2YNYA

Salmonella enterica sada 255-302 fused to gcn4 adaptors (sadak1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ynyA00
1GTWA 1JNMA 1S9KE 5AW9B 1SLQA 2Z5HA 3I5CA 4C7NA 2WWWA 2BASA 2VRSA 3TNUB 3SWFA 3UIAA 4C7NB 2KP8A 2YO2A 1A02J 1HBWA 1CZQA 5AVVB 1YYCA 2R5DA 4GKGA 4LC1A 1H8AA 5AVTB 1FOSF 1CI6A 2P2UA 2WTYA 2XU6A 3M9BA 3TYYA 1T2KC 2P67A 3M91A 1SP4A 1GU4A 3V5BA 3NMDA 3P32A 3P7KA 1X8YA 5AVQB 4DZOA 3MGNA 2Q7CA 1NAFA 1H89A 3NTNA 3VMZA 4I6MC 5APWA 2P7JA 1OWAA 3NFQA 4AQRD 3A2AA 1S9KD 1HJBA 3HTKA 3MD0A 5AW3B 3V4QA 3VMXA 4JYBA 4AYCA 3OAKA 5APTA 3P8MC 3VN0A 3L35A 2QM8A 5AVSB 3M9HA 3HE5B 2W27A 5AW5B 1NWQA 2C9NY 3NXSA 3O8ZA 1FAVA 2E42A 1H88A 2QM7A 3M06A 3VMYA 2N9BA 3HE4B 4HYTB 5AVRB 3VTPC 5AVYB 1HWTC 3IR9A 3L36A 1GK6A 1GZLA 1KQLA 3A7OA 5AW7B 2R3CA 4KHXA 4XE5B 4M3LA 1MUUA 5AW1B 1G2CB 1J2JB 2ZFCA 3HE4A 5AW8B 1GU5A 2H7HA 5APUA 1T2KD 1GD2E 1IO4A 3TK1A 5AVWB 2E43A 2YNYA 1CSBA 3LIDA 3LIEA 2YO3A 2W6AA 2Z5IA 3T97A 5APVA 1CI6B 2WPQA 2Q3IA 5AW6B 2XZRA 1HUCA 4EOTA 1FOSE 3B8EB 5AW0B 1GK4A 2Q5UA 5APYA 4GT1A 5CMZA 3TNUA 1JUNA 2R5BA 3KQGA 1MV8A 3M0AA 5APQA 3L37A 4JYCA 4I2LC 5AW2B 2XV5A 3V4WA 4RESB 5AVUB 2IPPA 1OXZA 2C9LY 2R32A 4AUWA 3A5TA 2WPSA 3M0DA 2WT7A 2JJLA 5AVXB 1MFZA 5AVZB 5APSA 2ZXEB 3HE5A 5AW4B 3KDPB 1DH3A 4B86A 4C46A 2WT7B 2WPRA 5APXA 3VYIA 3A3YB 1A02F
chains in the Genus database with same CATH superfamily
2KSEA 1KB9I 5KTBA 1G2CA 1HF9A 2O01J 1SLQA 2Y0DA 3I5CA 4WWIA 3VOPA 1SFCC 2L91A 1JMMA 2UWJE 3L70G 3B5ND 2KYVA 1X79B 3KPEA 1FE6A 1T8ZA 2ZYDA 5KAFH 3HRNA 4EIJA 1DEEG 2KP8A 5H2FH 3CX5I 4PJ0H 3HD7B 1M8OB 1L0NE 2P58A 3AECC 2H43A 1NHLA 4L76A 3FXEA 4LGDE 4LC1A 2E5TA 1PGQA 1H8AA 5AVTB 1FZCA 3L75E 2GM4A 3CXHI 1LTAC 1U7JA 5KLVD 1Y8AA 3AE6C 2E76D 1YBKA 2RH0A 1SQQE 1T2KC 3H1LJ 1J1DB 5M1BA 3RK3D 1KB9E 2M8RA 4I7ZC 3L74G 4I1LA 3B4SA 3AEAC 1NTZK 2FYUK 1LTJA 1FBMA 1K05A 2N1TA 3NMDA 2K9JB 3RK3C 3BCCG 2OQQA 1VQ5P 2IBZD 1IJDB 1SQBK 1IFMA 3CWBE 2K3RA 1GL2A 2Q7CA 3G4SP 3BVHA 2FKWB 4Y99B 1E79H 3H25A 3Q3DA 1XTGB 4I7ZB 3WUUA 1JTHB 2WQYC 2KNCA 2YXRB 1SQVE 3U1CA 1S5LE 4CPGA 1VL2A 1JO5A 2CPBA 2K37A 1JEKA 3B5NC 4H44C 3OAKA 4UB8H 2E76C 1P84I 3N4XA 4OGQB 1KQFB 1SQBE 4H13D 1KV4A 3HUSB 3R2PA 3VMAA 1M1JB 1M57D 4H44D 2KS1A 2PFXA 1LGHB 3M9HA 5AW5B 2XKMA 1PPJD 2RN0A 3AE8C 2PGDA 2E42A 2JR8A 1S5LH 2PRRA 3TGUE 1QL1A 2LR2A 3L73D 1SQVG 3IFMA 2JO1A 5KLIC 2KUBA 1N7SB 3II6A 4EDFA 3A0BH 4N78E 1SQQK 2QJYB 3VTPC 4ZNCA 2W8ZA 4GOFA 1NTZJ 2FYUJ 1Q7YQ 5B66E 3H1KD 5GTIH 3PH0A 4IFFA 4EYYQ 1NTKG 5AW7B 1VQ6P 3H1JJ 3CL3D 4KHXA 5CCGA 3H6PA 4M3LA 1MUUA 3Q5PA 1RE3C 5KJ7C 2NPSC 1NJIQ 1D7MA 1GU5A 1BGYG 3A0BE 2QJPC 1EDKA 1GW4A 1SQPG 1RE4A 2K9YA 5CCGD 1QVFO 3BCCE 1BSNA 3SFEC 4YXDC 3CXHH 2H89C 1AQTA 1G1JA 3Q1MA 1QL2A 1L0LG 1JY3P 5APVA 3TGUJ 1N73A 2AXTE 3H32A 5AW6B 1Q82Q 3OJAB 1NU1G 3ITKA 4PD4H 3USSA 3IAOA 1SFCD 2XZRA 1VQ7P 2FFDB 3TGUD 2KI7B 2A45H 2N1TD 4H0LD 1NYHA 1KC8Q 1GK4A 3CMEP 1RHZB 4GT1A 4BRYB 5CMZA 1BE3D 3TSIA 4BXLA 1VQPP 1SQXG 1YITP 5APQA 1RE4C 3M0AA 1OMIA 2WMMA 5KLVE 4I2LC 4U3FE 4OH8B 3L75D 4DT0A 3CCJP 1SQBD 1SQQD 2XNDH 4RESB 2H88C 2IPPA 1YJ9P 2C9LY 2KK7A 1BCCG 1Q81Q 1JY2O 1RF1B 3M0DA 1NTME 5CBNA 1FZFA 3H1JD 2AEMA 5AVXB 4RJTA 3B71A 2ZXEB 3HE5A 4WY4A 1QGKB 3H1KJ 4PD4D 3IN6A 2WSEH 3KDPB 3PRJA 3V2NA 3V2PA 4K35A 1ZXGA 3CPWO 1SS1A 2BCCE 2BCCJ 5APXA 2HR3A 2E74D 2N9YB 1HVVA 4RKUJ 1FZEA 1GL2C 5KLIB 2QSIA 1SQQJ 1S3JA 2J58A 3ABVC 3WUVA 5BU5A 1GTWA 1S9KE 2Z5HA 1NGMB 2MKVA 1BCCE 1PGOA 1NTMK 2WVRA 2BASA 2O01H 1JY3N 2B9BA 3FWLA 1PP9E 3SFDC 2KB7P 1IZNB 3L74J 4C7NB 1T3JA 1Y9BA 1H0TB 2AXCA 5KLVK 2PAJA 4L73A 1BE3E 2E75C 4IFDK 1HBWA 2QA4P 1G1IA 3GF7A 3VP8A 2WPVB 3P8CE 1P84D 4Y99C 3OA7A 1BSHA 3BRVB 3L71J 4D6TG 1IFNA 4ZKPA 3F89A 1SQPJ 3H1HG 4L75A 5CJ4A 3KZIH 1L0NG 3AE3C 1L0ND 3MUDA 3QH9A 2C0XA 1LP1A 1QX8A 3GLMA 4KJMA 4PV1B 1GU4A 3V5BA 1PP9G 3AE5C 1UIXA 3AE1C 3P32A 3P7KA 1KQSO 1SQXE 3L4FA 5AW8B 1EXIA 3MHVA 5AVQB 3AEDC 1NAFA 3H32B 2OYHA 1DIPA 1SQXK 2MJZA 4MN4C 2M5AA 4O9BA 2PP6A 2O3JA 3AEEC 2OYIC 1PV3A 1KILB 1JY2N 1N86A 3KHUA 3CCVP 1HJBA 4Z1MH 2QE7H 1NU1K 2HLOA 3MD0A 2YIUB 5AW3B 2OYHB 2ZT9C 2JWDA 3AE7C 1MZ9A 2E76B 1BCCJ 4AYCA 