2YNYA

Salmonella enterica sada 255-302 fused to gcn4 adaptors (sadak1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ynyA00
3MGNA 2YO3A 1NWQA 2W27A 5APQA 2W6AA 1HUCA 1G2CB 1H8AA 4AYCA 3A5TA 4I6MC 2WPRA 1CI6B 1J2JB 3P8MC 2WTYA 2P7JA 3OAKA 2JJLA 4C46A 3VTPC 3M06A 2WPSA 3P32A 1GU5A 3M0AA 2P67A 2VRSA 4C7NA 1S9KD 4JYBA 1T2KD 2H7HA 5APUA 1A02J 2R5BA 5AVWB 1T2KC 1JNMA 1HWTC 4C7NB 2ZFCA 5APWA 3VMYA 2IPPA 3TNUA 3HE4A 2QM8A 3A3YB 4LC1A 2Q3IA 5CMZA 5APVA 1GD2E 2C9LY 3O8ZA 3L36A 1CSBA 5APTA 1KQLA 5AVSB 3NTNA 1S9KE 5AVYB 3TYYA 3KDPB 3L37A 1JUNA 1NAFA 3A2AA 1MFZA 1CI6A 3M0DA 1GK4A 3P7KA 1MUUA 1HJBA 3UIAA 5AW1B 3LIEA 2Q7CA 3M9HA 3L35A 1OWAA 5AVQB 2WT7B 2KP8A 4M3LA 4B86A 2XZRA 5AVUB 3A7OA 5AW5B 5AW3B 3HTKA 5AVTB 2Z5IA 2BASA 4I2LC 1X8YA 3M91A 5AVZB 5APSA 3NMDA 3TK1A 3V4WA 3V4QA 2C9NY 4GKGA 1FAVA 5APXA 5AW4B 2ZXEB 2R3CA 2WWWA 4AUWA 5AVRB 1SP4A 3V5BA 2N9BA 1FOSE 4XE5B 1GK6A 3HE5A 4GT1A 2QM7A 5AVVB 3VYIA 1CZQA 3KQGA 5AVXB 2YNYA 3HE5B 2Q5UA 3T97A 1A02F 3I5CA 2XU6A 3VN0A 2WT7A 3LIDA 5AW2B 1YYCA 1IO4A 3M9BA 5AW6B 2XV5A 1OXZA 3SWFA 5AW7B 5APYA 2E43A 3NFQA 1MV8A 4HYTB 2R32A 1H89A 1GU4A 5AW0B 4RESB 1SLQA 2P2UA 4EOTA 1HBWA 3B8EB 3VMXA 2Z5HA 1DH3A 2WPQA 1GZLA 1H88A 5AW9B 3NXSA 1GTWA 1FOSF 3MD0A 5AW8B 3VMZA 3TNUB 4DZOA 3IR9A 4KHXA 2R5DA 2YO2A 4AQRD 3HE4B 2E42A 4JYCA
chains in the Genus database with same CATH superfamily
3D70A 5KJ7D 1NWQA 1SQQG 1AJYA 2QE7H 1BDCA 1DD4A 2FYNC 2V7QJ 3PLNA 3N4XA 2WPRA 2ZAEB 4JF7A 1NGMB 2IBZG 3RBZA 3A0BE 3OA7A 5GTIH 5E79E 4H44C 2KNCB 2P7JA 1DEBA 3OAKA 2JJLA 4ASWA 3IN6A 1SQXE 2K9JA 2FYUK 3TGUG 1LT9A 3W68A 2V7QH 2AEJA 3P32A 1GU5A 4A7PA 2LXBA 2O3JA 3GHGB 1NU1K 1PP9G 2KOGA 2P67A 2QIWA 4MN4C 1PP9D 1GDTA 2G8YA 3B5NB 3QH9A 3LW5H 1S3JA 1G1JA 1USEA 2BEQD 4R4MA 5EFWB 2O01H 5K5GB 1T2KC 1HWTC 4IL6X 2ZFCA 3VMYA 1PPJE 3CXHH 3OW2O 3TNUA 1JCCA 3AEAC 1SQBG 4YPCA 1LT9B 2NPSC 3CWBE 3D6YA 1ZN5A 4LC1A 4N3YB 1ZR2A 2OYHB 2E75C 1IFNA 1SQBK 5CCGC 2C9LY 1FJPA 1K73Q 3GG2A 3CWBJ 4H0LB 3NTNA 1N7SB 1Q86Q 2JP3A 1VQ4P 4DOJA 3L4FA 2YXQB 1NAFA 3RL0C 3PHLA 2FFDC 1KFMA 1QGKB 1MUUA 4RKUJ 1HJBA 3CCQP 2IFNA 3HUSC 3A0BH 3L70D 1KILD 1RHZB 3H1KD 1FJKA 2WSEJ 2FXMA 3CL3D 4PD4E 2O01J 1LTGC 3M9HA 1U7JA 1OWAA 2WT7B 4Z1MH 2KP8A 2ZVOB 1HF9A 1NKNA 1S4XA 4M3LA 1PGJA 2WMMA 4WWIA 1G1IA 1BGYD 2XZRA 4WBAA 5AVUB 2QG4A 3BRTB 1YJNP 1PIXA 3AE5C 3HTKA 3CCJP 1VQMP 3L71G 1SFCC 1SQVG 3L74E 2HG5D 3L71D 1PGQA 1FAVA 1BCCD 1SQPK 2ZYAA 3AEDC 1X22A 1LJ2A 1URQB 4GKGA 2N1TD 3H1LE 5APXA 3RBXA 1FDOA 1EZVD 1BSNA 1M8OB 1HTLC 2GA1A 2KS1A 2R3CA 3L75D 4AUWA 4RO0A 1BE3G 3Q5PA 2Q6QA 3VP9A 1FZCC 1M7LA 2B9BA 3JCUE 1LTJA 2PRRA 4WB4A 1HVVA 1MFTA 2KYVA 1N86A 2QM7A 1YQ3C 2SPZA 4LLHA 1GL2D 2G3AA 3EFGA 3CCRP 4IFFA 5TJHA 3BATA 2A45H 1J1EC 1L0NE 2RKLA 1M1JA 2XKMA 2K1AA 2Q5UA 1RQVA 3M0DC 2UWJE 2QEXP 4H13B 1RF1C 1W5CE 2CPBA 3LIDA 1JTHB 2OYOA 4WY4B 3H25A 1LP1A 1VQPP 2QJYC 2YIUC 1NU1G 1NTMD 2YKPA 1BDDA 3KZIH 4EYYQ 3SFDC 1EDJA 3L75J 4EDFA 2FYUG 5APYA 2W6BA 1KD1Q 2KI7B 2L91A 1XTCC 2ZJSE 2HPCB 1WRGA 1VQNP 1S5LX 4H44D 5CBNA 2QA4P 4EOTA 1GU4A 2P2UA 1URQA 1KILC 5KJ7C 3VMXA 4OVNF 1JY3O 1GW3A 2FXOA 2ZT9D 3KXDA 4U3FG 3RK3C 1M56D 4PV1D 1VF5B 1L0LJ 3I55P 1GZLA 1N73C 3GHGA 5AW9B 1AQ5A 1EC5A 3C1LA 4Y99C 3V2QA 3O6QA 4WVZA 4W7ZA 4PV1B 1CW5A 5KLVD 3GHGC 5AW8B 3VMZA 2KSEA 4I1LA 3V2RA 1SQVK 1R5SA 1NVOA 2JWDA 2CK3H 2E74D 1JCDA 1NTZJ 2MKVA 4AQRD 2KSJA 1SQQJ 1EQ7A 2KK7A 3BCCE 1YTZT 5CCGD 1KZUB 3S4RA 1ZP0C 2YO3A 3WUUA 4DCKA 2W27A 3GMAA 1BGYJ 1FC2C 1VQLP 3TDKA 1OIPA 2E75B 1JTHA 2P58A 3H1KE 1J2JB 1LWUA 2HLOA 1L0LD 2OARA 4I6MC 4XA4A 2FY8A 1IK7A 3TGUJ 3CWBD 2XDJA 1IFJA 3IAOA 4H0LC 4K3AA 1L4AA 1N7SC 1KB9H 2D2CD 1MKMA 3H1ID 2K37A 3L73D 3USSA 5KAIE 3H1HD 2WPSA 2M8RA 3QWOC 1KB9D 2FYUJ 4L74A 2Q1KA 1LTJB 3AE4C 1S9KD 1SQPD 2O1JA 2OYHA 1ZR4A 2IX7C 1A02J 2J5UA 1QLED 2FYZA 2R5BA 1G2CA 2Y0DA 3E1IA 4C7NB 1YBKA 5CJ0A 1BCCE 1Y47A 1ZOYC 2B87A 1L4AD 3HE4A 3L70E 4TT3H 3L72D 1FZFA 3CXHD 1YJWP 2E76D 5BU8B 3HD7C 1AVYA 2WITA 4HKZH 3HTKB 4ZMDA 1CSBA 5AVSB 3PP5A 1P84E 1PP9E 5AVYB 5DJUB 2K9JB 1KQFB 3TYYA 2FYUD 2YKQA 3AEGC 1M90Q 1VQ8P 1JUNA 1EDLA 2Y0EA 3FXDA 1M1JC 1SFCA 3M0DA 