2YNYA

Salmonella enterica sada 255-302 fused to gcn4 adaptors (sadak1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ynyA00
3TYYA 5AW7B 2VRSA 3B8EB 4JYCA 3A2AA 2Z5HA 5APWA 3VMXA 1NWQA 1FAVA 5AW3B 1SLQA 2XU6A 5AVTB 1S9KE 5APUA 2E43A 3M9HA 2H7HA 3V4QA 3TNUA 2Q7CA 2R32A 1CZQA 5APSA 5AW9B 4HYTB 1GK6A 3A3YB 1MV8A 3MD0A 5AVSB 3MGNA 1S9KD 4AUWA 3LIDA 3O8ZA 5AW4B 3VMZA 3TNUB 2W27A 4AYCA 2P2UA 1JUNA 5APXA 1GU5A 1MFZA 4C7NA 4EOTA 4GKGA 5AVUB 1OXZA 2E42A 5AVRB 5AW8B 2WT7B 3VMYA 3A5TA 2BASA 4C7NB 2Q3IA 3HE4A 5AW2B 2YNYA 1A02F 3KQGA 3HE5A 4I6MC 4XE5B 5CMZA 5AVXB 2N9BA 2R3CA 3OAKA 3HE4B 2KP8A 2WWWA 1CSBA 1MUUA 1X8YA 2W6AA 3HE5B 3M91A 2Q5UA 2WPRA 5AVYB 5APVA 1T2KD 2R5BA 1HJBA 1T2KC 2WT7A 4JYBA 2YO3A 4GT1A 5AW6B 3SWFA 1OWAA 3VYIA 3M9BA 5AVVB 3HTKA 1JNMA 1J2JB 4C46A 3M0AA 1CI6A 2C9LY 1GD2E 3P7KA 4I2LC 1HUCA 1G2CB 2QM8A 3TK1A 4LC1A 2WTYA 5AW1B 4M3LA 3P8MC 1A02J 3UIAA 1H88A 2C9NY 3LIEA 1FOSF 4DZOA 3V5BA 1KQLA 1NAFA 3P32A 3L37A 3V4WA 1CI6B 1FOSE 5AVQB 5APYA 4AQRD 2Z5IA 5AW5B 3M06A 5AW0B 1H89A 2ZXEB 2P7JA 2WPQA 3IR9A 3NFQA 2IPPA 1GTWA 3L36A 1GZLA 5APTA 2P67A 1GU4A 4B86A 1DH3A 1YYCA 3I5CA 3VN0A 1IO4A 2R5DA 2QM7A 1SP4A 2ZFCA 4RESB 3A7OA 3VTPC 1H8AA 1GK4A 5AVWB 3KDPB 2WPSA 3L35A 2JJLA 2XZRA 3M0DA 4KHXA 1HWTC 3T97A 3NMDA 2YO2A 2XV5A 5AVZB 3NTNA 1HBWA 3NXSA 5APQA
chains in the Genus database with same CATH superfamily
2QJPC 2Y0EA 3B8EB 2AXTE 5CCHA 3L70E 4I7ZC 5APUA 3H32B 2KSJA 3A0HH 2FY8A 2RH0A 3TGUD 2JEEA 1HVVA 4XFJA 3AEAC 1WMKA 2N1TD 2HPCB 2UWJE 1MZ9A 1JMBA 3CI9A 1GL2B 2FXMA 2GUVA 2IX7C 1J1DC 3HE5A 4I6MC 3MZWB 4XA4A 1KZUB 1YHQP 5AVYB 3AEDC 1HJBA 4HH2A 1Q7YQ 2NPSA 1Y8AA 2LXCB 4HJGH 1ZN5A 2C9LY 5CBOA 1K9MQ 3H1LE 1HUCA 1LT9A 3E1RA 3RGUA 1SQVJ 1H88A 2AEFA 3V5BA 3EFGA 2OGUA 5GTHH 1KQSO 1OMIA 1NTKD 3FGAD 1ZR2A 3SWYA 1SFCA 1FS0E 4YXWH 2WPSA 2A06D 2ZVOB 2ZYDA 3EFFK 1SQVG 3PHLA 1LNQA 4UB8E 2VRSA 2JP3A 1BGYJ 3Q1MA 2Y9YA 1YBKA 2W83C 5KAFE 4PD4I 2Q7CA 3B5NA 4GDOA 1GMJA 1NAYA 3CC2P 1SQQK 4BXLA 4GOEA 1HGVA 1FZGA 1ZRTD 4EOTA 1BCCE 2N1TC 2V7QJ 3G71P 1WRGA 2WT7B 1ZV8A 3H1HJ 4A7PA 1BGYG 4UB6E 5K5GB 1LP1A 1EXIA 2AXCA 3L74E 3D71A 2KK7A 1BSHA 1J2JB 3S4RA 2C0XA 3H1HG 3BCCD 3CC4P 3RK3B 4H13B 3M06A 2JO1A 3M0DC 2WPQA 1FE6A 4WVZA 1NVOA 1K73Q 1KYOI 3L71D 1NU1E 4GIFA 2ZFCA 3W67A 4WY4D 2JJLA 2D2CB 4ASVA 4WWIA 1SQPJ 1RF1C 5AVZB 3D6YA 2M5AB 2E76B 3CPWO 2K9YA 1VQMP 2WZ7A 1L4AA 1LTSC 1LTJB 1N7SD 1SQBK 1N7SB 5AW3B 5GTIE 3TGUE 2GUSA 2J59M 5KJ7A 2H7HA 2B87A 1ZP0C 1JCDA 1CZQA 1IFJA 1PZQA 1ZXGA 2JWAA 4C7NA 4PV1D 4PV1B 1SQPG 5KTBA 3FXEA 3G3ZA 1OW6A 1IFPA 2OYIA 2K88A 1IJDB 2L91A 4JYBA 4GT1A 4JF7A 3L72J 1GW4A 4IFDK 1VQLP 1QL2A 1JOCA 1FOSF 2BEQD 1CI6B 4O9BA 3JCUE 2IBZD 1IFNA 2R3SA 1YITP 3H1KE 1NTKE 3IR9A 3BRTB 4H0LD 4H0LB 1LWUB 2P10A 5APTA 3Q5SA 1USDA 2ZT9B 5CCHD 2W6JH 4C7RA 1H8AA 1IK7A 1JY3O 3L72G 5AVWB 3L75J 4WY4C 2IYPA 1JMMA 3PLNA 2FYZA 2XV5A 1DX7A 3OJAB 3NTNA 3P8CD 1EDIA 3H1ID 1LTJC 1S4XA 1N7SC 1NWQA 2P1JA 1JY2P 3II6A 3FWLA 5H2FE 1RE4C 1ZRTE 2OTKE 4ZKPA 5AW4B 2FFDA 2RKLA 3L75G 3AE3C 3V2RA 2IFNA 5KLVJ 4U3FJ 1QEXA 2HR3A 3VMYA 2NPSD 2NPSB 2PAJA 1R5LA 2QRXA 1RHZB 4L76A 1VQ7P 1L0ND 2K9JB 3QH9A 2Q6QA 2A45H 3GLMA 1KD1Q 1VQPP 5KLVG 4U3FG 3BCCE 3RK3E 1Q90D 2WSEJ 3AE5C 1G2CB 1SFCD 1SFCB 3A0HE 1NAFA 3L37A 2QG4A 3L71E 3V2QA 1JEKA 2YKQA 1P84I 2HFED 1PV3A 5CCHC 3RBXA 1L0NK 3C9IA 3B5ND 3B5NB 4KJMA 3T97A 1LTBC 2KXPB 1HBWA 4EIJA 1FDOA 5KLIB 1URQA 1R8EA 2KS1B 1D7MA 2FYUJ 4BRYA 5B66H 3GHGB 2Q3EA 4OGQC 3SWKA 5BU5A 3VMZA 3AEEC 2IZ0A 1SQVD 2KLUA 3F5HA 1JB0J 1N73A 2M3EA 4I7ZB 5GTHE 2NPSC 4JQ0D 4NPEA 2FYUG 1QL1A 1LT9C 5APVA 1JY2N 2YO3A 4KT0J 3CCRP 3V2NA 2O01H 4C46A 1BGYD 4ZMDA 2QM8A 2J58A 1L2PA 4DZOA 1SQVK 1SFCC 3HD7A 1EZVD 2QJYC 1AQ5A 2ZVNB 3SSUA 1Y9BA 2JKVA 3S1KA 1L4AD 2IFMA 3WUUA 3R4YA 4BWNA 3QWOC 1YTZT 2B87B 3H1IE 4L75A 3B5NC 4LGDE 5KLIC 1M1JA 3R2PA 2QE7H 3WUVA 1PL5A 1ZOYC 1Q2NA 2SPZA 4H44D 5EFWB 1FAVA 1PGOA 2ITAA 1SLQA 4OVNF 1S3JA 1VQKP 2WVRA 3H1JG 2QIWA 2MJZA 2Y0DA 3MD0A 3ABVC 4Y99C 3TNUB 1VQNP 3I55P 1KC8Q 3C1LA 4W7ZA 4PD4D 3L70J 5AW8B 2PRRA 4W7YA 1SQXJ 1L0NE 3KQGA 1BE3J 3GF3A 3O6QB 1X8YA 3AE1C 1X22A 3KZIH 1SQPD 