1AQX A;  3DKS A;  3LGC A;  1PN9 A;  1K0B A;  1A0R P;  1O7U A;  3HYP A;  4MH3 A;  3A5W A;  2RLI A;  3GV1 A;  2AHE A;  2JAC A;  1EEM A;  1V57 A;  3ZVJ D;  4CW9 A;  2TRC P;  20GS A;  3DGQ A;  1G0T A;  1TTZ A;  1TU8 A;  1JZO A;  1TRU A;  3HZ8 A;  3IHQ A;  1AAZ A;  2F9S A;  4V2L A;  2GLR A;  2REM A;  1TKD B;  3IDV A;  4GST A;  3DRN A;  2MBT A;  3IHG A;  1THX A;  3MAK A;  1VRS D;  2N5A A;  2CX4 A;  1PRX A;  3Q74 A;  6GSS A;  4K5R A;  2G2Q A;  4MDC A;  2QC7 A;  1MD3 A;  5JCG A;  4ZIL A;  3ERF A;  4LL1 B;  2XHF A;  4TN8 A;  2H71 A;  3HVX A;  1NHY A;  3P2A A;  3EMX A;  1QXH A;  1BAY A;  2MYG A;  3TRP A;  3CBU A;  1XWG A;  2X99 A;  3RAZ A;  5INY A;  2H6X A;  2H01 A;  1O81 A;  3FMW A;  1GSY A;  4Z2R A;  2WGR A;  1TK0 B;  2FY6 A;  4HU9 A;  3ME7 A;  4AGS A;  5EPF A;  2B7J A;  1I9D A;  3L0H A;  4V1A p;  1QMV A;  5IMA A;  4G0I A;  3RPP A;  5GST A;  1FB6 A;  5KN1 A;  4TW5 A;  1K0O A;  2QA2 A;  3VPT A;  3UVH A;  2CA8 A;  2R4V A;  3H79 A;  4QL7 A;  3VWV A;  3GFK A;  2CVB A;  4WR5 A;  2RUE A;  4OFT A;  4WF5 A;  6GSW A;  2VCQ A;  3ZYW A;  1R5P A;  2VCV A;  3C1R A;  1SEN A;  5KOX A;  5ID2 A;  3HD5 A;  4TXO B;  3FR6 A;  3I69 A;  4ZL8 A;  1VF1 A;  4X4J A;  2OA7 A;  5F07 A;  1TW9 A;  3QDN A;  1SK2 A;  4MZC A;  4IP6 A;  1TI3 A;  4OD7 A;  1AIU A;  4YQV A;  4NPB A;  4KND A;  4OO5 A;  2A2R A;  2H6Z A;  2LUS A;  2MMA A;  5BMU A;  3UIW A;  3ZFB A;  1AC1 A;  3GL5 A;  4JE1 A;  1T3B A;  1ZOF A;  3UEM A;  3MDK A;  3I6A A;  5IMV A;  3FR3 A;  2LRT A;  5B6N A;  1KNG A;  4TR4 A;  2VLU A;  4ZB8 A;  3TOT A;  2H74 A;  1G7E A;  4F82 A;  4PUF C;  2YAN A;  2CX3 A;  2OE0 A;  3G7Y A;  4GXZ A;  2IWT A;  1SKR B;  2K8S A;  2H75 A;  2E7P A;  1PGT A;  2LNS A;  2OKA A;  1K3L A;  4N30 A;  4PQH A;  1O85 A;  1XVQ A;  3ZTL A;  5KEJ A;  2Z9S A;  2GZZ A;  3ZRD A;  4O7H A;  5CRH A;  2GS3 A;  1EWX A;  2LRN A;  2YP6 A;  3L9V A;  5ECQ B;  1JHB A;  4TR1 B;  3TDG A;  3TKQ A;  4G0L A;  2HRN A;  1XPV A;  5ECS A;  1EEJ A;  1Z9H A;  1ST9 A;  3TB2 A;  3FZ5 A;  3PR8 A;  4KE3 A;  3TUE A;  2V32 A;  1A8L A;  5AIV A;  1R7H A;  13GS A;  2LRC A;  2HXK A;  4MF7 A;  5ECP B;  3IBH A;  1YDK A;  1URM A;  5HFK A;  1GNW A;  5FWG A;  5H5R A;  4JR4 A;  4FYB A;  2IFQ B;  