2YNYA

Salmonella enterica sada 255-302 fused to gcn4 adaptors (sadak1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
b'MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSMKQIEDKIEEILSKIYHIENEIARIKKLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ynyA00
5AW8B 3HTKA 3VN0A 2YO3A 4AYCA 4I2LC 3P8MC 3M0AA 2R5DA 2E42A 2C9NY 1NWQA 4DZOA 3NTNA 1NAFA 1OXZA 2P67A 5APWA 1A02F 4KHXA 4HYTB 5AVRB 5APUA 5AVZB 3KDPB 1CZQA 1CI6A 3A5TA 4C46A 5APXA 1SLQA 5AW1B 3IR9A 5AVSB 3VMZA 3M0DA 4LC1A 2Z5HA 3LIEA 1S9KE 1T2KC 1JNMA 1IO4A 3VTPC 3VMYA 3MGNA 5AVVB 3HE5B 2H7HA 1JUNA 5AVTB 2YO2A 5AW7B 3M06A 4GT1A 3NFQA 1J2JB 3T97A 3KQGA 3B8EB 2W27A 3L37A 3V4WA 1H88A 3HE4A 2Q7CA 2P2UA 3VMXA 2WWWA 1MUUA 1GD2E 1HWTC 1GZLA 2WTYA 1YYCA 5AVYB 3OAKA 2JJLA 2WPQA 5AW2B 2Q5UA 1G2CB 3HE4B 3MD0A 3L35A 1GU5A 3TNUA 3TNUB 2YNYA 3M9BA 1SP4A 4AQRD 2ZXEB 5AW9B 2R3CA 1HUCA 1MV8A 3M91A 1GK4A 2ZFCA 3P32A 1H89A 1A02J 4RESB 3P7KA 3A7OA 4M3LA 3NMDA 1CSBA 5AVXB 4B86A 1FAVA 4GKGA 1GK6A 2WT7B 5AW4B 1CI6B 3A3YB 1GTWA 1OWAA 4JYBA 3A2AA 2P7JA 3UIAA 1DH3A 2N9BA 2Q3IA 5APYA 1MFZA 2XU6A 2BASA 1H8AA 3TK1A 2QM8A 5AW6B 3V5BA 2WT7A 5APSA 5AVQB 5APTA 2VRSA 3O8ZA 4EOTA 5AVWB 3I5CA 2E43A 2IPPA 5CMZA 2WPRA 5AVUB 3SWFA 3NXSA 4I6MC 2WPSA 1FOSF 1GU4A 3TYYA 2XZRA 2XV5A 5APVA 3VYIA 3M9HA 1HBWA 2W6AA 4C7NB 4C7NA 1S9KD 1HJBA 3HE5A 1T2KD 3L36A 1FOSE 5AW3B 2R32A 4JYCA 2Z5IA 1KQLA 5APQA 2QM7A 2C9LY 4AUWA 5AW0B 2KP8A 3V4QA 2R5BA 4XE5B 1X8YA 5AW5B 3LIDA
chains in the Genus database with same CATH superfamily
4GOFA 2FYUK 5AW8B 1NTZD 3MUDC 1FZAA 1ZV8A 2D2CB 2YO3A 3L70D 3VN0A 1KYOE 1YIJP 2IYPA 2P10A 4PV1C 1VF5D 2K9JA 4U3FG 4BXLA 3PRJA 1EZVE 1HJ0A 5CCGA 2IX7C 2WSFJ 2KB7P 1RE3A 3GF3A 4WY4B 4H44D 1NTKG 1ZR2A 1RQUA 2WVRA 3LW5J 1NWQA 5APWA 1OXZA 3EQ2A 1G2CA 4TLFA 4H13B 2KYVA 2B87B 4IFFA 2FXMA 3L72E 3RK3C 1YJWP 2H8PD 2ZVNB 1KFNA 4UB8E 5CCHC 2QA4P 3GG2A 5AVRB 2B9BA 2FYUE 5APUA 5AVZB 1R5SA 3EFGA 1YHQP 1IFJA 3A5TA 3AEGC 1PFIA 1GDTA 1EDIA 3H1ID 1M8OB 1DEEG 1VF5B 1GW4A 1KB9H 2Q6QA 4TT3H 4WY4A 2WPVB 4H0LB 4KT0J 2I1KA 2G3AA 2XNXA 3GMAA 2MJZA 3RK2D 1NTME 3CX5E 3H1JJ 3B5NC 3T97B 3H32B 1Q86Q 1AA0A 2Y0EA 2Z5HA 3AEFC 1GL2D 2QRXA 3L4FA 4LC1A 1PGOA 1KB9I 1M57D 3G3ZA 3VTPC 1LT9C 2FFDA 4N78E 5AVVB 1ZW0A 3VMZA 2H7HA 1MKMA 3Q5SA 3SFEC 1BCCD 5AVTB 2YO2A 1URQD 2JKVA 2A45G 1LP1A 3CC4P 1LGHB 1LWUB 1AVYA 1M1JB 1RHZB 3E1RA 5DJUB 1IFMA 1LNQA 1LTSC 2O01N 3T97A 3Q3DA 1LTIC 2QG4A 2KIKA 2W27A 1Q2NA 3B8EB 5KJ7A 1ZRTE 3H1HE 2J5UA 1PP9J 3HE4A 2IZ1A 2HR3A 3CXHD 2KLVA 1GL2A 1GD2E 1GZLA 2I8DA 5B5EH 4ASWA 2WTYA 5AVYB 1KILB 1ZR4A 3OAKA 2LXBA 1U57A 3H1IE 2XKMA 4WY4D 5KLVE 1JCCA 2AXCA 3GW6A 1D7MA 1SQBK 3L74J 4OGQD 3AE4C 3MD0A 4IL6E 2UWJE 1FZFA 1FZEA 1FBMA 1BGYE 3TNUA 1PPJE 4N78D 1LTAC 1SQXJ 3C8VA 1L4AD 1R8EA 5AW9B 3AEEC 1EDKA 5KTBA 1L4AC 4WBAA 3Q5RA 3AE5C 3CWBG 3P32A 1H89A 1Y8AA 2IFMA 1KYOD 1IK7A 2A06E 2WQYC 3TF5A 4GOEA 2XNDH 2ZT9C 3P7KA 3D71A 4B86A 1CSBA 2WITA 2W6BA 1N73B 4I7ZC 2BCCE 2B89A 3L71J 1KYOI 3GHGB 3RL0B 3CI9A 5E79E 1JY2O 2GUSA 2ZYAA 2IBZE 2QVAA 3AE7C 4N6JA 2C0XA 3MIWA 2JO1A 3A2AA 1DH3A 1OIPA 3BCCG 4EDFA 4HKZH 1YJNP 2YKPA 2XU6A 1BDCA 4A7PA 2A45H 1U7MA 4DJGA 3CLQA 2QM8A 4NPFX 3KZIH 3V5BA 1FC2C 1NYHA 2FYNC 1JY2N 5APSA 2WT7A 3O8ZA 5L8RJ 2B88A 1JY3N 1DD4A 1W5CE 2FYNB 4YTPC 3H1KJ 2K3RA 1LTJA 4RO0A 1RF1B 3V2NA 3CX5I 2Y0CA 1NU1E 3S1KA 1W2EA 1Y9BA 2FFDC 2M8RA 1AJYA 1FOSF 3VMAA 1GU4A 3AE3C 1KB9E 3FXEA 3CC7P 4O9BA 2OGUA 2XV5A 3HD7A 3M9HA 2YMYA 1P84D 1NTZG 2E74C 3CX5H 4C7NB 3CWBD 5CJ0A 1HBWA 1SQQG 1FOSE 2POHA 2YXQB 3IF4A 3B71A 4JYCA 4PD4I 2Z5IA 5AW3B 2K37A 2QM7A 1SQVE 5GTHH 1PGQA 4OH8B 1IO4A 2HLOA 1PL5A 3A0BE 5AW0B 1SQPD 4GIFA 1X8YA 4XE5B 3F5HA 2FXPA 3IN6A 3MZWB 4HB1A 1JTHA 1ZLLA 1FS0E 1RE3C 2RMZA 4IOIH 2KOGA 3RL0D 1G1JA 1AVOA 2E76B 3P8MC 1BDDA 1SQPJ 2E75C 1ZN5A 2R5DA 5KLVJ 3H1KD 2YIUC 3L70G 3MUDA 4U7JA 2E42A 2H89C 1KILC 2FKWB 2C9NY 5TISE 1DIPA 3L71E 1HTLC 1NAFA 2RKLA 1N7SD 4NPEA 2N9YB 1NVOA 1VQLP 3HD7D 3V2RA 1PP9E 4R4MA 3FWLA 4PV1D 2QSIA 2YMKA 5KKZC 1AQTA 1SS1A 1CZQA 2K9JB 3KDPB 3L71D 2NZ2A 4EI2A 4ZKPA 1BE3J 3O6QA 1BCCG 3QWOC 1LT9B 2M3BA 2YKOA 4JQ0D 5BU8B 3HRNA 5CCGD 5KAFH 