3MTUE 1H0TB 1FZGA 1YTZI 5TISH 1OW6A 5AW1B 3UIAA 3RK2D 3LIEA 3RGUA 3Q1MA 1NTME 3JSVC 3L72J 2NRGA 3IFMA 3H1LD 4L75A 5KJ7A 4LGDE 2OTLP 1AV1A 1KB9I 5AVQB 1BE3E 3BRVB 2N1TC 4D6TG 2D2CB 4CPGA 2OYIC 1HGVA 2QVAA 4YXDC 3H32A 1J1DB 1S1CX 1SQQK 2H43A 3AE7C 2KLVA 1SFCD 2OGUA 3H1LG 2I8DA 4OWFA 1J1EB 3CCMP 3A7OA 2IZ0A 3TSIA 3CMAP 3P8CE 5AW5B 1RF1B 4L76A 1GL2B 3FGAD 5AVTB 5B66H 2M3EA 3G71P 1EDKA 2BASA 3L74J 4I2LC 3AE1C 3RK2B 1LT1A 5APSA 1LTTC 3V4WA 2C9NY 5KAFE 1W2BO 1OVRA 4PD4D 2R3SA 3N7NA 5AW4B 1NTKJ 4HH2A 4UB8E 1FZCA 2WSFH 1AA0A 1TU3F 2JDIH 2WWWA 1URQD 3HRNA 3G4SP 2JEEA 1SP4A 3B5ND 3CX5H 1FOSE 4GT1A 1SQXK 3KYQA 2Y9ZA 4DJGA 2QJPB 3CX5D 2IDBA 1VF5C 5AVXB 1IZNB 1ZLLA 3HE5B 3L74D 3AE8C 2XU6A 3L70G 2Q3EA 4PV1C 4W7YA 3VN0A 1BCCG 1ZW0A 1ZXGA 1KILE 2WT7A 3CI9A 3CCEP 2RN0A 3H32B 5GTHH 2XV5A 1KQGB 5KLVE 3SWFA 1JY2O 3EFFK 1IFPA 5AW7B 1KB9E 2E43A 1MV8A 1R5LA 1R8EA 5KAIH 1KILA 2E74C 1KYOD 3M9QA 2KUBA 2NPSA 3CWBG 1OVVA 1RE3C 1S2EA 3EWKA 1JY3N 3FWLA 3H6PA 2BCCJ 2ZYDA 4U3FD 1N8RQ 1HBWA 2RMZA 1L0LK 3WUTA 2CPSA 5H2FE 5KAFH 4D6TE 1DH3A 1KN7A 1N7SD 2GUSA 2OTKE 3H1KG 3L72E 1Y9BA 1PGOA 3L71E 3CXHE 2PGDA 3NXSA 1NTMG 2RH0A 4R4LA 3B71A 1D7MA 3AE2C 3MD0A 1NTZK 3ITKA 3TNUB 1NKZB 1ZV8A 3FX0A 1NTZG 2ZT9B 2I1KA 3G9RA 1BSHA 4HB1A 2OYHC 5M1BA 1Y8AA 2E5YA 4IFDK 2W83C 3VP8A 1SQXJ 3WU2E 3RL0g 1QX8A 1SS1A 3HE4B 4Y28J 2B87B 2E42A 4JYCA 1FZBA 1NTKK 2C0XA 2P1JA 3MGNA 1QEXA 2W6JH 5APQA 2W6AA 2IBZD 1G2CB 1M57D 4AYCA 1L0ND 3L72G 1KC8Q 2FFDB 1VQ6P 4GIFA 1CI6B 3P8MC 2E5TA 3F89A 3CXHI 3KHUA 4HJGH 4DZOA 3CC2P 1SQPJ 3PJSK 3T97B 4BRYB 1X0TA 4OGQC 2OYIA 1BE3D 2E76B 4NPEA 1RY3A 1DIPA 1EZVG 3M0AA 3MHVA 1WMKA 2VRSA 1QVFO 5KKZB 4W80A 1T3JA 1FDIA 1USDA 3BCCD 2FYUE 5APUA 5DJTB 5CJ4A 1NHLA 1K05A 1JEKA 4YTPC 1VL2A 5KLVG 1K8AQ 1LTAC 5B5EH 3BVHA 2WSSH 5AVWB 5L8RJ 1Z56A 3D6ZA 1K9MQ 3MUDC 1IFMA 1U57A 3SWKA 2IPPA 5KLIC 1N73A 1BGYG 4QMAA 1WT6A 1SFCB 5APVA 2OYIB 2N1TA 1UIIA 1AQTA 1L0NK 2C0WA 3AE3C 1J1DC 3H1IE 3H1IJ 1NU1J 3H1HE 3GW6A 1OW8A 3H1JE 2JR8A 3L36A 3O8ZA 3R2PA 1MZ9A 3G6EP 2KIKA 3C9IA 3G3ZA 1S9KE 3BASA 3O6QB 1GL2C 3L37A 3BCCG 2IBZI 3CX5E 2JWAA 2KZIA 2QRXA 3PH0A 2BEZF 1VDFA 2IFMA 2FYNB 3KPEA 5KLVK 1ZMEC 1L2PA 2AXTH 2ZXXA 1DEEG 3P7KA 3CCVP 3CC4P 1PGPA 2LKMA 2Y9YA 3RK3E 1NJIQ 1OZHA 3L74G 3S1KA 1GMJA 2A06E 2HR3A 3L73J 3PRJA 1L0LE 2HPCA 1YIJP 4H13C 2Q7CA 2BCCG 2NZ2A 3L35A 4WY4C 5GTHE 4ZNCA 2YIUB 1HJ0A 3HD7A 3L73E 4B86A 1P84D 1VF5D 1AVOA 1RE4A 3B5NC 4WY4D 3V2PA 1FZAA 4H13D 1JMBA 1LWUC 3S9OA 4PD4I 3WUVA 1JOCA 1M1KQ 3W67A 2Z5IA 2E75D 1S5LH 3Q5RA 5CCHD 4IL6H 1NTZD 1LT9C 2NPSB 3AECC 4L73A 3M91A 1KILB 2LR2A 3TK1A 2A45I 2K3RA 2M3BA 3V4QA 2Q9IA 3C8VA 2OTJP 3H1JJ 2M5AB 1NU1E 3H1HJ 3HUSA 3RK3B 2ZXEB 1YHQP 1S72P 3AEBC 4Y99B 3TGUD 2IYPA 1NYHA 1L0NG 2PP6A 1IFIA 1VQ5P 3RL0B 1VPCA 3L71J 1EXIA 1H0TA 4H0LD 1YJ9P 1GK6A 3HE5A 4N78D 1Q81Q 2R44A 4D6TJ 1FE6A 1P84I 1SQBD 1ZRTD 3KQGA 4TLFA 3L75G 3WU2H 1X79B 4KJMA 4U3FE 1JB0J 1SQQD 3U59A 5CCGA 1KV4A 1SQPE 1Q7YQ 2B88A 1JY2P 3I5CA 3H1LJ 5AW2B 1SQVD 1YYCA 2ITAA 3A0HE 2KZJA 4XFJA 1LNQA 3VOPA 1KORA 3M9BA 5AW6B 5KLVJ 1PV3A 2WQYC 2GUVA 3MIWA 2FKWB 1JM0A 1K04A 1RE3A 2W90A 2WSFJ 1RF0A 2I1JA 1OW7A 3Q2YA 4ASVA 3Q3DA 1YITP 1H89A 1PFIA 1X9VA 5AW0B 4JPZB 1SLQA 1NH4A 1OFCX 2JO1A 1N2DC 4NPFX 3U1CA 1Q90D 3P8CD 1W2EA 4PJ0E 1JMMA 1URQC 1NTKG 2WPQA 1L4AB 1QL2A 2IBZE 3CX5I 3SFEC 4OGQB 2J59M 2E76C 1H88A 1JY2N 1YI2P 1YQ4C 2QJKB 4BWNA 3CCLP 3K5BA 2M0BA 1OX3A 2OQQA 1KMIZ 4BRYA 4EI2A 3JCUH 1NTKE 2V4HA 2YXRB 2POHA 3II6A 3AEFC 3HD7B 4UB6E 5BU5A 1KYOE 1NTMK 2IZ1A 5KTBA 2YO2A 2MJZA 4O9BA 2Z4EA 3FWNA 2K9YA 5CBOA 2BCCE 4UB8H 1E5WA 4RJTA 1HUCA 1L0LG 2QJYB 2AXTE 3A5TA 2KB7P 2A06G 4EIJA 1RE4C 3B5NA 3CPWO 1H8AA 2A06D 3A0HH 2DW3A 2AEFA 1LTBC 1OMIA 3KZIE 1U7MA 2WTYA 1Q82Q 5C39A 2J58A 2IYOA 1AFOA 2HFED 1Q2NA 4C46A 2HYNA 1GW4A 3AE6C 3M06A 3VTPC 3H1JD 4C7RA 3CD6P 4OGQD 2KNCA 4C7NA 2N1TB 4JYBA 1FS0E 1T2KD 2H7HA 1FDMA 1VQOP 4PJ0H 1NO4A 3E1RA 3OJAB 1N73B 1N7LA 3H1IG 3VMAA 1JNMA 4I7ZC 1KQSO 1LTIC 2WSEH 5APWA 5B66E 4IL6E 4D6TD 1IO4A 1PP9J 1SQXG 3HD7D 4GDOA 3RK3D 1QL1A 1XTGB 2QM8A 4WY4A 3A3YB 5CMZA 1JY3P 2Q3IA 1JO5A 1HGZA 5CHXA 2LXCB 