2YNYA

Salmonella enterica sada 255-302 fused to gcn4 adaptors (sadak1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
b'MKQIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSMKQIEDKIEEILSKIYHIENEIARIKKLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ynyA00
5APTA 1GD2E 4I2LC 1GZLA 2ZXEB 2R5DA 2R3CA 5APQA 2Q7CA 1FOSE 3VTPC 5AVWB 1CSBA 3T97A 2XV5A 4C46A 2R32A 3NTNA 3LIEA 1HJBA 2WPSA 1HUCA 3LIDA 1GU4A 5AW8B 1MFZA 4JYBA 4C7NB 1JUNA 4B86A 3M9BA 3TNUA 3M0AA 3B8EB 3TYYA 2XU6A 3HE5B 3VMXA 1CI6B 2JJLA 3NXSA 5AW3B 1MV8A 3UIAA 4KHXA 2YO2A 2Q3IA 3V4QA 3A3YB 5CMZA 1J2JB 1T2KC 4M3LA 5AW4B 5AVVB 3O8ZA 1FAVA 3KQGA 1GK4A 5AW7B 2YNYA 1HBWA 3M06A 3SWFA 2WTYA 3VMZA 1A02F 4JYCA 3OAKA 2W6AA 2XZRA 4AUWA 2E43A 1YYCA 2WT7A 3A5TA 2R5BA 3NMDA 2C9LY 3HTKA 5APYA 1SLQA 3L35A 5AVRB 1FOSF 2WPRA 3P8MC 3V5BA 1A02J 3HE4B 3L36A 3NFQA 1OWAA 4LC1A 2P67A 4XE5B 5AW2B 2QM8A 4C7NA 2Z5HA 2N9BA 2BASA 4HYTB 3P7KA 1IO4A 5AVQB 1X8YA 5AVXB 2KP8A 3HE5A 2E42A 5APSA 2P2UA 5AW0B 1CI6A 3TK1A 3M0DA 3IR9A 1HWTC 4DZOA 3P32A 1NWQA 1GK6A 2P7JA 2ZFCA 3KDPB 3MGNA 5AW1B 5APXA 1GTWA 5AVTB 1H89A 1S9KD 3V4WA 5AVUB 1H8AA 3TNUB 3M91A 4EOTA 2IPPA 5AVSB 3MD0A 4GKGA 1S9KE 4AYCA 1NAFA 2VRSA 1OXZA 2QM7A 3I5CA 5APWA 1G2CB 1MUUA 3VMYA 2H7HA 5AVYB 2YO3A 4GT1A 2C9NY 3A2AA 5AVZB 2WPQA 5AW5B 1T2KD 2W27A 2Z5IA 4I6MC 3HE4A 5APUA 5AW6B 1SP4A 4AQRD 3M9HA 3VN0A 5AW9B 3A7OA 1CZQA 4RESB 2WT7B 2WWWA 1GU5A 1KQLA 3L37A 1DH3A 1H88A 3VYIA 5APVA 1JNMA 2Q5UA
chains in the Genus database with same CATH superfamily
1NTZE 3U1CA 1G1JA 4C46A 1VQ8P 3NTNA 2O01J 2KS1B 4ZMDA 3L74E 3F5HA 1GU4A 2Y0DA 4W80A 1JUNA 2CPSA 1P84H 1HGVA 2MKVA 3HE5B 5TISE 5AW3B 1MV8A 3A3YB 3FXDA 1EZVE 1SQVE 2GA1A 1A02F 3Q1MA 3CX5H 2OTLP 2C9LY 4DCKA 2W6JH 3FWNA 5B66E 1NTZK 4WY4A 1S4XA 2IBZG 2GUSA 2RH0A 1WRGA 3RL0D 3B5NB 1YBKA 2O01H 1SQPG 1BE3J 2AEFA 1OMIA 3PJSK 2D2CC 1SFCD 2ZVOB 1OVUA 1FJPA 4H13C 3V4WA 3M91A 5B5EH 1SQBG 2BCCD 3I5CA 1Z56A 1FZCA 2GM4A 1AVOA 3SFEC 3RK2B 1PPJE 1W2BO 3AE9C 4H0LD 3CCJP 1OFCX 1DEBA 3A0BH 4ASWA 2KK7A 3L74D 2NPSB 3LIDA 1NKZB 3TNUA 1XTCC 3WU2E 2AXTE 1KILE 2HODB 1LGHB 2N1TC 1EZVD 1SQVD 3O8ZA 2E75D 4U3FJ 2FYUG 1NAYA 1EDLA 1AQ5A 4AUWA 1T8ZA 2E43A 1YJWP 3AE2C 3CCLP 1NGMB 1LT1A 2IZ0A 1ZV8A 3CI9A 2KS1A 4PJ0E 2JWDA 2BCCJ 1BDDA 1JB0J 3HE5A 2ZYAA 2FXMA 2OYOA 3GF3A 3CCMP 3TGUD 1ZMEC 5KKZB 4WBAA 3AE6C 2B9BA 3D6YA 3L71G 5M1BA 2QVAA 2P10A 1W2EA 2KLUA 4XFJA 1YIJP 3V6IA 1L4AB 1QLED 4BRYB 1OXZA 4H44D 4RO0A 3A0HH 1T3JA 2QEXP 1XTGB 4DJGA 1PPJD 3CXHE 1X79B 3M9HA 1YJNP 1HH0A 2PRRA 1GU5A 1ZR2A 3B5NA 3VYIA 2Q5UA 1VQNP 1S5LX 4W7YA 3AE7C 1KYOI 3V2NA 1CSBA 5KLIB 3BVHA 1SQVJ 4ASVA 1W5CE 1BSHA 2JKVA 4C7NB 4HH2A 1FDOA 4O9BA 3GW6A 1Q90D 3HD7D 1D7MA 2XU6A 2E76D 1IZNB 2QJKB 1U57A 2E74C 5KAIE 2O1JA 1SVFA 3L70E 2WSEJ 1OZHA 1AJYA 1SLQA 1H0TB 1JY3O 3TGUJ 1IC2A 2Y0EA 1VQKP 3RL0B 2NPSA 1FZFA 1VQPP 2DW3A 1IFIA 1PFIA 3RK3E 3AE4C 5H2FH 2FY8A 2E42A 2HODA 1MKMA 3KXDA 1JY2O 1SQQG 5CCGC 3O6QB 4UB6E 1GMJA 1LTIC 1GTWA 2J58A 3PTZA 1SQXK 1NAFA 1KD1Q 2UWJE 1NTMG 2WPQA 2YMKA 3EFFK 1YQ3C 3CXHD 4H0LB 5DJUB 4D6TG 1NU1E 2WT7B 4LLHA 2IYOA 3B5NC 2Q7CA 3CC4P 3H1JE 2P58A 2FFDB 2Q1KA 1ZXGA 3B4SA 3OJAB 1P84E 3AEDC 1L4AA 2A45G 4BRYA 3VMAA 1KN7A 1T2KC 4M3LA 3WUUA 4ZNCA 3HRNA 1HBWA 3CWBE 3L70D 3CX5E 3RL0g 3RK2C 1EZVI 3CCEP 5E79E 3L36A 2M3EA 3NFQA 3RK3D 2QM8A 4C7NA 2C0XA 2NPSC 4IFFA 1DEEG 2WITA 2P7JA 3MGNA 5APXA 1UIIA 1AQTA 3TF5A 4H44B 5B5EE 1S9KE 4N3YB 4AYCA 5CCHC 3E1IA 1NTKG 4A7PA 2IBZI 1H0TA 2JEEA 1KQGB 1SS1A 3Q5PA 3KZIH 3I55P 1NU1D 1LJ2A 3D6ZA 1KTMA 2L91A 3VN0A 4RESB 2OYIB 3MIWA 1FZEA 2BEZF 3M9QA 1AA0A 4L73A 3CD6P 3H1JD 3CMAP 1S72P 3A0BE 1LTJB 3GHGB 1BE3E 3O6QA 1EDKA 2IDBA 1KILB 4WB4A 1P84D 3U1AA 3HD7B 1L0NG 2A06E 3L70J 3L75G 5KKZC 1MFTA 1N7SD 1KYOE 1VDFA 3H1LG 1L4AC 1ZW0A 5AW4B 1RF0A 3CWBD 5KAFH 1RE3A 3L72D 3CX5D 3N7NA 4JYCA 2WT7A 4Y28J 1YQ4C 4N6JA 5AVRB 1M56D 1M8OB 2XDJA 2YKOA 3D71A 2FFDA 3PRJA 2YIUB 1NH4A 5C39A 5KLIC 1VQMP 1Y8AA 1BGYG 5AVXB 1OIPA 3M0DA 3L73E 2HLOA 1DD4A 2PAJA 2POHA 5KJ7D 3S1KA 2QJKC 1S9KD 4JF7A 