5KKZB 5AVSB 3BRTB 3TDKA 3AEAC 2OYHB 1PIXA 3PHLA 1NTKD 1L0LK 1VL2A 2R3SA 1N7SA 2BCCJ 2PFXA 3HTKB 3JC22 5DJTB 1S5LH 4H0LC 3SFDC 5KLIC 1JNMA 1P84E 2FYZA 1NTMJ 1EZVI 1OVUA 2IBZI 3H1JE 3VMYA 3P8CE 1L0NE 1FJPA 3HE5B 1BSNA 1OX3A 1JUNA 5AW7B 3AE6C 4K3AA 2WSEJ 3B5ND 1FDIA 3WU2E 3D6ZA 1R5LA 3LW5H 1N73A 2K9YA 4WY4C 4ASVA 2OYHA 4PJ0H 1JCDA 3GHGA 1S72P 1Y47A 2P2UA 1X9VA 2KNCB 3KHUA 1HWTC 1YITP 4MN4C 3RL0g 2A45I 1S4XA 3H1KG 3WU2H 1KQGB 2KZIA 1U7JA 1LWUA 2KSJA 2JJLA 2JP3A 2FXOA 1YJ9P 1KD1Q 4H44B 5AW2B 1KFMA 4Y99C 2OYHC 1EDJA 1SQXG 3HE4B 4PD4D 1GL2C 1M1KQ 2HPCB 3H1LD 5KAFE 2HODA 2IBZD 4WB4A 1NU1K 1EC5A 4Y99B 1OW6A 1BE3E 3H1JD 3L74G 1Q81Q 1FZCA 2QJYC 4AQRD 2N1TA 1S5LX 4Y28J 1VQNP 2R3CA 1KILD 1MV8A 2ZYGA 3RK2C 1QEXA 5CBOA 5GTHE 2ZFCA 1WMKA 3IAOA 3Q5PA 3D70A 3O6QB 1DX7A 2A06D 4RESB 3CC2P 4L76A 1LTJB 3TGUG 4D6TG 3Q2YA 1YI2P 3A7OA 1JOCA 2MKVA 3PH0A 4OGQB 3H1LG 3RK3D 1FAVA 1SQQD 1OW7A 1T8ZA 1SQPE 1E5WA 2E75D 2W8ZA 4GKGA 3RBZA 3V2PA 3CCVP 5H2FH 1PPJD 1VQMP 3BVHA 1OW8A 1PP9D 2N1TB 2KI7B 1Q82Q 1NKNA 1N7LA 1GTWA 2WSEH 4L74A 2P7JA 1KQFB 3UIAA 5B66E 2HFED 2N9BA 1IFPA 3L73J 5KAIE 3H25A 1YQ3C 3HUSB 2BASA 1E79H 2M5AA 2ZT9B 3H1HJ 4KJMA 1QLED 2O01J 3PTZA 3TK1A 5CCHA 1S3JA 1VQOP 1IZNB 4GDOA 5APTA 2FFDB 1N73C 4XFJA 1JMMA 1L0NK 2QJKB 3MHVA 1MFTA 1LT1A 5AVWB 3H1HD 4W7YA 2BEZF 3G9RA 2WMMA 2ITAA 3PP5A 5KAIH 5CMZA 3HUSC 3RGUA 4Z1MH 2WZ7A 3L73E 3SWKA 4H0LD 1FE6A 2WPSA 3RK2B 2M5AB 1P84I 2ZT9D 2NPSB 4IFDK 1RF0A 5BU5A 1L0ND 3H6PA 1NU1J 1N8RQ 2D2CC 3KXDA 3VYIA 2K88A 1RE4C 1HJBA 1J1EB 2I1JA 2K1AA 1NTMG 2L5GB 1T2KD 3U59A 2O01H 3JCUE 3RL0C 3B4SA 1BSHA 1VDFA 1EDLA 3N4XA 3VP8A 5APQA 1KQLA 3WUVA 1IK9A 4AUWA 3N7NA 4EIJA 3P8CD 5CHXA 1N7SB 2W6JH 3L75G 1PV3A 4UB6H 3W68A 3CMEP 3GF7A 2HPCA 1JB0J 2V7QJ 5EFWB 1VQKP 1SQBG 4JF7A 4BRYB 1J1EC 1USDA 3E7KA 1OVVA 1M7LA 2Y0DA 3PJSK 1L0LE 3WUTA 2OYIC 1FDOA 3HTKA 2HG5D 2PGDA 2OTLP 1KMIZ 4I2LC 1FZCB 1KZUB 2JR8A 1JO5A 2AEFA 1K8AQ 3R2PA 2E5YA 3BASA 4DZOA 1KYOH 3B5NA 3NTNA 2OARA 2P67A 2JEEA 2B87A 2AXTH 1Z56A 2YXRB 1KV4A 1NTMK 2R44A 3E1IA 3FXDA 3H1IG 4HYTB 5KJ7D 3ZDMA 1URQC 1UIIA 4PD4E 3Q1MA 1OVRA 1K04A 3OA7A 3RK3E 1URQA 2WSCJ 4NPDA 2AXTE 1VQ5P 1BGYG 3CXHI 3IR9A 3AE1C 4IFMA 3HD7C 2QIWA 1NH4A 3M0DA 1BCCJ 1KILE 1OZHA 1S1CX 1Q90D 1ZRTD 2PRRA 3CWBE 3G6EP 1S9KE 2HODB 2J59M 2P1JA 2NPSA 2KS1B 3CXHH 3MGNA 2JDIH 2PP6A 3MTUE 2AEJA 2OTJP 2GM4A 2O1JA 3MP7B 1SQVK 2PAJA 3A0HE 2E5TA 2N1TD 2OYOA 3BRVB 4OGQC 3M06A 3WMM0 3NFQA 5K5GB 1M1JA 2Y9YA 2Q9IA 1FZCC 1NHLA 1J2JB 1WT6A 3CCUP 3AE2C 5KLVD 1JY2P 1FU1A 4U3FE 3I55P 1M56D 3L37A 3CL3D 3V4WA 1EZVG 2IBZG 2LXCB 5B66H 2Q7CA 2IZ0A 3FWNA 3VMXA 1H88A 1NTKE 1LTBC 2Q3EA 1NU1D 1P84H 2C0WA 3L74D 4C7RA 1YYCA 3K5BA 3L72G 3L73D 4I1LA 4DCKA 1AV1A 2E74D 1CW5A 2OTKE 1VQ4P 2FYUG 1VQ7P 1FZBA 1M90Q 1RF1A 1H0TA 1G2CB 3RBXA 4WWIA 1JM0A 1XTCC 3L35A 3FX0A 1GU5A 1AFOA 3S4RA 1VPCA 3TNUB 2NPSD 2O3JA 3VP9A 1K73Q 1KN7A 4ZKUA 1SQPK 1NTKJ 1MZ9A 3AEBC 3EFFK 1NU1G 1SP4A 2BCCD 3C9IA 4UB8H 4H44C 1SQBD 3W67A 1EZVD 2E74B 1GK4A 4BWNA 1PGPA 1H0TB 1A02J 2J58A 1JEKA 1NTZE 3A0HH 5CCHD 1NKZB 1XTGB 1L2PA 2FBWC 1SQQE 3H32A 3L72J 2GUVA 3NMDA 5E79H 3CCQP 2YKQA 1SQQK 1JTHB 4JBZA 1SQVG 1T3UA 4K35A 4N3YB 3CPWO 3U1AA 3ITKA 2D2CD 4YXWH 1RY3A 1URQB 1NOHA 1NTKK 2QJPB 3A3YB 3BATA 3H1HG 1LP1B 1OWAA 4JYBA 2GA1A 1PZQA 1EQ7A 1ZMEC 5APYA 1MFZA 2ZAEB 1K05A 5CBNA 1H8AA 1LTJC 2KUBA 1QX8A 5KLVG 1X0TA 3L70E 1IFDA 2VRSA 2DW3A 3SSUA 3V2QA 2N1TC 3CMAP 3L71G 1KILA 1KQSO 1IFIA 3CCMP 4RJTA 1VQ6P 1PPJG 2IPPA 1LT9A 1PP9G 1S2EA 2ZVOB 3CCJP 1SFCA 1SQVD 3SWFA 4CPGA 5H2FE 1IFNA 1NAYA 5APVA 2A06G 4U3FD 4JPZB 4ZMDA 2W6AA 4YXDC 4C7NA 1OFCX 4OWFA 1S9KD 2E76C 3HE5A 1NGMB 1KTMA 2KXPB 2YIUB 3EWKA 4PJ0E 2BCCG 3CCRP 3V6IA 2AEMA 1IC2A 1ZXGA 4EYYQ 2C9LY 1HGVA 4H13D 3II6A 4PD4H 1L0NG 2R5BA 5TISH 3RK3B 1SQXK 2KS1A 2WSCH 3LIDA 4PV1B 5M1BA 1TU3F 2KNCA 3BCCE 1NTMD 1RH5B 2OQQA 3CX5D 5GTIE 1ZP0C 1SFCC 3PLNA 5CCGC 3S9OA 4AYCA 3M0AA 2CPSA 2G8YA 1Q7YQ 1HGZA 1NO4A 3L75J 1FDMA 2W83C 1N7SC 1HH0A 2H88C 2QE7H 1N2DC 1RF1C 5BVZA 2KK7A 1BE3D 3H1KE 5GTIH 3D6YA 1SQQJ 3SWYA 2CPBA 2KSEA 2P58A 3JCUH 3L72D 4KHXA 4W80A 2Z4EA 1VQ9P 4ZNCA 4U3FJ 1L0LD 3KYQA 1CI6A 