5IIZ A;  2VCT A;  5D9T A;  4WEY A;  3KM6 A;  1XCC A;  4PNG A;  2C0D A;  1FO5 A;  5A4V A;  4K2D A;  3WD6 A;  1V98 A;  3F8U A;  2L6C A;  4Q5Q A;  1HD2 A;  2OBK A;  1IYH A;  2C3T A;  2EIO A;  3VI5 A;  2HZF A;  5EL8 A;  1VF3 A;  1BG5 A;  2LS5 A;  4HZ2 A;  1SL1 B;  3UJ1 A;  3Q18 A;  1K0A A;  4EDY A;  4KDY A;  4ZIJ A;  3HKR A;  3LYP A;  1X9M B;  2CT6 A;  2DIZ A;  5G1K A;  3BBY A;  1FW1 A;  3VI7 A;  3ZMK A;  2RUF A;  3KH7 A;  1HNB A;  4Z2T A;  4BVY B;  2GZY A;  4HQZ A;  1ERT A;  3HA9 A;  1SYX A;  1SD9 A;  3D5J A;  1Z7P A;  2N5F A;  3KTB A;  1JFU A;  3DWV A;  5ECN B;  5D9W A;  2HI7 A;  4NMU A;  1GUK A;  1YY7 A;  1MDI A;  3EU3 A;  2GSQ A;  2H66 A;  4GF0 A;  4L5O A;  4PX1 A;  3ISO A;  4MMM A;  4YQM A;  2X8H A;  5HR3 A;  3GUS A;  4Q5N A;  3Q6O A;  3KCM A;  4K7O A;  4E8E A;  1A23 A;  3M9K A;  3LXZ A;  2XPE A;  4L0W A;  2A4H A;  3M3M A;  2MZC A;  2AB6 A;  3LW9 A;  4GWR A;  4IS0 A;  4IJI A;  1GNE A;  4DSS B;  1XWA A;  4ML1 A;  1TP9 A;  2QSI A;  3I43 A;  2C8U A;  5ECH B;  3RBT A;  3WGD A;  3LEF A;  4MP4 A;  2GST A;  5J3R A;  2BMX A;  3O76 A;  4EDZ A;  3FRC A;  1M9A A;  3KMN A;  1SL2 B;  4QQ7 A;  1U3I A;  4N10 A;  5JCU A;  3E9J B;  2VCZ A;  3F4S A;  2HT9 A;  4HJM A;  5ECK B;  1GTA A;  2HSH A;  2LKU A;  1H4O A;  1TDI A;  2HZE B;  2OAD A;  4I2U A;  1X5D A;  3RHC A;  3LSZ A;  1X5E A;  3ZML A;  3GTU B;  2P31 A;  3FZA A;  22GS A;  3ZRE A;  4FYC A;  1F2E A;  2FCH A;  3RHB A;  2AV4 A;  3PPU A;  5JWO B;  5F8B A;  2I4A A;  3UAP A;  2VM1 A;  2B5Y A;  2CAI A;  4XS4 B;  4GSN A;  1B9Y C;  2JU5 A;  4F9Z A;  5HR1 A;  3E3E A;  4EF0 A;  4MJC A;  5ELA A;  4K7N A;  4N0V A;  2H0G A;  1J9B A;  2DC5 A;  4TR1 A;  3LOR A;  2YZU A;  2WUL A;  1HNC A;  3H4K A;  3UOM A;  4HDE A;  4IBP A;  2WRT A;  2YN1 A;  4ILF A;  2NBS A;  4KA0 A;  2B6M A;  2RII A;  2GTU A;  1XBS A;  5IMD A;  1QUW A;  3ZLP A;  1M0U A;  5F0G A;  3EC3 A;  4MZB A;  2YWM A;  3L9U A;  2LNT A;  2MMO A;  5G1L A;  1YJ6 A;  1M2D A;  1EV4 A;  3QPM A;  3KIJ A;  4USS A;  3GN3 A;  5DCG A;  4I6X A;  4FYU A;  2DMM A;  2V1M A;  3IAM 2;  2E2G A;  4ECC A;  4IKH A;  4MLY A;  3FK8 A;  4A5P A;  3GH6 A;  4WKW A;  4Z7X A;  5DQY A;  2DJJ A;  2DKH A;  3D4M A;  4XHM A;  3EPT A;  4L8E