5APTA 1LWUB 1KQLA 2HODA 2W8ZA 3GLMA 4H44B 1N7SA 3V2NA 5CCHA 1VQ7P 3L70J 2WSCJ 3KDPB 2YMYA 4U7JA 1IFDA 3A2AA 1SQBE 1MFZA 1ZRTE 2FBWC 1IJDB 1EXJA 4GOFA 1KTMA 1PPJG 1CI6A 2L5GB 1GK4A 4BXLA 2P10A 2FFDA 2PAJA 3E7KA 3CC7P 4DT0A 1SQVE 4U3FJ 2KXPB 3RL0D 2H89C 3MZWB 1BE3J 1LGHB 2WZ7A 2PFXA 3AEEC 2N9YB 2AEMA 1SQXD 1KFNA 1LTJC 1NTMJ 2A45G 1RH5B 1NAYA 2YMKA 3F5HA 4IFMA 1T8ZA 4JQ0D 3TGUE 1FU1A 3MP7B 3H1KJ 1PZQA 2KLUA 1T6AA 4N78E 1VQ9P 2NPSD 4GODA 3GF3A 4NPDA 5AW3B 2E74B 1IC2A 1FZEA 4JBZA 1RF1A 1SQQE 1X8YA 3H1JG 5AVZB 3AE9C 3NMDA 1RQUA 2K88A 2JKVA 5H2FH 1PPJD 3ABVC 3I56P 2M5AA 3HUSB 1FBMA 3CMEP 3WMM0 2ZVNB 4ZKUA 2ZYGA 3ZDMA 1DX7A 1LP1B 3L73G 1SVFA 1P84H 5BVZA 1PL5A 3CLQA 3MUDA 1NOHA 1BCCJ 4GOEA 5AVRB 2N9BA 3V5BA 4XE5B 1M1JB 3CCSP 1KYOH 2ZT9C 5AVVB 1CZQA 4KT0J 3PTZA 3VYIA 2O01N 2BCCD 3GF7A 1L4AC 2AXCA 2QSIA 2WSCH 5TISE 2YNYA 3T97A 1A02F 2QJKC 2YKOA 1E79H 4YXWH 2H88C 4PD4H 1NU1D 4UB6H 2B89A 2KS1B 2D2CC 3L75E 5GTIE 5E79H 1EZVI 1OXZA 3EQ2A 1VQKP 3H1HG 1NTKD 3JC22 3NFQA 4HYTB 2R32A 3TF5A 3B4SA 3LW5J 2WPVB 1BGYE 1OVUA 3CCUP 3Q5SA 1FZCB 4RESB 1L0NJ 1S5LE 3R4YA 3RK2C 3SSUA 3SWYA 1HH0A 3U1AA 3FXEA 3B8EB 3BCCJ 5KKZC 2Z5HA 1QVGO 1DD3A 1NTZE 5B5EE 1T3UA 5CCHC 4ZKPA 1IK9A 2O1KA 1GL2A 1LTSC 4IOIH 4N6JA 3V6IA 2GM4A 1SQVJ 1GTWA 2H8PD 5KLIB 1FOSF 1EZVE 2HODB 1SQPG 2XNDH 3IR9A 4KHXA 2R5DA 1UIXA 2Y0CA 2QJPC 4K35A 2FXPA 4OH8B 1EDIA 1SQBJ 1GD2E 3D71A 2WVRA 3IF4A 1KYOI 4I7ZB 1RF0C 2XNXA
chains in the Genus database with same CATH topology
5KJ7D 1NWQA 3N4XA 2WPRA 4JF7A 3OA7A 5BVZA 2P7JA 1DEBA 3OAKA 2JJLA 2FYUK 1LT9A 3P32A 1GU5A 3GHGB 1NU1K 2P67A 2KOGA 1GDTA 3B5NB 3LW5H 1G1JA 2O01H 1T2KC 1HWTC 2ZFCA 3VMYA 3TNUA 1JCCA 1LT9B 2NPSC 1ZN5A 4LC1A 4N3YB 1ZR2A 2OYHB 1IFNA 1SQBK 5CCGC 2C9LY 1FJPA 3NTNA 1N7SB 4DOJA 3L4FA 1NAFA 3RL0C 2FFDC 1KFMA 1MUUA 1HJBA 2IFNA 3HUSC 1KILD 1FJKA 3CL3D 2FXMA 1LTGC 3M9HA 1OWAA 2WT7B 2KP8A 1NKNA 4M3LA 1G1IA 2XZRA 4WBAA 5AVUB 3BRTB 3HTKA 1SFCC 2HG5D 4GKGA 1FAVA 1SQPK 1URQB 2N1TD 5APXA 1HTLC 2R3CA 4AUWA 1FZCC 3VP9A 1M7LA 1LTJA 1HVVA 2KYVA 1N86A 2QM7A 4LLHA 1GL2D 3EFGA 4IFFA 3BATA 2A45H 1J1EC 2XKMA 1M1JA 3M0DC 2Q5UA 1FZFA 1RF1C 2CPBA 3LIDA 1JTHB 4WY4B 2YKPA 5APYA 2W6BA 1XTCC 2HPCB 1WRGA 1GU4A 4EOTA 2P2UA 1URQA 1KILC 5KJ7C 3VMXA 1JY3O 1GW3A 3RK3C 1N73C 1GZLA 1AQ5A 3GHGA 5AW9B 4Y99C 3V2QA 4W7ZA 1CW5A 3GHGC 5AW8B 3VMZA 4I1LA 3V2RA 1SQVK 1JCDA 4AQRD 2KSJA 1EQ7A 1YTZT 5CCGD 1KZUB 2YO3A 2W27A 4I6MC 1JTHA 1J2JB 1LWUA 2HLOA 2OARA 4XA4A 2XDJA 1IFJA 1L4AA 1N7SC 2WPSA 2M8RA 1S9KD 1LTJB 2O1JA 2OYHA 1ZR4A 2IX7C 1A02J 2FYZA 2R5BA 1G2CA 3E1IA 4C7NB 5CJ0A 1L4AD 3HE4A 5BU8B 3HD7C 2WITA 3HTKB 1CSBA 5AVSB 3PP5A 5AVYB 3TYYA 2YKQA 1JUNA 1M1JC 1SFCA 3M0DA 3MTUE 1FZGA 1YTZI 3UIAA 5AW1B 3RK2D 3LIEA 3IFMA 5KJ7A 4LGDE 5AVQB 3BRVB 2N1TC 2OYIC 1HGVA 3H32A 1J1DB 1SQQK 2H43A 2KLVA 1SFCD 1J1EB 3A7OA 3TSIA 3P8CE 5AW5B 1RF1B 5AVTB 1GL2B 2BASA 4I2LC 3RK2B 3V4WA 5APSA 1LTTC 2C9NY 3N7NA 5AW4B 4HH2A 1FZCA 2WSFH 2WWWA 1URQD 3HRNA 2JEEA 1SP4A 3B5ND 1FOSE 4GT1A 1SQXK 3KYQA 5AVXB 1ZLLA 3HE5B 2XU6A 4W7YA 3VN0A 2WT7A 3CI9A 3H32B 2XV5A 3SWFA 1JY2O 5AW7B 2E43A 1MV8A 1KILA 3M9QA 2NPSA 1RE3C 1JY3N 1HBWA 3H6PA 1L0LK 2CPSA 1DH3A 1N7SD 2GUSA 3NXSA 3MD0A 4DZOA 1NTZK 3TNUB 1NKZB 1ZV8A 2I1KA 2OYHC 4IFDK 3VP8A 3HE4B 2E42A 4JYCA 1FZBA 1NTKK 2C0XA 2P1JA 3MGNA 5APQA 2W6AA 1G2CB 4AYCA 2FFDB 4GIFA 1CI6B 3P8MC 2OYIA 1RY3A 3M0AA 2VRSA 4W80A 1T3JA 5CJ4A 5APUA 1NHLA 3BVHA 1LTAC 5AVWB 1Z56A 1IFMA 2IPPA 1N73A 1WT6A 1SFCB 5APVA 2OYIB 2N1TA 1L0NK 2C0WA 1GD2E 1J1DC 3O8ZA 4WB4A 3R2PA 3L36A 1MZ9A 1S9KE 3C9IA 3G3ZA 3BASA 1GL2C 3L37A 5KLVK 2IFMA 1VDFA 3KPEA 3P7KA 2LKMA 2HPCA 2Q7CA 3L35A 4WY4C 3HD7A 4B86A 4WY4D 1RE4A 3B5NC 3V2PA 1FZAA 1LWUC 1JOCA 2Z5IA 5CCHD 1LT9C 2NPSB 3M91A 1KILB 3TK1A 2Q9IA 2A45I 2M3BA 3V4QA 3HUSA 3RK3B 2ZXEB 4Y99B 2PP6A 1IFIA 3RL0B 1VPCA 1GK6A 3HE5A 4N78D 3KQGA 1X79B 5CCGA 3U59A 1JY2P 3I5CA 5AW2B 1YYCA 3VOPA 1IO4A 3M9BA 5AW6B 2GUVA 3MIWA 2FKWB 1RE3A 1H89A 1RF0A 2I1JA 1PFIA 1X9VA 5AW0B 1SLQA 1NH4A 1N2DC 3U1CA 3P8CD 1W2EA 1JMMA 1URQC 2WPQA 1L4AB 1QL2A 2J59M 1H88A 1JY2N 3II6A 2POHA 5BU5A 3HD7B 5KTBA 1NTMK 2YO2A 