2JWDA 2V7QH 1SQXE 2Y9ZA 4C46A 2V4HA 5APXA 1SLQA 3B5NB 3CD6P 5AW1B 1EXJA 2QJPC 3ABVC 4WVZA 1M1JC 3L74E 1J1DB 1X22A 3JSVC 3BCCD 1KC8Q 3U1CA 1KORA 3HD7B 3LIEA 1T2KC 2ZXXA 3I56P 1OMIA 1VF5C 1WRGA 1NJIQ 4D6TE 3TGUE 1BGYD 1ZOYC 1VQ8P 1KB9D 3BCCJ 3USSA 2QJKC 2FY8A 1N86A 3H1LE 4GT1A 2JWAA 3VOPA 2WSSH 3KQGA 3F89A 1DEBA 2HYNA 1X79B 1YQ4C 2RN0A 3KZIE 2WWWA 4QMAA 1MUUA 3KPEA 2E76D 1RQVA 2KLUA 1JY3O 2RH0A 3CXHE 3H1LJ 3C1LA 3AE8C 2WPQA 4H13C 3TGUJ 4D6TJ 1GW3A 2Q5UA 2NRGA 1QL1A 4DOJA 2LKMA 3H1IJ 2FYUD 1PGJA 4HH2A 3G4SP 1BCCE 3WUUA 2CK3H 4W7ZA 1S5LE 1NTZJ 3GLMA 4DT0A 1YTZI 3L73G 2YNYA 3M9BA 3CCEP 2ZXEB 2OYIA 1SQVJ 2FYUJ 2Q1KA 3CCLP 1HUCA 1SFCB 2LR2A 3TSIA 3M91A 4IL6X 3G71P 3OJAB 1W2BO 4GODA 2BEQD 3H1JG 4L73A 3FGAD 3L75D 4XA4A 2ZYDA 3CCSP 2NPSC 4HJGH 4RKUJ 1UIXA 1K9MQ 4M3LA 1EXIA 1GL2B 1JY3P 3CWBJ 5AVXB 1QVFO 1L0NJ 3M0DC 4L75A 1GK6A 2WT7B 5AW4B 3L75E 1CI6B 5C39A 1SVFA 1LWUC 1RF0C 2IDBA 1G1IA 1LTGC 3IFMA 1SQBE 4R4LA 1SFCD 2WSFH 3AE9C 3QH9A 1HF9A 4LLHA 1L0LG 4BRYA 2Q3IA 3M9QA 2H43A 5B5EE 3GHGC 3HUSA 1VQPP 5AW6B 1GMJA 1J1DC 2SPZA 1NTZK 5AVQB 2XDJA 3AEDC 1YBKA 1L4AA 1LJ2A 3A0BH 4EOTA 2E75B 3OW2O 1QL2A 2E43A 3I5CA 2M0BA 2IYOA 1JMBA 1BE3G 2WPRA 1DD3A 2OYIB 2IFNA 4OVNF 4YPCA 5AVUB 1LTTC 2M3EA 3NXSA 1SQBJ 4I6MC 1L0LJ 1T3JA 4LGDE 1QGKB 3TYYA 4IL6H 2XZRA 2KZJA 5KLIB 1L4AB 1USEA 1A02F 5KLVK 3AECC 1FZGA 3R4YA 1FJKA 4UB6E 3L36A 1AQ5A 2R32A 2O1KA 1SQPG 2L91A 1QVGO 1HVVA 2W90A 1RE4A 4D6TD 4I7ZB 3L70J 1YTZT 5CJ4A 5KJ7C 3TGUD 5TJHA 2KP8A 3V4QA 1IJDB 2QEXP 2ZJSE 5AW5B 1BGYJ 1SQXD 2QJYB 1T6AA
chains in the Genus database with same CATH topology
2FYUK 5AW8B 3VN0A 1FZAA 1ZV8A 2YO3A 5CCGA 2IX7C 2KB7P 1RE3A 4WY4B 1ZR2A 1NWQA 5APWA 1OXZA 3EQ2A 1G2CA 3RK3C 1A02F 2KYVA 4IFFA 1PFIA 2FXMA 2H8PD 1KFNA 5CCHC 5AVRB 5APUA 5AVZB 3EFGA 1IFJA 3A5TA 1GDTA 1GW4A 4WY4A 2I1KA 2XNXA 3RK2D 2MJZA 3VMZA 3B5NC 3H32B 4LC1A 2Z5HA 1GL2D 3L4FA 3G3ZA 3VTPC 1LT9C 4N78E 5AVVB 2H7HA 5AVTB 2YO2A 1URQD 2A45G 1LGHB 1LWUB 1M1JB 1IFMA 1LTSC 3T97A 1LTIC 3B8EB 2W27A 5KJ7A 3HE4A 2KLVA 1GL2A 1GD2E 1GZLA 2WTYA 5AVYB 1KILB 1ZR4A 3OAKA 4WY4D 2XKMA 1JCCA 1SQBK 3MD0A 1FZFA 1FZEA 1FBMA 3TNUA 4N78D 1LTAC 1L4AD 5AW9B 5KTBA 1L4AC 4WBAA 3P32A 1H89A 2IFMA 3P7KA 4B86A 1CSBA 2WITA 2W6BA 1N73B 3GHGB 3RL0B 3CI9A 1JY2O 2GUSA 4N6JA 2C0XA 3MIWA 3A2AA 1DH3A 2YKPA 2XU6A 2A45H 3CLQA 2QM8A 3V5BA 2WT7A 5APSA 1JY2N 3O8ZA 1JY3N 1LTJA 1RF1B 3V2NA 2FFDC 1W2EA 2M8RA 1FOSF 1GU4A 4O9BA 2XV5A 3HD7A 3M9HA 2YMYA 1HBWA 4C7NB 5CJ0A 1FOSE 2POHA 5AW3B 4JYCA 2Z5IA 2QM7A 4OH8B 2HLOA 5AW0B 4GIFA 1X8YA 4XE5B 3V2QA 1ZLLA 1JTHA 1RE3C 3RL0D 2KOGA 1G1JA 3P8MC 1ZN5A 2R5DA 3MUDA 2E42A 1KILC 2FKWB 2C9NY 1HTLC 1NAFA 1N7SD 3HD7D 3V2RA 3KDPB 1CZQA 4ZKPA 5BU8B 1LT9B 2M3BA 2YKOA 3HRNA 5CCGD 5AVSB 3BRTB 2OYHB 1L0LK 1N7SA 3HTKB 1JNMA 2FYZA 3VMYA 1FJPA 3P8CE 3HE5B 1JUNA 5AW7B 3B5ND 3LW5H 1N73A 4WY4C 2OYHA 1JCDA 3GHGA 2P2UA 1X9VA 1HWTC 2A45I 1LWUA 2JJLA 5AW2B 1KFMA 4Y99C 3HE4B 1GL2C 2HPCB 2HODA 4WB4A 1NU1K 4Y99B 1FZCA 4AQRD 2N1TA 2R3CA 1KILD 1MV8A 3RK2C 2ZFCA 1DX7A 4RESB 1LTJB 3A7OA 1JOCA 3RK3D 1FAVA 1T8ZA 4GKGA 1E5WA 3V2PA 3BVHA 2N1TB 1NKNA 1N7LA 1GTWA 2WSEH 2P7JA 3UIAA 2HFED 2N9BA 3HUSB 2BASA 3TK1A 5CCHA 2OYHC 2FFDB 1N73C 5APTA 1JMMA 1L0NK 5AVWB 4W7YA 3PP5A 5CMZA 3HUSC 2WZ7A 2WPSA 3RK2B 4IFDK 2NPSB 1RF0A 5BU5A 3H6PA 3VYIA 1RE4C 1HJBA 1J1EB 2I1JA 2OYIB 1T2KD 2L5GB 3U59A 2O01H 3RL0C 1VDFA 3N4XA 3VP8A 5APQA 1KQLA 1IK9A 4AUWA 3N7NA 4EIJA 3P8CD 5CHXA 1N7SB 2HPCA 4JF7A 1J1EC 2OYIC 1M7LA 3HTKA 2HG5D 4I2LC 1FZCB 1KZUB 1JO5A 3R2PA 3BASA 4DZOA 3B5NA 3NTNA 2OARA 2P67A 2JEEA 1Z56A 1NTMK 3E1IA 5KJ7D 4HYTB 1URQC 3OA7A 1URQA 3IR9A 4IFMA 3HD7C 1NH4A 3M0DA 1S9KE 2FFDA 1IO4A 2HODB 2J59M 2P1JA 2NPSA 3MTUE 3MGNA 2PP6A 2GM4A 2O1JA 1SQVK 2PAJA 2N1TD 3BRVB 3WMM0 3M06A 3NFQA 1M1JA 2Q9IA 1FZCC 1NHLA 1J2JB 1WT6A 1JY2P 1FU1A 3L37A 3CL3D 3V4WA 1H88A 2Q7CA 3VMXA 1LTBC 4C7RA 2C0WA 1YYCA 1CW5A 4I1LA 1FZBA 1RF1A 1G2CB 1XTCC 3L35A 1GU5A 1AFOA 1VPCA 3TNUB 2NPSD 3VP9A 4ZKUA 1SQPK 1MZ9A 1SP4A 3C9IA 1GK4A 1A02J 2J58A 5CCHD 1NKZB 1XTGB 3H32A 3NMDA 2GUVA 2YKQA 1SQQK 1JTHB 1T3UA 4N3YB 3U1AA 1RY3A 3BATA 1NOHA 1NTKK 1URQB 3A3YB 