A;  3TJG A;  1T7P B;  5DAL B;  1K3Y A;  3IE3 A;  4FIW A;  1UA5 A;  3PH9 A;  5IM9 A;  1AXD A;  2H1B A;  3QR6 A;  3UBL A;  5AIS A;  4PQI A;  1M2B A;  3D21 A;  3TKS A;  3KZQ A;  3ERG A;  2IMF A;  2L6D A;  2C1Y A;  4I97 A;  2VUP A;  1EGR A;  1BYE A;  4JBB A;  2IIY A;  2TRX A;  3TRQ A;  1PD2 1;  4J2F A;  2GSS A;  3WGE A;  1Z3E A;  3E0U A;  1GP1 A;  2ZCT A;  4P3Y B;  1XW5 A;  3DIE A;  4RUV A;  1OE8 A;  5G5F A;  4EVM A;  2B7K A;  2HRA A;  1DE1 A;  2X4A A;  2VL2 A;  2H70 A;  1FVJ A;  2D2Z A;  4ULX A;  4KUN A;  2WJU A;  4DSQ A;  3BJ5 A;  5EVO A;  1B8X A;  1YEP A;  5D73 A;  4DSS A;  1R26 A;  4KSO A;  1SYR A;  3TJJ A;  5CAX A;  1WRY A;  3QCP A;  4YKF A;  5J5N A;  3BOA A;  2O8V B;  3R3E A;  3LWA A;  5C00 A;  1QFN A;  1GLQ A;  1TRV A;  1K0C A;  5LCZ A;  2X8G A;  1AUC A;  2YZH A;  2M72 A;  5KN0 A;  2RM6 A;  4POB A;  4V1A g;  11GS A;  1USB A;  4MJA A;  3C8E A;  1YQ1 A;  4V2M A;  4OFM A;  1EZK A;  2B5E A;  3DML A;  2FA8 A;  1K0N A;  2IPA A;  2PVO C;  3C71 A;  2V41 A;  1E6B A;  3W8J A;  3KP8 A;  4JRR A;  5JCW A;  1KBN A;  4KGI A;  2HYX A;  3IV4 A;  2PPT A;  4GSS A;  1OAZ A;  3N9J A;  3M1G A;  3G9B A;  2WDU A;  4IEL A;  5IQY A;  1LU4 A;  4KF9 A;  3WYW A;  4JR6 A;  2UZ8 A;  3J7Y b;  4KW6 A;  1E2Y A;  1GTU A;  3ERW A;  1RQM A;  2V6K A;  3A5I A;  1T4Z A;  1B4P A;  3F6F A;  4KSM A;  14GS A;  2TIR A;  3LG6 A;  5CNW A;  3WT2 A;  3GH9 A;  5LNK e;  1ON4 A;  4XS1 A;  3TGZ A;  4TR0 A;  3Q19 A;  5GAP D;  2VAF A;  1H75 A;  2ON7 A;  1ZL9 A;  3VWX A;  1XWC A;  3D0Z A;  3CSI A;  12GS A;  3C73 A;  3HJM A;  3I9V 2;  2QGV A;  1U3A A;  1JZD A;  4AJ8 A;  3UBK A;  3P90 A;  1WJK A;  1TRS A;  3VFI A;  3GKN A;  2IMK A;  3F63 A;  1OE7 A;  2YPM A;  3F6D A;  2C3Q A;  19GS A;  4N0Z A;  4K1F A;  4ECJ A;  4NV5 A;  2JSY A;  1OVN A;  3MSZ A;  3QAG A;  1OC3 A;  3NIV A;  4OCF A;  5E4W A;  1A0F A;  4K7I A;  2IMD A;  2CVD A;  4RI6 A;  4E8H A;  3GMF A;  3KXO A;  1R5A A;  3D4T A;  5DAL A;  7GSS A;  5B8A A;  4BVX A;  1NHO A;  3TJF A;  2F8F A;  1T8E B;  1C72 A;  4YQU A;  1WMJ A;  4J57 E;  4LLR A;  3H1N A;  2IME A;  4ID0 A;  3LJR A;  1GH2 A;  1CQG A;  4PUA A;  3K8N A;  4MAB A;  4F0C A;  1TXX A;  2YWI A;  4XCS A;  2NVL A;  3ZIJ A;  4HS1 A;  2BJX