1M7LA 4H44B 3AEGC 2A45G 1HGVA 1PGPA 1LP1B 5AVSB 5L8RJ 4OWFA 1VQNP 1OZHA 1KZUB 1T3UA 1IFJA 2KS1B 3HE5B 4XA4A 3WU2E 1ZR2A 4Y28J 2JDIH 1NWQA 3O8ZA 1NTKJ 1K8AQ 1FAVA 2FXPA 3GHGC 3H1IG 3H1JG 1LT9B 5CCHD 3I56P 1FZCB 2FFDA 3S9OA 1LT1A 2BEQD 1N7SA 3CI9A 3VMYA 3QWOC 3CXHD 1RQUA 3HE4B 5DJTB 4HYTB 5CJ0A 1SQQG 1SQBG 3H1ID 3D71A 1RF1C 3L75G 5AVYB 1LJ2A 2QJKB 1XTCC 3KXDA 1X22A 2D2CC 3IR9A 3RL0C 1AV1A 3EQ2A 4DCKA 1GK6A 4IFMA 3A7OA 1J1DC 5BU8B 4UB6H 1LTIC 1OW7A 1VDFA 1L0LJ 2FYZA 4XE5B 3S1KA 3TGUG 3S4RA 1G2CB 1SQVJ 1OW8A 3HE4A 4YPCA 2H7HA 3PTZA 5APUA 1BDCA 2M3EA 1NU1D 2FFDC 1IK9A 3CCRP 5GTHE 1NKZB 1NVOA 4OGQC 3MIWA 3TK1A 2R3SA 1HH0A 5AVWB 3W68A 2LXBA 3H1HJ 3LIEA 1E5WA 1URQD 1X9VA 3JSVC 3P8CD 4WVZA 1BDDA 3CWBJ 1MFTA 1LWUC 1GW3A 1M56D 1SQXJ 2IBZE 2WSFH 1DD3A 3HD7D 2QEXP 1CI6B 1GDTA 3V2RA 2Q3IA 1LTBC 2L5GB 2ZXXA 2ZJSE 1S1CX 4NPEA 1RF1A 3LW5J 1VF5B 1KYOE 2I1KA 3BRTB 1WT6A 1PP9D 4TLFA 5KKZC 1PPJE 1SQPE 2FY8A 1USEA 2WSCH 3PP5A 1ZOYC 1HTLC 1EC5A 1VQ4P 2ITAA 2SPZA 4BRYA 3PLNA 4IL6H 3H1HD 1YI2P 1MV8A 4OVNF 3L37A 5AW2B 1LT9C 4D6TD 1Q86Q 1OX3A 2J59M 1L4AC 4PD4E 1YHQP 2C0WA 1SQVD 2IZ0A 2YXQB 3TDKA 5E79H 3HTKB 1WMKA 3R4YA 5GTHH 1DX7A 1MFZA 2KNCB 1FDMA 3CC7P 1PPJG 3LW5H 2Z4EA 1P84H 1OVUA 2NZ2A 4WY4C 1EZVI 2KSJA 4GDOA 5KAFE 3M9QA 1NTKE 2YIUC 4B86A 5TJHA 2WT7B 3VYIA 3C9IA 2B87A 1VQKP 1RY3A 2XDJA 3AE2C 1L4AB 3CCUP 1A02F 3H1KE 3U1AA 1Z56A 1NO4A 4QMAA 2HFED 5CCHA 1JNMA 1ZRTE 5AW9B 1ZR4A 2A06E 2WWWA 2I8DA 1M90Q 4W80A 1S72P 1EDJA 1SFCA 1VF5D 3SWFA 4UB6E 2Q1KA 1FJKA 1NU1E 3UIAA 1LTGC 1R5SA 5B5EE 4PV1C 2YO2A 1K73Q 1PP9J 1JM0A 1BCCD 2FYNC 5AVVB 1FZCC 2R5DA 2IBZG 4GKGA 2K9JA 4EI2A 3AEBC 2KOGA 3O6QA 1LTJB 1NAYA 1FOSF 2WTYA 3T97B 1SQXD 1BE3G 3TYYA 2P67A 1Q90D 3C1LA 3FX0A 2E5YA 1IK7A 1FDOA 1IFDA 3L72E 4KT0J 4C7RA 1KTMA 4JQ0D 5KLVG 1CW5A 4XFJA 1FU1A 1YQ4C 3H1LE 5CBOA 1KMIZ 3CCMP 4DZOA 1EZVE 3MGNA 1H89A 1JY2P 3L71E 1L0LD 2QVAA 3CLQA 1NTMJ 3NTNA 4HH2A 4I6MC 3VMZA 3CX5E 3A0HH 1KD1Q 2P7JA 1ZV8A 1YJNP 2OYIB 1KYOD 1L0NJ 3A2AA 4L74A 1KORA 1FDIA 1L4AD 1SQPD 3L70D 3HUSA 1W2EA 1HJ0A 4PD4I 4PV1D 1BGYD 1USDA 3H1IJ 4HJGH 3V4QA 2IYOA 3O6QB 3VMXA 2IYPA 2WSFJ 2YMYA 4JYBA 2ZYAA 2LKMA 1LTSC 3BASA 1W5CE 3P8MC 5APTA 2IDBA 1K9MQ 1FS0E 5E79E 3RK2D 2JKVA 1KFNA 1NTKD 1IC2A 1VQ9P 2QJKC 1EZVG 3D70A 2M3BA 4RO0A 3Q5RA 3H1KG 2C9NY 1N7LA 2K1AA 4N6JA 3ZDMA 1KB9H 1PL5A 1JB0J 1UIIA 5C39A 1H88A 1JOCA 2FYNB 2QM7A 2O1JA 4WY4D 5DJUB 2KLVA 1KYOH 3H1HE 3L73G 3B5NA 2FXMA 2N9BA 1VQMP 2AEFA 1EQ7A 1OIPA 2BCCD 2QJYC 4W7YA 1T6AA 1YTZT 1HWTC 3HUSC 2OARA 1KILC 4DOJA 1FZGA 2FXOA 3CX5H 1OFCX 4WY4B 1KQLA 2QRXA 1P84E 4U3FJ 3H1JE 5K5GB 3M0DC 4LLHA 2OYHC 5AW1B 1J2JB 2JEEA 2M0BA 1AVOA 2AXTH 2I1JA 1NTZE 2FYUE 3G9RA 2Y0CA 3L72G 3N7NA 1IFPA 1S2EA 3RK2B 3RK3E 1URQB 2P1JA 1LT9A 1K04A 3MP7B 1OW6A 1N73B 1RQVA 1GD2E 2QJPB 2RMZA 2V7QH 1IO4A 1BGYE 1U7MA 2E43A 2YO3A 1JTHA 2W6AA 1VPCA 2WZ7A 2HODA 1NTKK 4JBZA 2E75D 4NPDA 3G3ZA 3T97A 2O01N 2WPQA 2FBWC 3L71D 4GODA 1JY3O 2WSEJ 4ZMDA 1Q2NA 1EDIA 3CCQP 3BCCD 3BCCJ 3E1RA 2IX7C 1RH5B 2N1TB 1MKMA 2ZAEB 1HUCA 3RK2C 3A0HE 5CHXA 1N8RQ 1FOSE 3L74D 1FC2C 2G8YA 3KYQA 1M1KQ 1L2PA 1AQ5A 3GHGA 5APYA 3WU2H 2LXCB 1FZAA 1FJPA 3TNUA 4U7JA 3CXHE 3KQGA 3GG2A 3RBXA 3FGAD 2OTJP 2E74B 2KIKA 2E75B 2ZYGA 1Y47A 3H1IE 4R4LA 1EDLA 3GF3A 5AVUB 4GIFA 2JWAA 2NPSA 4GOEA 4DJGA 3A5TA 2HYNA 3G6EP 1LNQA 1YTZI 2AEJA 2JJLA 4U3FD 5AVZB 2HPCB 2BEZF 5APSA 1SQPK 5AW4B 3I55P 3RL0B 4K3AA 2H8PD 1M1JA 2IFMA 2OYIA 2A06D 1DH3A 4C46A 2WPRA 1RF0C 4WBAA 2WSSH 1SVFA 1VQ8P 4HKZH 1KILD 3JCUE 1W2BO 2V7QJ 5KKZB 1SQBJ 1ZN5A 2JP3A 3RBZA 3L75J 1HGZA 2B89A 1PZQA 3JC22 4C7NA 2D2CB 1JCDA 2RKLA 1NTZG 2FYUG 2VRSA 1X0TA 1BE3J 3TNUB 3E7KA 5B66H 5GTIE 1QVGO 3D6YA 3L74E 1SQVK 2CPSA 2OTKE 5KAIE 4ASWA 3G71P 1VF5C 1A02J 1CZQA 2G3AA 1URQC 1YYCA 4UB8E 1VQLP 4IOIH 3SWKA 1KN7A 2HG5D 1PGJA 4OGQD 1CI6A 2DW3A 2KLUA 2P2UA 2XU6A 2KXPB 3M9BA 5TISE 3CCLP 2GUVA 1JMBA 1GL2D 2OGUA 3CWBG 1EXJA 1LTTC 2J5UA 3M91A 5KJ7D 4N3YB 1AA0A 2IZ1A 2E74C 5H2FE 1NH4A 1NTMD 2GUSA 1SP4A 3SWYA 3Q5SA 2KZIA 1AFOA 3GW6A 2ZT9B 3AEFC 1J1EC 1X8YA 3CC2P 2YKQA 3HD7A 3WUTA 1LTJC 2QG4A 1KB9D 1R8EA 1YQ3C 5APWA 4ZKUA 