3AEGC 4U3FE 3CCQP 3A0HE 1EXJA 3Q2YA 3H1KG 5AVYB 5AVZB 4K35A 1QVGO 1K04A 1Q81Q 1JEKA 2E5YA 4ZKPA 3RL0C 1KMIZ 3B71A 4EIJA 2G3AA 4PD4H 4I2LC 5KLVE 4NPDA 4HB1A 1IK7A 3CXHI 2I8DA 3VTPC 1BE3D 2ZT9B 1PV3A 3QWOC 3H25A 2A06D 1HTLC 3CWBJ 5AW8B 3L72J 3H1IG 5EFWB 1KYOD 3TYYA 3NXSA 4TLFA 4KHXA 3WUVA 3BCCG 5AVVB 1NTZG 3KQGA 1RF0C 2WTYA 4NPEA 1RE3C 1LTAC 2R5BA 4H0LC 3H32B 4YTPC 2OYIA 4W7ZA 3L35A 2WPVB 3Q5RA 3LW5H 3RK3B 2KSEA 1LTJA 3GHGA 5CHXA 3C9IA 3HD7A 1KILA 2FFDC 4IFDK 1GL2D 5H2FE 3AE5C 3L73D 3CLQA 3HUSB 2RMZA 4DZOA 3M0DC 1FE6A 2A45H 3OA7A 2K9JB 2LR2A 4U3FD 3CC7P 2YXRB 1GDTA 2YXQB 4MN4C 1NTKJ 2KZIA 4GT1A 1R5SA 1K8AQ 1K9MQ 1LWUB 4BXLA 2M8RA 2M0BA 3TGUE 1OVVA 1L0LG 5KLVD 1AVYA 3GF7A 2HFED 5APVA 1JNMA 2IBZE 1SQVK 2W6BA 1BSNA 1KZUB 1SQPE 2FBWC 1HJBA 1JCCA 1N7SB 3Q3DA 3AECC 2Z4EA 5CBNA 1N8RQ 1USEA 4H44C 5L8RJ 1USDA 1SQBE 1P84I 1FZGA 1EC5A 3SFDC 3AEEC 1YYCA 2Y9YA 3L73J 3E1RA 2OYIC 3CX5I 4IOIH 1T3UA 1URQD 1LTJC 3GHGC 2BASA 3P7KA 1KILC 2W90A 5AVQB 2P2UA 1IFJA 5CBOA 1GK6A 2SPZA 4UB8E 2FYNB 3MD0A 4WY4C 2ZYGA 2E5TA 2FYUE 5KLVJ 3H32A 1JMMA 1KFMA 3C1LA 3P8CE 5CJ0A 1PGQA 3KZIE 1KORA 1PP9G 2IBZD 3L37A 4JQ0D 2YIUC 2ZAEB 4DOJA 1GD2E 2FYZA 3CPWO 1SQPD 3HUSA 2Q9IA 1VQ9P 2K9JA 1FZCC 1PGPA 2KLVA 2W83C 2IX7C 3L71E 1CI6B 4K3AA 1SQBD 1VQ6P 2YO2A 3JSVC 2OQQA 3BATA 1WMKA 1LWUA 5KAFE 3JCUH 3AEBC 4IL6H 2R44A 5APYA 3G4SP 3G3ZA 2KYVA 1VQ4P 4HJGH 2QA4P 2FXPA 1J1EB 2ZT9C 3L4FA 1N7SA 1OW8A 2XKMA 1SQXG 2N1TD 5GTHH 2NZ2A 1JY2P 1R8EA 2B87B 2WSCH 3VP9A 2XNDH 2IFNA 4EOTA 2CK3H 2IPPA 2H43A 2FYUD 1JY2N 4I1LA 5BU5A 1G2CB 2H7HA 3FWLA 2YO3A 3P8CD 1SFCB 1SQPJ 4I6MC 3N4XA 3ITKA 3RK3C 3FGAD 4RKUJ 1L0LJ 3MUDA 2ZYDA 4PD4E 1H88A 3Q5SA 3G9RA 5APTA 5KJ7A 1SQBJ 5APQA 3U59A 1HVVA 1FBMA 2AEJA 3HUSC 1FZBA 3H1HG 1JTHB 1SQQE 4B86A 1U7JA 3L71D 3IFMA 2O3JA 3I56P 1Q82Q 3EQ2A 3UIAA 2Q3IA 4HKZH 5CMZA 1N73B 1UIXA 1NTME 5AW7B 3ZDMA 3W68A 1LT9B 1LWUC 3MHVA 3W67A 3GLMA 1VQ7P 3MTUE 4D6TE 1NHLA 4PV1D 3CC2P 4ZKUA 1URQB 2E75B 3EWKA 1BCCG 2M5AB 2FYUJ 3PH0A 3L72E 1CI6A 1BDCA 1NU1K 1RHZB 1CW5A 2ITAA 3KDPB 3ABVC 2JO1A 2YKPA 1H89A 2LXCB 2K9YA 5BU8B 3CCSP 1NVOA 2OARA 2IYPA 1DX7A 1YTZT 1IFMA 3CL3D 2WMMA 3G6EP 4KJMA 1DD3A 4PD4D 1QL2A 3C8VA 4LGDE 2H89C 3L71J 4Z1MH 1KC8Q 4GOFA 4YPCA 5CCGD 3MUDC 2ZXEB 1LTBC 1LTTC 3IAOA 5KJ7C 2XV5A 2R32A 3LIEA 1SQQD 2B88A 2B87A 2KOGA 1L2PA 2XNXA 3CCVP 2FYNC 2LKMA 3EFGA 1NTMD 4Y99B 2RKLA 1SFCA 1NTKE 1JOCA 3OAKA 3FXEA 2KXPB 4D6TD 2R3SA 2E76B 5GTIH 4DT0A 2N1TB 2Z5HA 4HYTB 1JTHA 3SSUA 1QEXA 3IR9A 3L75E 2FKWB 2P1JA 1KB9H 1N73A 1KV4A 1YTZI 1EXIA 1LNQA 1ZRTE 2HR3A 2JDIH 3H1LE 1NTKK 2O01N 1LT9A 1JMBA 1EDJA 3V2RA 1S3JA 1URQA 2NPSD 1M57D 1M7LA 1NOHA 1SQQJ 1KQFB 3PHLA 1CZQA 3SWYA 1J1EC 2WSSH 2M5AA 2GUVA 1LTSC 2R5DA 1YHQP 3RGUA 1FOSE 3KHUA 1BGYE 1NTMJ 4WWIA 1HUCA 3H6PA 5CCHD 3R4YA 4QMAA 1HF9A 1Y47A 1S5LH 1RQUA 4D6TJ 3MP7B 2V4HA 1Q7YQ 3LW5J 1FJKA 3OW2O 1NTKD 1AFOA 1FAVA 2KZJA 4OGQD 2CPBA 2AXCA 3H1KE 4WVZA 2BCCG 1SFCC 3KYQA 2W6AA 4PV1B 2HYNA 3JCUE 4IL6E 4JPZB 4N78E 1A02J 2OTJP 1FS0E 1QL1A 1EDIA 2QG4A 3BRVB 1L0ND 1IO4A 1GW3A 1QGKB 3L75D 2KIKA 5GTHE 3H1IE 3TK1A 3L74G 1HWTC 3CCUP 2WZ7A 1ZRTD 3H1LD 3D70A 4BWNA 1N73C 5KLVK 3BCCE 1FDIA 2J59M 1LT9C 1EZVG 1SQVG 2C9NY 2HG5D 2KB7P 2W27A 2WSFH 1URQC 2N1TA 3A7OA 2E75C 3WMM0 1KQLA 2H88C 3S4RA 1PIXA 4GOEA 1ZLLA 1BGYD 2R3CA 4PD4I 3CCRP 1HJ0A 4JYBA 2V7QH 1RE4A 3JC22 3TGUG 3BRTB 4OH8B 5E79H 3CMEP 3E7KA 1R5LA 1J2JB 3H1KD 3II6A 3SWFA 3VMZA 2I1KA 3A5TA 1NKNA 1L0NJ 4N78D 4RJTA 3L75J 3V2QA 2WPRA 1OW6A 1L0LE 1PPJG 3HE4B 1IFPA 3H1LJ 2NRGA 1VF5D 1JM0A 1E5WA 2Y9ZA 3H1ID 1X8YA 1ZOYC 1M1JB 3T97B 3TDKA 5AW1B 2J5UA 3BCCD 1NTZD 4Y99C 1H8AA 2OGUA 5AVSB 2AEMA 1SQPK 2YKQA 3IN6A 2A45I 5APWA 1GW4A 1MUUA 3HD7C 1FU1A 1ZN5A 1BGYJ 2E76C 1L0LK 5APUA 3AEFC 1TU3F 2M3BA 1KYOH 2FXOA 1SQBK 1VQ5P 1IK9A 1IFDA 3RBZA 1K05A 2IZ1A 3H1KJ 1PGJA 1RF1B 1N86A 1X9VA 1MFZA 1OW7A 1FDMA 4JBZA 3VMXA 1RE4C 2D2CD 4OGQB 2QE7H 1FZAA 1GK4A 2B89A 4H13D 5CCGA 1PZQA 3AE1C 2OYHB 3H1IJ 1L0LD 4I7ZB 5GTIE 1PP9E 1FOSF 3MZWB 3P8MC 1G1IA 2WSCJ 2FYUK 1OWAA 4EI2A 4LC1A 