2MJZA 4O9BA 2Z4EA 1E5WA 1HUCA 1H8AA 3A5TA 1JO5A 2KB7P 4EIJA 1RE4C 3B5NA 1LTBC 2WTYA 2J58A 1AFOA 2HFED 4C46A 2HYNA 1GW4A 3M06A 3VTPC 4C7RA 4C7NA 2N1TB 4JYBA 1T2KD 2H7HA 1FDMA 1NO4A 3OJAB 1N73B 1N7LA 1JNMA 1LTIC 2WSEH 5APWA 3HD7D 3RK3D 1QL1A 1XTGB 2QM8A 4WY4A 3A3YB 5CMZA 1JY3P 2Q3IA 1HGZA 5CHXA 5APTA 1LWUB 1KQLA 2HODA 3V2NA 1N7SA 5CCHA 3KDPB 2YMYA 1IFDA 3A2AA 1MFZA 1IJDB 1CI6A 2L5GB 1GK4A 2FFDA 2PAJA 3RL0D 1LGHB 2WZ7A 1KFNA 2A45G 1LTJC 4IFMA 1T8ZA 1FU1A 4N78E 2NPSD 5AW3B 1IC2A 1FZEA 1RF1A 1X8YA 5AVZB 3NMDA 3HUSB 1FBMA 3WMM0 4ZKUA 1DX7A 1SVFA 3MUDA 3CLQA 5AVRB 1NOHA 3V5BA 2N9BA 4XE5B 1M1JB 5AVVB 3VYIA 1CZQA 1L4AC 2WSCH 2YNYA 3T97A 1A02F 2YKOA 1OXZA 3EQ2A 3NFQA 4HYTB 2R32A 1FZCB 4RESB 3U1AA 3SWYA 3RK2C 1HH0A 3B8EB 2Z5HA 1T3UA 5CCHC 4ZKPA 1IK9A 2O1KA 1GL2A 1LTSC 4N6JA 2GM4A 1GTWA 2H8PD 1FOSF 2HODB 3IR9A 4KHXA 2R5DA 4OH8B 1RF0C 2XNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGN A;  2YO3 A;  1NWQ A;  2W27 A;  5APQ A;  2W6A A;  1HUC A;  1G2C B;  1H8A A;  4AYC A;  3A5T A;  4I6M C;  2WPR A;  1CI6 B;  1J2J B;  3P8M C;  2WTY A;  2P7J A;  3OAK A;  2JJL A;  4C46 A;  3VTP C;  3M06 A;  2WPS A;  3P32 A;  1GU5 A;  3M0A A;  2P67 A;  2VRS A;  4C7N A;  1S9K D;  4JYB A;  1T2K D;  2H7H A;  5APU A;  1A02 J;  2R5B A;  5AVW B;  1T2K C;  1JNM A;  1HWT C;  4C7N B;  2ZFC A;  5APW A;  3VMY A;  2IPP A;  3TNU A;  3HE4 A;  2QM8 A;  3A3Y B;  4LC1 A;  2Q3I A;  5CMZ A;  5APV A;  1GD2 E;  2C9L Y;  3O8Z A;  3L36 A;  1CSB A;  5APT A;  1KQL A;  5AVS B;  3NTN A;  1S9K E;  5AVY B;  3TYY A;  3KDP B;  3L37 A;  1JUN A;  1NAF A;  3A2A A;  1MFZ A;  1CI6 A;  3M0D A;  1GK4 A;  3P7K A;  1MUU A;  1HJB A;  3UIA A;  5AW1 B;  3LIE A;  2Q7C A;  3M9H A;  3L35 A;  1OWA A;  5AVQ B;  2WT7 B;  2KP8 A;  4M3L A;  4B86 A;  2XZR A;  5AVU B;  3A7O A;  5AW5 B;  5AW3 B;  3HTK A;  5AVT B;  2Z5I A;  2BAS A;  4I2L C;  1X8Y A;  3M91 A;  5AVZ B;  5APS A;  3NMD A;  3TK1 A;  3V4W A;  3V4Q A;  2C9N Y;  4GKG A;  1FAV A;  5APX A;  5AW4 B;  2ZXE B;  2R3C A;  2WWW A;  4AUW A;  5AVR B;  1SP4 A;  3V5B A;  2N9B A;  1FOS E;  4XE5 B;  1GK6 A;  3HE5 A;  4GT1 A;  2QM7 A;  5AVV B;  3VYI A;  1CZQ A;  3KQG A;  5AVX B;  2YNY A;  3HE5 B;  2Q5U A;  3T97 A;  1A02 F;  3I5C A;  2XU6 A;  3VN0 A;  2WT7 A;  3LID A;  5AW2 B;  1YYC A;  1IO4 A;  3M9B A;  5AW6 B;  2XV5 A;  1OXZ A;  3SWF A;  5AW7 B;  5APY A;  2E43 A;  3NFQ A;  1MV8 A;  4HYT B;  2R32 A;  1H89 A;  1GU4 A;  5AW0 B;  4RES B;  1SLQ A;  2P2U A;  4EOT A;  1HBW A;  3B8E B;  3VMX A;  2Z5H A;  1DH3 A;  2WPQ A;  1GZL A;  1H88 A;  5AW9 B;  3NXS A;  1GTW A;  1FOS F;  3MD0 A;  5AW8 B;  3VMZ A;  3TNU B;  4DZO A;  3IR9 A;  4KHX A;  2R5D A;  2YO2 A;  4AQR D;  3HE4 B;  2E42 A;  4JYC A; 
#chains in the Genus database with same CATH topology
 3D70 A;  5KJ7 D;  1NWQ A;  1SQQ G;  1AJY A;  2QE7 H;  1BDC A;  1DD4 A;  2FYN C;  2V7Q J;  3PLN A;  3N4X A;  2WPR A;  2ZAE B;  4JF7 A;  1NGM B;  2IBZ G;  3RBZ A;  3A0B E;  3OA7 A;  5GTI H;  5E79 E;  4H44 C;  2KNC B;  2P7J A;  1DEB A;  3OAK A;  2JJL A;  4ASW A;  3IN6 A;  1SQX E;  2K9J A;  2FYU K;  3TGU G;  1LT9 A;  3W68 A;  2V7Q H;  2AEJ A;  3P32 A;  1GU5 A;  4A7P A;  2LXB A;  2O3J A;  3GHG B;  1NU1 K;  1PP9 G;  2KOG A;  2P67 A;  2QIW A;  4MN4 C;  1PP9 D;  1GDT A;  2G8Y A;  3B5N B;  3QH9 A;  3LW5 H;  1S3J A;  1G1J A;  1USE A;  2BEQ D;  4R4M A;  5EFW B;  2O01 H;  5K5G B;  1T2K C;  1HWT C;  4IL6 X;  2ZFC A;  3VMY A;  1PPJ E;  3CXH H;  3OW2 O;  3TNU A;  1JCC A;  3AEA C;  1SQB G;  4YPC A;  1LT9 B;  2NPS C;  3CWB E;  3D6Y A;  1ZN5 A;  4LC1 A;  4N3Y B;  1ZR2 A;  2OYH B;  2E75 C;  1IFN A;  1SQB K;  5CCG C;  2C9L Y;  1FJP A;  1K73 Q;  3GG2 A;  3CWB J;  4H0L B;  3NTN A;  1N7S B;  1Q86 Q;  2JP3 A;  1VQ4 P;  4DOJ A;  3L4F A;  2YXQ B;  1NAF A;  3RL0 C;  3PHL A;  2FFD C;  1KFM A;  1QGK B;  1MUU A;  4RKU J;  1HJB A;  3CCQ P;  2IFN A;  3HUS C;  3A0B H;  3L70 D;  1KIL D;  1RHZ B;  3H1K D;  1FJK A;  2WSE J;  2FXM A;  3CL3 D;  4PD4 E;  2O01 J;  1LTG C;  3M9H A;  1U7J A;  1OWA A;  2WT7 B;  4Z1M H;  2KP8 A;  2ZVO B;  1HF9 A;  1NKN A;  1S4X A;  4M3L A;  1PGJ A;  2WMM