2GM4A 1M56D 2N1TB 2WSEH 5CHXA 1RF0A 5AVVB 2O3JA 3CL3D 2N9YB 3L70G 4I2LC 1LT1A 3HTKB 5AW1B 1VQ6P 3L73J 1SQXG 1BE3G 1VQOP 2Z5IA 2ZXEB 2HODA 3E7KA 1KB9H 2HLOA 3IFMA 3GF7A 1LTTC 1NO4A 4YTPC 1L4AC 1M57D 3PP5A 3H1LJ 1SQQD 2Y0CA 1SQPK 3L73G 3NXSA 1LTIC 1PPJE 1VQ8P 2KIKA 4H44C 3V6IA 1KFNA 2XU6A 4DCKA 3L72D 2CK3H 2Y9ZA 1MV8A 3AEFC 3MP7B 4EI2A 2OYIC 3H1LG 1XTCC 2JDIH 1RF1B 3CX5E 3FWNA 1LGHB 5AVRB 1PP9D 1P84H 3PH0A 2BASA 1K04A 2Q3IA 1SS1A 2FBWC 3CXHH 3PRJA 4PJ0H 3L75D 2CPBA 1OVRA 3N4XA 1BGYE 1YTZI 1VQ4P 1OIPA 1X0TA 1OW8A 5B5EH 1JM0A 3B4SA 1ZR4A 1EZVE 2AEJA 4AQRD 4IOIH 1GTWA 3L74J 2KZJA 2P67A 1URQD 5KLVD 1GU4A 4U3FD 1URQB 2KI7B 1WT6A 1M7LA 1SQBD 1UIIA 1W2EA 1VPCA 4QMAA 4RESB 1N7LA 2BCCJ 2E75C 1NKZB 4BRYB 3NMDA 3SFDC 1G1JA 3TYYA 4JYCA 2FFDC 1KFMA 3AE2C 1SVFA 2WITA 3TSIA 1OVUA 5BU8B 3CWBE 3L74G 4OWFA 1H0TA 1U7JA 1NU1J 2WQYC 1VL2A 4WY4B 3VP9A 1S9KD 4AUWA 2RMZA 2RN0A 2BCCG 1DD3A 1JTHA 2G8YA 3MUDA 5AVUB 5KLVK 1FC2C 2KNCB 1NHLA 3HE4A 5AW2B 4TLFA 5M1BA 2NRGA 1KB9D 1NU1G 1QVGO 3EQ2A 1MFTA 1KILA 3HD7D 2WPVB 1FU1A 3HD7B 2FYNC 2E5TA 1MKMA 1DIPA 2B88A 2QVAA 2KYVA 5B66E 1S1CX 2YIUB 1NTZJ 5DJUB 3L36A 2CPSA 1NJIQ 1URQC 3I5CA 2QM7A 4DJGA 1SQQE 1J1EB 2M3BA 3BVHA 2OYHA 3PTZA 4K35A 1P84D 4Z1MH 1AV1A 3H1KJ 2QA4P 3A2AA 1NTKJ 3CXHD 3H32A 4R4LA 5L8RJ 3L72E 1NTZG 1N73C 1ZMEC 3AECC 2A06E 2FYUK 2R32A 5AW9B 5APSA 1QGKB 3B71A 5AVSB 3O8ZA 2WSFJ 3AE4C 2YMYA 1GL2A 1EQ7A 1PP9E 1FZCA 2H89C 3ITKA 2Q9IA 1W2BO 2G3AA 2R44A 3CCMP 1Q86Q 3H1KG 1NTKG 1L0LJ 3L75E 1Z56A 2H8PD 2KUBA 4OGQD 3GMAA 4OGQB 3H25A 1VDFA 2E5YA 3HE5B 2Q5UA 2V7QH 4OH8B 5CCGA 2GA1A 1T2KD 3BATA 3JC22 3L4FA 4ASWA 1NTMJ 1HF9A 3HD7C 4ZNCA 4I1LA 4IFFA 2HODB 1GD2E 3CCUP 3WUTA 4WB4A 4D6TJ 3G4SP 1A02J 3E1IA 1L0LG 1EXJA 2I8DA 2K3RA 3TF5A 1FOSE 1BSNA 1LT9B 5KLVE 4U3FE 2YIUC 1DEBA 1H89A 1SQBE 2KOGA 3VN0A 1M1JC 3MTUE 1NTMG 3BCCJ 3G6EP 1J1EC 4ZKUA 1T3UA 3IN6A 3A0BH 1SQXD 1BE3D 4PD4H 2O01N 3W68A 4D6TG 4NPDA 1OVVA 1RQUA 1USEA 2QJYB 1KQGB 3KZIE 2O1KA 2KB7P 5AVTB 1S9KE 2E43A 4GODA 2YKPA 3BCCG 3MGNA 2MKVA 2NZ2A 3L73D 4GOFA 5KKZB 5CJ0A 3AE8C 1KB9E 2XNDH 1RF0C 1SQXK 1IZNB 2ZXXA 3CD6P 1YIJP 2L5GB 3U1AA 3RL0g 2WWWA 1QLED 4Y99B 1FZBA 1KMIZ 1T2KC 2QJKC 1QX8A 2LKMA 2YXRB 3CCJP 2OTJP 1DEEG 1IC2A 1LP1B 4NPFX 1KYOH 2ZYAA 4RJTA 1M90Q 1KQLA 3P32A 2M0BA 5AW0B 2P7JA 3AEGC 3CCVP 1YYCA 1IO4A 1NYHA 1IK9A 1FZAA 2ZJSE 1P84E 1KN7A 5CBNA 3VTPC 2M5AA 2IBZE 1S72P 2PGDA 3KHUA 1H0TB 3CXHE 5C39A 3CCSP 4PJ0E 4JPZB 3Q2YA 2YXQB 2IDBA 1EC5A 2FXOA 1PFIA 1HH0A 1RE4A 3H1JJ 2DW3A 3AE9C 5B5EE 3V4QA 1L4AB 2WSFH 1OZHA 1S2EA 3H1HD 3A3YB 5KJ7D 2JWDA 3P8CE 3H1IJ 1K05A 1JUNA 4DOJA 1YJ9P 1FZFA 1JY3P 5KKZC 2WMMA 4H44B 1GDTA 3A5TA 1KILD 4C7NB 1KILB 5E79H 5TISH 3HUSA 3VMAA 1GW3A 1Y47A 2BCCD 4Y28J 2OYIB 2R5BA 4DT0A 2YMKA 3VOPA 1OX3A 1AA0A 3H1IG 4L74A 2IYOA 1M8OB 3M9BA 1JNMA 1IFMA 1QVFO 3LW5J 1HJ0A 1CI6A 1N86A 2B9BA 3UIAA 3LIEA 1NU1D 1LWUA 5AVQB 2OYHB 2WSCJ 3BASA 3AE7C 1GZLA 2B89A 2JR8A 1SQXE 1BE3E 1E79H 3CX5I 3KDPB 2POHA 1FJKA 1L0NG 2E74C 2YO2A 1FBMA 3IF4A 5APQA 2IZ1A 1T8ZA 1GL2D 4RO0A 3MUDC 2ZAEB 1YJWP 1FZCB 2Q1KA 3L73E 1NU1K 3WMM0 1FDMA 3KPEA 1KTMA 2E75D 2E75B 1AFOA 5KJ7C 1IFIA 3CCEP 2HYNA 1KYOD 2E42A 1YQ4C 5CJ4A 5CCGD 2FFDB 4IL6H 1NTZD 1EZVI 1KILC 4TT3H 2K9JA 4XE5B 1G1IA 2WSSH 1SQVE 2N9BA 2R3CA 3WU2H 1JCCA 2HG5D 4MN4C 5AW6B 2FXPA 2OYOA 5KAIH 3VYIA 1G2CA 1EDKA 3H1KD 1E5WA 1VQ5P 1PPJG 3Q3DA 3P8MC 2YKOA 1JY3N 2A45I 3PJSK 5AW5B 2OYHC 1JY2O 3AEBC 1NTZK 1BCCJ 2FYNB 3CCLP 3IAOA 5TJHA 1L0LD 3OA7A 1AVOA 1N8RQ 1NH4A 1RE3A 3Q5PA 2XZRA 1S5LH 3F89A 2I1KA 3GW6A 4U7JA 2KS1A 1YI2P 1KORA 2XKMA 1RY3A 1GL2C 1NTKK 3T97B 3K5BA 3VMXA 3TDKA 3MIWA 3GHGA 3H1HE 1NTMD 1FZCC 1U7MA 1BCCG 3M9HA 2OARA 1X9VA 1NOHA 2W90A 4D6TD 3RK2D 3RK2B 1KILE 1EZVG 5CCGC 1FZEA 3CWBJ 1N73B 1L0LK 2BCCE 1RH5B 1YJNP 4HKZH 3RK3D 4L73A 2KP8A 4H13D 2W6AA 3A0BE 1X79B 2AXTH 4PD4E 3LW5H 2P58A 1NTMK 2XNXA 3TGUJ 3USSA 2A45G 3P7KA 3TK1A 1EDLA 4M3LA 2WSCH 2D2CD 2PFXA 3CWBG 1IFDA 3V4WA 1SQPE 2E76D 5APYA 1U57A 2KLVA 3JSVC 2LR2A 1ZW0A 1LTGC 3A7OA 3GG2A 3TGUG 1RQVA 2FYUD 3KYQA 3CLQA 3AE6C 1DD4A 1UIXA 3EWKA 1T3JA 3H6PA 1M1JB 3VP8A 3TNUA 5BVZA 1SQQJ 