3BCCJ 5AW2B 1NTZJ 2N9BA 1S1CX 5APSA 5AW0B 3L74J 1LP1B 1KB9E 2G8YA 1JY3P 2K3RA 4GKGA 1NO4A 1GL2B 1K73Q 1QX8A 2QM7A 2RN0A 1WT6A 4R4MA 4PV1C 1JY3N 3A2AA 2Q6QA 5AW5B 2PFXA 3L70G 3HE4A 4AQRD 1KILD 2ZXXA 2WWWA 3V2PA 2QJPB 1M1JA 4GDOA 1SQXE 3T97A 1PL5A 2ZVNB 2WQYC 4WY4D 2HPCB 1JO5A 1J1DB 2QJYB 3M9BA 1S5LE 2JJLA 5TISH 2O1KA 4YXWH 1IFNA 3V4QA 2JP3A 2N9YB 1N2DC 2Y0CA 1ZR4A 4CPGA 2I1JA 3TSIA 2K1AA 1FC2C 2XZRA 1Q86Q 1PGOA 2WVRA 3AEAC 1PP9D 5BVZA 1VF5B 1NU1G 5B66H 1YJ9P 5CCHA 3WUTA 2P67A 1RF1A 4XE5B 3K5BA 5KTBA 3H1JG 3H1HE 2WSEH 2KP8A 1KB9D 4YXDC 2LXBA 5AVTB 3USSA 3QH9A 1NYHA 3PLNA 1JCDA 1VPCA 5K5GB 2PP6A 4KT0J 2OYHA 5TJHA 3CWBG 1SQQK 3SWKA 1N7SC 3L72G 1Y9BA 2ZT9D 3PP5A 2E74D 1EQ7A 5AW6B 4GODA 4OVNF 2W8ZA 4L75A 1IJDB 1NTMK 3HTKB 5CJ4A 3GMAA 1GZLA 1SQXD 1BCCE 1X0TA 5AVWB 1U7MA 1LP1A 1M1JC 1ZP0C 2D2CB 2JWAA 3M0AA 3FX0A 1KFNA 1GL2A 3WU2H 2AXTH 1PP9J 1YITP 3GG2A 4H13B 3R2PA 2K37A 2YNYA 3M06A 2KNCB 3NMDA 4UB8H 3AE3C 3V5BA 4EYYQ 1MZ9A 1G2CA 3VP8A 2C0WA 4PJ0H 2HPCA 3H1HD 1RF1C 2QRXA 1BE3G 3B5ND 4U7JA 1LTGC 2A06G 1Q2NA 4XA4A 4OGQC 4GIFA 1RQVA 2K88A 4IFMA 5AVUB 4C7RA 1M1KQ 3VMYA 1SQXJ 3AE8C 1T2KD 4L74A 2OYHC 1L0NE 4I7ZC 1SP4A 3G71P 1N7LA 1E79H 3CXHH 1DIPA 1HGZA 3BASA 1DH3A 3RK2D 1BCCD 2ZJSE 4WY4B 2WPSA 3RBXA 1OX3A 3L73G 1AV1A 3B8EB 1X22A 4IL6X 1GL2C 2H8PD 1NJIQ 1OVRA 2BEQD 4NPFX 1L0NK 4U3FG 5KAIH 1RY3A 1KQSO 2MJZA 3IF4A 4L76A 3H1HJ 3HTKA 1VQOP 1RH5B 1FZCB 2QJPC 1NU1J 1VQLP 2Q3EA 2QIWA 2QSIA 1VL2A 5KLVG 2YMYA 2PGDA 1S2EA 3H1JJ 3F89A 1J1DC 2QJYC 2KI7B 1M90Q 3S9OA 5DJTB 4TT3H 2WSFJ 3P32A 1T6AA 1NWQA 2ZFCA 4UB6H 4EDFA 2KSJA 1YI2P 2KUBA 3TNUB 1KB9I 3KPEA 3VOPA 2VRSA 2KNCA 2BCCE 1BCCJ 2E74B 2OTKE 4R4LA 1L4AD 2Z5IA 1QVFO 2IFMA 1VF5C 2V7QJ 5AW9B 2JR8A 2L5GB 4OWFA
chains in the Genus database with same CATH topology
5APTA 3M9QA 3U1CA 5KJ7A 5APQA 3U59A 1HVVA 1G1JA 1FBMA 1LTJB 3GHGB 4C46A 3NTNA 3HUSC 1FZBA 3HD7B 1KILB 1N86A 1X9VA 4WB4A 1MFZA 3U1AA 1GU4A 1RF1B 4W80A 1JUNA 1FDMA 1JTHB 4B86A 2CPSA 1HGVA 3IFMA 3HE5B 3VMXA 1N7SD 3EQ2A 1RE4C 5AW3B 1MV8A 3UIAA 1VDFA 2Q3IA 3A3YB 5CMZA 1N73B 1L4AC 5AW4B 1RF0A 5AW7B 1FZAA 1GK4A 1RE3A 1LT9B 3N7NA 1LWUC 1A02F 4JYCA 5CCGA 2WT7A 2C9LY 2OYHB 3MTUE 1NHLA 4N6JA 5AVRB 1FOSF 3P8MC 1G1IA 1NTZK 4WY4A 4ZKUA 1URQB 2XDJA 2YKOA 2FFDA 2FYUK 1OWAA 4LC1A 1NH4A 2GUSA 5AW2B 1WRGA 3RL0D 2N9BA 3B5NB 2O01H 5AVXB 5APSA 5AW0B 1CI6A 3M0DA 1NU1K 2HLOA 1SFCD 1CW5A 2PAJA 2POHA 3KDPB 5KJ7D 2YKPA 1H89A 1S9KD 1JY3P 1FJPA 3V4WA 4JF7A 3M91A 4GKGA 1NO4A 1GL2B 5BU8B 2QM7A 3I5CA 1Z56A 1WT6A 5AVYB 1JY3N 2OARA 1FZCA 3A2AA 5AVZB 2GM4A 5AW5B 1DX7A 1YTZT 1IFMA 3HE4A 3CL3D 4AQRD 4ZKPA 1KILD 3RK2B 3RL0C 1QL2A 2WWWA 4LGDE 4EIJA 3V2PA 5CCGD 4I2LC 1DEBA 2ZXEB 1LTBC 1M1JA 1LTTC 3VTPC 3T97A 5KJ7C 2XV5A 2R32A 3LIEA 2NPSB 1HTLC 3LIDA 4WY4D 2KOGA 5AW8B 2HPCB 1JO5A 1J1DB 1NKZB 3M9BA 3TNUA 1XTCC 2XNXA 3TYYA 2JJLA 3NXSA 2HODB 2O1KA 4KHXA 1IFNA 2LKMA 1LGHB 3V4QA 3EFGA 2N1TC 1N2DC 4Y99B 1ZR4A 5AVVB 1SFCA 3O8ZA 2I1JA 3KQGA 3TSIA 1RF0C 2WTYA 1AQ5A 1JOCA 3OAKA 2XZRA 1RE3C 4AUWA 1T8ZA 2E43A 1LTAC 2R5BA 3H32B 2OYIA 4W7ZA 3L35A 5BVZA 3LW5H 5CCHA 3RK3B 1LTJA 3GHGA 5CHXA 1ZV8A 3C9IA 3CI9A 2N1TB 2P67A 1KILA 3HD7A 1RF1A 4XE5B 2Z5HA 2FFDC 4HYTB 5KTBA 1JTHA 4IFDK 1GL2D 2WSEH 2KP8A 3HE5A 3CLQA 2FXMA 3HUSB 3IR9A 2FKWB 2P1JA 4DZOA 1N73A 1YTZI 3M0DC 2A45H 4WBAA 3OA7A 5AVTB 1NTKK 1LT9A 1W2EA 1JCDA 1VPCA 1GDTA 1L4AB 2PP6A 1OXZA 2OYHA 3V2RA 1T3JA 4GT1A 1XTGB 1SQQK 1N7SC 1LWUB 1URQA 2M8RA 3PP5A 1EQ7A 5AW6B 2NPSD 1M7LA 1NOHA 1X79B 3M9HA 1HH0A 1CZQA 3SWYA 1GU5A 1J1EC 1ZR2A 3B5NA 2HFED 1IJDB 3HTKB 1NTMK 5APVA 3VYIA 2Q5UA 2GUVA 5CJ4A 1JNMA 1SQVK 4W7YA 1LTSC 1GZLA 2R5DA 2W6BA 1FOSE 1KZUB 3V2NA 5AVWB 1CSBA 1M1JC 3BVHA 1HJBA 1HUCA 1JCCA 3H6PA 5CCHD 4C7NB 1N7SB 4HH2A 4O9BA 2Z4EA 3M0AA 3HD7D 1KFNA 2XU6A 1GL2A 1FJKA 1FZGA 1AFOA 1FAVA 2CPBA 3R2PA 2YNYA 3M06A 1SFCC 2O1JA 3KYQA 1SVFA 2W6AA 2HYNA 1YYCA 3NMDA 1SLQA 4N78E 1JY3O 2OYIC 1IC2A 3V5BA 1A02J 3RL0B 1MZ9A 1G2CA 1QL1A 1T3UA 3VP8A 2C0WA 2NPSA 1FZFA 1URQD 1LTJC 2HPCA 3GHGC 3BRVB 2BASA 1IFIA 