1QLED 1RF0A 1DEBA 1OWAA 3FXDA 3EFGA 3H1LG 3NFQA 4AQRD 1N2DC 4BWNA 1S5LX 2O1KA 3RL0g 1NTZD 2FYUD 3EWKA 1S9KD 3F5HA 1U57A 2HPCA 2P10A 5KLVJ 2OTLP 2Q3EA 3HTKA 1GMJA 2IFNA 1FZBA 3RK3B 3CX5D 3BATA 3V2QA 3L73J 3RL0D 5EFWB 3K5BA 3VN0A 4JPZB 4H13C 1KYOI 3GMAA 1YJWP 3AE9C 2A06G 3L35A 1ZLLA 2QM8A 3MTUE 3WMM0 2W27A 5TISH 1PIXA 3NXSA 4U3FG 4PJ0E 2YKPA 2IBZI 2Y0EA 5CCHC 3W67A 2Q9IA 4R4MA 3M06A 3CMAP 3B5NB 1DD4A 3C8VA 3EFFK 4A7PA 3CD6P 1TU3F 3PHLA 5AVRB 1PFIA 1BGYJ 3MZWB 4H0LB 1M1JC 3L70J 3TF5A 1KILA 1KILE 1SFCB 2YMKA 1LWUA 3L36A 3L73E 1GZLA 3CC4P 1YIJP 1ZRTD 2R3CA 4N78D 1ZW0A 1L0LE 2WITA 3D6ZA 5KAIH 2ZFCA 5B5EH 3PJSK 5BVZA 1L4AA 2Q6QA 1T2KD 1L0NK 4TT3H 2CK3H 4YXWH 1NKNA 2N1TC 4HB1A 3U59A 1RE3A 3JCUH 3L71G 4D6TJ 3VP9A 5KJ7A 4W7ZA 2YNYA 1CSBA 2POHA 3AE4C 3LIDA 2HODB 2W6JH 3Q2YA 3H1LD 2Z5IA 3MUDC 1R5LA 2ZVNB 3IF4A 1J1EB 4IL6X 2GA1A 2W90A 3RGUA 2B88A 2V4HA 3L72J 3L72D 1ZP0C 3V6IA 2NRGA 1N73C 4D6TE 4EOTA 1NTMG 1IFIA 3B8EB 1KQGB 1S4XA 2R44A 4H0LC 5AW0B 1H0TA 2Q5UA 1LWUB 3CWBD 1QEXA 2ZVOB 2ZT9D 1N7SD 2Y9YA 2OYOA 3FWNA 1JUNA 2R5BA 1L0LK 1WRGA 4YTPC 2W6BA 4JYCA 3SSUA 3V4WA 2XV5A 3HD7C 2XNXA 2BCCG 1OVRA 1GL2B 1AJYA 1NU1J 1OXZA 1NOHA 2K88A 2A45I 2R32A 4AUWA 2NPSB 3L70E 2WPSA 1JCCA 2WSCJ 3E1IA 2B87B 2KZJA 5CCGC 4WB4A 2Y9ZA 1ZMEC 2WT7A 4H13B 3OW2O 2QIWA 2YKOA 4ASVA 3KZIE 4IL6E 2NPSD 3CCEP 3GHGB 4NPFX 1EZVD 2M5AB 4JF7A 1AVYA 1KFMA 1OVVA 3CCSP 1URQA 3A3YB 1VQOP 2W83C 1N7SC 2D2CD
chains in the Genus database with same CATH topology
5KTBA 1G2CA 1SLQA 3I5CA 3VOPA 1SFCC 1JMMA 3B5ND 2KYVA 1X79B 3KPEA 1T8ZA 3HRNA 4EIJA 2KP8A 3HD7B 2H43A 1NHLA 4LGDE 1H8AA 4LC1A 5AVTB 1FZCA 1LTAC 1T2KC 1J1DB 3RK3D 2M8RA 4I1LA 1NTZK 2FYUK 1LTJA 1FBMA 2N1TA 3NMDA 2GM4A 3RK3C 1IJDB 1SQBK 1IFMA 3BVHA 1GL2A 2Q7CA 2FKWB 4Y99B 1XTGB 1JTHB 3U1CA 1JO5A 2CPBA 3B5NC 3OAKA 3N4XA 3HUSB 3R2PA 1M1JB 3M9HA 1LGHB 5AW5B 2XKMA 2E42A 1QL1A 3IFMA 1N7SB 3II6A 4N78E 1SQQK 3VTPC 4IFFA 5AW7B 3CL3D 4KHXA 5CCGA 3H6PA 4M3LA 1MUUA 1RE3C 5KJ7C 2NPSC 1GW4A 1RE4A 5CCGD 1G1JA 1QL2A 5APVA 1JY3P 1N73A 3H32A 5AW6B 3OJAB 1SFCD 2XZRA 2FFDB 2N1TD 2A45H 1GK4A 4GT1A 5CMZA 3TSIA 5APQA 1RE4C 3M0AA 4I2LC 4OH8B 4RESB 2C9LY 2IPPA 1JY2O 1RF1B 3M0DA 1FZFA 5AVXB 2ZXEB 3HE5A 4WY4A 3V2NA 2WSEH 3KDPB 3V2PA 5APXA 1HVVA 1FZEA 1GL2C 2J58A 5BU5A 1GTWA 1S9KE 2Z5HA 1NTMK 2BASA 2O01H 1JY3N 2KB7P 4C7NB 1T3JA 5KLVK 2PAJA 4IFDK 1HBWA 1G1IA 3P8CE 4Y99C 3OA7A 3BRVB 4ZKPA 1IFNA 5CJ4A 3MUDA 2C0XA 1GU4A 3V5BA 3P32A 3P7KA 3L4FA 5AVQB 1NAFA 3H32B 2OYHA 1SQXK 2MJZA 4O9BA 2PP6A 2OYIC 1KILB 1JY2N 1N86A 1HJBA 3MD0A 1NU1K 2HLOA 5AW3B 2OYHB 1MZ9A 4AYCA 1M7LA 2A45G 1HGVA 5AVSB 1KZUB 1T3UA 1IFJA 3HE5B 4XA4A 1ZR2A 1NWQA 3O8ZA 1FAVA 3GHGC 2FFDA 5CCHD 1LT9B 1FZCB 3VMYA 1N7SA 3CI9A 3HE4B 4HYTB 5CJ0A 1RF1C 5AVYB 1XTCC 3IR9A 3RL0C 3EQ2A 1GK6A 4IFMA 3A7OA 1J1DC 5BU8B 1LTIC 1VDFA 2FYZA 4XE5B 1G2CB 3HE4A 2H7HA 5APUA 2FFDC 1IK9A 1NKZB 3MIWA 3TK1A 5AVWB 1HH0A 3LIEA 1E5WA 1URQD 1X9VA 3P8CD 1LWUC 1GW3A 2WSFH 3HD7D 1CI6B 1GDTA 3V2RA 2Q3IA 1LTBC 2L5GB 1RF1A 2I1KA 3BRTB 1WT6A 2WSCH 3PP5A 1HTLC 1MV8A 3L37A 5AW2B 1LT9C 2J59M 1L4AC 2C0WA 3HTKB 1DX7A 1MFZA 1FDMA 2Z4EA 3LW5H 4WY4C 2KSJA 3M9QA 4B86A 2WT7B 3VYIA 3C9IA 1RY3A 2XDJA 1L4AB 1A02F 3U1AA 1Z56A 1NO4A 2HFED 5CCHA 1JNMA 5AW9B 1ZR4A 2WWWA 4W80A 1SFCA 3SWFA 1FJKA 3UIAA 1LTGC 2YO2A 5AVVB 1FZCC 2R5DA 4GKGA 2KOGA 1LTJB 1FOSF 2WTYA 3TYYA 2P67A 4C7RA 1IFDA 1CW5A 1FU1A 4DZOA 3MGNA 1H89A 1JY2P 3NTNA 3CLQA 3VMZA 4HH2A 4I6MC 2OYIB 2P7JA 1ZV8A 3A2AA 1L4AD 3HUSA 1W2EA 3V4QA 3VMXA 2YMYA 4JYBA 2LKMA 1LTSC 3BASA 5APTA 3P8MC 1PFIA 3RK2D 1KFNA 1IC2A 2M3BA 2C9NY 1N7LA 4N6JA 1H88A 1JOCA 2QM7A 2O1JA 4WY4D 2KLVA 3B5NA 2FXMA 2N9BA 1EQ7A 4W7YA 1YTZT 1HWTC 3HUSC 2OARA 1KILC 4DOJA 1FZGA 4WY4B 1KQLA 3M0DC 4LLHA 2OYHC 5AW1B 1J2JB 2JEEA 5AW8B 3VP8A 2I1JA 1GU5A 3N7NA 3RK2B 1URQB 2P1JA 1LT9A 1N73B 1GD2E 1IO4A 2E43A 2YO3A 1JTHA 2W6AA 1VPCA 2WZ7A 2HODA 1NTKK 3T97A 3G3ZA 2WPQA 1JY3O 2IX7C 2N1TB 1HUCA 3RK2C 1FOSE 5CHXA 3KYQA 1AQ5A 3GHGA 5APYA 1FJPA 1FZAA 3TNUA 3KQGA 5AVUB 4GIFA 2NPSA 3A5TA 2HYNA 1YTZI 2JJLA 5AVZB 2HPCB 5APSA 1SQPK 5AW4B 3RL0B 2H8PD 1M1JA 2IFMA 2OYIA 