1OWAA 4JYBA 1EQ7A 5APYA 1MFZA 1H8AA 1LTJC 1IFDA 2VRSA 2N1TC 1KILA 1IFIA 2IPPA 1LT9A 1SFCA 3SWFA 1IFNA 5APVA 2W6AA 4C7NA 1S9KD 3HE5A 1IC2A 2C9LY 1HGVA 3II6A 2R5BA 3RK3B 1SQXK 2WSCH 3LIDA 1SFCC 4AYCA 5CCGC 3M0AA 2CPSA 1FDMA 1HGZA 1NO4A 1N7SC 1HH0A 1RF1C 1N2DC 5BVZA 3SWYA 2CPBA 4KHXA 4W80A 2Z4EA 3KYQA 1CI6A 4C46A 5APXA 1SLQA 3B5NB 5AW1B 1M1JC 1J1DB 3U1CA 3LIEA 3HD7B 1T2KC 1WRGA 1N86A 4GT1A 3VOPA 3KQGA 1DEBA 2HYNA 1X79B 2WWWA 1MUUA 3KPEA 1JY3O 2WPQA 1GW3A 2Q5UA 4DOJA 1QL1A 2LKMA 4HH2A 4W7ZA 1YTZI 2YNYA 3M9BA 2ZXEB 2OYIA 1HUCA 1SFCB 3TSIA 3M91A 3OJAB 4XA4A 2NPSC 4M3LA 1GL2B 1JY3P 5AVXB 3M0DC 1GK6A 2WT7B 5AW4B 1CI6B 1SVFA 1LWUC 1RF0C 1G1IA 1LTGC 3IFMA 1SFCD 2WSFH 4LLHA 2Q3IA 3M9QA 2H43A 3GHGC 3HUSA 5AW6B 1J1DC 1NTZK 5AVQB 2XDJA 1L4AA 4EOTA 1QL2A 2E43A 3I5CA 2WPRA 2IFNA 5AVUB 1LTTC 3NXSA 4I6MC 1T3JA 4LGDE 3TYYA 2XZRA 1L4AB 5KLVK 1FZGA 1FJKA 3L36A 1AQ5A 2R32A 2O1KA 1HVVA 1RE4A 5KJ7C 5CJ4A 1YTZT 2KP8A 3V4QA 1IJDB 5AW5B 2KSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  3HTK A;  3VN0 A;  2YO3 A;  4AYC A;  4I2L C;  3P8M C;  3M0A A;  2R5D A;  2E42 A;  2C9N Y;  1NWQ A;  4DZO A;  3NTN A;  1NAF A;  1OXZ A;  2P67 A;  5APW A;  1A02 F;  4KHX A;  4HYT B;  5AVR B;  5APU A;  5AVZ B;  3KDP B;  1CZQ A;  1CI6 A;  3A5T A;  4C46 A;  5APX A;  1SLQ A;  5AW1 B;  3IR9 A;  5AVS B;  3VMZ A;  3M0D A;  4LC1 A;  2Z5H A;  3LIE A;  1S9K E;  1T2K C;  1JNM A;  1IO4 A;  3VTP C;  3VMY A;  3MGN A;  5AVV B;  3HE5 B;  2H7H A;  1JUN A;  5AVT B;  2YO2 A;  5AW7 B;  3M06 A;  4GT1 A;  3NFQ A;  1J2J B;  3T97 A;  3KQG A;  3B8E B;  2W27 A;  3L37 A;  3V4W A;  1H88 A;  3HE4 A;  2Q7C A;  2P2U A;  3VMX A;  2WWW A;  1MUU A;  1GD2 E;  1HWT C;  1GZL A;  2WTY A;  1YYC A;  5AVY B;  3OAK A;  2JJL A;  2WPQ A;  5AW2 B;  2Q5U A;  1G2C B;  3HE4 B;  3MD0 A;  3L35 A;  1GU5 A;  3TNU A;  3TNU B;  2YNY A;  3M9B A;  1SP4 A;  4AQR D;  2ZXE B;  5AW9 B;  2R3C A;  1HUC A;  1MV8 A;  3M91 A;  1GK4 A;  2ZFC A;  3P32 A;  1H89 A;  1A02 J;  4RES B;  3P7K A;  3A7O A;  4M3L A;  3NMD A;  1CSB A;  5AVX B;  4B86 A;  1FAV A;  4GKG A;  1GK6 A;  2WT7 B;  5AW4 B;  1CI6 B;  3A3Y B;  1GTW A;  1OWA A;  4JYB A;  3A2A A;  2P7J A;  3UIA A;  1DH3 A;  2N9B A;  2Q3I A;  5APY A;  1MFZ A;  2XU6 A;  2BAS A;  1H8A A;  3TK1 A;  2QM8 A;  5AW6 B;  3V5B A;  2WT7 A;  5APS A;  5AVQ B;  5APT A;  2VRS A;  3O8Z A;  4EOT A;  5AVW B;  3I5C A;  2E43 A;  2IPP A;  5CMZ A;  2WPR A;  5AVU B;  3SWF A;  3NXS A;  4I6M C;  2WPS A;  1FOS F;  1GU4 A;  3TYY A;  2XZR A;  2XV5 A;  5APV A;  3VYI A;  3M9H A;  1HBW A;  2W6A A;  4C7N B;  4C7N A;  1S9K D;  1HJB A;  3HE5 A;  1T2K D;  3L36 A;  1FOS E;  5AW3 B;  2R32 A;  4JYC A;  2Z5I A;  1KQL A;  5APQ A;  2QM7 A;  2C9L Y;  4AUW A;  5AW0 B;  2KP8 A;  3V4Q A;  2R5B A;  4XE5 B;  1X8Y A;  5AW5 B;  3LID A; 
#chains in the Genus database with same CATH topology
 4GOF A;  2FYU K;  5AW8 B;  1NTZ D;  3MUD C;  1FZA A;  1ZV8 A;  2D2C B;  2YO3 A;  3L70 D;  3VN0 A;  1KYO E;  1YIJ P;  2IYP A;  2P10 A;  4PV1 C;  1VF5 D;  2K9J A;  4U3F G;  4BXL A;  3PRJ A;  1EZV E;  1HJ0 A;  5CCG A;  2IX7 C;  2WSF J;  2KB7 P;  1RE3 A;  3GF3 A;  4WY4 B;  4H44 D;  1NTK G;  1ZR2 A;  1RQU A;  2WVR A;  3LW5 J;  1NWQ A;  5APW A;  1OXZ A;  3EQ2 A;  1G2C A;  4TLF A;  4H13 B;  2KYV A;  2B87 B;  4IFF A;  2FXM A;  3L72 E;  3RK3 C;  1YJW P;  2H8P D;  2ZVN B;  1KFN A;  4UB8 E;  5CCH C;  2QA4 P;  3GG2 A;  5AVR B;  2B9B A;  2FYU E;  5APU A;  5AVZ B;  1R5S A;  3EFG A;  1YHQ P;  1IFJ A;  3A5T A;  3AEG C;  1PFI A;  1GDT A;  1EDI A;  3H1I D;  1M8O B;  1DEE G;  1VF5 B;  1GW4 A;  1KB9 H;  2Q6Q A;  4TT3 H;  4WY4 A;  2WPV B;  4H0L B;  4KT0 J;  2I1K A;  2G3A A;  2XNX A;  3GMA A;  2MJZ A;  3RK2 D;  1NTM E;  3CX5 E;  3H1J J;  3B5N C;  3T97 B;  3H32 B;  1Q86 Q;  1AA0 A;  2Y0E A;  2Z5H A;  3AEF C;  1GL2 D;  2QRX A;  3L4F A;  4LC1 A;  1PGO A;  1KB9 I;  1M57 D;  3G3Z A;  3VTP C;  1LT9 C;  2FFD A;  4N78 E;  5AVV B;  1ZW0 A;  3VMZ A;  2H7H A;  1MKM A;  3Q5S A;  3SFE C;  1BCC D;  5AVT B;  2YO2 A;  1URQ D;  2JKV A;  2A45 G;  1LP1 A;  3CC4 P;  1LGH B;  1LWU B;  1AVY A;  1M1J B;  1RHZ B;  3E1R A;  