3P7KA 1IO4A 1PFIA 1GW3A 1KILC 1RF1C 5AVQB 2E42A 2P2UA 1IFJA 3TK1A 2HODA 3B5ND 1HWTC 1LTGC 2WZ7A 1JY2O 5CCGC 1GK6A 4XA4A 1LTIC 1GTWA 4GIFA 1N73C 5KLVK 2J58A 4IFMA 5AVUB 3MD0A 1SQXK 2J59M 4C7RA 4WY4C 1NAFA 1LT9C 3H32A 3VMYA 1JMMA 2C9NY 2WPQA 1KFMA 2HG5D 1T2KD 2KB7P 2W27A 2OYHC 3P8CE 2WSFH 5CJ0A 1SP4A 1N7LA 1URQC 2N1TA 3A7OA 1HGZA 2WT7B 3BASA 3WMM0 1KQLA 3L37A 4LLHA 1DH3A 3RK2D 4DOJA 1GD2E 1ZLLA 2R3CA 2FYZA 3B5NC 2Q7CA 4WY4B 3HUSA 2Q9IA 2FFDB 2WPSA 4JYBA 3OJAB 1FZCC 1RE4A 2KLVA 3B8EB 3BRTB 2IX7C 4OH8B 1CI6B 1L4AA 2A45G 2YO2A 1GL2C 3BATA 1J2JB 1T2KC 2H8PD 4M3LA 3HRNA 1LWUA 1L0NK 1HBWA 3II6A 3SWFA 1RY3A 3VMZA 2MJZA 2I1KA 3A5TA 1NKNA 4N78D 3RK2C 3HTKA 5APYA 1FZCB 3V2QA 2WPRA 3G3ZA 2KYVA 3HE4B 3L36A 3NFQA 1J1EB 1E5WA 2YMYA 2QM8A 3L4FA 1N7SA 3RK3D 4C7NA 2C0XA 2NPSC 4IFFA 2XKMA 2N1TD 2WITA 1X8YA 1J1DC 1M1JB 3P32A 1JY2P 1NWQA 2P7JA 2ZFCA 3MGNA 5AW1B 5APXA 2KSJA 2WSCH 3VP9A 2IFNA 4Y99C 1H8AA 3TNUB 4EOTA 2IPPA 5AVSB 1S9KE 2H43A 4N3YB 4AYCA 1SQPK 2YKQA 3KPEA 3VOPA 2VRSA 5CCHC 3E1IA 1JY2N 4I1LA 5BU5A 2A45I 5APWA 1G2CB 1GW4A 1MUUA 2H7HA 2YO3A 3HD7C 3P8CD 1FU1A 1ZN5A 1SFCB 1L4AD 2JEEA 2Z5IA 4I6MC 3N4XA 1L0LK 2IFMA 5APUA 2M3BA 3VN0A 5AW9B 3RK3C 1SQBK 4RESB 1IK9A 1IFDA 2L5GB 3MUDA 2OYIB 1H88A 3MIWA 1FZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APT A;  1GD2 E;  4I2L C;  1GZL A;  2ZXE B;  2R5D A;  2R3C A;  5APQ A;  2Q7C A;  1FOS E;  3VTP C;  5AVW B;  1CSB A;  3T97 A;  2XV5 A;  4C46 A;  2R32 A;  3NTN A;  3LIE A;  1HJB A;  2WPS A;  1HUC A;  3LID A;  1GU4 A;  5AW8 B;  1MFZ A;  4JYB A;  4C7N B;  1JUN A;  4B86 A;  3M9B A;  3TNU A;  3M0A A;  3B8E B;  3TYY A;  2XU6 A;  3HE5 B;  3VMX A;  1CI6 B;  2JJL A;  3NXS A;  5AW3 B;  1MV8 A;  3UIA A;  4KHX A;  2YO2 A;  2Q3I A;  3V4Q A;  3A3Y B;  5CMZ A;  1J2J B;  1T2K C;  4M3L A;  5AW4 B;  5AVV B;  3O8Z A;  1FAV A;  3KQG A;  1GK4 A;  5AW7 B;  2YNY A;  1HBW A;  3M06 A;  3SWF A;  2WTY A;  3VMZ A;  1A02 F;  4JYC A;  3OAK A;  2W6A A;  2XZR A;  4AUW A;  2E43 A;  1YYC A;  2WT7 A;  3A5T A;  2R5B A;  3NMD A;  2C9L Y;  3HTK A;  5APY A;  1SLQ A;  3L35 A;  5AVR B;  1FOS F;  2WPR A;  3P8M C;  3V5B A;  1A02 J;  3HE4 B;  3L36 A;  3NFQ A;  1OWA A;  4LC1 A;  2P67 A;  4XE5 B;  5AW2 B;  2QM8 A;  4C7N A;  2Z5H A;  2N9B A;  2BAS A;  4HYT B;  3P7K A;  1IO4 A;  5AVQ B;  1X8Y A;  5AVX B;  2KP8 A;  3HE5 A;  2E42 A;  5APS A;  2P2U A;  5AW0 B;  1CI6 A;  3TK1 A;  3M0D A;  3IR9 A;  1HWT C;  4DZO A;  3P32 A;  1NWQ A;  1GK6 A;  2P7J A;  2ZFC A;  3KDP B;  3MGN A;  5AW1 B;  5APX A;  1GTW A;  5AVT B;  1H89 A;  1S9K D;  3V4W A;  5AVU B;  1H8A A;  3TNU B;  3M91 A;  4EOT A;  2IPP A;  5AVS B;  3MD0 A;  4GKG A;  1S9K E;  4AYC A;  1NAF A;  2VRS A;  1OXZ A;  2QM7 A;  3I5C A;  5APW A;  1G2C B;  1MUU A;  3VMY A;  2H7H A;  5AVY B;  2YO3 A;  4GT1 A;  2C9N Y;  3A2A A;  5AVZ B;  2WPQ A;  5AW5 B;  1T2K D;  2W27 A;  2Z5I A;  4I6M C;  3HE4 A;  5APU A;  5AW6 B;  1SP4 A;  4AQR D;  3M9H A;  3VN0 A;  5AW9 B;  3A7O A;  1CZQ A;  4RES B;  2WT7 B;  2WWW A;  1GU5 A;  1KQL A;  3L37 A;  1DH3 A;  1H88 A;  3VYI A;  5APV A;  1JNM A;  2Q5U A; 
#chains in the Genus database with same CATH topology
 1NTZ E;  3U1C A;  1G1J A;  4C46 A;  1VQ8 P;  3NTN A;  2O01 J;  2KS1 B;  4ZMD A;  3L74 E;  3F5H A;  1GU4 A;  2Y0D A;  4W80 A;  1JUN A;  2CPS A;  1P84 H;  1HGV A;  2MKV A;  3HE5 B;  5TIS E;  5AW3 B;  1MV8 A;  3A3Y B;  3FXD A;  1EZV E;  1SQV E;  2GA1 A;  1A02 F;  3Q1M A;  3CX5 H;  2OTL P;  2C9L Y;  4DCK A;  2W6J H;  3FWN A;  5B66 E;  1NTZ K;  4WY4 A;  1S4X A;  2IBZ G;  2GUS A;  2RH0 A;  1WRG A;  3RL0 D;  3B5N B;  1YBK A;  2O01 H;  1SQP G;  1BE3 J;  2AEF A;  1OMI A;  3PJS K;  2D2C C;  1SFC D;  2ZVO B;  1OVU A;  1FJP A;  4H13 C;  3V4W A;  3M91 A;  5B5E H;  1SQB G;  2BCC D;  3I5C A;  1Z56 A;  1FZC A;  2GM4 A;  1AVO A;  3SFE C;  3RK2 B;  1PPJ E;  1W2B O;  3AE9 C;  4H0L D;  3CCJ P;  1OFC X;  1DEB A;  3A0B H;  4ASW A;  2KK7 A;  3L74 D;  2NPS B;  3LID A;  1NKZ B;  3TNU A;  1XTC C;  3WU2 E;  2AXT E;  1KIL E;  2HOD B;  1LGH B;  