1DH3A 4C46A 2WPRA 1RF0C 4WBAA 1SVFA 1KILD 1ZN5A 1HGZA 4C7NA 1JCDA 2VRSA 3TNUB 1SQVK 2CPSA 1A02J 1CZQA 1URQC 1YYCA 2HG5D 1CI6A 2P2UA 2XU6A 3M9BA 2GUVA 1GL2D 1LTTC 3M91A 5KJ7D 4N3YB 3SWYA 1NH4A 2GUSA 1SP4A 1AFOA 1J1EC 1X8YA 2YKQA 3HD7A 1LTJC 5APWA 4ZKUA 1RF0A 1DEBA 1OWAA 3EFGA 3NFQA 4AQRD 1N2DC 2O1KA 2HPCA 1S9KD 3HTKA 2IFNA 1FZBA 3RK3B 3BATA 3V2QA 3RL0D 3VN0A 3L35A 1ZLLA 2QM8A 3MTUE 3WMM0 2W27A 3NXSA 2YKPA 5CCHC 2Q9IA 3M06A 3B5NB 5AVRB 1M1JC 1KILA 1SFCB 1LWUA 3L36A 1GZLA 2R3CA 4N78D 2WITA 2ZFCA 5BVZA 1L4AA 1T2KD 1L0NK 1NKNA 2N1TC 3U59A 1RE3A 5KJ7A 3VP9A 4W7ZA 3LIDA 2YNYA 1CSBA 2POHA 2HODB 2Z5IA 1J1EB 1N73C 4EOTA 1IFIA 3B8EB 5AW0B 2Q5UA 1LWUB 1N7SD 1JUNA 2R5BA 1L0LK 1WRGA 2W6BA 4JYCA 3V4WA 2XV5A 3HD7C 2XNXA 1GL2B 1OXZA 1NOHA 2A45I 2R32A 4AUWA 2NPSB 2WPSA 1JCCA 3E1IA 5CCGC 4WB4A 2WT7A 2YKOA 2NPSD 3GHGB 4JF7A 1KFMA 1URQA 3A3YB 1N7SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTW A;  1JNM A;  1S9K E;  5AW9 B;  1SLQ A;  2Z5H A;  3I5C A;  4C7N A;  2WWW A;  2BAS A;  2VRS A;  3TNU B;  3SWF A;  3UIA A;  4C7N B;  2KP8 A;  2YO2 A;  1A02 J;  1HBW A;  1CZQ A;  5AVV B;  1YYC A;  2R5D A;  4GKG A;  4LC1 A;  1H8A A;  5AVT B;  1FOS F;  1CI6 A;  2P2U A;  2WTY A;  2XU6 A;  3M9B A;  3TYY A;  1T2K C;  2P67 A;  3M91 A;  1SP4 A;  1GU4 A;  3V5B A;  3NMD A;  3P32 A;  3P7K A;  1X8Y A;  5AVQ B;  4DZO A;  3MGN A;  2Q7C A;  1NAF A;  1H89 A;  3NTN A;  3VMZ A;  4I6M C;  5APW A;  2P7J A;  1OWA A;  3NFQ A;  4AQR D;  3A2A A;  1S9K D;  1HJB A;  3HTK A;  3MD0 A;  5AW3 B;  3V4Q A;  3VMX A;  4JYB A;  4AYC A;  3OAK A;  5APT A;  3P8M C;  3VN0 A;  3L35 A;  2QM8 A;  5AVS B;  3M9H A;  3HE5 B;  2W27 A;  5AW5 B;  1NWQ A;  2C9N Y;  3NXS A;  3O8Z A;  1FAV A;  2E42 A;  1H88 A;  2QM7 A;  3M06 A;  3VMY A;  2N9B A;  3HE4 B;  4HYT B;  5AVR B;  3VTP C;  5AVY B;  1HWT C;  3IR9 A;  3L36 A;  1GK6 A;  1GZL A;  1KQL A;  3A7O A;  5AW7 B;  2R3C A;  4KHX A;  4XE5 B;  4M3L A;  1MUU A;  5AW1 B;  1G2C B;  1J2J B;  2ZFC A;  3HE4 A;  5AW8 B;  1GU5 A;  2H7H A;  5APU A;  1T2K D;  1GD2 E;  1IO4 A;  3TK1 A;  5AVW B;  2E43 A;  2YNY A;  1CSB A;  3LID A;  3LIE A;  2YO3 A;  2W6A A;  2Z5I A;  3T97 A;  5APV A;  1CI6 B;  2WPQ A;  2Q3I A;  5AW6 B;  2XZR A;  1HUC A;  4EOT A;  1FOS E;  3B8E B;  5AW0 B;  1GK4 A;  2Q5U A;  5APY A;  4GT1 A;  5CMZ A;  3TNU A;  1JUN A;  2R5B A;  3KQG A;  1MV8 A;  3M0A A;  5APQ A;  3L37 A;  4JYC A;  4I2L C;  5AW2 B;  2XV5 A;  3V4W A;  4RES B;  5AVU B;  2IPP A;  1OXZ A;  2C9L Y;  2R32 A;  4AUW A;  3A5T A;  2WPS A;  3M0D A;  2WT7 A;  2JJL A;  5AVX B;  1MFZ A;  5AVZ B;  5APS A;  2ZXE B;  3HE5 A;  5AW4 B;  3KDP B;  1DH3 A;  4B86 A;  4C46 A;  2WT7 B;  2WPR A;  5APX A;  3VYI A;  3A3Y B;  1A02 F; 
#chains in the Genus database with same CATH topology
 2KSE A;  1KB9 I;  5KTB A;  1G2C A;  1HF9 A;  2O01 J;  1SLQ A;  2Y0D A;  3I5C A;  4WWI A;  3VOP A;  1SFC C;  2L91 A;  1JMM A;  2UWJ E;  3L70 G;  3B5N D;  2KYV A;  1X79 B;  3KPE A;  1FE6 A;  1T8Z A;  2ZYD A;  5KAF H;  3HRN A;  4EIJ A;  1DEE G;  2KP8 A;  5H2F H;  3CX5 I;  4PJ0 H;  3HD7 B;  1M8O B;  1L0N E;  2P58 A;  3AEC C;  2H43 A;  1NHL A;  4L76 A;  3FXE A;  4LGD E;  4LC1 A;  2E5T A;  1PGQ A;  1H8A A;  5AVT B;  1FZC A;  3L75 E;  2GM4 A;  3CXH I;  1LTA C;  1U7J A;  5KLV D;  1Y8A A;  3AE6 C;  2E76 D;  1YBK A;  2RH0 A;  1SQQ E;  1T2K C;  3H1L J;  1J1D B;  5M1B A;  3RK3 D;  1KB9 E;  2M8R A;  4I7Z C;  3L74 G;  4I1L A;  3B4S A;  3AEA C;  1NTZ K;  2FYU K;  1LTJ A;  1FBM A;  1K05 A;  2N1T A;  3NMD A;  2K9J B;  3RK3 C;  3BCC G;  2OQQ A;  1VQ5 P;  2IBZ D;  1IJD B;  1SQB K;  1IFM A;  3CWB E;  2K3R A;  1GL2 A;  2Q7C A;  3G4S P;  3BVH A;  2FKW B;  4Y99 B;  1E79 H;  3H25 A;  3Q3D A;  1XTG B;  4I7Z B;  3WUU A;  1JTH B;  2WQY C;  2KNC A;  2YXR B;  1SQV E;  3U1C A;  1S5L E;  4CPG A;  1VL2 A;  1JO5 A;  2CPB A;  2K37 A;  1JEK A;  3B5N C;  4H44 C;  3OAK A;  4UB8 H;  2E76 C;  1P84 I;  3N4X A;  4OGQ B;  1KQF B;  1SQB E;  4H13 D;  1KV4 A;  3HUS B;  3R2P A;  3VMA A;  1M1J B;  1M57 D;  4H44 D;  2KS1 A;  2PFX A;  1LGH B;  3M9H A;  5AW5 B;  2XKM A;  1PPJ D;  2RN0 A;  3AE8 