5DJU B;  1IFM A;  1LNQ A;  1LTS C;  2O01 N;  3T97 A;  3Q3D A;  1LTI C;  2QG4 A;  2KIK A;  2W27 A;  1Q2N A;  3B8E B;  5KJ7 A;  1ZRT E;  3H1H E;  2J5U A;  1PP9 J;  3HE4 A;  2IZ1 A;  2HR3 A;  3CXH D;  2KLV A;  1GL2 A;  1GD2 E;  1GZL A;  2I8D A;  5B5E H;  4ASW A;  2WTY A;  5AVY B;  1KIL B;  1ZR4 A;  3OAK A;  2LXB A;  1U57 A;  3H1I E;  2XKM A;  4WY4 D;  5KLV E;  1JCC A;  2AXC A;  3GW6 A;  1D7M A;  1SQB K;  3L74 J;  4OGQ D;  3AE4 C;  3MD0 A;  4IL6 E;  2UWJ E;  1FZF A;  1FZE A;  1FBM A;  1BGY E;  3TNU A;  1PPJ E;  4N78 D;  1LTA C;  1SQX J;  3C8V A;  1L4A D;  1R8E A;  5AW9 B;  3AEE C;  1EDK A;  5KTB A;  1L4A C;  4WBA A;  3Q5R A;  3AE5 C;  3CWB G;  3P32 A;  1H89 A;  1Y8A A;  2IFM A;  1KYO D;  1IK7 A;  2A06 E;  2WQY C;  3TF5 A;  4GOE A;  2XND H;  2ZT9 C;  3P7K A;  3D71 A;  4B86 A;  1CSB A;  2WIT A;  2W6B A;  1N73 B;  4I7Z C;  2BCC E;  2B89 A;  3L71 J;  1KYO I;  3GHG B;  3RL0 B;  3CI9 A;  5E79 E;  1JY2 O;  2GUS A;  2ZYA A;  2IBZ E;  2QVA A;  3AE7 C;  4N6J A;  2C0X A;  3MIW A;  2JO1 A;  3A2A A;  1DH3 A;  1OIP A;  3BCC G;  4EDF A;  4HKZ H;  1YJN P;  2YKP A;  2XU6 A;  1BDC A;  4A7P A;  2A45 H;  1U7M A;  4DJG A;  3CLQ A;  2QM8 A;  4NPF X;  3KZI H;  3V5B A;  1FC2 C;  1NYH A;  2FYN C;  1JY2 N;  5APS A;  2WT7 A;  3O8Z A;  5L8R J;  2B88 A;  1JY3 N;  1DD4 A;  1W5C E;  2FYN B;  4YTP C;  3H1K J;  2K3R A;  1LTJ A;  4RO0 A;  1RF1 B;  3V2N A;  3CX5 I;  2Y0C A;  1NU1 E;  3S1K A;  1W2E A;  1Y9B A;  2FFD C;  2M8R A;  1AJY A;  1FOS F;  3VMA A;  1GU4 A;  3AE3 C;  1KB9 E;  3FXE A;  3CC7 P;  4O9B A;  2OGU A;  2XV5 A;  3HD7 A;  3M9H A;  2YMY A;  1P84 D;  1NTZ G;  2E74 C;  3CX5 H;  4C7N B;  3CWB D;  5CJ0 A;  1HBW A;  1SQQ G;  1FOS E;  2POH A;  2YXQ B;  3IF4 A;  3B71 A;  4JYC A;  4PD4 I;  2Z5I A;  5AW3 B;  2K37 A;  2QM7 A;  1SQV E;  5GTH H;  1PGQ A;  4OH8 B;  1IO4 A;  2HLO A;  1PL5 A;  3A0B E;  5AW0 B;  1SQP D;  4GIF A;  1X8Y A;  4XE5 B;  3F5H A;  2FXP A;  3IN6 A;  3MZW B;  4HB1 A;  1JTH A;  1ZLL A;  1FS0 E;  1RE3 C;  2RMZ A;  4IOI H;  2KOG A;  3RL0 D;  1G1J A;  1AVO A;  2E76 B;  3P8M C;  1BDD A;  1SQP J;  2E75 C;  1ZN5 A;  2R5D A;  5KLV J;  3H1K D;  2YIU C;  3L70 G;  3MUD A;  4U7J A;  2E42 A;  2H89 C;  1KIL C;  2FKW B;  2C9N Y;  5TIS E;  1DIP A;  3L71 E;  1HTL C;  1NAF A;  2RKL A;  1N7S D;  4NPE A;  2N9Y B;  1NVO A;  1VQL P;  3HD7 D;  3V2R A;  1PP9 E;  4R4M A;  3FWL A;  4PV1 D;  2QSI A;  2YMK A;  5KKZ C;  1AQT A;  1SS1 A;  1CZQ A;  2K9J B;  3KDP B;  3L71 D;  2NZ2 A;  4EI2 A;  4ZKP A;  1BE3 J;  3O6Q A;  1BCC G;  3QWO C;  1LT9 B;  2M3B A;  2YKO A;  4JQ0 D;  5BU8 B;  3HRN A;  5CCG D;  5KAF H;  5KKZ B;  5AVS B;  3BRT B;  3TDK A;  3AEA C;  2OYH B;  1PIX A;  3PHL A;  1NTK D;  1L0L K;  1VL2 A;  2R3S A;  1N7S A;  2BCC J;  2PFX A;  3HTK B;  3JC2 2;  5DJT B;  1S5L H;  4H0L C;  3SFD C;  5KLI C;  1JNM A;  1P84 E;  2FYZ A;  1NTM J;  1EZV I;  1OVU A;  2IBZ I;  3H1J E;  3VMY A;  3P8C E;  1L0N E;  1FJP A;  3HE5 B;  1BSN A;  1OX3 A;  1JUN A;  5AW7 B;  3AE6 C;  4K3A A;  2WSE J;  3B5N D;  1FDI A;  3WU2 E;  3D6Z A;  1R5L A;  3LW5 H;  1N73 A;  2K9Y A;  4WY4 C;  4ASV A;  2OYH A;  4PJ0 H;  1JCD A;  3GHG A;  1S72 P;  1Y47 A;  2P2U A;  1X9V A;  2KNC B;  3KHU A;  1HWT C;  1YIT P;  4MN4 C;  3RL0 g;  2A45 I;  1S4X A;  3H1K G;  3WU2 H;  1KQG B;  2KZI A;  1U7J A;  1LWU A;  2KSJ A;  2JJL A;  2JP3 A;  2FXO A;  1YJ9 P;  1KD1 Q;  4H44 B;  5AW2 B;  1KFM A;  4Y99 C;  2OYH C;  1EDJ A;  1SQX G;  3HE4 B;  4PD4 D;  1GL2 C;  1M1K Q;  2HPC B;  3H1L D;  5KAF E;  2HOD A;  2IBZ D;  4WB4 A;  1NU1 K;  1EC5 A;  4Y99 B;  1OW6 A;  1BE3 E;  3H1J D;  3L74 G;  1Q81 Q;  1FZC A;  2QJY C;  4AQR D;  2N1T A;  1S5L X;  4Y28 J;  1VQN P;  2R3C A;  1KIL D;  1MV8 A;  2ZYG A;  3RK2 C;  1QEX A;  5CBO A;  5GTH E;  2ZFC A;  1WMK A;  3IAO A;  3Q5P A;  3D70 A;  3O6Q B;  1DX7 A;  2A06 D;  4RES B;  3CC2 P;  4L76 A;  1LTJ B;  3TGU G;  4D6T G;  3Q2Y A;  1YI2 P;  3A7O A;  1JOC A;  2MKV A;  3PH0 A;  4OGQ B;  3H1L G;  3RK3 D;  1FAV A;  1SQQ D;  1OW7 A;  1T8Z A;  1SQP E;  1E5W A;  2E75 D;  2W8Z A;  4GKG A;  3RBZ A;  3V2P A;  3CCV P;  5H2F H;  1PPJ D;  1VQM P;  3BVH