2N1T C;  1EZV D;  1SQV D;  3O8Z A;  2E75 D;  4U3F J;  2FYU G;  1NAY A;  1EDL A;  1AQ5 A;  4AUW A;  1T8Z A;  2E43 A;  1YJW P;  3AE2 C;  3CCL P;  1NGM B;  1LT1 A;  2IZ0 A;  1ZV8 A;  3CI9 A;  2KS1 A;  4PJ0 E;  2JWD A;  2BCC J;  1BDD A;  1JB0 J;  3HE5 A;  2ZYA A;  2FXM A;  2OYO A;  3GF3 A;  3CCM P;  3TGU D;  1ZME C;  5KKZ B;  4WBA A;  3AE6 C;  2B9B A;  3D6Y A;  3L71 G;  5M1B A;  2QVA A;  2P10 A;  1W2E A;  2KLU A;  4XFJ A;  1YIJ P;  3V6I A;  1L4A B;  1QLE D;  4BRY B;  1OXZ A;  4H44 D;  4RO0 A;  3A0H H;  1T3J A;  2QEX P;  1XTG B;  4DJG A;  1PPJ D;  3CXH E;  1X79 B;  3M9H A;  1YJN P;  1HH0 A;  2PRR A;  1GU5 A;  1ZR2 A;  3B5N A;  3VYI A;  2Q5U A;  1VQN P;  1S5L X;  4W7Y A;  3AE7 C;  1KYO I;  3V2N A;  1CSB A;  5KLI B;  3BVH A;  1SQV J;  4ASV A;  1W5C E;  1BSH A;  2JKV A;  4C7N B;  4HH2 A;  1FDO A;  4O9B A;  3GW6 A;  1Q90 D;  3HD7 D;  1D7M A;  2XU6 A;  2E76 D;  1IZN B;  2QJK B;  1U57 A;  2E74 C;  5KAI E;  2O1J A;  1SVF A;  3L70 E;  2WSE J;  1OZH A;  1AJY A;  1SLQ A;  1H0T B;  1JY3 O;  3TGU J;  1IC2 A;  2Y0E A;  1VQK P;  3RL0 B;  2NPS A;  1FZF A;  1VQP P;  2DW3 A;  1IFI A;  1PFI A;  3RK3 E;  3AE4 C;  5H2F H;  2FY8 A;  2E42 A;  2HOD A;  1MKM A;  3KXD A;  1JY2 O;  1SQQ G;  5CCG C;  3O6Q B;  4UB6 E;  1GMJ A;  1LTI C;  1GTW A;  2J58 A;  3PTZ A;  1SQX K;  1NAF A;  1KD1 Q;  2UWJ E;  1NTM G;  2WPQ A;  2YMK A;  3EFF K;  1YQ3 C;  3CXH D;  4H0L B;  5DJU B;  4D6T G;  1NU1 E;  2WT7 B;  4LLH A;  2IYO A;  3B5N C;  2Q7C A;  3CC4 P;  3H1J E;  2P58 A;  2FFD B;  2Q1K A;  1ZXG A;  3B4S A;  3OJA B;  1P84 E;  3AED C;  1L4A A;  2A45 G;  4BRY A;  3VMA A;  1KN7 A;  1T2K C;  4M3L A;  3WUU A;  4ZNC A;  3HRN A;  1HBW A;  3CWB E;  3L70 D;  3CX5 E;  3RL0 g;  3RK2 C;  1EZV I;  3CCE P;  5E79 E;  3L36 A;  2M3E A;  3NFQ A;  3RK3 D;  2QM8 A;  4C7N A;  2C0X A;  2NPS C;  4IFF A;  1DEE G;  2WIT A;  2P7J A;  3MGN A;  5APX A;  1UII A;  1AQT A;  3TF5 A;  4H44 B;  5B5E E;  1S9K E;  4N3Y B;  4AYC A;  5CCH C;  3E1I A;  1NTK G;  4A7P A;  2IBZ I;  1H0T A;  2JEE A;  1KQG B;  1SS1 A;  3Q5P A;  3KZI H;  3I55 P;  1NU1 D;  1LJ2 A;  3D6Z A;  1KTM A;  2L91 A;  3VN0 A;  4RES B;  2OYI B;  3MIW A;  1FZE A;  2BEZ F;  3M9Q A;  1AA0 A;  4L73 A;  3CD6 P;  3H1J D;  3CMA P;  1S72 P;  3A0B E;  1LTJ B;  3GHG B;  1BE3 E;  3O6Q A;  1EDK A;  2IDB A;  1KIL B;  4WB4 A;  1P84 D;  3U1A A;  3HD7 B;  1L0N G;  2A06 E;  3L70 J;  3L75 G;  5KKZ C;  1MFT A;  1N7S D;  1KYO E;  1VDF A;  3H1L G;  1L4A C;  1ZW0 A;  5AW4 B;  1RF0 A;  3CWB D;  5KAF H;  1RE3 A;  3L72 D;  3CX5 D;  3N7N A;  4JYC A;  2WT7 A;  4Y28 J;  1YQ4 C;  4N6J A;  5AVR B;  1M56 D;  1M8O B;  2XDJ A;  2YKO A;  3D71 A;  2FFD A;  3PRJ A;  2YIU B;  1NH4 A;  5C39 A;  5KLI C;  1VQM P;  1Y8A A;  1BGY G;  5AVX B;  1OIP A;  3M0D A;  3L73 E;  2HLO A;  1DD4 A;  2PAJ A;  2POH A;  5KJ7 D;  3S1K A;  2QJK C;  1S9K D;  4JF7 A;  3AEG C;  4U3F E;  3CCQ P;  3A0H E;  1EXJ A;  3Q2Y A;  3H1K G;  5AVY B;  5AVZ B;  4K35 A;  1QVG O;  1K04 A;  1Q81 Q;  1JEK A;  2E5Y A;  4ZKP A;  3RL0 C;  1KMI Z;  3B71 A;  4EIJ A;  2G3A A;  4PD4 H;  4I2L C;  5KLV E;  4NPD A;  4HB1 A;  1IK7 A;  3CXH I;  2I8D A;  3VTP C;  1BE3 D;  2ZT9 B;  1PV3 A;  3QWO C;  3H25 A;  2A06 D;  1HTL C;  3CWB J;  5AW8 B;  3L72 J;  3H1I G;  5EFW B;  1KYO D;  3TYY A;  3NXS A;  4TLF A;  4KHX A;  3WUV A;  3BCC G;  5AVV B;  1NTZ G;  3KQG A;  1RF0 C;  2WTY A;  4NPE A;  1RE3 C;  1LTA C;  2R5B A;  4H0L C;  3H32 B;  4YTP C;  2OYI A;  4W7Z A;  3L35 A;  2WPV B;  3Q5R A;  3LW5 H;  3RK3 B;  2KSE A;  1LTJ A;  3GHG A;  5CHX A;  3C9I A;  3HD7 A;  1KIL A;  2FFD C;  4IFD K;  1GL2 D;  5H2F E;  3AE5 C;  3L73 D;  3CLQ A;  3HUS B;  2RMZ A;  4DZO A;  3M0D C;  1FE6 A;  2A45 H;  3OA7 A;  2K9J B;  2LR2 A;  4U3F D;  3CC7 P;  2YXR B;  1GDT A;  2YXQ B;  4MN4 C;  1NTK J;  2KZI A;  4GT1 A;  1R5S A;  1K8A Q;  1K9M Q;  1LWU B;  4BXL A;  2M8R A;  2M0B A;  3TGU E;  1OVV A;  1L0L G;  5KLV D;  1AVY A;  3GF7 A;  2HFE D;  5APV A;  1JNM A;  2IBZ E;  1SQV K;  2W6B A;  1BSN A;  1KZU B;  1SQP E;  2FBW