3OW2O 1NKNA 1KYOE 3HUSB 2AEMA 2W27A 1NTZE 3RK2C 1AQTA 2M8RA 1OW7A 5APXA 1GU5A 3KXDA 4YPCA 1N2DC 3FXDA 3O6QA 4YXDC 4N78D 2YNYA 3HRNA 1VQ9P 1A02F 2I1JA 3ZDMA 2O01J 4LLHA 3RK3C 2HPCA 4UB8H 2N1TA 1SQQG 3M91A 4H13C 3CX5H 2WPRA 3CMAP 1PP9J 3U1CA 1TU3F 4N6JA 5KAFH 1OWAA 2ZT9D 3HTKA 3M0AA 2H88C 3D70A 1EDJA 2FKWB 3H1JD 3CMEP 2WTYA 2C9NY 2D2CC 2W6BA 3RL0D 3RL0B 3CCQP 2A06G 2E76C 3Q5RA 2QJKB 4N3YB 3M9QA 2K1AA 1PP9G 1Q82Q 4JBZA 1L0LE 2LXBA 2R5DA 4UB6H 1FJPA 1PGPA 5E79E 5TISE 3L35A 3M0DA 5DJTB 4EDFA 3C8VA 1XTGB 1KB9I 5AW7B 1NTME 4PV1C 2KSEA 1SQBJ 2Z5HA 4CPGA 2XDJA 2OQQA 3L70D 4IFMA 4D6TE 1PGJA 1RF1A 1GK6A 2KZIA 2H43A 3HUSC 3LIDA 1KQFB 3V2PA 1MFZA 3L71J 4IL6X 3RBZA 1W5CE 3U59A 1Q81Q 3G9RA 1SQBG 5AVXB 1CW5A 1PIXA 3OAKA 1MUUA 2W8ZA 1VF5D 1VF5B 1LTAC 2C0WA 2WT7A 1HTLC 4H0LC 1LWUC 5GTIH 1ZLLA 1YQ3C 2IBZI 2ZT9C 3CXHI 3L71G 4EYYQ 3I56P 2QSIA 3RL0C 1K8AQ 3H1LD 3S9OA 2K37A 2V4HA 3NFQA 3D6ZA 1AJYA 2IPPA 3MHVA 1NGMB 1PPJD 2FYUE 4IL6E 1PGQA 4RKUJ 3FX0A 1GK4A 1S5LX 4KHXA 1HWTC 2BEZF 3WU2E 2QJPB 3N7NA 2OTLP 5APWA 3CX5D 4WY4A 5KAIE 4K3AA 4R4MA 2Z4EA 4HYTB 3JCUH 2E74D 2KNCA 2E74B 4AYCA 1LTJA 1N7SA 2P2UA 4N78E 4GKGA 1OXZA 1JTHB 1BCCD 1J1DB 5CMZA 4HB1A 3HE4B 2O1JA 1CSBA 1KV4A 2PP6A 1VF5C 1S5LE 2IBZG 1R5SA 3SWFA 3H1JE 2ZYGA 3SFEC 1OFCX 3L74D 5H2FH 2QEXP 1FDIA 4LC1A 1LJ2A 1BDDA 3BRVB 4W80A 1RE3C 1JO5A 1BDCA 1AVYA 1T6AA 1HGZA 1M1KQ 4B86A 1DH3A 4WBAA 1SP4A 2J5UA 3CC7P 1L0NJ 3GHGC 3CWBD
chains in the Genus database with same CATH topology
3B8EB 3A2AA 2XKMA 3H32A 5CCHA 1RY3A 1GL2C 1NTKK 3VMXA 3MIWA 3GHGA 1FZCC 1N73C 5APUA 3H32B 3M9HA 2FYUK 2R32A 2OARA 2KSJA 5APSA 5AW9B 1X9VA 3GHGB 5AVSB 5BU5A 3O8ZA 1NOHA 3VMZA 2JEEA 1GL2A 2YMYA 1EQ7A 3RK2D 3RK2B 1HVVA 2N1TD 1FZCA 2HPCB 1MZ9A 1N73A 2Q9IA 3CI9A 5CCGC 1GL2B 2FXMA 2GUVA 2IX7C 1J1DC 1FZEA 2NPSC 1N73B 1L0LK 3HE5A 4I6MC 1Z56A 2H8PD 4XA4A 3RK3D 2KP8A 1VDFA 1KZUB 2W6AA 3HE5B 1QL1A 1LT9C 2Q5UA 1X79B 4OH8B 5CCGA 5AVYB 5APVA 1T2KD 1HJBA 3LW5H 3BATA 1JY2N 4HH2A 3L4FA 2YO3A 2NPSA 3HD7C 1NTMK 3V2NA 2O01H 4I1LA 4C46A 4IFFA 2XNXA 2HODB 1ZN5A 2A45G 2C9LY 1GD2E 3P7KA 1HUCA 2QM8A 3TK1A 1LT9A 4WB4A 4M3LA 1A02J 2WSCH 1H88A 2J58A 3E1IA 1IFDA 1SQVK 1SFCC 4DZOA 3V5BA 3V4WA 1FOSE 3HD7A 5APYA 3EFGA 1LT9B 1DEBA 1H89A 1AQ5A 2KOGA 2KLVA 3VN0A 1M1JC 3MTUE 1L4AD 1ZR2A 3SWYA 1SFCA 2IFMA 1J1EC 4ZKUA 1LTGC 1T3UA 3A7OA 1YTZT 2WPSA 3B5NC 3KYQA 4LGDE 1M1JA 2VRSA 3CLQA 3R2PA 1FAVA 2O1KA 1T3JA 3H6PA 1SLQA 2KB7P 1M1JB 5AVTB 3VP8A 1S9KE 2E43A 3TNUA 5BVZA 3B5NA 2Q7CA 2YKPA 2MJZA 1NKNA 1SQQK 3MD0A 3MGNA 3HUSB 4Y99C 3TNUB 2W27A 1HGVA 3RK2C 2M8RA 5APXA 1GU5A 1FZGA 4EOTA 2N1TC 4W7ZA 5AW8B 5CJ0A 1WRGA 1N2DC 2WT7B 1ZV8A 4W7YA 4N78D 3HRNA 2YNYA 1A02F 2I1JA 3KQGA 1RF0C 1SQXK 2L5GB 4LLHA 3U1AA 3RK3C 2HPCA 2N1TA 2WWWA 1X8YA 3M91A 4Y99B 2WPRA 1FZBA 1T2KC 3U1CA 2GM4A 4N6JA 2N1TB 2WSEH 5CHXA 1OWAA 1RF0A 2LKMA 5AVVB 3HTKA 3CL3D 1J2JB 1IC2A 3M0AA 4I2LC 2FKWB 2WTYA 3HTKB 5AW1B 2C0XA 2C9NY 2W6BA 3RL0D 1KQLA 3P32A 3RK3B 3RL0B 2Z5IA 3M06A 3M0DC 5AW0B 2ZXEB 2P7JA 2WPQA 4N3YB 2HODA 3M9QA 2HLOA 1YYCA 1IO4A 3IFMA 2R5DA 1LTTC 1NO4A 1IK9A 1FZAA 1L4AC 1FJPA 4GIFA 2ZFCA 3PP5A 3VTPC 4WY4D 3L35A 3M0DA 2JJLA 1XTGB 1RF1C 5AVZB 1SQPK 3NXSA 1LTIC 5AW7B 2WZ7A 2Z5HA 1L4AA 1PFIA 1LTSC 1LTJB 1N7SD 1SQBK 1N7SB 2XDJA 1HH0A 5AW3B 1RE4A 1KFNA 2GUSA 2XU6A 2J59M 5KJ7A 2H7HA 3V4QA 1JCDA 1L4AB 2WSFH 4IFMA 1CZQA 1RF1A 1GK6A 1IFJA 1MV8A 3A3YB 2H43A 5KJ7D 3P8CE 3HUSC 3LIDA 2OYIC 1XTCC 1RF1B 1JUNA 3V2PA 4DOJA 1MFZA 4C7NA 5KTBA 1FZFA 1JY3P 1LGHB 5AVRB 3U59A 3G3ZA 1GDTA 3A5TA 1KILD 2BASA 4C7NB 2Q3IA 1KILB 3HUSA 2OYIA 5AVXB 1CW5A 1GW3A 3OAKA 1MUUA 2OYIB 2CPBA 1IJDB 1LTAC 2R5BA 2C0WA 3VOPA 2WT7A 4JYBA 1HTLC 3N4XA 4GT1A 1LWUC 1ZLLA 1YTZI 3M9BA 4JF7A 1JNMA 1IFMA 1CI6A 1GW4A 1ZR4A 4IFDK 1N86A 1QL2A 3UIAA 3LIEA 1JOCA 1FOSF 1CI6B 4O9BA 1LWUA 5AVQB 3RL0C 4AQRD 1IFNA 2OYHB 3BASA 3IR9A 3BRTB 3NFQA 2IPPA 1GTWA 1GZLA 1LWUB 5APTA 2P67A 1URQD 1GU4A 1URQB 1WT6A 1M7LA 5CCHD 1W2EA 4C7RA 1VPCA 4RESB 1H8AA 1GK4A 1JY3O 1N7LA 5AVWB 4WY4C 3KDPB 1JMMA 4KHXA 2POHA 1NKZB 1FJKA 2FYZA 1HWTC 3NMDA 2YO2A 1FBMA 2XV5A 3OJAB 1DX7A 3NTNA 1G1JA 5APQA 