A;  4OO4 A;  2K18 A;  3IRA A;  1MDJ A;  1NSW A;  3FZ4 A;  5A5K A;  4MZW A;  1F6M C;  4O5R A;  1LBK A;  5FHI A;  4PQ1 A;  2GZP A;  3HZ4 A;  3IR4 A;  5B7C A;  3KH9 A;  2I1U A;  1DUG A;  4CY8 A;  1HNA A;  1QGV A;  3GUR A;  3TKR A;  4IHU A;  4G0K A;  1PQN A;  2FHE A;  4ZBB A;  4ISD A;  3UVT A;  3MWH A;  2H0H A;  1WP0 A;  4ECB A;  2LQO A;  3H93 A;  3BD2 A;  2WZ9 A;  3TOU A;  2JSZ A;  4K2X A;  1BX9 A;  3EU4 A;  3EWL A;  1ZGN A;  1PMT A;  4ML6 A;  4EKZ A;  1HQO A;  2R6K A;  5ECM B;  2FWG A;  4NHW A;  4V2N A;  3KMO A;  3KTL A;  1JLV A;  5AIX A;  1ABA A;  5H5Q A;  1YF0 A;  4IVF A;  1NM3 A;  1GSS A;  2KP2 A;  10GS A;  2VCW A;  4POM A;  5FT3 A;  1M99 A;  3O6T A;  3QD9 A;  1WPI A;  2LV3 A;  4ZL9 A;  3GKM A;  5IMC A;  2JL4 A;  1JLW A;  1SJZ A;  1V58 A;  1TU7 A;  1O8W A;  2LJR A;  4EL1 A;  4KAE A;  1S3A A;  5KOW A;  2DJ1 A;  4OCE A;  6GSY A;  3RPN A;  2GGT A;  1PKZ A;  3GIX A;  1AW9 A;  3FZ9 A;  1CQH A;  3FKF A;  1A2M A;  4MF5 A;  4EO3 A;  5DDL A;  1FG4 A;  4PXO A;  1Z6M A;  3LYK A;  3F3R A;  4ZBA A;  5A4U A;  1PL2 A;  4BWQ A;  3DXB A;  5IPH A;  2CAQ A;  4TXO A;  1T4Y A;  2PVQ A;  2HRF A;  18GS A;  1QK8 A;  2FLS A;  5CRG A;  2FGX A;  2GVP A;  1ERV A;  4IP1 A;  1NW2 A;  5HQP A;  3R2Q A;  2GT6 A;  2PMT A;  2I9H A;  1GSE A;  2HLS A;  2LST A;  2L59 A;  4KX4 A;  2PN8 A;  2IN3 A;  2H6Y A;  3KEB A;  5J4U A;  1X9S B;  4BWS A;  2O89 A;  2CZ3 A;  4Z2U A;  2YJH A;  1OKD A;  2X64 A;  1V40 A;  3VWU A;  3QAV A;  2A4V A;  3F9U A;  3G7I A;  1S3D A;  2HE3 A;  3CMI A;  3US3 A;  1WE0 A;  4WBR D;  4ACS A;  5B6M A;  2F51 A;  3GKX A;  3GST A;  1PL1 A;  5BRT A;  3CSJ A;  3F0I A;  2F3M A;  2PGT A;  3HJP A;  5IOW A;  2MMZ A;  3M8N A;  4MPF A;  2H72 A;  3VPQ A;  1J08 A;  4WF4 A;  2R0G A;  1WWJ A;  2GQK A;  1YKC A;  4MA9 A;  1OC9 B;  1T1V A;  2IL3 A;  3KD0 A;  2FUG 2;  2KP1 A;  3HCZ A;  4JU5 A;  2A2S A;  3HJO A;  2FNO A;  3QFA C;  4HJ2 A;  2VD1 A;  3C7M A;  5IPG A;  3DVW A;  3ZIT A;  3AY8 A;  1U6T A;  4EXJ A;  2EC4 A;  4PTS A;  5ID2 B;  5KN2 A;  4CY6 A;  4K5S A;  3APO A;  4CHS A;  1UN2 A;  1J0F A;  5HR0 A;  3DVX A;  2HSY A;  1B48 A;  2N5B A;  2QA1 A;  3GSS A;  2H1G A;  2IFQ A;  3O3T A;  4XRA A;  1F37 A;  2ES7 A;  3EVI A;  