A;  1OW8 A;  1PP9 D;  2N1T B;  2KI7 B;  1Q82 Q;  1NKN A;  1N7L A;  1GTW A;  2WSE H;  4L74 A;  2P7J A;  1KQF B;  3UIA A;  5B66 E;  2HFE D;  2N9B A;  1IFP A;  3L73 J;  5KAI E;  3H25 A;  1YQ3 C;  3HUS B;  2BAS A;  1E79 H;  2M5A A;  2ZT9 B;  3H1H J;  4KJM A;  1QLE D;  2O01 J;  3PTZ A;  3TK1 A;  5CCH A;  1S3J A;  1VQO P;  1IZN B;  4GDO A;  5APT A;  2FFD B;  1N73 C;  4XFJ A;  1JMM A;  1L0N K;  2QJK B;  3MHV A;  1MFT A;  1LT1 A;  5AVW B;  3H1H D;  4W7Y A;  2BEZ F;  3G9R A;  2WMM A;  2ITA A;  3PP5 A;  5KAI H;  5CMZ A;  3HUS C;  3RGU A;  4Z1M H;  2WZ7 A;  3L73 E;  3SWK A;  4H0L D;  1FE6 A;  2WPS A;  3RK2 B;  2M5A B;  1P84 I;  2ZT9 D;  2NPS B;  4IFD K;  1RF0 A;  5BU5 A;  1L0N D;  3H6P A;  1NU1 J;  1N8R Q;  2D2C C;  3KXD A;  3VYI A;  2K88 A;  1RE4 C;  1HJB A;  1J1E B;  2I1J A;  2K1A A;  1NTM G;  2L5G B;  1T2K D;  3U59 A;  2O01 H;  3JCU E;  3RL0 C;  3B4S A;  1BSH A;  1VDF A;  1EDL A;  3N4X A;  3VP8 A;  5APQ A;  1KQL A;  3WUV A;  1IK9 A;  4AUW A;  3N7N A;  4EIJ A;  3P8C D;  5CHX A;  1N7S B;  2W6J H;  3L75 G;  1PV3 A;  4UB6 H;  3W68 A;  3CME P;  3GF7 A;  2HPC A;  1JB0 J;  2V7Q J;  5EFW B;  1VQK P;  1SQB G;  4JF7 A;  4BRY B;  1J1E C;  1USD A;  3E7K A;  1OVV A;  1M7L A;  2Y0D A;  3PJS K;  1L0L E;  3WUT A;  2OYI C;  1FDO A;  3HTK A;  2HG5 D;  2PGD A;  2OTL P;  1KMI Z;  4I2L C;  1FZC B;  1KZU B;  2JR8 A;  1JO5 A;  2AEF A;  1K8A Q;  3R2P A;  2E5Y A;  3BAS A;  4DZO A;  1KYO H;  3B5N A;  3NTN A;  2OAR A;  2P67 A;  2JEE A;  2B87 A;  2AXT H;  1Z56 A;  2YXR B;  1KV4 A;  1NTM K;  2R44 A;  3E1I A;  3FXD A;  3H1I G;  4HYT B;  5KJ7 D;  3ZDM A;  1URQ C;  1UII A;  4PD4 E;  3Q1M A;  1OVR A;  1K04 A;  3OA7 A;  3RK3 E;  1URQ A;  2WSC J;  4NPD A;  2AXT E;  1VQ5 P;  1BGY G;  3CXH I;  3IR9 A;  3AE1 C;  4IFM A;  3HD7 C;  2QIW A;  1NH4 A;  3M0D A;  1BCC J;  1KIL E;  1OZH A;  1S1C X;  1Q90 D;  1ZRT D;  2PRR A;  3CWB E;  3G6E P;  1S9K E;  2HOD B;  2J59 M;  2P1J A;  2NPS A;  2KS1 B;  3CXH H;  3MGN A;  2JDI H;  2PP6 A;  3MTU E;  2AEJ A;  2OTJ P;  2GM4 A;  2O1J A;  3MP7 B;  1SQV K;  2PAJ A;  3A0H E;  2E5T A;  2N1T D;  2OYO A;  3BRV B;  4OGQ C;  3M06 A;  3WMM 0;  3NFQ A;  5K5G B;  1M1J A;  2Y9Y A;  2Q9I A;  1FZC C;  1NHL A;  1J2J B;  1WT6 A;  3CCU P;  3AE2 C;  5KLV D;  1JY2 P;  1FU1 A;  4U3F E;  3I55 P;  1M56 D;  3L37 A;  3CL3 D;  3V4W A;  1EZV G;  2IBZ G;  2LXC B;  5B66 H;  2Q7C A;  2IZ0 A;  3FWN A;  3VMX A;  1H88 A;  1NTK E;  1LTB C;  2Q3E A;  1NU1 D;  1P84 H;  2C0W A;  3L74 D;  4C7R A;  1YYC A;  3K5B A;  3L72 G;  3L73 D;  4I1L A;  4DCK A;  1AV1 A;  2E74 D;  1CW5 A;  2OTK E;  1VQ4 P;  2FYU G;  1VQ7 P;  1FZB A;  1M90 Q;  1RF1 A;  1H0T A;  1G2C B;  3RBX A;  4WWI A;  1JM0 A;  1XTC C;  3L35 A;  3FX0 A;  1GU5 A;  1AFO A;  3S4R A;  1VPC A;  3TNU B;  2NPS D;  2O3J A;  3VP9 A;  1K73 Q;  1KN7 A;  4ZKU A;  1SQP K;  1NTK J;  1MZ9 A;  3AEB C;  3EFF K;  1NU1 G;  1SP4 A;  2BCC D;  3C9I A;  4UB8 H;  4H44 C;  1SQB D;  3W67 A;  1EZV D;  2E74 B;  1GK4 A;  4BWN A;  1PGP A;  1H0T B;  1A02 J;  2J58 A;  1JEK A;  1NTZ E;  3A0H H;  5CCH D;  1NKZ B;  1XTG B;  1L2P A;  2FBW C;  1SQQ E;  3H32 A;  3L72 J;  2GUV A;  3NMD A;  5E79 H;  3CCQ P;  2YKQ A;  1SQQ K;  1JTH B;  4JBZ A;  1SQV G;  1T3U A;  4K35 A;  4N3Y B;  3CPW O;  3U1A A;  3ITK A;  2D2C D;  4YXW H;  1RY3 A;  1URQ B;  1NOH A;  1NTK K;  2QJP B;  3A3Y B;  3BAT A;  3H1H G;  1LP1 B;  1OWA A;  4JYB A;  2GA1 A;  1PZQ A;  1EQ7 A;  1ZME C;  5APY A;  1MFZ A;  2ZAE B;  1K05 A;  5CBN A;  1H8A A;  1LTJ C;  2KUB A;  1QX8 A;  5KLV G;  1X0T A;  3L70 E;  1IFD A;  2VRS A;  2DW3 A;  3SSU A;  3V2Q A;  2N1T C;  3CMA P;  3L71 G;  1KIL A;  1KQS O;  1IFI A;  3CCM P;  4RJT A;  1VQ6 P;  1PPJ G;  2IPP A;  1LT9 A;  1PP9 G;  1S2E A;  2ZVO B;  3CCJ P;  1SFC A;  1SQV D;  3SWF A;  4CPG A;  5H2F E;  1IFN A;  1NAY A;  5APV A;  2A06 G;  4U3F D;  4JPZ B;  4ZMD A;  2W6A A;  4YXD C;  4C7N A;  1OFC X;  4OWF A;  1S9K D;  2E76 C;  3HE5 A;  1NGM B;  1KTM A;  2KXP B;  2YIU B;  3EWK A;  4PJ0 E;  2BCC G;  3CCR P;  3V6I A;  2AEM A;  1IC2 A;  1ZXG A;  4EYY Q;  2C9L Y;  1HGV A;  4H13 D;  3II6 A;  4PD4 H;  1L0N G;  