3TYYA 3P8CD 1T8ZA 3N7NA 4JYCA 2FFDC 1GL2D 1KFMA 1LTJC 1SVFA 5APWA 1N7SC 1NWQA 2WITA 3TSIA 5BU8B 4WY4A 1FZCB 2P1JA 1JY2P 3II6A 1NU1K 2Z4EA 3WMM0 1FDMA 3KPEA 4HYTB 1RE4C 4WY4B 3VP9A 1AFOA 5KJ7C 4ZKPA 1S9KD 4AUWA 5AW4B 2FFDA 4AYCA 1IFIA 1LTJA 1N7SA 2P2UA 2HYNA 1JTHA 3V2RA 2IFNA 3MUDA 4N78E 4GKGA 5AVUB 1OXZA 5KLVK 2E42A 5CJ4A 5CCGD 2FFDB 1NHLA 1JTHB 3VMYA 2NPSD 1J1DB 3HE4A 5AW2B 1KILC 2NPSB 2PAJA 4XE5B 5CMZA 1G1IA 2N9BA 2R3CA 3HE4B 1JCCA 2O1JA 1CSBA 2HG5D 2PP6A 2A45H 3EQ2A 5AW6B 1KILA 3HD7D 3SWFA 1FU1A 3HD7B 3VYIA 1G2CA 1E5WA 1G2CB 4LC1A 3P8MC 2YKOA 1JY3N 1SFCD 2A45I 1SFCB 2KYVA 3BRVB 1NAFA 4W80A 3L37A 5AW5B 2OYHC 3V2QA 1RE3C 1JY2O 1JO5A 2YKQA 1NTZK 1HGZA 3L36A 2CPSA 4B86A 1DH3A 4WBAA 1URQC 3I5CA 2HFED 5CCHC 2QM7A 2M3BA 1J1EB 1SP4A 3BVHA 3GHGC 3OA7A 2OYHA 1L0NK 1NH4A 1RE3A 2XZRA 3C9IA 3B5ND 3B5NB 3T97A 2I1KA 1LTBC 1HBWA 4EIJA 1URQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYY A;  5AW7 B;  2VRS A;  3B8E B;  4JYC A;  3A2A A;  2Z5H A;  5APW A;  3VMX A;  1NWQ A;  1FAV A;  5AW3 B;  1SLQ A;  2XU6 A;  5AVT B;  1S9K E;  5APU A;  2E43 A;  3M9H A;  2H7H A;  3V4Q A;  3TNU A;  2Q7C A;  2R32 A;  1CZQ A;  5APS A;  5AW9 B;  4HYT B;  1GK6 A;  3A3Y B;  1MV8 A;  3MD0 A;  5AVS B;  3MGN A;  1S9K D;  4AUW A;  3LID A;  3O8Z A;  5AW4 B;  3VMZ A;  3TNU B;  2W27 A;  4AYC A;  2P2U A;  1JUN A;  5APX A;  1GU5 A;  1MFZ A;  4C7N A;  4EOT A;  4GKG A;  5AVU B;  1OXZ A;  2E42 A;  5AVR B;  5AW8 B;  2WT7 B;  3VMY A;  3A5T A;  2BAS A;  4C7N B;  2Q3I A;  3HE4 A;  5AW2 B;  2YNY A;  1A02 F;  3KQG A;  3HE5 A;  4I6M C;  4XE5 B;  5CMZ A;  5AVX B;  2N9B A;  2R3C A;  3OAK A;  3HE4 B;  2KP8 A;  2WWW A;  1CSB A;  1MUU A;  1X8Y A;  2W6A A;  3HE5 B;  3M91 A;  2Q5U A;  2WPR A;  5AVY B;  5APV A;  1T2K D;  2R5B A;  1HJB A;  1T2K C;  2WT7 A;  4JYB A;  2YO3 A;  4GT1 A;  5AW6 B;  3SWF A;  1OWA A;  3VYI A;  3M9B A;  5AVV B;  3HTK A;  1JNM A;  1J2J B;  4C46 A;  3M0A A;  1CI6 A;  2C9L Y;  1GD2 E;  3P7K A;  4I2L C;  1HUC A;  1G2C B;  2QM8 A;  3TK1 A;  4LC1 A;  2WTY A;  5AW1 B;  4M3L A;  3P8M C;  1A02 J;  3UIA A;  1H88 A;  2C9N Y;  3LIE A;  1FOS F;  4DZO A;  3V5B A;  1KQL A;  1NAF A;  3P32 A;  3L37 A;  3V4W A;  1CI6 B;  1FOS E;  5AVQ B;  5APY A;  4AQR D;  2Z5I A;  5AW5 B;  3M06 A;  5AW0 B;  1H89 A;  2ZXE B;  2P7J A;  2WPQ A;  3IR9 A;  3NFQ A;  2IPP A;  1GTW A;  3L36 A;  1GZL A;  5APT A;  2P67 A;  1GU4 A;  4B86 A;  1DH3 A;  1YYC A;  3I5C A;  3VN0 A;  1IO4 A;  2R5D A;  2QM7 A;  1SP4 A;  2ZFC A;  4RES B;  3A7O A;  3VTP C;  1H8A A;  1GK4 A;  5AVW B;  3KDP B;  2WPS A;  3L35 A;  2JJL A;  2XZR A;  3M0D A;  4KHX A;  1HWT C;  3T97 A;  3NMD A;  2YO2 A;  2XV5 A;  5AVZ B;  3NTN A;  1HBW A;  3NXS A;  5APQ A; 
#chains in the Genus database with same CATH topology
 2QJP C;  2Y0E A;  3B8E B;  2AXT E;  5CCH A;  3L70 E;  4I7Z C;  5APU A;  3H32 B;  2KSJ A;  3A0H H;  2FY8 A;  2RH0 A;  3TGU D;  2JEE A;  1HVV A;  4XFJ A;  3AEA C;  1WMK A;  2N1T D;  2HPC B;  2UWJ E;  1MZ9 A;  1JMB A;  3CI9 A;  1GL2 B;  2FXM A;  2GUV A;  2IX7 C;  1J1D C;  3HE5 A;  4I6M C;  3MZW B;  4XA4 A;  1KZU B;  1YHQ P;  5AVY B;  3AED C;  1HJB A;  4HH2 A;  1Q7Y Q;  2NPS A;  1Y8A A;  2LXC B;  4HJG H;  1ZN5 A;  2C9L Y;  5CBO A;  1K9M Q;  3H1L E;  1HUC A;  1LT9 A;  3E1R A;  3RGU A;  1SQV J;  1H88 A;  2AEF A;  3V5B A;  3EFG A;  2OGU A;  5GTH H;  1KQS O;  1OMI A;  1NTK D;  3FGA D;  1ZR2 A;  3SWY A;  1SFC A;  1FS0 E;  4YXW H;  2WPS A;  2A06 D;  2ZVO B;  2ZYD A;  3EFF K;  1SQV G;  3PHL A;  1LNQ A;  4UB8 E;  2VRS A;  2JP3 A;  1BGY J;  3Q1M A;  2Y9Y A;  1YBK A;  2W83 C;  5KAF E;  4PD4 I;  2Q7C A;  3B5N A;  4GDO A;  1GMJ A;  1NAY A;  3CC2 P;  1SQQ K;  4BXL A;  4GOE A;  1HGV A;  1FZG A;  1ZRT D;  4EOT A;  1BCC E;  2N1T C;  2V7Q J;  3G71 P;  1WRG A;  2WT7 B;  1ZV8 A;  3H1H J;  4A7P A;  1BGY G;  4UB6 E;  5K5G B;  1LP1 A;  1EXI A;  2AXC A;  3L74 E;  3D71 A;  2KK7 A;  1BSH A;  1J2J B;  3S4R A;  2C0X A;  3H1H G;  3BCC D;  3CC4 P;  3RK3 B;  4H13 B;  3M06 A;  2JO1 A;  3M0D C;  2WPQ A;  1FE6 A;  4WVZ A;  1NVO A;  1K73 Q;  1KYO I;  3L71 D;  1NU1 E;  4GIF A;  2ZFC