A;  4WWI A;  1G1I A;  1BGY D;  2XZR A;  4WBA A;  5AVU B;  2QG4 A;  3BRT B;  1YJN P;  1PIX A;  3AE5 C;  3HTK A;  3CCJ P;  1VQM P;  3L71 G;  1SFC C;  1SQV G;  3L74 E;  2HG5 D;  3L71 D;  1PGQ A;  1FAV A;  1BCC D;  1SQP K;  2ZYA A;  3AED C;  1X22 A;  1LJ2 A;  1URQ B;  4GKG A;  2N1T D;  3H1L E;  5APX A;  3RBX A;  1FDO A;  1EZV D;  1BSN A;  1M8O B;  1HTL C;  2GA1 A;  2KS1 A;  2R3C A;  3L75 D;  4AUW A;  4RO0 A;  1BE3 G;  3Q5P A;  2Q6Q A;  3VP9 A;  1FZC C;  1M7L A;  2B9B A;  3JCU E;  1LTJ A;  2PRR A;  4WB4 A;  1HVV A;  1MFT A;  2KYV A;  1N86 A;  2QM7 A;  1YQ3 C;  2SPZ A;  4LLH A;  1GL2 D;  2G3A A;  3EFG A;  3CCR P;  4IFF A;  5TJH A;  3BAT A;  2A45 H;  1J1E C;  1L0N E;  2RKL A;  1M1J A;  2XKM A;  2K1A A;  2Q5U A;  1RQV A;  3M0D C;  2UWJ E;  2QEX P;  4H13 B;  1RF1 C;  1W5C E;  2CPB A;  3LID A;  1JTH B;  2OYO A;  4WY4 B;  3H25 A;  1LP1 A;  1VQP P;  2QJY C;  2YIU C;  1NU1 G;  1NTM D;  2YKP A;  1BDD A;  3KZI H;  4EYY Q;  3SFD C;  1EDJ A;  3L75 J;  4EDF A;  2FYU G;  5APY A;  2W6B A;  1KD1 Q;  2KI7 B;  2L91 A;  1XTC C;  2ZJS E;  2HPC B;  1WRG A;  1VQN P;  1S5L X;  4H44 D;  5CBN A;  2QA4 P;  4EOT A;  1GU4 A;  2P2U A;  1URQ A;  1KIL C;  5KJ7 C;  3VMX A;  4OVN F;  1JY3 O;  1GW3 A;  2FXO A;  2ZT9 D;  3KXD A;  4U3F G;  3RK3 C;  1M56 D;  4PV1 D;  1VF5 B;  1L0L J;  3I55 P;  1GZL A;  1N73 C;  3GHG A;  5AW9 B;  1AQ5 A;  1EC5 A;  3C1L A;  4Y99 C;  3V2Q A;  3O6Q A;  4WVZ A;  4W7Z A;  4PV1 B;  1CW5 A;  5KLV D;  3GHG C;  5AW8 B;  3VMZ A;  2KSE A;  4I1L A;  3V2R A;  1SQV K;  1R5S A;  1NVO A;  2JWD A;  2CK3 H;  2E74 D;  1JCD A;  1NTZ J;  2MKV A;  4AQR D;  2KSJ A;  1SQQ J;  1EQ7 A;  2KK7 A;  3BCC E;  1YTZ T;  5CCG D;  1KZU B;  3S4R A;  1ZP0 C;  2YO3 A;  3WUU A;  4DCK A;  2W27 A;  3GMA A;  1BGY J;  1FC2 C;  1VQL P;  3TDK A;  1OIP A;  2E75 B;  1JTH A;  2P58 A;  3H1K E;  1J2J B;  1LWU A;  2HLO A;  1L0L D;  2OAR A;  4I6M C;  4XA4 A;  2FY8 A;  1IK7 A;  3TGU J;  3CWB D;  2XDJ A;  1IFJ A;  3IAO A;  4H0L C;  4K3A A;  1L4A A;  1N7S C;  1KB9 H;  2D2C D;  1MKM A;  3H1I D;  2K37 A;  3L73 D;  3USS A;  5KAI E;  3H1H D;  2WPS A;  2M8R A;  3QWO C;  1KB9 D;  2FYU J;  4L74 A;  2Q1K A;  1LTJ B;  3AE4 C;  1S9K D;  1SQP D;  2O1J A;  2OYH A;  1ZR4 A;  2IX7 C;  1A02 J;  2J5U A;  1QLE D;  2FYZ A;  2R5B A;  1G2C A;  2Y0D A;  3E1I A;  4C7N B;  1YBK A;  5CJ0 A;  1BCC E;  1Y47 A;  1ZOY C;  2B87 A;  1L4A D;  3HE4 A;  3L70 E;  4TT3 H;  3L72 D;  1FZF A;  3CXH D;  1YJW P;  2E76 D;  5BU8 B;  3HD7 C;  1AVY A;  2WIT A;  4HKZ H;  3HTK B;  4ZMD A;  1CSB A;  5AVS B;  3PP5 A;  1P84 E;  1PP9 E;  5AVY B;  5DJU B;  2K9J B;  1KQF B;  3TYY A;  2FYU D;  2YKQ A;  3AEG C;  1M90 Q;  1VQ8 P;  1JUN A;  1EDL A;  2Y0E A;  3FXD A;  1M1J C;  1SFC A;  3M0D A;  3MTU E;  1H0T B;  1FZG A;  1YTZ I;  5TIS H;  1OW6 A;  5AW1 B;  3UIA A;  3RK2 D;  3LIE A;  3RGU A;  3Q1M A;  1NTM E;  3JSV C;  3L72 J;  2NRG A;  3IFM A;  3H1L D;  4L75 A;  5KJ7 A;  4LGD E;  2OTL P;  1AV1 A;  1KB9 I;  5AVQ B;  1BE3 E;  3BRV B;  2N1T C;  4D6T G;  2D2C B;  4CPG A;  2OYI C;  1HGV A;  2QVA A;  4YXD C;  3H32 A;  1J1D B;  1S1C X;  1SQQ K;  2H43 A;  3AE7 C;  2KLV A;  1SFC D;  2OGU A;  3H1L G;  2I8D A;  4OWF A;  1J1E B;  3CCM P;  3A7O A;  2IZ0 A;  3TSI A;  3CMA P;  3P8C E;  5AW5 B;  1RF1 B;  4L76 A;  1GL2 B;  3FGA D;  5AVT B;  5B66 H;  2M3E A;  3G71 P;  1EDK A;  2BAS A;  3L74 J;  4I2L C;  3AE1 C;  3RK2 B;  1LT1 A;  5APS A;  1LTT C;  3V4W A;  2C9N Y;  5KAF E;  1W2B O;  1OVR A;  4PD4 D;  2R3S A;  3N7N A;  5AW4 B;  1NTK J;  4HH2 A;  4UB8 E;  1FZC A;  2WSF H;  1AA0 A;  1TU3 F;  2JDI H;  2WWW A;  1URQ D;  3HRN A;  3G4S P;  2JEE A;  1SP4 A;  3B5N D;  3CX5 H;  1FOS E;  4GT1 A;  1SQX K;  3KYQ A;  2Y9Z A;  4DJG A;  2QJP B;  3CX5 D;  2IDB A;  1VF5 C;  5AVX B;  1IZN B;  1ZLL A;  3HE5 B;  3L74 D;  3AE8 C;  2XU6 A;  3L70 G;  2Q3E A;  4PV1 C;  4W7Y A;  3VN0 A;  1BCC G;  1ZW0 A;  1ZXG A;  1KIL E;  2WT7 A;  3CI9 A;  3CCE P;  2RN0 A;  3H32 B;  5GTH H;  2XV5 A;  1KQG B;  5KLV E;  3SWF A;  1JY2 O;  3EFF K;  1IFP A;  5AW7 B;  1KB9 E;  2E43 A;  1MV8 A;  1R5L A;  1R8E A;  5KAI H;  