2R5B A;  5TIS H;  3RK3 B;  1SQX K;  2KS1 A;  2WSC H;  3LID A;  4PV1 B;  5M1B A;  1TU3 F;  2KNC A;  3BCC E;  1NTM D;  1RH5 B;  2OQQ A;  3CX5 D;  5GTI E;  1ZP0 C;  1SFC C;  3PLN A;  5CCG C;  3S9O A;  4AYC A;  3M0A A;  2CPS A;  2G8Y A;  1Q7Y Q;  1HGZ A;  1NO4 A;  3L75 J;  1FDM A;  2W83 C;  1N7S C;  1HH0 A;  2H88 C;  2QE7 H;  1N2D C;  1RF1 C;  5BVZ A;  2KK7 A;  1BE3 D;  3H1K E;  5GTI H;  3D6Y A;  1SQQ J;  3SWY A;  2CPB A;  2KSE A;  2P58 A;  3JCU H;  3L72 D;  4KHX A;  4W80 A;  2Z4E A;  1VQ9 P;  4ZNC A;  4U3F J;  1L0L D;  3KYQ A;  1CI6 A;  2JWD A;  2V7Q H;  1SQX E;  2Y9Z A;  4C46 A;  2V4H A;  5APX A;  1SLQ A;  3B5N B;  3CD6 P;  5AW1 B;  1EXJ A;  2QJP C;  3ABV C;  4WVZ A;  1M1J C;  3L74 E;  1J1D B;  1X22 A;  3JSV C;  3BCC D;  1KC8 Q;  3U1C A;  1KOR A;  3HD7 B;  3LIE A;  1T2K C;  2ZXX A;  3I56 P;  1OMI A;  1VF5 C;  1WRG A;  1NJI Q;  4D6T E;  3TGU E;  1BGY D;  1ZOY C;  1VQ8 P;  1KB9 D;  3BCC J;  3USS A;  2QJK C;  2FY8 A;  1N86 A;  3H1L E;  4GT1 A;  2JWA A;  3VOP A;  2WSS H;  3KQG A;  3F89 A;  1DEB A;  2HYN A;  1X79 B;  1YQ4 C;  2RN0 A;  3KZI E;  2WWW A;  4QMA A;  1MUU A;  3KPE A;  2E76 D;  1RQV A;  2KLU A;  1JY3 O;  2RH0 A;  3CXH E;  3H1L J;  3C1L A;  3AE8 C;  2WPQ A;  4H13 C;  3TGU J;  4D6T J;  1GW3 A;  2Q5U A;  2NRG A;  1QL1 A;  4DOJ A;  2LKM A;  3H1I J;  2FYU D;  1PGJ A;  4HH2 A;  3G4S P;  1BCC E;  3WUU A;  2CK3 H;  4W7Z A;  1S5L E;  1NTZ J;  3GLM A;  4DT0 A;  1YTZ I;  3L73 G;  2YNY A;  3M9B A;  3CCE P;  2ZXE B;  2OYI A;  1SQV J;  2FYU J;  2Q1K A;  3CCL P;  1HUC A;  1SFC B;  2LR2 A;  3TSI A;  3M91 A;  4IL6 X;  3G71 P;  3OJA B;  1W2B O;  4GOD A;  2BEQ D;  3H1J G;  4L73 A;  3FGA D;  3L75 D;  4XA4 A;  2ZYD A;  3CCS P;  2NPS C;  4HJG H;  4RKU J;  1UIX A;  1K9M Q;  4M3L A;  1EXI A;  1GL2 B;  1JY3 P;  3CWB J;  5AVX B;  1QVF O;  1L0N J;  3M0D C;  4L75 A;  1GK6 A;  2WT7 B;  5AW4 B;  3L75 E;  1CI6 B;  5C39 A;  1SVF A;  1LWU C;  1RF0 C;  2IDB A;  1G1I A;  1LTG C;  3IFM A;  1SQB E;  4R4L A;  1SFC D;  2WSF H;  3AE9 C;  3QH9 A;  1HF9 A;  4LLH A;  1L0L G;  4BRY A;  2Q3I A;  3M9Q A;  2H43 A;  5B5E E;  3GHG C;  3HUS A;  1VQP P;  5AW6 B;  1GMJ A;  1J1D C;  2SPZ A;  1NTZ K;  5AVQ B;  2XDJ A;  3AED C;  1YBK A;  1L4A A;  1LJ2 A;  3A0B H;  4EOT A;  2E75 B;  3OW2 O;  1QL2 A;  2E43 A;  3I5C A;  2M0B A;  2IYO A;  1JMB A;  1BE3 G;  2WPR A;  1DD3 A;  2OYI B;  2IFN A;  4OVN F;  4YPC A;  5AVU B;  1LTT C;  2M3E A;  3NXS A;  1SQB J;  4I6M C;  1L0L J;  1T3J A;  4LGD E;  1QGK B;  3TYY A;  4IL6 H;  2XZR A;  2KZJ A;  5KLI B;  1L4A B;  1USE A;  1A02 F;  5KLV K;  3AEC C;  1FZG A;  3R4Y A;  1FJK A;  4UB6 E;  3L36 A;  1AQ5 A;  2R32 A;  2O1K A;  1SQP G;  2L91 A;  1QVG O;  1HVV A;  2W90 A;  1RE4 A;  4D6T D;  4I7Z B;  3L70 J;  1YTZ T;  5CJ4 A;  5KJ7 C;  3TGU D;  5TJH A;  2KP8 A;  3V4Q A;  1IJD B;  2QEX P;  2ZJS E;  5AW5 B;  1BGY J;  1SQX D;  2QJY B;  1T6A A; 
#chains in the Genus database with same CATH homology
 2FYU K;  5AW8 B;  3VN0 A;  1FZA A;  1ZV8 A;  2YO3 A;  5CCG A;  2IX7 C;  2KB7 P;  1RE3 A;  4WY4 B;  1ZR2 A;  1NWQ A;  5APW A;  1OXZ A;  3EQ2 A;  1G2C A;  3RK3 C;  1A02 F;  2KYV A;  4IFF A;  1PFI A;  2FXM A;  2H8P D;  1KFN A;  5CCH C;  5AVR B;  5APU A;  5AVZ B;  3EFG A;  1IFJ A;  3A5T A;  1GDT A;  1GW4 A;  4WY4 A;  2I1K A;  2XNX A;  3RK2 D;  2MJZ A;  3VMZ A;  3B5N C;  3H32 B;  4LC1 A;  2Z5H A;  1GL2 D;  3L4F A;  3G3Z A;  3VTP C;  1LT9 C;  4N78 E;  5AVV B;  2H7H A;  5AVT B;  2YO2 A;  1URQ D;  2A45 G;  1LGH B;  1LWU B;  1M1J B;  1IFM A;  1LTS C;  3T97 A;  1LTI C;  3B8E B;  2W27 A;  5KJ7 A;  3HE4 A;  2KLV A;  1GL2 A;  1GD2 E;  1GZL A;  2WTY A;  5AVY B;  1KIL B;  1ZR4 A;  3OAK A;  4WY4 D;  2XKM A;  1JCC A;  1SQB K;  3MD0 A;  1FZF A;  1FZE A;  1FBM A;  3TNU A;  4N78 D;  1LTA C;  1L4A D;  5AW9 B;  5KTB A;  1L4A C;  4WBA A;  3P32 A;  1H89 A;  2IFM A;  3P7K A;  4B86 A;  1CSB A;  2WIT A;  2W6B A;  1N73 B;  3GHG B;  3RL0 B;  3CI9 A;  1JY2 O;  2GUS A;  4N6J A;  2C0X A;  3MIW A;  3A2A A;  1DH3 A;  2YKP A;  2XU6 A;  2A45 H;  3CLQ A;  2QM8 A;  3V5B A;  2WT7 A;  5APS A;  1JY2 N;  3O8Z A;  1JY3 N;  1LTJ A;  