A;  3W67 A;  4WY4 D;  2JJL A;  2D2C B;  4ASV A;  4WWI A;  1SQP J;  1RF1 C;  5AVZ B;  3D6Y A;  2M5A B;  2E76 B;  3CPW O;  2K9Y A;  1VQM P;  2WZ7 A;  1L4A A;  1LTS C;  1LTJ B;  1N7S D;  1SQB K;  1N7S B;  5AW3 B;  5GTI E;  3TGU E;  2GUS A;  2J59 M;  5KJ7 A;  2H7H A;  2B87 A;  1ZP0 C;  1JCD A;  1CZQ A;  1IFJ A;  1PZQ A;  1ZXG A;  2JWA A;  4C7N A;  4PV1 D;  4PV1 B;  1SQP G;  5KTB A;  3FXE A;  3G3Z A;  1OW6 A;  1IFP A;  2OYI A;  2K88 A;  1IJD B;  2L91 A;  4JYB A;  4GT1 A;  4JF7 A;  3L72 J;  1GW4 A;  4IFD K;  1VQL P;  1QL2 A;  1JOC A;  1FOS F;  2BEQ D;  1CI6 B;  4O9B A;  3JCU E;  2IBZ D;  1IFN A;  2R3S A;  1YIT P;  3H1K E;  1NTK E;  3IR9 A;  3BRT B;  4H0L D;  4H0L B;  1LWU B;  2P10 A;  5APT A;  3Q5S A;  1USD A;  2ZT9 B;  5CCH D;  2W6J H;  4C7R A;  1H8A A;  1IK7 A;  1JY3 O;  3L72 G;  5AVW B;  3L75 J;  4WY4 C;  2IYP A;  1JMM A;  3PLN A;  2FYZ A;  2XV5 A;  1DX7 A;  3OJA B;  3NTN A;  3P8C D;  1EDI A;  3H1I D;  1LTJ C;  1S4X A;  1N7S C;  1NWQ A;  2P1J A;  1JY2 P;  3II6 A;  3FWL A;  5H2F E;  1RE4 C;  1ZRT E;  2OTK E;  4ZKP A;  5AW4 B;  2FFD A;  2RKL A;  3L75 G;  3AE3 C;  3V2R A;  2IFN A;  5KLV J;  4U3F J;  1QEX A;  2HR3 A;  3VMY A;  2NPS D;  2NPS B;  2PAJ A;  1R5L A;  2QRX A;  1RHZ B;  4L76 A;  1VQ7 P;  1L0N D;  2K9J B;  3QH9 A;  2Q6Q A;  2A45 H;  3GLM A;  1KD1 Q;  1VQP P;  5KLV G;  4U3F G;  3BCC E;  3RK3 E;  1Q90 D;  2WSE J;  3AE5 C;  1G2C B;  1SFC D;  1SFC B;  3A0H E;  1NAF A;  3L37 A;  2QG4 A;  3L71 E;  3V2Q A;  1JEK A;  2YKQ A;  1P84 I;  2HFE D;  1PV3 A;  5CCH C;  3RBX A;  1L0N K;  3C9I A;  3B5N D;  3B5N B;  4KJM A;  3T97 A;  1LTB C;  2KXP B;  1HBW A;  4EIJ A;  1FDO A;  5KLI B;  1URQ A;  1R8E A;  2KS1 B;  1D7M A;  2FYU J;  4BRY A;  5B66 H;  3GHG B;  2Q3E A;  4OGQ C;  3SWK A;  5BU5 A;  3VMZ A;  3AEE C;  2IZ0 A;  1SQV D;  2KLU A;  3F5H A;  1JB0 J;  1N73 A;  2M3E A;  4I7Z B;  5GTH E;  2NPS C;  4JQ0 D;  4NPE A;  2FYU G;  1QL1 A;  1LT9 C;  5APV A;  1JY2 N;  2YO3 A;  4KT0 J;  3CCR P;  3V2N A;  2O01 H;  4C46 A;  1BGY D;  4ZMD A;  2QM8 A;  2J58 A;  1L2P A;  4DZO A;  1SQV K;  1SFC C;  3HD7 A;  1EZV D;  2QJY C;  1AQ5 A;  2ZVN B;  3SSU A;  1Y9B A;  2JKV A;  3S1K A;  1L4A D;  2IFM A;  3WUU A;  3R4Y A;  4BWN A;  3QWO C;  1YTZ T;  2B87 B;  3H1I E;  4L75 A;  3B5N C;  4LGD E;  5KLI C;  1M1J A;  3R2P A;  2QE7 H;  3WUV A;  1PL5 A;  1ZOY C;  1Q2N A;  2SPZ A;  4H44 D;  5EFW B;  1FAV A;  1PGO A;  2ITA A;  1SLQ A;  4OVN F;  1S3J A;  1VQK P;  2WVR A;  3H1J G;  2QIW A;  2MJZ A;  2Y0D A;  3MD0 A;  3ABV C;  4Y99 C;  3TNU B;  1VQN P;  3I55 P;  1KC8 Q;  3C1L A;  4W7Z A;  4PD4 D;  3L70 J;  5AW8 B;  2PRR A;  4W7Y A;  1SQX J;  1L0N E;  3KQG A;  1BE3 J;  3GF3 A;  3O6Q B;  1X8Y A;  3AE1 C;  1X22 A;  3KZI H;  1SQP D;  2GM4 A;  1M56 D;  2N1T B;  2WSE H;  5CHX A;  1RF0 A;  5AVV B;  2O3J A;  3CL3 D;  2N9Y B;  3L70 G;  4I2L C;  1LT1 A;  3HTK B;  5AW1 B;  1VQ6 P;  3L73 J;  1SQX G;  1BE3 G;  1VQO P;  2Z5I A;  2ZXE B;  2HOD A;  3E7K A;  1KB9 H;  2HLO A;  3IFM A;  3GF7 A;  1LTT C;  1NO4 A;  4YTP C;  1L4A C;  1M57 D;  3PP5 A;  3H1L J;  1SQQ D;  2Y0C A;  1SQP K;  3L73 G;  3NXS A;  1LTI C;  1PPJ E;  1VQ8 P;  2KIK A;  4H44 C;  3V6I A;  1KFN A;  2XU6 A;  4DCK A;  3L72 D;  2CK3 H;  2Y9Z A;  1MV8 A;  3AEF C;  3MP7 B;  4EI2 A;  2OYI C;  3H1L G;  1XTC C;  2JDI H;  1RF1 B;  3CX5 E;  3FWN A;  1LGH B;  5AVR B;  1PP9 D;  1P84 H;  3PH0 A;  2BAS A;  1K04 A;  2Q3I A;  1SS1 A;  2FBW C;  3CXH H;  3PRJ A;  4PJ0 H;  3L75 D;  2CPB A;  1OVR A;  3N4X A;  1BGY E;  1YTZ I;  1VQ4 P;  1OIP A;  1X0T A;  1OW8 A;  5B5E H;  1JM0 A;  3B4S A;  1ZR4 A;  1EZV E;  2AEJ A;  4AQR D;  4IOI H;  1GTW A;  3L74 J;  2KZJ A;  2P67 A;  1URQ D;  5KLV D;  1GU4 A;  4U3F D;  1URQ B;  2KI7 B;  1WT6 A;  1M7L A;  1SQB D;  1UII A;  1W2E A;  1VPC A;  4QMA A;  4RES B;  1N7L A;  2BCC J;  2E75 C;  1NKZ B;  4BRY B;  3NMD A;  3SFD C;  1G1J A;  3TYY A;  4JYC A;  2FFD C;  1KFM A;  3AE2 C;  1SVF A;  2WIT A;  3TSI A;  1OVU A;  5BU8 B;  3CWB E;  3L74 G;  4OWF A;  1H0T A;  1U7J A;  1NU1 J;  2WQY C;  1VL2 A;  4WY4 B;  3VP9 A;  1S9K D;  4AUW A;  2RMZ A;  