C;  2PGD A;  2E42 A;  2JR8 A;  1S5L H;  2PRR A;  3TGU E;  1QL1 A;  2LR2 A;  3L73 D;  1SQV G;  3IFM A;  2JO1 A;  5KLI C;  2KUB A;  1N7S B;  3II6 A;  4EDF A;  3A0B H;  4N78 E;  1SQQ K;  2QJY B;  3VTP C;  4ZNC A;  2W8Z A;  4GOF A;  1NTZ J;  2FYU J;  1Q7Y Q;  5B66 E;  3H1K D;  5GTI H;  3PH0 A;  4IFF A;  4EYY Q;  1NTK G;  5AW7 B;  1VQ6 P;  3H1J J;  3CL3 D;  4KHX A;  5CCG A;  3H6P A;  4M3L A;  1MUU A;  3Q5P A;  1RE3 C;  5KJ7 C;  2NPS C;  1NJI Q;  1D7M A;  1GU5 A;  1BGY G;  3A0B E;  2QJP C;  1EDK A;  1GW4 A;  1SQP G;  1RE4 A;  2K9Y A;  5CCG D;  1QVF O;  3BCC E;  1BSN A;  3SFE C;  4YXD C;  3CXH H;  2H89 C;  1AQT A;  1G1J A;  3Q1M A;  1QL2 A;  1L0L G;  1JY3 P;  5APV A;  3TGU J;  1N73 A;  2AXT E;  3H32 A;  5AW6 B;  1Q82 Q;  3OJA B;  1NU1 G;  3ITK A;  4PD4 H;  3USS A;  3IAO A;  1SFC D;  2XZR A;  1VQ7 P;  2FFD B;  3TGU D;  2KI7 B;  2A45 H;  2N1T D;  4H0L D;  1NYH A;  1KC8 Q;  1GK4 A;  3CME P;  1RHZ B;  4GT1 A;  4BRY B;  5CMZ A;  1BE3 D;  3TSI A;  4BXL A;  1VQP P;  1SQX G;  1YIT P;  5APQ A;  1RE4 C;  3M0A A;  1OMI A;  2WMM A;  5KLV E;  4I2L C;  4U3F E;  4OH8 B;  3L75 D;  4DT0 A;  3CCJ P;  1SQB D;  1SQQ D;  2XND H;  4RES B;  2H88 C;  2IPP A;  1YJ9 P;  2C9L Y;  2KK7 A;  1BCC G;  1Q81 Q;  1JY2 O;  1RF1 B;  3M0D A;  1NTM E;  5CBN A;  1FZF A;  3H1J D;  2AEM A;  5AVX B;  4RJT A;  3B71 A;  2ZXE B;  3HE5 A;  4WY4 A;  1QGK B;  3H1K J;  4PD4 D;  3IN6 A;  2WSE H;  3KDP B;  3PRJ A;  3V2N A;  3V2P A;  4K35 A;  1ZXG A;  3CPW O;  1SS1 A;  2BCC E;  2BCC J;  5APX A;  2HR3 A;  2E74 D;  2N9Y B;  1HVV A;  4RKU J;  1FZE A;  1GL2 C;  5KLI B;  2QSI A;  1SQQ J;  1S3J A;  2J58 A;  3ABV C;  3WUV A;  5BU5 A;  1GTW A;  1S9K E;  2Z5H A;  1NGM B;  2MKV A;  1BCC E;  1PGO A;  1NTM K;  2WVR A;  2BAS A;  2O01 H;  1JY3 N;  2B9B A;  3FWL A;  1PP9 E;  3SFD C;  2KB7 P;  1IZN B;  3L74 J;  4C7N B;  1T3J A;  1Y9B A;  1H0T B;  2AXC A;  5KLV K;  2PAJ A;  4L73 A;  1BE3 E;  2E75 C;  4IFD K;  1HBW A;  2QA4 P;  1G1I A;  3GF7 A;  3VP8 A;  2WPV B;  3P8C E;  1P84 D;  4Y99 C;  3OA7 A;  1BSH A;  3BRV B;  3L71 J;  4D6T G;  1IFN A;  4ZKP A;  3F89 A;  1SQP J;  3H1H G;  4L75 A;  5CJ4 A;  3KZI H;  1L0N G;  3AE3 C;  1L0N D;  3MUD A;  3QH9 A;  2C0X A;  1LP1 A;  1QX8 A;  3GLM A;  4KJM A;  4PV1 B;  1GU4 A;  3V5B A;  1PP9 G;  3AE5 C;  1UIX A;  3AE1 C;  3P32 A;  3P7K A;  1KQS O;  1SQX E;  3L4F A;  5AW8 B;  1EXI A;  3MHV A;  5AVQ B;  3AED C;  1NAF A;  3H32 B;  2OYH A;  1DIP A;  1SQX K;  2MJZ A;  4MN4 C;  2M5A A;  4O9B A;  2PP6 A;  2O3J A;  3AEE C;  2OYI C;  1PV3 A;  1KIL B;  1JY2 N;  1N86 A;  3KHU A;  3CCV P;  1HJB A;  4Z1M H;  2QE7 H;  1NU1 K;  2HLO A;  3MD0 A;  2YIU B;  5AW3 B;  2OYH B;  2ZT9 C;  2JWD A;  3AE7 C;  1MZ9 A;  2E76 B;  1BCC J;  4AYC A;  1M7L A;  4H44 B;  3AEG C;  2A45 G;  1HGV A;  1PGP A;  1LP1 B;  5AVS B;  5L8R J;  4OWF A;  1VQN P;  1OZH A;  1KZU B;  1T3U A;  1IFJ A;  2KS1 B;  3HE5 B;  4XA4 A;  3WU2 E;  1ZR2 A;  4Y28 J;  2JDI H;  1NWQ A;  3O8Z A;  1NTK J;  1K8A Q;  1FAV A;  2FXP A;  3GHG C;  3H1I G;  3H1J G;  1LT9 B;  5CCH D;  3I56 P;  1FZC B;  2FFD A;  3S9O A;  1LT1 A;  2BEQ D;  1N7S A;  3CI9 A;  3VMY A;  3QWO C;  3CXH D;  1RQU A;  3HE4 B;  5DJT B;  4HYT B;  5CJ0 A;  1SQQ G;  1SQB G;  3H1I D;  3D71 A;  1RF1 C;  3L75 G;  5AVY B;  1LJ2 A;  2QJK B;  1XTC C;  3KXD A;  1X22 A;  2D2C C;  3IR9 A;  3RL0 C;  1AV1 A;  3EQ2 A;  4DCK A;  1GK6 A;  4IFM A;  3A7O A;  1J1D C;  5BU8 B;  4UB6 H;  1LTI C;  1OW7 A;  1VDF A;  1L0L J;  2FYZ A;  4XE5 B;  3S1K A;  3TGU G;  3S4R A;  1G2C B;  1SQV J;  1OW8 A;  3HE4 A;  4YPC A;  2H7H A;  3PTZ A;  5APU A;  1BDC A;  2M3E A;  1NU1 D;  2FFD C;  1IK9 A;  3CCR P;  5GTH E;  1NKZ B;  1NVO A;  4OGQ C;  3MIW A;  3TK1 A;  2R3S A;  1HH0 A;  5AVW B;  3W68 A;  2LXB A;  3H1H J;  3LIE A;  1E5W A;  1URQ D;  1X9V A;  3JSV C;  3P8C D;  4WVZ A;  1BDD A;  3CWB J;  1MFT A;  1LWU C;  1GW3 A;  1M56 D;  1SQX J;  2IBZ E;  2WSF H;  1DD3 A;  3HD7 D;  2QEX P;  1CI6 B;  1GDT A;  3V2R A;  2Q3I A;  1LTB C;  2L5G B;  2ZXX A;  2ZJS E;  1S1C X;  4NPE A;  1RF1 A;  3LW5 J;  1VF5 B;  1KYO E;  2I1K A;  3BRT B;  