C;  1HJB A;  1JCC A;  1N7S B;  3Q3D A;  3AEC C;  2Z4E A;  5CBN A;  1N8R Q;  1USE A;  4H44 C;  5L8R J;  1USD A;  1SQB E;  1P84 I;  1FZG A;  1EC5 A;  3SFD C;  3AEE C;  1YYC A;  2Y9Y A;  3L73 J;  3E1R A;  2OYI C;  3CX5 I;  4IOI H;  1T3U A;  1URQ D;  1LTJ C;  3GHG C;  2BAS A;  3P7K A;  1KIL C;  2W90 A;  5AVQ B;  2P2U A;  1IFJ A;  5CBO A;  1GK6 A;  2SPZ A;  4UB8 E;  2FYN B;  3MD0 A;  4WY4 C;  2ZYG A;  2E5T A;  2FYU E;  5KLV J;  3H32 A;  1JMM A;  1KFM A;  3C1L A;  3P8C E;  5CJ0 A;  1PGQ A;  3KZI E;  1KOR A;  1PP9 G;  2IBZ D;  3L37 A;  4JQ0 D;  2YIU C;  2ZAE B;  4DOJ A;  1GD2 E;  2FYZ A;  3CPW O;  1SQP D;  3HUS A;  2Q9I A;  1VQ9 P;  2K9J A;  1FZC C;  1PGP A;  2KLV A;  2W83 C;  2IX7 C;  3L71 E;  1CI6 B;  4K3A A;  1SQB D;  1VQ6 P;  2YO2 A;  3JSV C;  2OQQ A;  3BAT A;  1WMK A;  1LWU A;  5KAF E;  3JCU H;  3AEB C;  4IL6 H;  2R44 A;  5APY A;  3G4S P;  3G3Z A;  2KYV A;  1VQ4 P;  4HJG H;  2QA4 P;  2FXP A;  1J1E B;  2ZT9 C;  3L4F A;  1N7S A;  1OW8 A;  2XKM A;  1SQX G;  2N1T D;  5GTH H;  2NZ2 A;  1JY2 P;  1R8E A;  2B87 B;  2WSC H;  3VP9 A;  2XND H;  2IFN A;  4EOT A;  2CK3 H;  2IPP A;  2H43 A;  2FYU D;  1JY2 N;  4I1L A;  5BU5 A;  1G2C B;  2H7H A;  3FWL A;  2YO3 A;  3P8C D;  1SFC B;  1SQP J;  4I6M C;  3N4X A;  3ITK A;  3RK3 C;  3FGA D;  4RKU J;  1L0L J;  3MUD A;  2ZYD A;  4PD4 E;  1H88 A;  3Q5S A;  3G9R A;  5APT A;  5KJ7 A;  1SQB J;  5APQ A;  3U59 A;  1HVV A;  1FBM A;  2AEJ A;  3HUS C;  1FZB A;  3H1H G;  1JTH B;  1SQQ E;  4B86 A;  1U7J A;  3L71 D;  3IFM A;  2O3J A;  3I56 P;  1Q82 Q;  3EQ2 A;  3UIA A;  2Q3I A;  4HKZ H;  5CMZ A;  1N73 B;  1UIX A;  1NTM E;  5AW7 B;  3ZDM A;  3W68 A;  1LT9 B;  1LWU C;  3MHV A;  3W67 A;  3GLM A;  1VQ7 P;  3MTU E;  4D6T E;  1NHL A;  4PV1 D;  3CC2 P;  4ZKU A;  1URQ B;  2E75 B;  3EWK A;  1BCC G;  2M5A B;  2FYU J;  3PH0 A;  3L72 E;  1CI6 A;  1BDC A;  1NU1 K;  1RHZ B;  1CW5 A;  2ITA A;  3KDP B;  3ABV C;  2JO1 A;  2YKP A;  1H89 A;  2LXC B;  2K9Y A;  5BU8 B;  3CCS P;  1NVO A;  2OAR A;  2IYP A;  1DX7 A;  1YTZ T;  1IFM A;  3CL3 D;  2WMM A;  3G6E P;  4KJM A;  1DD3 A;  4PD4 D;  1QL2 A;  3C8V A;  4LGD E;  2H89 C;  3L71 J;  4Z1M H;  1KC8 Q;  4GOF A;  4YPC A;  5CCG D;  3MUD C;  2ZXE B;  1LTB C;  1LTT C;  3IAO A;  5KJ7 C;  2XV5 A;  2R32 A;  3LIE A;  1SQQ D;  2B88 A;  2B87 A;  2KOG A;  1L2P A;  2XNX A;  3CCV P;  2FYN C;  2LKM A;  3EFG A;  1NTM D;  4Y99 B;  2RKL A;  1SFC A;  1NTK E;  1JOC A;  3OAK A;  3FXE A;  2KXP B;  4D6T D;  2R3S A;  2E76 B;  5GTI H;  4DT0 A;  2N1T B;  2Z5H A;  4HYT B;  1JTH A;  3SSU A;  1QEX A;  3IR9 A;  3L75 E;  2FKW B;  2P1J A;  1KB9 H;  1N73 A;  1KV4 A;  1YTZ I;  1EXI A;  1LNQ A;  1ZRT E;  2HR3 A;  2JDI H;  3H1L E;  1NTK K;  2O01 N;  1LT9 A;  1JMB A;  1EDJ A;  3V2R A;  1S3J A;  1URQ A;  2NPS D;  1M57 D;  1M7L A;  1NOH A;  1SQQ J;  1KQF B;  3PHL A;  1CZQ A;  3SWY A;  1J1E C;  2WSS H;  2M5A A;  2GUV A;  1LTS C;  2R5D A;  1YHQ P;  3RGU A;  1FOS E;  3KHU A;  1BGY E;  1NTM J;  4WWI A;  1HUC A;  3H6P A;  5CCH D;  3R4Y A;  4QMA A;  1HF9 A;  1Y47 A;  1S5L H;  1RQU A;  4D6T J;  3MP7 B;  2V4H A;  1Q7Y Q;  3LW5 J;  1FJK A;  3OW2 O;  1NTK D;  1AFO A;  1FAV A;  2KZJ A;  4OGQ D;  2CPB A;  2AXC A;  3H1K E;  4WVZ A;  2BCC G;  1SFC C;  3KYQ A;  2W6A A;  4PV1 B;  2HYN A;  3JCU E;  4IL6 E;  4JPZ B;  4N78 E;  1A02 J;  2OTJ P;  1FS0 E;  1QL1 A;  1EDI A;  2QG4 A;  3BRV B;  1L0N D;  1IO4 A;  1GW3 A;  1QGK B;  3L75 D;  2KIK A;  5GTH E;  3H1I E;  3TK1 A;  3L74 G;  1HWT C;  3CCU P;  2WZ7 A;  1ZRT D;  3H1L D;  3D70 A;  4BWN A;  1N73 C;  5KLV K;  3BCC E;  1FDI A;  2J59 M;  1LT9 C;  1EZV G;  1SQV G;  2C9N Y;  2HG5 D;  2KB7 P;  2W27 A;  2WSF H;  1URQ C;  2N1T A;  3A7O A;  2E75 C;  3WMM 0;  1KQL A;  2H88 C;  3S4R A;  1PIX A;  4GOE A;  1ZLL A;  1BGY D;  2R3C A;  4PD4 I;  3CCR P;  1HJ0 A;  4JYB A;  2V7Q H;  1RE4 A;  3JC2 2;  3TGU G;  3BRT B;  4OH8 B;  5E79 H;  3CME P;  3E7K A;  1R5L A;  1J2J B;  3H1K D;  3II6 A;  3SWF A;  3VMZ A;  2I1K A;  3A5T A;  1NKN A;  1L0N J;  4N78 D;  4RJT A;  