2RN0 A;  2BCC G;  1DD3 A;  1JTH A;  2G8Y A;  3MUD A;  5AVU B;  5KLV K;  1FC2 C;  2KNC B;  1NHL A;  3HE4 A;  5AW2 B;  4TLF A;  5M1B A;  2NRG A;  1KB9 D;  1NU1 G;  1QVG O;  3EQ2 A;  1MFT A;  1KIL A;  3HD7 D;  2WPV B;  1FU1 A;  3HD7 B;  2FYN C;  2E5T A;  1MKM A;  1DIP A;  2B88 A;  2QVA A;  2KYV A;  5B66 E;  1S1C X;  2YIU B;  1NTZ J;  5DJU B;  3L36 A;  2CPS A;  1NJI Q;  1URQ C;  3I5C A;  2QM7 A;  4DJG A;  1SQQ E;  1J1E B;  2M3B A;  3BVH A;  2OYH A;  3PTZ A;  4K35 A;  1P84 D;  4Z1M H;  1AV1 A;  3H1K J;  2QA4 P;  3A2A A;  1NTK J;  3CXH D;  3H32 A;  4R4L A;  5L8R J;  3L72 E;  1NTZ G;  1N73 C;  1ZME C;  3AEC C;  2A06 E;  2FYU K;  2R32 A;  5AW9 B;  5APS A;  1QGK B;  3B71 A;  5AVS B;  3O8Z A;  2WSF J;  3AE4 C;  2YMY A;  1GL2 A;  1EQ7 A;  1PP9 E;  1FZC A;  2H89 C;  3ITK A;  2Q9I A;  1W2B O;  2G3A A;  2R44 A;  3CCM P;  1Q86 Q;  3H1K G;  1NTK G;  1L0L J;  3L75 E;  1Z56 A;  2H8P D;  2KUB A;  4OGQ D;  3GMA A;  4OGQ B;  3H25 A;  1VDF A;  2E5Y A;  3HE5 B;  2Q5U A;  2V7Q H;  4OH8 B;  5CCG A;  2GA1 A;  1T2K D;  3BAT A;  3JC2 2;  3L4F A;  4ASW A;  1NTM J;  1HF9 A;  3HD7 C;  4ZNC A;  4I1L A;  4IFF A;  2HOD B;  1GD2 E;  3CCU P;  3WUT A;  4WB4 A;  4D6T J;  3G4S P;  1A02 J;  3E1I A;  1L0L G;  1EXJ A;  2I8D A;  2K3R A;  3TF5 A;  1FOS E;  1BSN A;  1LT9 B;  5KLV E;  4U3F E;  2YIU C;  1DEB A;  1H89 A;  1SQB E;  2KOG A;  3VN0 A;  1M1J C;  3MTU E;  1NTM G;  3BCC J;  3G6E P;  1J1E C;  4ZKU A;  1T3U A;  3IN6 A;  3A0B H;  1SQX D;  1BE3 D;  4PD4 H;  2O01 N;  3W68 A;  4D6T G;  4NPD A;  1OVV A;  1RQU A;  1USE A;  2QJY B;  1KQG B;  3KZI E;  2O1K A;  2KB7 P;  5AVT B;  1S9K E;  2E43 A;  4GOD A;  2YKP A;  3BCC G;  3MGN A;  2MKV A;  2NZ2 A;  3L73 D;  4GOF A;  5KKZ B;  5CJ0 A;  3AE8 C;  1KB9 E;  2XND H;  1RF0 C;  1SQX K;  1IZN B;  2ZXX A;  3CD6 P;  1YIJ P;  2L5G B;  3U1A A;  3RL0 g;  2WWW A;  1QLE D;  4Y99 B;  1FZB A;  1KMI Z;  1T2K C;  2QJK C;  1QX8 A;  2LKM A;  2YXR B;  3CCJ P;  2OTJ P;  1DEE G;  1IC2 A;  1LP1 B;  4NPF X;  1KYO H;  2ZYA A;  4RJT A;  1M90 Q;  1KQL A;  3P32 A;  2M0B A;  5AW0 B;  2P7J A;  3AEG C;  3CCV P;  1YYC A;  1IO4 A;  1NYH A;  1IK9 A;  1FZA A;  2ZJS E;  1P84 E;  1KN7 A;  5CBN A;  3VTP C;  2M5A A;  2IBZ E;  1S72 P;  2PGD A;  3KHU A;  1H0T B;  3CXH E;  5C39 A;  3CCS P;  4PJ0 E;  4JPZ B;  3Q2Y A;  2YXQ B;  2IDB A;  1EC5 A;  2FXO A;  1PFI A;  1HH0 A;  1RE4 A;  3H1J J;  2DW3 A;  3AE9 C;  5B5E E;  3V4Q A;  1L4A B;  2WSF H;  1OZH A;  1S2E A;  3H1H D;  3A3Y B;  5KJ7 D;  2JWD A;  3P8C E;  3H1I J;  1K05 A;  1JUN A;  4DOJ A;  1YJ9 P;  1FZF A;  1JY3 P;  5KKZ C;  2WMM A;  4H44 B;  1GDT A;  3A5T A;  1KIL D;  4C7N B;  1KIL B;  5E79 H;  5TIS H;  3HUS A;  3VMA A;  1GW3 A;  1Y47 A;  2BCC D;  4Y28 J;  2OYI B;  2R5B A;  4DT0 A;  2YMK A;  3VOP A;  1OX3 A;  1AA0 A;  3H1I G;  4L74 A;  2IYO A;  1M8O B;  3M9B A;  1JNM A;  1IFM A;  1QVF O;  3LW5 J;  1HJ0 A;  1CI6 A;  1N86 A;  2B9B A;  3UIA A;  3LIE A;  1NU1 D;  1LWU A;  5AVQ B;  2OYH B;  2WSC J;  3BAS A;  3AE7 C;  1GZL A;  2B89 A;  2JR8 A;  1SQX E;  1BE3 E;  1E79 H;  3CX5 I;  3KDP B;  2POH A;  1FJK A;  1L0N G;  2E74 C;  2YO2 A;  1FBM A;  3IF4 A;  5APQ A;  2IZ1 A;  1T8Z A;  1GL2 D;  4RO0 A;  3MUD C;  2ZAE B;  1YJW P;  1FZC B;  2Q1K A;  3L73 E;  1NU1 K;  3WMM 0;  1FDM A;  3KPE A;  1KTM A;  2E75 D;  2E75 B;  1AFO A;  5KJ7 C;  1IFI A;  3CCE P;  2HYN A;  1KYO D;  2E42 A;  1YQ4 C;  5CJ4 A;  5CCG D;  2FFD B;  4IL6 H;  1NTZ D;  1EZV I;  1KIL C;  4TT3 H;  2K9J A;  4XE5 B;  1G1I A;  2WSS H;  1SQV E;  2N9B A;  2R3C A;  3WU2 H;  1JCC A;  2HG5 D;  4MN4 C;  5AW6 B;  2FXP A;  2OYO A;  5KAI H;  3VYI A;  1G2C A;  1EDK A;  3H1K D;  1E5W A;  1VQ5 P;  1PPJ G;  3Q3D A;  3P8M C;  2YKO A;  1JY3 N;  2A45 I;  3PJS K;  5AW5 B;  2OYH C;  1JY2 O;  3AEB C;  1NTZ K;  1BCC J;  2FYN B;  3CCL P;  3IAO A;  5TJH A;  1L0L D;  3OA7 A;  1AVO A;  1N8R Q;  1NH4 A;  1RE3 A;  3Q5P A;  2XZR A;  1S5L H;  3F89 A;  2I1K A;  3GW6 A;  4U7J A;  2KS1 A;  1YI2 P;  1KOR A;  2XKM A;  1RY3 A;  1GL2 C;  1NTK K;  3T97 B;  3K5B A;  3VMX A;  3TDK A;  3MIW A;  3GHG A;  3H1H E;  1NTM D;  1FZC