1RF1 B;  3V2N A;  2FFD C;  1W2E A;  2M8R A;  1FOS F;  1GU4 A;  4O9B A;  2XV5 A;  3HD7 A;  3M9H A;  2YMY A;  1HBW A;  4C7N B;  5CJ0 A;  1FOS E;  2POH A;  5AW3 B;  4JYC A;  2Z5I A;  2QM7 A;  4OH8 B;  2HLO A;  5AW0 B;  4GIF A;  1X8Y A;  4XE5 B;  3V2Q A;  1ZLL A;  1JTH A;  1RE3 C;  3RL0 D;  2KOG A;  1G1J A;  3P8M C;  1ZN5 A;  2R5D A;  3MUD A;  2E42 A;  1KIL C;  2FKW B;  2C9N Y;  1HTL C;  1NAF A;  1N7S D;  3HD7 D;  3V2R A;  3KDP B;  1CZQ A;  4ZKP A;  5BU8 B;  1LT9 B;  2M3B A;  2YKO A;  3HRN A;  5CCG D;  5AVS B;  3BRT B;  2OYH B;  1L0L K;  1N7S A;  3HTK B;  1JNM A;  2FYZ A;  3VMY A;  1FJP A;  3P8C E;  3HE5 B;  1JUN A;  5AW7 B;  3B5N D;  3LW5 H;  1N73 A;  4WY4 C;  2OYH A;  1JCD A;  3GHG A;  2P2U A;  1X9V A;  1HWT C;  2A45 I;  1LWU A;  2JJL A;  5AW2 B;  1KFM A;  4Y99 C;  3HE4 B;  1GL2 C;  2HPC B;  2HOD A;  4WB4 A;  1NU1 K;  4Y99 B;  1FZC A;  4AQR D;  2N1T A;  2R3C A;  1KIL D;  1MV8 A;  3RK2 C;  2ZFC A;  1DX7 A;  4RES B;  1LTJ B;  3A7O A;  1JOC A;  3RK3 D;  1FAV A;  1T8Z A;  4GKG A;  1E5W A;  3V2P A;  3BVH A;  2N1T B;  1NKN A;  1N7L A;  1GTW A;  2WSE H;  2P7J A;  3UIA A;  2HFE D;  2N9B A;  3HUS B;  2BAS A;  3TK1 A;  5CCH A;  2OYH C;  2FFD B;  1N73 C;  5APT A;  1JMM A;  1L0N K;  5AVW B;  4W7Y A;  3PP5 A;  5CMZ A;  3HUS C;  2WZ7 A;  2WPS A;  3RK2 B;  4IFD K;  2NPS B;  1RF0 A;  5BU5 A;  3H6P A;  3VYI A;  1RE4 C;  1HJB A;  1J1E B;  2I1J A;  2OYI B;  1T2K D;  2L5G B;  3U59 A;  2O01 H;  3RL0 C;  1VDF A;  3N4X A;  3VP8 A;  5APQ A;  1KQL A;  1IK9 A;  4AUW A;  3N7N A;  4EIJ A;  3P8C D;  5CHX A;  1N7S B;  2HPC A;  4JF7 A;  1J1E C;  2OYI C;  1M7L A;  3HTK A;  2HG5 D;  4I2L C;  1FZC B;  1KZU B;  1JO5 A;  3R2P A;  3BAS A;  4DZO A;  3B5N A;  3NTN A;  2OAR A;  2P67 A;  2JEE A;  1Z56 A;  1NTM K;  3E1I A;  5KJ7 D;  4HYT B;  1URQ C;  3OA7 A;  1URQ A;  3IR9 A;  4IFM A;  3HD7 C;  1NH4 A;  3M0D A;  1S9K E;  2FFD A;  1IO4 A;  2HOD B;  2J59 M;  2P1J A;  2NPS A;  3MTU E;  3MGN A;  2PP6 A;  2GM4 A;  2O1J A;  1SQV K;  2PAJ A;  2N1T D;  3BRV B;  3WMM 0;  3M06 A;  3NFQ A;  1M1J A;  2Q9I A;  1FZC C;  1NHL A;  1J2J B;  1WT6 A;  1JY2 P;  1FU1 A;  3L37 A;  3CL3 D;  3V4W A;  1H88 A;  2Q7C A;  3VMX A;  1LTB C;  4C7R A;  2C0W A;  1YYC A;  1CW5 A;  4I1L A;  1FZB A;  1RF1 A;  1G2C B;  1XTC C;  3L35 A;  1GU5 A;  1AFO A;  1VPC A;  3TNU B;  2NPS D;  3VP9 A;  4ZKU A;  1SQP K;  1MZ9 A;  1SP4 A;  3C9I A;  1GK4 A;  1A02 J;  2J58 A;  5CCH D;  1NKZ B;  1XTG B;  3H32 A;  3NMD A;  2GUV A;  2YKQ A;  1SQQ K;  1JTH B;  1T3U A;  4N3Y B;  3U1A A;  1RY3 A;  3BAT A;  1NOH A;  1NTK K;  1URQ B;  3A3Y B;  1OWA A;  4JYB A;  1EQ7 A;  5APY A;  1MFZ A;  1H8A A;  1LTJ C;  1IFD A;  2VRS A;  2N1T C;  1KIL A;  1IFI A;  2IPP A;  1LT9 A;  1SFC A;  3SWF A;  1IFN A;  5APV A;  2W6A A;  4C7N A;  1S9K D;  3HE5 A;  1IC2 A;  2C9L Y;  1HGV A;  3II6 A;  2R5B A;  3RK3 B;  1SQX K;  2WSC H;  3LID A;  1SFC C;  4AYC A;  5CCG C;  3M0A A;  2CPS A;  1FDM A;  1HGZ A;  1NO4 A;  1N7S C;  1HH0 A;  1RF1 C;  1N2D C;  5BVZ A;  3SWY A;  2CPB A;  4KHX A;  4W80 A;  2Z4E A;  3KYQ A;  1CI6 A;  4C46 A;  5APX A;  1SLQ A;  3B5N B;  5AW1 B;  1M1J C;  1J1D B;  3U1C A;  3LIE A;  3HD7 B;  1T2K C;  1WRG A;  1N86 A;  4GT1 A;  3VOP A;  3KQG A;  1DEB A;  2HYN A;  1X79 B;  2WWW A;  1MUU A;  3KPE A;  1JY3 O;  2WPQ A;  1GW3 A;  2Q5U A;  4DOJ A;  1QL1 A;  2LKM A;  4HH2 A;  4W7Z A;  1YTZ I;  2YNY A;  3M9B A;  2ZXE B;  2OYI A;  1HUC A;  1SFC B;  3TSI A;  3M91 A;  3OJA B;  4XA4 A;  2NPS C;  4M3L A;  1GL2 B;  1JY3 P;  5AVX B;  3M0D C;  1GK6 A;  2WT7 B;  5AW4 B;  1CI6 B;  1SVF A;  1LWU C;  1RF0 C;  1G1I A;  1LTG C;  3IFM A;  1SFC D;  2WSF H;  4LLH A;  2Q3I A;  3M9Q A;  2H43 A;  3GHG C;  3HUS A;  5AW6 B;  1J1D C;  1NTZ K;  5AVQ B;  2XDJ A;  1L4A A;  4EOT A;  1QL2 A;  2E43 A;  3I5C A;  2WPR A;  2IFN A;  5AVU B;  1LTT C;  3NXS A;  4I6M C;  1T3J A;  4LGD E;  3TYY A;  2XZR A;  1L4A B;  5KLV K;  1FZG A;  1FJK A;  3L36 A;  1AQ5 A;  2R32 A;  2O1K A;  1HVV A;  1RE4 A;  5KJ7 C;  5CJ4 A;  1YTZ T;  2KP8 A;  3V4Q A;  1IJD B;  5AW5 B;  2KSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...