3L75 J;  3V2Q A;  2WPR A;  1OW6 A;  1L0L E;  1PPJ G;  3HE4 B;  1IFP A;  3H1L J;  2NRG A;  1VF5 D;  1JM0 A;  1E5W A;  2Y9Z A;  3H1I D;  1X8Y A;  1ZOY C;  1M1J B;  3T97 B;  3TDK A;  5AW1 B;  2J5U A;  3BCC D;  1NTZ D;  4Y99 C;  1H8A A;  2OGU A;  5AVS B;  2AEM A;  1SQP K;  2YKQ A;  3IN6 A;  2A45 I;  5APW A;  1GW4 A;  1MUU A;  3HD7 C;  1FU1 A;  1ZN5 A;  1BGY J;  2E76 C;  1L0L K;  5APU A;  3AEF C;  1TU3 F;  2M3B A;  1KYO H;  2FXO A;  1SQB K;  1VQ5 P;  1IK9 A;  1IFD A;  3RBZ A;  1K05 A;  2IZ1 A;  3H1K J;  1PGJ A;  1RF1 B;  1N86 A;  1X9V A;  1MFZ A;  1OW7 A;  1FDM A;  4JBZ A;  3VMX A;  1RE4 C;  2D2C D;  4OGQ B;  2QE7 H;  1FZA A;  1GK4 A;  2B89 A;  4H13 D;  5CCG A;  1PZQ A;  3AE1 C;  2OYH B;  3H1I J;  1L0L D;  4I7Z B;  5GTI E;  1PP9 E;  1FOS F;  3MZW B;  3P8M C;  1G1I A;  2WSC J;  2FYU K;  1OWA A;  4EI2 A;  4LC1 A;  3BCC J;  5AW2 B;  1NTZ J;  2N9B A;  1S1C X;  5APS A;  5AW0 B;  3L74 J;  1LP1 B;  1KB9 E;  2G8Y A;  1JY3 P;  2K3R A;  4GKG A;  1NO4 A;  1GL2 B;  1K73 Q;  1QX8 A;  2QM7 A;  2RN0 A;  1WT6 A;  4R4M A;  4PV1 C;  1JY3 N;  3A2A A;  2Q6Q A;  5AW5 B;  2PFX A;  3L70 G;  3HE4 A;  4AQR D;  1KIL D;  2ZXX A;  2WWW A;  3V2P A;  2QJP B;  1M1J A;  4GDO A;  1SQX E;  3T97 A;  1PL5 A;  2ZVN B;  2WQY C;  4WY4 D;  2HPC B;  1JO5 A;  1J1D B;  2QJY B;  3M9B A;  1S5L E;  2JJL A;  5TIS H;  2O1K A;  4YXW H;  1IFN A;  3V4Q A;  2JP3 A;  2N9Y B;  1N2D C;  2Y0C A;  1ZR4 A;  4CPG A;  2I1J A;  3TSI A;  2K1A A;  1FC2 C;  2XZR A;  1Q86 Q;  1PGO A;  2WVR A;  3AEA C;  1PP9 D;  5BVZ A;  1VF5 B;  1NU1 G;  5B66 H;  1YJ9 P;  5CCH A;  3WUT A;  2P67 A;  1RF1 A;  4XE5 B;  3K5B A;  5KTB A;  3H1J G;  3H1H E;  2WSE H;  2KP8 A;  1KB9 D;  4YXD C;  2LXB A;  5AVT B;  3USS A;  3QH9 A;  1NYH A;  3PLN A;  1JCD A;  1VPC A;  5K5G B;  2PP6 A;  4KT0 J;  2OYH A;  5TJH A;  3CWB G;  1SQQ K;  3SWK A;  1N7S C;  3L72 G;  1Y9B A;  2ZT9 D;  3PP5 A;  2E74 D;  1EQ7 A;  5AW6 B;  4GOD A;  4OVN F;  2W8Z A;  4L75 A;  1IJD B;  1NTM K;  3HTK B;  5CJ4 A;  3GMA A;  1GZL A;  1SQX D;  1BCC E;  1X0T A;  5AVW B;  1U7M A;  1LP1 A;  1M1J C;  1ZP0 C;  2D2C B;  2JWA A;  3M0A A;  3FX0 A;  1KFN A;  1GL2 A;  3WU2 H;  2AXT H;  1PP9 J;  1YIT P;  3GG2 A;  4H13 B;  3R2P A;  2K37 A;  2YNY A;  3M06 A;  2KNC B;  3NMD A;  4UB8 H;  3AE3 C;  3V5B A;  4EYY Q;  1MZ9 A;  1G2C A;  3VP8 A;  2C0W A;  4PJ0 H;  2HPC A;  3H1H D;  1RF1 C;  2QRX A;  1BE3 G;  3B5N D;  4U7J A;  1LTG C;  2A06 G;  1Q2N A;  4XA4 A;  4OGQ C;  4GIF A;  1RQV A;  2K88 A;  4IFM A;  5AVU B;  4C7R A;  1M1K Q;  3VMY A;  1SQX J;  3AE8 C;  1T2K D;  4L74 A;  2OYH C;  1L0N E;  4I7Z C;  1SP4 A;  3G71 P;  1N7L A;  1E79 H;  3CXH H;  1DIP A;  1HGZ A;  3BAS A;  1DH3 A;  3RK2 D;  1BCC D;  2ZJS E;  4WY4 B;  2WPS A;  3RBX A;  1OX3 A;  3L73 G;  1AV1 A;  3B8E B;  1X22 A;  4IL6 X;  1GL2 C;  2H8P D;  1NJI Q;  1OVR A;  2BEQ D;  4NPF X;  1L0N K;  4U3F G;  5KAI H;  1RY3 A;  1KQS O;  2MJZ A;  3IF4 A;  4L76 A;  3H1H J;  3HTK A;  1VQO P;  1RH5 B;  1FZC B;  2QJP C;  1NU1 J;  1VQL P;  2Q3E A;  2QIW A;  2QSI A;  1VL2 A;  5KLV G;  2YMY A;  2PGD A;  1S2E A;  3H1J J;  3F89 A;  1J1D C;  2QJY C;  2KI7 B;  1M90 Q;  3S9O A;  5DJT B;  4TT3 H;  2WSF J;  3P32 A;  1T6A A;  1NWQ A;  2ZFC A;  4UB6 H;  4EDF A;  2KSJ A;  1YI2 P;  2KUB A;  3TNU B;  1KB9 I;  3KPE A;  3VOP A;  2VRS A;  2KNC A;  2BCC E;  1BCC J;  2E74 B;  2OTK E;  4R4L A;  1L4A D;  2Z5I A;  1QVF O;  2IFM A;  1VF5 C;  2V7Q J;  5AW9 B;  2JR8 A;  2L5G B;  4OWF A; 
#chains in the Genus database with same CATH homology