1KIL A;  2E74 C;  1KYO D;  3M9Q A;  2KUB A;  2NPS A;  3CWB G;  1OVV A;  1RE3 C;  1S2E A;  3EWK A;  1JY3 N;  3FWL A;  3H6P A;  2BCC J;  2ZYD A;  4U3F D;  1N8R Q;  1HBW A;  2RMZ A;  1L0L K;  3WUT A;  2CPS A;  5H2F E;  5KAF H;  4D6T E;  1DH3 A;  1KN7 A;  1N7S D;  2GUS A;  2OTK E;  3H1K G;  3L72 E;  1Y9B A;  1PGO A;  3L71 E;  3CXH E;  2PGD A;  3NXS A;  1NTM G;  2RH0 A;  4R4L A;  3B71 A;  1D7M A;  3AE2 C;  3MD0 A;  1NTZ K;  3ITK A;  3TNU B;  1NKZ B;  1ZV8 A;  3FX0 A;  1NTZ G;  2ZT9 B;  2I1K A;  3G9R A;  1BSH A;  4HB1 A;  2OYH C;  5M1B A;  1Y8A A;  2E5Y A;  4IFD K;  2W83 C;  3VP8 A;  1SQX J;  3WU2 E;  3RL0 g;  1QX8 A;  1SS1 A;  3HE4 B;  4Y28 J;  2B87 B;  2E42 A;  4JYC A;  1FZB A;  1NTK K;  2C0X A;  2P1J A;  3MGN A;  1QEX A;  2W6J H;  5APQ A;  2W6A A;  2IBZ D;  1G2C B;  1M57 D;  4AYC A;  1L0N D;  3L72 G;  1KC8 Q;  2FFD B;  1VQ6 P;  4GIF A;  1CI6 B;  3P8M C;  2E5T A;  3F89 A;  3CXH I;  3KHU A;  4HJG H;  4DZO A;  3CC2 P;  1SQP J;  3PJS K;  3T97 B;  4BRY B;  1X0T A;  4OGQ C;  2OYI A;  1BE3 D;  2E76 B;  4NPE A;  1RY3 A;  1DIP A;  1EZV G;  3M0A A;  3MHV A;  1WMK A;  2VRS A;  1QVF O;  5KKZ B;  4W80 A;  1T3J A;  1FDI A;  1USD A;  3BCC D;  2FYU E;  5APU A;  5DJT B;  5CJ4 A;  1NHL A;  1K05 A;  1JEK A;  4YTP C;  1VL2 A;  5KLV G;  1K8A Q;  1LTA C;  5B5E H;  3BVH A;  2WSS H;  5AVW B;  5L8R J;  1Z56 A;  3D6Z A;  1K9M Q;  3MUD C;  1IFM A;  1U57 A;  3SWK A;  2IPP A;  5KLI C;  1N73 A;  1BGY G;  4QMA A;  1WT6 A;  1SFC B;  5APV A;  2OYI B;  2N1T A;  1UII A;  1AQT A;  1L0N K;  2C0W A;  3AE3 C;  1J1D C;  3H1I E;  3H1I J;  1NU1 J;  3H1H E;  3GW6 A;  1OW8 A;  3H1J E;  2JR8 A;  3L36 A;  3O8Z A;  3R2P A;  1MZ9 A;  3G6E P;  2KIK A;  3C9I A;  3G3Z A;  1S9K E;  3BAS A;  3O6Q B;  1GL2 C;  3L37 A;  3BCC G;  2IBZ I;  3CX5 E;  2JWA A;  2KZI A;  2QRX A;  3PH0 A;  2BEZ F;  1VDF A;  2IFM A;  2FYN B;  3KPE A;  5KLV K;  1ZME C;  1L2P A;  2AXT H;  2ZXX A;  1DEE G;  3P7K A;  3CCV P;  3CC4 P;  1PGP A;  2LKM A;  2Y9Y A;  3RK3 E;  1NJI Q;  1OZH A;  3L74 G;  3S1K A;  1GMJ A;  2A06 E;  2HR3 A;  3L73 J;  3PRJ A;  1L0L E;  2HPC A;  1YIJ P;  4H13 C;  2Q7C A;  2BCC G;  2NZ2 A;  3L35 A;  4WY4 C;  5GTH E;  4ZNC A;  2YIU B;  1HJ0 A;  3HD7 A;  3L73 E;  4B86 A;  1P84 D;  1VF5 D;  1AVO A;  1RE4 A;  3B5N C;  4WY4 D;  3V2P A;  1FZA A;  4H13 D;  1JMB A;  1LWU C;  3S9O A;  4PD4 I;  3WUV A;  1JOC A;  1M1K Q;  3W67 A;  2Z5I A;  2E75 D;  1S5L H;  3Q5R A;  5CCH D;  4IL6 H;  1NTZ D;  1LT9 C;  2NPS B;  3AEC C;  4L73 A;  3M91 A;  1KIL B;  2LR2 A;  3TK1 A;  2A45 I;  2K3R A;  2M3B A;  3V4Q A;  2Q9I A;  3C8V A;  2OTJ P;  3H1J J;  2M5A B;  1NU1 E;  3H1H J;  3HUS A;  3RK3 B;  2ZXE B;  1YHQ P;  1S72 P;  3AEB C;  4Y99 B;  3TGU D;  2IYP A;  1NYH A;  1L0N G;  2PP6 A;  1IFI A;  1VQ5 P;  3RL0 B;  1VPC A;  3L71 J;  1EXI A;  1H0T A;  4H0L D;  1YJ9 P;  1GK6 A;  3HE5 A;  4N78 D;  1Q81 Q;  2R44 A;  4D6T J;  1FE6 A;  1P84 I;  1SQB D;  1ZRT D;  3KQG A;  4TLF A;  3L75 G;  3WU2 H;  1X79 B;  4KJM A;  4U3F E;  1JB0 J;  1SQQ D;  3U59 A;  5CCG A;  1KV4 A;  1SQP E;  1Q7Y Q;  2B88 A;  1JY2 P;  3I5C A;  3H1L J;  5AW2 B;  1SQV D;  1YYC A;  2ITA A;  3A0H E;  2KZJ A;  4XFJ A;  1LNQ A;  3VOP A;  1KOR A;  3M9B A;  5AW6 B;  5KLV J;  1PV3 A;  2WQY C;  2GUV A;  3MIW A;  2FKW B;  1JM0 A;  1K04 A;  1RE3 A;  2W90 A;  2WSF J;  1RF0 A;  2I1J A;  1OW7 A;  3Q2Y A;  4ASV A;  3Q3D A;  1YIT P;  1H89 A;  1PFI A;  1X9V A;  5AW0 B;  4JPZ B;  1SLQ A;  1NH4 A;  1OFC X;  2JO1 A;  1N2D C;  4NPF X;  3U1C A;  1Q90 D;  3P8C D;  1W2E A;  4PJ0 E;  1JMM A;  1URQ C;  1NTK G;  2WPQ A;  1L4A B;  1QL2 A;  2IBZ E;  3CX5 I;  3SFE C;  4OGQ B;  2J59 M;  2E76 C;  1H88 A;  1JY2 N;  1YI2 P;  1YQ4 C;  2QJK B;  4BWN A;  3CCL P;  3K5B A;  2M0B A;  1OX3 A;  2OQQ A;  1KMI Z;  4BRY A;  4EI2 A;  3JCU H;  1NTK E;  2V4H A;  2YXR B;  2POH A;  3II6 A;  3AEF C;  3HD7 B;  4UB6 E;  5BU5 A;  1KYO E;  1NTM K;  2IZ1 A;  5KTB A;  2YO2 A;  2MJZ A;  4O9B A;  2Z4E A;  3FWN A;  2K9Y A;  5CBO A;  2BCC E;  4UB8 H;  1E5W A;  4RJT A;  1HUC A;  1L0L G;  2QJY B;  2AXT E;  3A5T A;  2KB7 P;  2A06 G;  4EIJ A;  1RE4 C;  3B5N A;  3CPW O;  1H8A A;  2A06 D;  3A0H H;  2DW3 A;  2AEF A;  1LTB C;  1OMI A;  3KZI E;  1U7M A;  2WTY A;  1Q82 Q;  5C39 A;  2J58 A;  2IYO A;  1AFO A;  2HFE D;  1Q2N A;  4C46 A;  2HYN A;  1GW4 A;  3AE6 C;  3M06 A;  3VTP C;  3H1J D;  4C7R A;  3CD6 P;  4OGQ D;  2KNC A;  4C7N A;  2N1T B;  4JYB A;  1FS0 E;  1T2K D;  2H7H A;  1FDM A;  1VQO P;  4PJ0 H;  1NO4 A;  3E1R A;  3OJA B;  1N73 B;  1N7L A;  3H1I G;  3VMA A;  1JNM A;  4I7Z C;  1KQS O;  1LTI C;  2WSE H;  5APW A;  5B66 E;  4IL6 E;  4D6T D;  1IO4 A;  1PP9 J;  1SQX G;  3HD7 D;  4GDO A;  3RK3 D;  1QL1 A;  1XTG B;  2QM8 A;  4WY4 A;  3A3Y B;  5CMZ A;  1JY3 P;  2Q3I A;  1JO5 A;  1HGZ A;  5CHX A;  2LXC B;  5APT A;  1LWU B;  1KQL A;  2HOD A;  2W8Z A;  3GLM A;  4H44 B;  1N7S A;  3V2N A;  5CCH A;  1VQ7 P;  3L70 J;  2WSC J;  3KDP B;  2YMY A;  4U7J A;  1IFD A;  3A2A A;  1SQB E;  1MFZ A;  1ZRT E;  2FBW C;  1IJD B;  1EXJ A;  4GOF A;  1KTM A;  1PPJ G;  1CI6 A;  2L5G B;  1GK4 A;  4BXL A;  2P10 A;  2FFD A;  2PAJ A;  3E7K A;  3CC7 P;  4DT0 A;  1SQV E;  4U3F J;  2KXP B;  3RL0 D;  2H89 C;  3MZW B;  1BE3 J;  1LGH B;  2WZ7 A;  2PFX A;  3AEE C;  2N9Y B;  2AEM A;  1SQX D;  1KFN A;  1LTJ C;  1NTM J;  2A45 G;  1RH5 B;  1NAY A;  2YMK A;  3F5H A;  4IFM A;  1T8Z A;  4JQ0 D;  3TGU E;  1FU1 A;  3MP7 B;  3H1K J;  1PZQ A;  2KLU A;  1T6A A;  4N78 E;  1VQ9 P;  2NPS D;  4GOD A;  3GF3 A;  4NPD A;  5AW3 B;  2E74 B;  1IC2 A;  1FZE A;  4JBZ A;  1RF1 A;  1SQQ E;  1X8Y A;  3H1J G;  5AVZ B;  3AE9 C;  3NMD A;  1RQU A;  2K88 A;  2JKV A;  5H2F H;  1PPJ D;  3ABV C;  3I56 P;  2M5A A;  3HUS B;  1FBM A;  3CME P;  3WMM 0;  2ZVN B;  4ZKU A;  2ZYG A;  3ZDM A;  1DX7 A;  1LP1 B;  3L73 G;  1SVF A;  1P84 H;  5BVZ A;  1PL5 A;  3CLQ A;  3MUD A;  1NOH A;  1BCC J;  4GOE A;  5AVR B;  2N9B A;  3V5B A;  4XE5 B;  1M1J B;  3CCS P;  1KYO H;  2ZT9 C;  5AVV B;  1CZQ A;  4KT0 J;  3PTZ A;  3VYI A;  2O01 N;  2BCC D;  3GF7 A;  1L4A C;  2AXC A;  2QSI A;  2WSC H;  5TIS E;  2YNY A;  3T97 A;  1A02 F;  2QJK C;  2YKO A;  1E79 H;  4YXW H;  2H88 C;  4PD4 H;  1NU1 D;  4UB6 H;  2B89 A;  2KS1 B;  2D2C C;  3L75 E;  5GTI E;  5E79 H;  1EZV I;  1OXZ A;  3EQ2 A;  1VQK P;  3H1H G;  1NTK D;  3JC2 2;  3NFQ A;  4HYT B;  2R32 A;  3TF5 A;  3B4S A;  3LW5 J;  2WPV B;  1BGY E;  1OVU A;  3CCU P;  3Q5S A;  1FZC B;  4RES B;  1L0N J;  1S5L E;  3R4Y A;  3RK2 C;  3SSU A;  3SWY A;  1HH0 A;  3U1A A;  3FXE A;  3B8E B;  3BCC J;  5KKZ C;  2Z5H A;  1QVG O;  1DD3 A;  1NTZ E;  5B5E E;  1T3U A;  5CCH C;  4ZKP A;  1IK9 A;  2O1K A;  1GL2 A;  1LTS C;  4IOI H;  4N6J A;  3V6I A;  2GM4 A;  1SQV J;  1GTW A;  2H8P D;  5KLI B;  1FOS F;  1EZV E;  2HOD B;  1SQP G;  2XND H;  3IR9 A;  4KHX A;  2R5D A;  1UIX A;  2Y0C A;  2QJP C;  4K35 A;  2FXP A;  4OH8 B;  1EDI A;  1SQB J;  1GD2 E;  3D71 A;  2WVR A;  3IF4 A;  1KYO I;  4I7Z B;  1RF0 C;  2XNX A; 
#chains in the Genus database with same CATH homology
 5KJ7 D;  1NWQ A;  3N4X A;  2WPR A;  4JF7 A;  3OA7 A;  5BVZ A;  2P7J A;  1DEB A;  3OAK A;  2JJL A;  2FYU K;  1LT9 A;  3P32 A;  1GU5 A;  3GHG B;  1NU1 K;  2P67 A;  2KOG A;  1GDT A;  3B5N B;  3LW5 H;  1G1J A;  2O01 H;  1T2K C;  1HWT C;  2ZFC A;  3VMY A;  3TNU A;  1JCC A;  1LT9 B;  2NPS C;  1ZN5 A;  4LC1 A;  4N3Y B;  1ZR2 A;  2OYH B;  1IFN A;  1SQB K;  5CCG C;  2C9L Y;  1FJP A;  3NTN A;  1N7S B;  4DOJ A;  3L4F A;  1NAF A;  3RL0 C;  2FFD C;  1KFM A;  1MUU A;  1HJB A;  2IFN A;  3HUS C;  1KIL D;  1FJK A;  3CL3 D;  2FXM A;  1LTG C;  3M9H A;  1OWA A;  2WT7 B;  2KP8 A;  1NKN A;  4M3L A;  1G1I A;  2XZR A;  4WBA A;  5AVU B;  3BRT B;  3HTK A;  1SFC C;  2HG5 D;  4GKG A;  1FAV A;  1SQP K;  1URQ B;  2N1T D;  5APX A;  1HTL C;  2R3C A;  4AUW A;  1FZC C;  3VP9 A;  1M7L A;  1LTJ A;  1HVV A;  2KYV A;  1N86 A;  2QM7 A;  4LLH A;  1GL2 D;  3EFG A;  4IFF A;  3BAT A;  2A45 H;  1J1E C;  2XKM A;  1M1J A;  3M0D C;  2Q5U A;  1FZF A;  1RF1 C;  2CPB A;  3LID A;  1JTH B;  4WY4 B;  2YKP A;  5APY A;  2W6B A;  1XTC C;  2HPC B;  1WRG A;  1GU4 A;  4EOT A;  2P2U A;  1URQ A;  1KIL C;  5KJ7 C;  3VMX A;  1JY3 O;  1GW3 A;  3RK3 C;  1N73 C;  1GZL A;  