C;  1U7M A;  1BCC G;  3M9H A;  2OAR A;  1X9V A;  1NOH A;  2W90 A;  4D6T D;  3RK2 D;  3RK2 B;  1KIL E;  1EZV G;  5CCG C;  1FZE A;  3CWB J;  1N73 B;  1L0L K;  2BCC E;  1RH5 B;  1YJN P;  4HKZ H;  3RK3 D;  4L73 A;  2KP8 A;  4H13 D;  2W6A A;  3A0B E;  1X79 B;  2AXT H;  4PD4 E;  3LW5 H;  2P58 A;  1NTM K;  2XNX A;  3TGU J;  3USS A;  2A45 G;  3P7K A;  3TK1 A;  1EDL A;  4M3L A;  2WSC H;  2D2C D;  2PFX A;  3CWB G;  1IFD A;  3V4W A;  1SQP E;  2E76 D;  5APY A;  1U57 A;  2KLV A;  3JSV C;  2LR2 A;  1ZW0 A;  1LTG C;  3A7O A;  3GG2 A;  3TGU G;  1RQV A;  2FYU D;  3KYQ A;  3CLQ A;  3AE6 C;  1DD4 A;  1UIX A;  3EWK A;  1T3J A;  3H6P A;  1M1J B;  3VP8 A;  3TNU A;  5BVZ A;  1SQQ J;  3OW2 O;  1NKN A;  1KYO E;  3HUS B;  2AEM A;  2W27 A;  1NTZ E;  3RK2 C;  1AQT A;  2M8R A;  1OW7 A;  5APX A;  1GU5 A;  3KXD A;  4YPC A;  1N2D C;  3FXD A;  3O6Q A;  4YXD C;  4N78 D;  2YNY A;  3HRN A;  1VQ9 P;  1A02 F;  2I1J A;  3ZDM A;  2O01 J;  4LLH A;  3RK3 C;  2HPC A;  4UB8 H;  2N1T A;  1SQQ G;  3M91 A;  4H13 C;  3CX5 H;  2WPR A;  3CMA P;  1PP9 J;  3U1C A;  1TU3 F;  4N6J A;  5KAF H;  1OWA A;  2ZT9 D;  3HTK A;  3M0A A;  2H88 C;  3D70 A;  1EDJ A;  2FKW B;  3H1J D;  3CME P;  2WTY A;  2C9N Y;  2D2C C;  2W6B A;  3RL0 D;  3RL0 B;  3CCQ P;  2A06 G;  2E76 C;  3Q5R A;  2QJK B;  4N3Y B;  3M9Q A;  2K1A A;  1PP9 G;  1Q82 Q;  4JBZ A;  1L0L E;  2LXB A;  2R5D A;  4UB6 H;  1FJP A;  1PGP A;  5E79 E;  5TIS E;  3L35 A;  3M0D A;  5DJT B;  4EDF A;  3C8V A;  1XTG B;  1KB9 I;  5AW7 B;  1NTM E;  4PV1 C;  2KSE A;  1SQB J;  2Z5H A;  4CPG A;  2XDJ A;  2OQQ A;  3L70 D;  4IFM A;  4D6T E;  1PGJ A;  1RF1 A;  1GK6 A;  2KZI A;  2H43 A;  3HUS C;  3LID A;  1KQF B;  3V2P A;  1MFZ A;  3L71 J;  4IL6 X;  3RBZ A;  1W5C E;  3U59 A;  1Q81 Q;  3G9R A;  1SQB G;  5AVX B;  1CW5 A;  1PIX A;  3OAK A;  1MUU A;  2W8Z A;  1VF5 D;  1VF5 B;  1LTA C;  2C0W A;  2WT7 A;  1HTL C;  4H0L C;  1LWU C;  5GTI H;  1ZLL A;  1YQ3 C;  2IBZ I;  2ZT9 C;  3CXH I;  3L71 G;  4EYY Q;  3I56 P;  2QSI A;  3RL0 C;  1K8A Q;  3H1L D;  3S9O A;  2K37 A;  2V4H A;  3NFQ A;  3D6Z A;  1AJY A;  2IPP A;  3MHV A;  1NGM B;  1PPJ D;  2FYU E;  4IL6 E;  1PGQ A;  4RKU J;  3FX0 A;  1GK4 A;  1S5L X;  4KHX A;  1HWT C;  2BEZ F;  3WU2 E;  2QJP B;  3N7N A;  2OTL P;  5APW A;  3CX5 D;  4WY4 A;  5KAI E;  4K3A A;  4R4M A;  2Z4E A;  4HYT B;  3JCU H;  2E74 D;  2KNC A;  2E74 B;  4AYC A;  1LTJ A;  1N7S A;  2P2U A;  4N78 E;  4GKG A;  1OXZ A;  1JTH B;  1BCC D;  1J1D B;  5CMZ A;  4HB1 A;  3HE4 B;  2O1J A;  1CSB A;  1KV4 A;  2PP6 A;  1VF5 C;  1S5L E;  2IBZ G;  1R5S A;  3SWF A;  3H1J E;  2ZYG A;  3SFE C;  1OFC X;  3L74 D;  5H2F H;  2QEX P;  1FDI A;  4LC1 A;  1LJ2 A;  1BDD A;  3BRV B;  4W80 A;  1RE3 C;  1JO5 A;  1BDC A;  1AVY A;  1T6A A;  1HGZ A;  1M1K Q;  4B86 A;  1DH3 A;  4WBA A;  1SP4 A;  2J5U A;  3CC7 P;  1L0N J;  3GHG C;  3CWB D; 
#chains in the Genus database with same CATH homology
 3B8E B;  3A2A A;  2XKM A;  3H32 A;  5CCH A;  1RY3 A;  1GL2 C;  1NTK K;  3VMX A;  3MIW A;  3GHG A;  1FZC C;  1N73 C;  5APU A;  3H32 B;  3M9H A;  2FYU K;  2R32 A;  2OAR A;  2KSJ A;  5APS A;  5AW9 B;  1X9V A;  3GHG B;  5AVS B;  5BU5 A;  3O8Z A;  1NOH A;  3VMZ A;  2JEE A;  1GL2 A;  2YMY A;  1EQ7 A;  3RK2 D;  3RK2 B;  1HVV A;  2N1T D;  1FZC A;  2HPC B;  1MZ9 A;  1N73 A;  2Q9I A;  3CI9 A;  5CCG C;  1GL2 B;  2FXM A;  2GUV A;  2IX7 C;  1J1D C;  1FZE A;  2NPS C;  1N73 B;  1L0L K;  3HE5 A;  4I6M C;  1Z56 A;  2H8P D;  4XA4 A;  3RK3 D;  2KP8 A;  1VDF A;  1KZU B;  2W6A A;  3HE5 B;  1QL1 A;  1LT9 C;  2Q5U A;  1X79 B;  4OH8 B;  5CCG A;  5AVY B;  5APV A;  1T2K D;  1HJB A;  3LW5 H;  3BAT A;  1JY2 N;  4HH2 A;  3L4F A;  2YO3 A;  2NPS A;  3HD7 C;  1NTM K;  3V2N A;  2O01 H;  4I1L A;  4C46 A;  4IFF A;  2XNX A;  2HOD B;  1ZN5 A;  2A45 G;  2C9L Y;  1GD2 E;  3P7K A;  1HUC A;  2QM8 A;  3TK1 A;  1LT9 A;  4WB4 A;  4M3L A;  1A02 J;  2WSC H;  1H88 A;  2J58 A;  3E1I A;  1IFD A;  1SQV K;  1SFC C;  4DZO A;  3V5B A;  3V4W A;  1FOS E;  3HD7 A;  5APY A;  3EFG A;  1LT9 B;  1DEB A;  1H89 A;  1AQ5 A;  2KOG A;  2KLV A;  3VN0 A;  1M1J C;  3MTU E;  1L4A D;  1ZR2 A;  3SWY A;  1SFC A;  2IFM A;  1J1E C;  4ZKU A;  1LTG C;  1T3U A;  3A7O A;  1YTZ T;  2WPS A;  3B5N C;  3KYQ A;  4LGD E;  1M1J A;  2VRS A;  3CLQ A;  3R2P A;  1FAV A;  2O1K A;  1T3J A;  3H6P A;  1SLQ A;  2KB7 P;  1M1J B;  5AVT B;  3VP8 A;  1S9K E;  2E43 A;  3TNU A;  5BVZ A;  3B5N A;  2Q7C A;  2YKP A;  2MJZ A;  1NKN A;  1SQQ K;  3MD0 A;  3MGN A;  3HUS B;  4Y99 C;  3TNU B;  2W27 A;  1HGV A;  3RK2 C;  2M8R A;  5APX A;  1GU5 A;  1FZG A;  4EOT A;  2N1T C;  4W7Z A;  5AW8 B;  5CJ0 A;  1WRG A;  1N2D C;  2WT7 B;  1ZV8 A;  4W7Y A;  4N78 D;  3HRN A;  2YNY A;  1A02 F;  2I1J A;  3KQG A;  1RF0 C;  1SQX K;  2L5G B;  4LLH A;  3U1A A;  3RK3 C;  2HPC A;  2N1T A;  2WWW A;  1X8Y A;  3M91 A;  4Y99 B;  2WPR A;  1FZB A;  1T2K C;  3U1C A;  2GM4 A;  4N6J A;  2N1T B;  2WSE H;  5CHX A;  1OWA A;  1RF0 A;  2LKM A;  5AVV B;  3HTK A;  3CL3 D;  1J2J B;  1IC2 A;  3M0A A;  4I2L C;  2FKW B;  2WTY A;  3HTK B;  5AW1 B;  2C0X A;  2C9N Y;  2W6B A;  3RL0 D;  1KQL A;  3P32 A;  3RK3 B;  3RL0 B;  2Z5I A;  3M06 A;  3M0D C;  5AW0 B;  2ZXE B;  2P7J A;  2WPQ A;  4N3Y B;  2HOD A;  3M9Q A;  2HLO A;  1YYC A;  1IO4 A;  3IFM A;  2R5D A;  1LTT C;  1NO4 A;  1IK9 A;  1FZA A;  1L4A C;  1FJP A;  4GIF A;  2ZFC A;  3PP5 A;  3VTP C;  4WY4 D;  3L35 A;  3M0D A;  2JJL A;  1XTG B;  1RF1 C;  5AVZ B;  1SQP K;  3NXS A;  1LTI C;  5AW7 B;  2WZ7 A;  2Z5H A;  1L4A A;  1PFI A;  1LTS C;  1LTJ B;  1N7S D;  1SQB K;  1N7S B;  2XDJ A;  1HH0 A;  5AW3 B;  1RE4 A;  1KFN A;  2GUS A;  2XU6 A;  2J59 M;  5KJ7 A;  2H7H A;  3V4Q A;  1JCD A;  1L4A B;  2WSF H;  4IFM A;  1CZQ A;  1RF1 A;  1GK6 A;  1IFJ A;  1MV8 A;  3A3Y B;  2H43 A;  5KJ7 D;  3P8C E;  3HUS C;  3LID A;  2OYI C;  1XTC C;  1RF1 B;  1JUN A;  3V2P A;  4DOJ A;  1MFZ A;  4C7N A;  5KTB A;  1FZF A;  1JY3 P;  1LGH B;  5AVR B;  3U59 A;  3G3Z A;  1GDT A;  3A5T A;  1KIL D;  2BAS A;  4C7N B;  2Q3I A;  1KIL B;  3HUS A;  2OYI A;  5AVX B;  1CW5 A;  1GW3 A;  3OAK A;  1MUU A;  2OYI B;  2CPB A;  1IJD B;  1LTA C;  2R5B A;  2C0W A;  3VOP A;  2WT7 A;  4JYB A;  1HTL C;  3N4X A;  4GT1 A;  1LWU C;  1ZLL A;  1YTZ I;  3M9B A;  4JF7 A;  1JNM A;  1IFM A;  1CI6 A;  1GW4 A;  1ZR4 A;  4IFD K;  1N86 A;  1QL2 A;  3UIA A;  3LIE A;  1JOC A;  1FOS F;  1CI6 B;  4O9B A;  1LWU A;  5AVQ B;  3RL0 C;  4AQR D;  1IFN A;  2OYH B;  3BAS A;  3IR9 A;  3BRT B;  3NFQ A;  2IPP A;  1GTW A;  1GZL A;  1LWU B;  5APT A;  2P67 A;  1URQ D;  1GU4 A;  1URQ B;  1WT6 A;  1M7L A;  5CCH D;  1W2E A;  4C7R A;  1VPC A;  4RES B;  1H8A A;  1GK4 A;  1JY3 O;  1N7L A;  5AVW B;  4WY4 C;  3KDP B;  1JMM A;  4KHX A;  2POH A;  1NKZ B;  1FJK A;  2FYZ A;  1HWT C;  3NMD A;  2YO2 A;  1FBM A;  2XV5 A;  3OJA B;  1DX7 A;  3NTN A;  1G1J A;  5APQ A;  3TYY A;  3P8C D;  1T8Z A;  3N7N A;  4JYC A;  2FFD C;  1GL2 D;  1KFM A;  1LTJ C;  1SVF A;  5APW A;  1N7S C;  1NWQ A;  2WIT A;  3TSI A;  5BU8 B;  4WY4 A;  1FZC B;  2P1J A;  1JY2 P;  3II6 A;  1NU1 K;  2Z4E A;  3WMM 0;  1FDM A;  3KPE A;  4HYT B;  1RE4 C;  4WY4 B;  3VP9 A;  1AFO A;  5KJ7 C;  4ZKP A;  1S9K D;  4AUW A;  5AW4 B;  2FFD A;  4AYC A;  1IFI A;  1LTJ A;  1N7S A;  2P2U A;  2HYN A;  1JTH A;  3V2R A;  2IFN A;  3MUD A;  4N78 E;  4GKG A;  5AVU B;  1OXZ A;  5KLV K;  2E42 A;  5CJ4 A;  5CCG D;  2FFD B;  1NHL A;  1JTH B;  3VMY A;  2NPS D;  1J1D B;  3HE4 A;  5AW2 B;  1KIL C;  2NPS B;  2PAJ A;  4XE5 B;  5CMZ A;  1G1I A;  2N9B A;  2R3C A;  3HE4 B;  1JCC A;  2O1J A;  1CSB A;  2HG5 D;  2PP6 A;  2A45 H;  3EQ2 A;  5AW6 B;  1KIL A;  3HD7 D;  3SWF A;  1FU1 A;  3HD7 B;  3VYI A;  1G2C A;  1E5W A;  1G2C B;  4LC1 A;  3P8M C;  2YKO A;  1JY3 N;  1SFC D;  2A45 I;  1SFC B;  2KYV A;  3BRV B;  1NAF A;  4W80 A;  3L37 A;  5AW5 B;  2OYH C;  3V2Q A;  1RE3 C;  1JY2 O;  1JO5 A;  2YKQ A;  1NTZ K;  1HGZ A;  3L36 A;  2CPS A;  4B86 A;  1DH3 A;  4WBA A;  1URQ C;  3I5C A;  2HFE D;  5CCH C;  2QM7 A;  2M3B A;  1J1E B;  1SP4 A;  3BVH A;  3GHG C;  3OA7 A;  2OYH A;  1L0N K;  1NH4 A;  1RE3 A;  2XZR A;  3C9I A;  3B5N D;  3B5N B;  3T97 A;  2I1K A;  1LTB C;  1HBW A;  4EIJ A;  1URQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...