1WT6 A;  1PP9 D;  4TLF A;  5KKZ C;  1PPJ E;  1SQP E;  2FY8 A;  1USE A;  2WSC H;  3PP5 A;  1ZOY C;  1HTL C;  1EC5 A;  1VQ4 P;  2ITA A;  2SPZ A;  4BRY A;  3PLN A;  4IL6 H;  3H1H D;  1YI2 P;  1MV8 A;  4OVN F;  3L37 A;  5AW2 B;  1LT9 C;  4D6T D;  1Q86 Q;  1OX3 A;  2J59 M;  1L4A C;  4PD4 E;  1YHQ P;  2C0W A;  1SQV D;  2IZ0 A;  2YXQ B;  3TDK A;  5E79 H;  3HTK B;  1WMK A;  3R4Y A;  5GTH H;  1DX7 A;  1MFZ A;  2KNC B;  1FDM A;  3CC7 P;  1PPJ G;  3LW5 H;  2Z4E A;  1P84 H;  1OVU A;  2NZ2 A;  4WY4 C;  1EZV I;  2KSJ A;  4GDO A;  5KAF E;  3M9Q A;  1NTK E;  2YIU C;  4B86 A;  5TJH A;  2WT7 B;  3VYI A;  3C9I A;  2B87 A;  1VQK P;  1RY3 A;  2XDJ A;  3AE2 C;  1L4A B;  3CCU P;  1A02 F;  3H1K E;  3U1A A;  1Z56 A;  1NO4 A;  4QMA A;  2HFE D;  5CCH A;  1JNM A;  1ZRT E;  5AW9 B;  1ZR4 A;  2A06 E;  2WWW A;  2I8D A;  1M90 Q;  4W80 A;  1S72 P;  1EDJ A;  1SFC A;  1VF5 D;  3SWF A;  4UB6 E;  2Q1K A;  1FJK A;  1NU1 E;  3UIA A;  1LTG C;  1R5S A;  5B5E E;  4PV1 C;  2YO2 A;  1K73 Q;  1PP9 J;  1JM0 A;  1BCC D;  2FYN C;  5AVV B;  1FZC C;  2R5D A;  2IBZ G;  4GKG A;  2K9J A;  4EI2 A;  3AEB C;  2KOG A;  3O6Q A;  1LTJ B;  1NAY A;  1FOS F;  2WTY A;  3T97 B;  1SQX D;  1BE3 G;  3TYY A;  2P67 A;  1Q90 D;  3C1L A;  3FX0 A;  2E5Y A;  1IK7 A;  1FDO A;  1IFD A;  3L72 E;  4KT0 J;  4C7R A;  1KTM A;  4JQ0 D;  5KLV G;  1CW5 A;  4XFJ A;  1FU1 A;  1YQ4 C;  3H1L E;  5CBO A;  1KMI Z;  3CCM P;  4DZO A;  1EZV E;  3MGN A;  1H89 A;  1JY2 P;  3L71 E;  1L0L D;  2QVA A;  3CLQ A;  1NTM J;  3NTN A;  4HH2 A;  4I6M C;  3VMZ A;  3CX5 E;  3A0H H;  1KD1 Q;  2P7J A;  1ZV8 A;  1YJN P;  2OYI B;  1KYO D;  1L0N J;  3A2A A;  4L74 A;  1KOR A;  1FDI A;  1L4A D;  1SQP D;  3L70 D;  3HUS A;  1W2E A;  1HJ0 A;  4PD4 I;  4PV1 D;  1BGY D;  1USD A;  3H1I J;  4HJG H;  3V4Q A;  2IYO A;  3O6Q B;  3VMX A;  2IYP A;  2WSF J;  2YMY A;  4JYB A;  2ZYA A;  2LKM A;  1LTS C;  3BAS A;  1W5C E;  3P8M C;  5APT A;  2IDB A;  1K9M Q;  1FS0 E;  5E79 E;  3RK2 D;  2JKV A;  1KFN A;  1NTK D;  1IC2 A;  1VQ9 P;  2QJK C;  1EZV G;  3D70 A;  2M3B A;  4RO0 A;  3Q5R A;  3H1K G;  2C9N Y;  1N7L A;  2K1A A;  4N6J A;  3ZDM A;  1KB9 H;  1PL5 A;  1JB0 J;  1UII A;  5C39 A;  1H88 A;  1JOC A;  2FYN B;  2QM7 A;  2O1J A;  4WY4 D;  5DJU B;  2KLV A;  1KYO H;  3H1H E;  3L73 G;  3B5N A;  2FXM A;  2N9B A;  1VQM P;  2AEF A;  1EQ7 A;  1OIP A;  2BCC D;  2QJY C;  4W7Y A;  1T6A A;  1YTZ T;  1HWT C;  3HUS C;  2OAR A;  1KIL C;  4DOJ A;  1FZG A;  2FXO A;  3CX5 H;  1OFC X;  4WY4 B;  1KQL A;  2QRX A;  1P84 E;  4U3F J;  3H1J E;  5K5G B;  3M0D C;  4LLH A;  2OYH C;  5AW1 B;  1J2J B;  2JEE A;  2M0B A;  1AVO A;  2AXT H;  2I1J A;  1NTZ E;  2FYU E;  3G9R A;  2Y0C A;  3L72 G;  3N7N A;  1IFP A;  1S2E A;  3RK2 B;  3RK3 E;  1URQ B;  2P1J A;  1LT9 A;  1K04 A;  3MP7 B;  1OW6 A;  1N73 B;  1RQV A;  1GD2 E;  2QJP B;  2RMZ A;  2V7Q H;  1IO4 A;  1BGY E;  1U7M A;  2E43 A;  2YO3 A;  1JTH A;  2W6A A;  1VPC A;  2WZ7 A;  2HOD A;  1NTK K;  4JBZ A;  2E75 D;  4NPD A;  3G3Z A;  3T97 A;  2O01 N;  2WPQ A;  2FBW C;  3L71 D;  4GOD A;  1JY3 O;  2WSE J;  4ZMD A;  1Q2N A;  1EDI A;  3CCQ P;  3BCC D;  3BCC J;  3E1R A;  2IX7 C;  1RH5 B;  2N1T B;  1MKM A;  2ZAE B;  1HUC A;  3RK2 C;  3A0H E;  5CHX A;  1N8R Q;  1FOS E;  3L74 D;  1FC2 C;  2G8Y A;  3KYQ A;  1M1K Q;  1L2P A;  1AQ5 A;  3GHG A;  5APY A;  3WU2 H;  2LXC B;  1FZA A;  1FJP A;  3TNU A;  4U7J A;  3CXH E;  3KQG A;  3GG2 A;  3RBX A;  3FGA D;  2OTJ P;  2E74 B;  2KIK A;  2E75 B;  2ZYG A;  1Y47 A;  3H1I E;  4R4L A;  1EDL A;  3GF3 A;  5AVU B;  4GIF A;  2JWA A;  2NPS A;  4GOE A;  4DJG A;  3A5T A;  2HYN A;  3G6E P;  1LNQ A;  1YTZ I;  2AEJ A;  2JJL A;  4U3F D;  5AVZ B;  2HPC B;  2BEZ F;  5APS A;  1SQP K;  5AW4 B;  3I55 P;  3RL0 B;  4K3A A;  2H8P D;  1M1J A;  2IFM A;  2OYI A;  2A06 D;  1DH3 A;  4C46 A;  2WPR A;  1RF0 C;  4WBA A;  2WSS H;  1SVF A;  1VQ8 P;  4HKZ H;  1KIL D;  3JCU E;  1W2B O;  2V7Q J;  5KKZ B;  1SQB J;  1ZN5 A;  2JP3 A;  3RBZ A;  3L75 J;  1HGZ A;  2B89 A;  1PZQ A;  3JC2 2;  4C7N A;  2D2C B;  1JCD A;  2RKL A;  1NTZ G;  2FYU G;  2VRS A;  1X0T A;  1BE3 J;  3TNU