4BPY A;  5D9V A;  2C4J A;  4D73 B;  1GUH A;  3ZFL A;  1QQ2 A;  3LFL A;  1Y6E A;  2O87 A;  1XVW A;  1M9B A;  1G6Y A;  4J56 E;  2B1K A;  17GS A;  1M7T A;  4HEA 2;  4ZB6 A;  1V2A A;  3SWL A;  5A4W A;  3GNJ A;  3QMX A;  1SD8 A;  1X9W B;  3CRT A;  2VLT A;  4F03 A;  5C04 A;  4ICY A;  4WBJ A;  2R0C A;  1K0D A;  2K8V A;  2AJQ B;  4L5L A;  2LJA A;  4KCE A;  2ZNM A;  3J7Y k;  2H8L A;  2DJ0 A;  2FA4 A;  4BVY A;  2DJ3 A;  5J9C A;  2M80 A;  1WOU A;  5F05 A;  1ML6 A;  1VGL A;  2PBJ A;  3A2V A;  1GSD A;  2CV4 A;  5ELG A;  2PU9 C;  2FD3 A;  1ZCP A;  1EOG A;  3IOS A;  4TR3 A;  3UMA A;  1DBY A;  2H30 A;  5D96 A;  4KCA A;  1VF4 A;  5G5E A;  3PGT A;  3TKP A;  1S3C A;  1N8J A;  2HSM A;  2JZT A;  4G9H A;  1OKT A;  5IO2 A;  1SJI A;  5CRD A;  4PNF A;  2DIY A;  3SBC A;  3DD3 A;  5CYY A;  5G31 A;  1A2L A;  2GDR A;  2C3N A;  2WCI A;  4BA7 A;  2PUK C;  4KDX A;  3IC8 A;  5CRW A;  1PN0 A;  1EGO A;  2AUV A;  2ZUP A;  3IC4 A;  4HU7 A;  3EUR A;  3CYN A;  4H86 A;  3UAR A;  2C0G A;  1A2J A;  5D8I A;  3WT1 A;  4O5U A;  2RM5 A;  1THO A;  1VF2 A;  1W89 A;  2LEG A;  4MH2 A;  1WIK A;  3FR9 A;  3FHK A;  3W8S A;  2J23 A;  3V1W A;  2KUC A;  4K8M A;  4KH7 A;  4HI7 A;  5ECI B;  2EIR A;  5IMF A;  1XWK A;  3MNG A;  2HZE A;  1OC8 A;  3IA1 A;  3GYK A;  4NWY A;  3GTU A;  5GSS A;  6GST A;  1GUM A;  3U6V A;  5G2Z A;  1XW6 A;  4AJ6 A;  1TK8 B;  1PA3 A;  4ZB9 A;  4XIH A;  5B8B A;  1Q4J A;  2A2P A;  4LA1 A;  1ZYP A;  3A3T A;  2NTO A;  1SKW B;  2FWH A;  4GLT A;  4X0X A;  4XS4 A;  1B9X C;  2DJK A;  1BQ7 A;  1O8X A;  2IJY A;  4LL4 B;  1ZZY A;  1IYI A;  3GKK A;  1KEB A;  1MD4 A;  3RDW A;  4OFN A;  4FQU A;  3VLN A;  1OC9 A;  3VUR A;  2P0G A;  5IO0 A;  1PKW A;  1ZMA A;  4I8B A;  2WFC A;  5AN1 A;  1MEK A;  2H1D A;  1GRX A;  3GRX A;  2B3S A;  4IW9 A;  3QOU A;  3KP9 A;  2L5L A;  2E2M A;  2PER A;  4JZQ A;  4XTS A;  3GX0 A;  2OBI A;  4HZ4 A;  3ZIV A;  1EV9 A;  3D22 A;  2NDO A;  4GTU A;  3KGK A;  4I5Q A;  4JED A;  4DEJ A;  2O7K A;  2QKE A;  1Z6N A;  4IJ3 A;  4D73 A;  3L9S A;  5D93 A;  1ZYE A;  2E0Q A;  3D6I A;  6GSU A;  4IQ1 A;  1GUL A;  1PX7 A;  2BTO T;  1YKA A;  4XRD A;  5JWQ B;  2DJ2 A;  2H19 A;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...