1AQ5 A;  3GHG A;  5AW9 B;  4Y99 C;  3V2Q A;  4W7Z A;  1CW5 A;  3GHG C;  5AW8 B;  3VMZ A;  4I1L A;  3V2R A;  1SQV K;  1JCD A;  4AQR D;  2KSJ A;  1EQ7 A;  1YTZ T;  5CCG D;  1KZU B;  2YO3 A;  2W27 A;  4I6M C;  1JTH A;  1J2J B;  1LWU A;  2HLO A;  2OAR A;  4XA4 A;  2XDJ A;  1IFJ A;  1L4A A;  1N7S C;  2WPS A;  2M8R A;  1S9K D;  1LTJ B;  2O1J A;  2OYH A;  1ZR4 A;  2IX7 C;  1A02 J;  2FYZ A;  2R5B A;  1G2C A;  3E1I A;  4C7N B;  5CJ0 A;  1L4A D;  3HE4 A;  5BU8 B;  3HD7 C;  2WIT A;  3HTK B;  1CSB A;  5AVS B;  3PP5 A;  5AVY B;  3TYY A;  2YKQ A;  1JUN A;  1M1J C;  1SFC A;  3M0D A;  3MTU E;  1FZG A;  1YTZ I;  3UIA A;  5AW1 B;  3RK2 D;  3LIE A;  3IFM A;  5KJ7 A;  4LGD E;  5AVQ B;  3BRV B;  2N1T C;  2OYI C;  1HGV A;  3H32 A;  1J1D B;  1SQQ K;  2H43 A;  2KLV A;  1SFC D;  1J1E B;  3A7O A;  3TSI A;  3P8C E;  5AW5 B;  1RF1 B;  5AVT B;  1GL2 B;  2BAS A;  4I2L C;  3RK2 B;  3V4W A;  5APS A;  1LTT C;  2C9N Y;  3N7N A;  5AW4 B;  4HH2 A;  1FZC A;  2WSF H;  2WWW A;  1URQ D;  3HRN A;  2JEE A;  1SP4 A;  3B5N D;  1FOS E;  4GT1 A;  1SQX K;  3KYQ A;  5AVX B;  1ZLL A;  3HE5 B;  2XU6 A;  4W7Y A;  3VN0 A;  2WT7 A;  3CI9 A;  3H32 B;  2XV5 A;  3SWF A;  1JY2 O;  5AW7 B;  2E43 A;  1MV8 A;  1KIL A;  3M9Q A;  2NPS A;  1RE3 C;  1JY3 N;  1HBW A;  3H6P A;  1L0L K;  2CPS A;  1DH3 A;  1N7S D;  2GUS A;  3NXS A;  3MD0 A;  4DZO A;  1NTZ K;  3TNU B;  1NKZ B;  1ZV8 A;  2I1K A;  2OYH C;  4IFD K;  3VP8 A;  3HE4 B;  2E42 A;  4JYC A;  1FZB A;  1NTK K;  2C0X A;  2P1J A;  3MGN A;  5APQ A;  2W6A A;  1G2C B;  4AYC A;  2FFD B;  4GIF A;  1CI6 B;  3P8M C;  2OYI A;  1RY3 A;  3M0A A;  2VRS A;  4W80 A;  1T3J A;  5CJ4 A;  5APU A;  1NHL A;  3BVH A;  1LTA C;  5AVW B;  1Z56 A;  1IFM A;  2IPP A;  1N73 A;  1WT6 A;  1SFC B;  5APV A;  2OYI B;  2N1T A;  1L0N K;  2C0W A;  1GD2 E;  1J1D C;  3O8Z A;  4WB4 A;  3R2P A;  3L36 A;  1MZ9 A;  1S9K E;  3C9I A;  3G3Z A;  3BAS A;  1GL2 C;  3L37 A;  5KLV K;  2IFM A;  1VDF A;  3KPE A;  3P7K A;  2LKM A;  2HPC A;  2Q7C A;  3L35 A;  4WY4 C;  3HD7 A;  4B86 A;  4WY4 D;  1RE4 A;  3B5N C;  3V2P A;  1FZA A;  1LWU C;  1JOC A;  2Z5I A;  5CCH D;  1LT9 C;  2NPS B;  3M91 A;  1KIL B;  3TK1 A;  2Q9I A;  2A45 I;  2M3B A;  3V4Q A;  3HUS A;  3RK3 B;  2ZXE B;  4Y99 B;  2PP6 A;  1IFI A;  3RL0 B;  1VPC A;  1GK6 A;  3HE5 A;  4N78 D;  3KQG A;  1X79 B;  5CCG A;  3U59 A;  1JY2 P;  3I5C A;  5AW2 B;  1YYC A;  3VOP A;  1IO4 A;  3M9B A;  5AW6 B;  2GUV A;  3MIW A;  2FKW B;  1RE3 A;  1H89 A;  1RF0 A;  2I1J A;  1PFI A;  1X9V A;  5AW0 B;  1SLQ A;  1NH4 A;  1N2D C;  3U1C A;  3P8C D;  1W2E A;  1JMM A;  1URQ C;  2WPQ A;  1L4A B;  1QL2 A;  2J59 M;  1H88 A;  1JY2 N;  3II6 A;  2POH A;  5BU5 A;  3HD7 B;  5KTB A;  1NTM K;  2YO2 A;  2MJZ A;  4O9B A;  2Z4E A;  1E5W A;  1HUC A;  1H8A A;  3A5T A;  1JO5 A;  2KB7 P;  4EIJ A;  1RE4 C;  3B5N A;  1LTB C;  2WTY A;  2J58 A;  1AFO A;  2HFE D;  4C46 A;  2HYN A;  1GW4 A;  3M06 A;  3VTP C;  4C7R A;  4C7N A;  2N1T B;  4JYB A;  1T2K D;  2H7H A;  1FDM A;  1NO4 A;  3OJA B;  1N73 B;  1N7L A;  1JNM A;  1LTI C;  2WSE H;  5APW A;  3HD7 D;  3RK3 D;  1QL1 A;  1XTG B;  2QM8 A;  4WY4 A;  3A3Y B;  5CMZ A;  1JY3 P;  2Q3I A;  1HGZ A;  5CHX A;  5APT A;  1LWU B;  1KQL A;  2HOD A;  3V2N A;  1N7S A;  5CCH A;  3KDP B;  2YMY A;  1IFD A;  3A2A A;  1MFZ A;  1IJD B;  1CI6 A;  2L5G B;  1GK4 A;  2FFD A;  2PAJ A;  3RL0 D;  1LGH B;  2WZ7 A;  1KFN A;  2A45 G;  1LTJ C;  4IFM A;  1T8Z A;  1FU1 A;  4N78 E;  2NPS D;  5AW3 B;  1IC2 A;  1FZE A;  1RF1 A;  1X8Y A;  5AVZ B;  3NMD A;  3HUS B;  1FBM A;  3WMM 0;  4ZKU A;  1DX7 A;  1SVF A;  3MUD A;  3CLQ A;  5AVR B;  1NOH A;  3V5B A;  2N9B A;  4XE5 B;  1M1J B;  5AVV B;  3VYI A;  1CZQ A;  1L4A C;  2WSC H;  2YNY A;  3T97 A;  1A02 F;  2YKO A;  1OXZ A;  3EQ2 A;  3NFQ A;  4HYT B;  2R32 A;  1FZC B;  4RES B;  3U1A A;  3SWY A;  3RK2 C;  1HH0 A;  3B8E B;  2Z5H A;  1T3U A;  5CCH C;  4ZKP A;  1IK9 A;  2O1K A;  1GL2 A;  1LTS C;  4N6J A;  2GM4 A;  1GTW A;  2H8P D;  1FOS F;  2HOD B;  3IR9 A;  4KHX A;  2R5D A;  4OH8 B;  1RF0 C;  2XNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...