B;  3E7K A;  5B66 H;  5GTI E;  1QVG O;  3D6Y A;  3L74 E;  1SQV K;  2CPS A;  2OTK E;  5KAI E;  4ASW A;  3G71 P;  1VF5 C;  1A02 J;  1CZQ A;  2G3A A;  1URQ C;  1YYC A;  4UB8 E;  1VQL P;  4IOI H;  3SWK A;  1KN7 A;  2HG5 D;  1PGJ A;  4OGQ D;  1CI6 A;  2DW3 A;  2KLU A;  2P2U A;  2XU6 A;  2KXP B;  3M9B A;  5TIS E;  3CCL P;  2GUV A;  1JMB A;  1GL2 D;  2OGU A;  3CWB G;  1EXJ A;  1LTT C;  2J5U A;  3M91 A;  5KJ7 D;  4N3Y B;  1AA0 A;  2IZ1 A;  2E74 C;  5H2F E;  1NH4 A;  1NTM D;  2GUS A;  1SP4 A;  3SWY A;  3Q5S A;  2KZI A;  1AFO A;  3GW6 A;  2ZT9 B;  3AEF C;  1J1E C;  1X8Y A;  3CC2 P;  2YKQ A;  3HD7 A;  3WUT A;  1LTJ C;  2QG4 A;  1KB9 D;  1R8E A;  1YQ3 C;  5APW A;  4ZKU A;  1QLE D;  1RF0 A;  1DEB A;  1OWA A;  3FXD A;  3EFG A;  3H1L G;  3NFQ A;  4AQR D;  1N2D C;  4BWN A;  1S5L X;  2O1K A;  3RL0 g;  1NTZ D;  2FYU D;  3EWK A;  1S9K D;  3F5H A;  1U57 A;  2HPC A;  2P10 A;  5KLV J;  2OTL P;  2Q3E A;  3HTK A;  1GMJ A;  2IFN A;  1FZB A;  3RK3 B;  3CX5 D;  3BAT A;  3V2Q A;  3L73 J;  3RL0 D;  5EFW B;  3K5B A;  3VN0 A;  4JPZ B;  4H13 C;  1KYO I;  3GMA A;  1YJW P;  3AE9 C;  2A06 G;  3L35 A;  1ZLL A;  2QM8 A;  3MTU E;  3WMM 0;  2W27 A;  5TIS H;  1PIX A;  3NXS A;  4U3F G;  4PJ0 E;  2YKP A;  2IBZ I;  2Y0E A;  5CCH C;  3W67 A;  2Q9I A;  4R4M A;  3M06 A;  3CMA P;  3B5N B;  1DD4 A;  3C8V A;  3EFF K;  4A7P A;  3CD6 P;  1TU3 F;  3PHL A;  5AVR B;  1PFI A;  1BGY J;  3MZW B;  4H0L B;  1M1J C;  3L70 J;  3TF5 A;  1KIL A;  1KIL E;  1SFC B;  2YMK A;  1LWU A;  3L36 A;  3L73 E;  1GZL A;  3CC4 P;  1YIJ P;  1ZRT D;  2R3C A;  4N78 D;  1ZW0 A;  1L0L E;  2WIT A;  3D6Z A;  5KAI H;  2ZFC A;  5B5E H;  3PJS K;  5BVZ A;  1L4A A;  2Q6Q A;  1T2K D;  1L0N K;  4TT3 H;  2CK3 H;  4YXW H;  1NKN A;  2N1T C;  4HB1 A;  3U59 A;  1RE3 A;  3JCU H;  3L71 G;  4D6T J;  3VP9 A;  5KJ7 A;  4W7Z A;  2YNY A;  1CSB A;  2POH A;  3AE4 C;  3LID A;  2HOD B;  2W6J H;  3Q2Y A;  3H1L D;  2Z5I A;  3MUD C;  1R5L A;  2ZVN B;  3IF4 A;  1J1E B;  4IL6 X;  2GA1 A;  2W90 A;  3RGU A;  2B88 A;  2V4H A;  3L72 J;  3L72 D;  1ZP0 C;  3V6I A;  2NRG A;  1N73 C;  4D6T E;  4EOT A;  1NTM G;  1IFI A;  3B8E B;  1KQG B;  1S4X A;  2R44 A;  4H0L C;  5AW0 B;  1H0T A;  2Q5U A;  1LWU B;  3CWB D;  1QEX A;  2ZVO B;  2ZT9 D;  1N7S D;  2Y9Y A;  2OYO A;  3FWN A;  1JUN A;  2R5B A;  1L0L K;  1WRG A;  4YTP C;  2W6B A;  4JYC A;  3SSU A;  3V4W A;  2XV5 A;  3HD7 C;  2XNX A;  2BCC G;  1OVR A;  1GL2 B;  1AJY A;  1NU1 J;  1OXZ A;  1NOH A;  2K88 A;  2A45 I;  2R32 A;  4AUW A;  2NPS B;  3L70 E;  2WPS A;  1JCC A;  2WSC J;  3E1I A;  2B87 B;  2KZJ A;  5CCG C;  4WB4 A;  2Y9Z A;  1ZME C;  2WT7 A;  4H13 B;  3OW2 O;  2QIW A;  2YKO A;  4ASV A;  3KZI E;  4IL6 E;  2NPS D;  3CCE P;  3GHG B;  4NPF X;  1EZV D;  2M5A B;  4JF7 A;  1AVY A;  1KFM A;  1OVV A;  3CCS P;  1URQ A;  3A3Y B;  1VQO P;  2W83 C;  1N7S C;  2D2C D; 
#chains in the Genus database with same CATH homology
 5KTB A;  1G2C A;  1SLQ A;  3I5C A;  3VOP A;  1SFC C;  1JMM A;  3B5N D;  2KYV A;  1X79 B;  3KPE A;  1T8Z A;  3HRN A;  4EIJ A;  2KP8 A;  3HD7 B;  2H43 A;  1NHL A;  4LGD E;  1H8A A;  4LC1 A;  5AVT B;  1FZC A;  1LTA C;  1T2K C;  1J1D B;  3RK3 D;  2M8R A;  4I1L A;  1NTZ K;  2FYU K;  1LTJ A;  1FBM A;  2N1T A;  3NMD A;  2GM4 A;  3RK3 C;  1IJD B;  1SQB K;  1IFM A;  3BVH A;  1GL2 A;  2Q7C A;  2FKW B;  4Y99 B;  1XTG B;  1JTH B;  3U1C A;  1JO5 A;  2CPB A;  3B5N C;  3OAK A;  3N4X A;  3HUS B;  3R2P A;  1M1J B;  3M9H A;  1LGH B;  5AW5 B;  2XKM A;  2E42 A;  1QL1 A;  3IFM A;  1N7S B;  3II6 A;  4N78 E;  1SQQ K;  3VTP C;  4IFF A;  5AW7 B;  3CL3 D;  4KHX A;  5CCG A;  3H6P A;  4M3L A;  1MUU A;  1RE3 C;  5KJ7 C;  2NPS C;  1GW4 A;  1RE4 A;  5CCG D;  1G1J A;  1QL2 A;  5APV A;  1JY3 P;  1N73 A;  3H32 A;  5AW6 B;  3OJA B;  1SFC D;  2XZR A;  2FFD B;  2N1T D;  2A45 H;  1GK4 A;  4GT1 A;  5CMZ A;  3TSI A;  5APQ A;  1RE4 C;  3M0A A;  4I2L C;  4OH8 B;  4RES B;  2C9L Y;  2IPP A;  1JY2 O;  1RF1 B;  3M0D A;  1FZF A;  5AVX B;  2ZXE B;  3HE5 A;  4WY4 A;  3V2N A;  2WSE H;  3KDP B;  3V2P A;  5APX A;  1HVV A;  1FZE A;  1GL2 C;  2J58 A;  5BU5 A;  1GTW A;  1S9K E;  2Z5H A;  1NTM K;  2BAS A;  2O01 H;  1JY3 N;  2KB7 P;  4C7N B;  1T3J A;  5KLV K;  2PAJ A;  4IFD K;  1HBW A;  1G1I A;  3P8C E;  4Y99 C;  3OA7 A;  3BRV B;  4ZKP A;  1IFN A;  5CJ4 A;  3MUD A;  2C0X A;  1GU4 A;  3V5B A;  3P32 A;  3P7K A;  3L4F A;  5AVQ B;  1NAF A;  3H32 B;  2OYH A;  1SQX K;  2MJZ A;  4O9B A;  2PP6 A;  2OYI C;  1KIL B;  1JY2 N;  1N86 A;  1HJB A;  3MD0 A;  1NU1 K;  2HLO A;  5AW3 B;  2OYH B;  1MZ9 A;  4AYC A;  1M7L A;  2A45 G;  1HGV A;  5AVS B;  1KZU B;  1T3U A;  1IFJ A;  3HE5 B;  4XA4 A;  1ZR2 A;  1NWQ A;  3O8Z A;  1FAV A;  3GHG C;  2FFD A;  5CCH D;  1LT9 B;  1FZC B;  3VMY A;  1N7S A;  3CI9 A;  3HE4 B;  4HYT B;  5CJ0 A;  1RF1 C;  5AVY B;  1XTC C;  3IR9 A;  3RL0 C;  3EQ2 A;  1GK6 A;  4IFM A;  3A7O A;  1J1D C;  5BU8 B;  1LTI C;  1VDF A;  2FYZ A;  4XE5 B;  1G2C B;  3HE4 A;  2H7H A;  5APU A;  2FFD C;  1IK9 A;  1NKZ B;  3MIW A;  3TK1 A;  5AVW B;  1HH0 A;  3LIE A;  1E5W A;  1URQ D;  1X9V A;  3P8C D;  1LWU C;  1GW3 A;  2WSF H;  3HD7 D;  1CI6 B;  1GDT A;  3V2R A;  2Q3I A;  1LTB C;  2L5G B;  1RF1 A;  2I1K A;  3BRT B;  1WT6 A;  2WSC H;  3PP5 A;  1HTL C;  1MV8 A;  3L37 A;  5AW2 B;  1LT9 C;  2J59 M;  1L4A C;  2C0W A;  3HTK B;  1DX7 A;  1MFZ A;  1FDM A;  2Z4E A;  3LW5 H;  4WY4 C;  2KSJ A;  3M9Q A;  4B86 A;  2WT7 B;  3VYI A;  3C9I A;  1RY3 A;  2XDJ A;  1L4A B;  1A02 F;  3U1A A;  1Z56 A;  1NO4 A;  2HFE D;  5CCH A;  1JNM A;  5AW9 B;  1ZR4 A;  2WWW A;  4W80 A;  1SFC A;  3SWF A;  1FJK A;  3UIA A;  1LTG C;  2YO2 A;  5AVV B;  1FZC C;  2R5D A;  4GKG A;  2KOG A;  1LTJ B;  1FOS F;  2WTY A;  3TYY A;  2P67 A;  4C7R A;  1IFD A;  1CW5 A;  1FU1 A;  4DZO A;  3MGN A;  1H89 A;  1JY2 P;  3NTN A;  3CLQ A;  3VMZ A;  4HH2 A;  4I6M C;  2OYI B;  2P7J A;  1ZV8 A;  3A2A A;  1L4A D;  3HUS A;  1W2E A;  3V4Q A;  3VMX A;  2YMY A;  4JYB A;  2LKM A;  1LTS C;  3BAS A;  5APT A;  3P8M C;  1PFI A;  3RK2 D;  1KFN A;  1IC2 A;  2M3B A;  2C9N Y;  1N7L A;  4N6J A;  1H88 A;  1JOC A;  2QM7 A;  2O1J A;  4WY4 D;  2KLV A;  3B5N A;  2FXM A;  2N9B A;  1EQ7 A;  4W7Y A;  1YTZ T;  1HWT C;  3HUS C;  2OAR A;  1KIL C;  4DOJ A;  1FZG A;  4WY4 B;  1KQL A;  3M0D C;  4LLH A;  2OYH C;  5AW1 B;  1J2J B;  2JEE A;  5AW8 B;  3VP8 A;  2I1J A;  1GU5 A;  3N7N A;  3RK2 B;  1URQ B;  2P1J A;  1LT9 A;  1N73 B;  1GD2 E;  1IO4 A;  2E43 A;  2YO3 A;  1JTH A;  2W6A A;  1VPC A;  2WZ7 A;  2HOD A;  1NTK K;  3T97 A;  3G3Z A;  2WPQ A;  1JY3 O;  2IX7 C;  2N1T B;  1HUC A;  3RK2 C;  1FOS E;  5CHX A;  3KYQ A;  1AQ5 A;  3GHG A;  5APY A;  1FJP A;  1FZA A;  3TNU A;  3KQG A;  5AVU B;  4GIF A;  2NPS A;  3A5T A;  2HYN A;  1YTZ I;  2JJL A;  5AVZ B;  2HPC B;  5APS A;  1SQP K;  5AW4 B;  3RL0 B;  2H8P D;  1M1J A;  2IFM A;  2OYI A;  1DH3 A;  4C46 A;  2WPR A;  1RF0 C;  4WBA A;  1SVF A;  1KIL D;  1ZN5 A;  1HGZ A;  4C7N A;  1JCD A;  2VRS A;  3TNU B;  1SQV K;  2CPS A;  1A02 J;  1CZQ A;  1URQ C;  1YYC A;  2HG5 D;  1CI6 A;  2P2U A;  2XU6 A;  3M9B A;  2GUV A;  1GL2 D;  1LTT C;  3M91 A;  5KJ7 D;  4N3Y B;  3SWY A;  1NH4 A;  2GUS A;  1SP4 A;  1AFO A;  1J1E C;  1X8Y A;  2YKQ A;  3HD7 A;  1LTJ C;  5APW A;  4ZKU A;  1RF0 A;  1DEB A;  1OWA A;  3EFG A;  3NFQ A;  4AQR D;  1N2D C;  2O1K A;  2HPC A;  1S9K D;  3HTK A;  2IFN A;  1FZB A;  3RK3 B;  3BAT A;  3V2Q A;  3RL0 D;  3VN0 A;  3L35 A;  1ZLL A;  2QM8 A;  3MTU E;  3WMM 0;  2W27 A;  3NXS A;  2YKP A;  5CCH C;  2Q9I A;  3M06 A;  3B5N B;  5AVR B;  1M1J C;  1KIL A;  1SFC B;  1LWU A;  3L36 A;  1GZL A;  2R3C A;  4N78 D;  2WIT A;  2ZFC A;  5BVZ A;  1L4A A;  1T2K D;  1L0N K;  1NKN A;  2N1T C;  3U59 A;  1RE3 A;  5KJ7 A;  3VP9 A;  4W7Z A;  3LID A;  2YNY A;  1CSB A;  2POH A;  2HOD B;  2Z5I A;  1J1E B;  1N73 C;  4EOT A;  1IFI A;  3B8E B;  5AW0 B;  2Q5U A;  1LWU B;  1N7S D;  1JUN A;  2R5B A;  1L0L K;  1WRG A;  2W6B A;  4JYC A;  3V4W A;  2XV5 A;  3HD7 C;  2XNX A;  1GL2 B;  1OXZ A;  1NOH A;  2A45 I;  2R32 A;  4AUW A;  2NPS B;  2WPS A;  1JCC A;  3E1I A;  5CCG C;  4WB4 A;  2WT7 A;  2YKO A;  2NPS D;  3GHG B;  4JF7 A;  1KFM A;  1URQ A;  3A3Y B;  1N7S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...