 5APT A;  3M9Q A;  3U1C A;  5KJ7 A;  5APQ A;  3U59 A;  1HVV A;  1G1J A;  1FBM A;  1LTJ B;  3GHG B;  4C46 A;  3NTN A;  3HUS C;  1FZB A;  3HD7 B;  1KIL B;  1N86 A;  1X9V A;  4WB4 A;  1MFZ A;  3U1A A;  1GU4 A;  1RF1 B;  4W80 A;  1JUN A;  1FDM A;  1JTH B;  4B86 A;  2CPS A;  1HGV A;  3IFM A;  3HE5 B;  3VMX A;  1N7S D;  3EQ2 A;  1RE4 C;  5AW3 B;  1MV8 A;  3UIA A;  1VDF A;  2Q3I A;  3A3Y B;  5CMZ A;  1N73 B;  1L4A C;  5AW4 B;  1RF0 A;  5AW7 B;  1FZA A;  1GK4 A;  1RE3 A;  1LT9 B;  3N7N A;  1LWU C;  1A02 F;  4JYC A;  5CCG A;  2WT7 A;  2C9L Y;  2OYH B;  3MTU E;  1NHL A;  4N6J A;  5AVR B;  1FOS F;  3P8M C;  1G1I A;  1NTZ K;  4WY4 A;  4ZKU A;  1URQ B;  2XDJ A;  2YKO A;  2FFD A;  2FYU K;  1OWA A;  4LC1 A;  1NH4 A;  2GUS A;  5AW2 B;  1WRG A;  3RL0 D;  2N9B A;  3B5N B;  2O01 H;  5AVX B;  5APS A;  5AW0 B;  1CI6 A;  3M0D A;  1NU1 K;  2HLO A;  1SFC D;  1CW5 A;  2PAJ A;  2POH A;  3KDP B;  5KJ7 D;  2YKP A;  1H89 A;  1S9K D;  1JY3 P;  1FJP A;  3V4W A;  4JF7 A;  3M91 A;  4GKG A;  1NO4 A;  1GL2 B;  5BU8 B;  2QM7 A;  3I5C A;  1Z56 A;  1WT6 A;  5AVY B;  1JY3 N;  2OAR A;  1FZC A;  3A2A A;  5AVZ B;  2GM4 A;  5AW5 B;  1DX7 A;  1YTZ T;  1IFM A;  3HE4 A;  3CL3 D;  4AQR D;  4ZKP A;  1KIL D;  3RK2 B;  3RL0 C;  1QL2 A;  2WWW A;  4LGD E;  4EIJ A;  3V2P A;  5CCG D;  4I2L C;  1DEB A;  2ZXE B;  1LTB C;  1M1J A;  1LTT C;  3VTP C;  3T97 A;  5KJ7 C;  2XV5 A;  2R32 A;  3LIE A;  2NPS B;  1HTL C;  3LID A;  4WY4 D;  2KOG A;  5AW8 B;  2HPC B;  1JO5 A;  1J1D B;  1NKZ B;  3M9B A;  3TNU A;  1XTC C;  2XNX A;  3TYY A;  2JJL A;  3NXS A;  2HOD B;  2O1K A;  4KHX A;  1IFN A;  2LKM A;  1LGH B;  3V4Q A;  3EFG A;  2N1T C;  1N2D C;  4Y99 B;  1ZR4 A;  5AVV B;  1SFC A;  3O8Z A;  2I1J A;  3KQG A;  3TSI A;  1RF0 C;  2WTY A;  1AQ5 A;  1JOC A;  3OAK A;  2XZR A;  1RE3 C;  4AUW A;  1T8Z A;  2E43 A;  1LTA C;  2R5B A;  3H32 B;  2OYI A;  4W7Z A;  3L35 A;  5BVZ A;  3LW5 H;  5CCH A;  3RK3 B;  1LTJ A;  3GHG A;  5CHX A;  1ZV8 A;  3C9I A;  3CI9 A;  2N1T B;  2P67 A;  1KIL A;  3HD7 A;  1RF1 A;  4XE5 B;  2Z5H A;  2FFD C;  4HYT B;  5KTB A;  1JTH A;  4IFD K;  1GL2 D;  2WSE H;  2KP8 A;  3HE5 A;  3CLQ A;  2FXM A;  3HUS B;  3IR9 A;  2FKW B;  2P1J A;  4DZO A;  1N73 A;  1YTZ I;  3M0D C;  2A45 H;  4WBA A;  3OA7 A;  5AVT B;  1NTK K;  1LT9 A;  1W2E A;  1JCD A;  1VPC A;  1GDT A;  1L4A B;  2PP6 A;  1OXZ A;  2OYH A;  3V2R A;  1T3J A;  4GT1 A;  1XTG B;  1SQQ K;  1N7S C;  1LWU B;  1URQ A;  2M8R A;  3PP5 A;  1EQ7 A;  5AW6 B;  2NPS D;  1M7L A;  1NOH A;  1X79 B;  3M9H A;  1HH0 A;  1CZQ A;  3SWY A;  1GU5 A;  1J1E C;  1ZR2 A;  3B5N A;  2HFE D;  1IJD B;  3HTK B;  1NTM K;  5APV A;  3VYI A;  2Q5U A;  2GUV A;  5CJ4 A;  1JNM A;  1SQV K;  4W7Y A;  1LTS C;  1GZL A;  2R5D A;  2W6B A;  1FOS E;  1KZU B;  3V2N A;  5AVW B;  1CSB A;  1M1J C;  3BVH A;  1HJB A;  1HUC A;  1JCC A;  3H6P A;  5CCH D;  4C7N B;  1N7S B;  4HH2 A;  4O9B A;  2Z4E A;  3M0A A;  3HD7 D;  1KFN A;  2XU6 A;  1GL2 A;  1FJK A;  1FZG A;  1AFO A;  1FAV A;  2CPB A;  3R2P A;  2YNY A;  3M06 A;  1SFC C;  2O1J A;  3KYQ A;  1SVF A;  2W6A A;  2HYN A;  1YYC A;  3NMD A;  1SLQ A;  4N78 E;  1JY3 O;  2OYI C;  1IC2 A;  3V5B A;  1A02 J;  3RL0 B;  1MZ9 A;  1G2C A;  1QL1 A;  1T3U A;  3VP8 A;  2C0W A;  2NPS A;  1FZF A;  1URQ D;  1LTJ C;  2HPC A;  3GHG C;  3BRV B;  2BAS A;  1IFI A;  3P7K A;  1IO4 A;  1PFI A;  1GW3 A;  1KIL C;  1RF1 C;  5AVQ B;  2E42 A;  2P2U A;  1IFJ A;  3TK1 A;  2HOD A;  3B5N D;  1HWT C;  1LTG C;  2WZ7 A;  1JY2 O;  5CCG C;  1GK6 A;  4XA4 A;  1LTI C;  1GTW A;  4GIF A;  1N73 C;  5KLV K;  2J58 A;  4IFM A;  5AVU B;  3MD0 A;  1SQX K;  2J59 M;  4C7R A;  4WY4 C;  1NAF A;  1LT9 C;  3H32 A;  3VMY A;  1JMM A;  2C9N Y;  2WPQ A;  1KFM A;  2HG5 D;  1T2K D;  2KB7 P;  2W27 A;  2OYH C;  3P8C E;  2WSF H;  5CJ0 A;  1SP4 A;  1N7L A;  1URQ C;  2N1T A;  3A7O A;  1HGZ A;  2WT7 B;  3BAS A;  3WMM 0;  1KQL A;  3L37 A;  4LLH A;  1DH3 A;  3RK2 D;  4DOJ A;  1GD2 E;  1ZLL A;  2R3C A;  2FYZ A;  3B5N C;  2Q7C A;  4WY4 B;  3HUS A;  2Q9I A;  2FFD B;  2WPS A;  4JYB A;  3OJA B;  1FZC C;  1RE4 A;  2KLV A;  3B8E B;  3BRT B;  2IX7 C;  4OH8 B;  1CI6 B;  1L4A A;  2A45 G;  2YO2 A;  1GL2 C;  3BAT A;  1J2J B;  1T2K C;  2H8P D;  4M3L A;  3HRN A;  1LWU A;  1L0N K;  1HBW A;  3II6 A;  3SWF A;  1RY3 A;  3VMZ A;  2MJZ A;  2I1K A;  3A5T A;  1NKN A;  4N78 D;  3RK2 C;  3HTK A;  5APY A;  1FZC B;  3V2Q A;  2WPR A;  3G3Z A;  2KYV A;  3HE4 B;  3L36 A;  3NFQ A;  1J1E B;  1E5W A;  2YMY A;  2QM8 A;  3L4F A;  1N7S A;  3RK3 D;  4C7N A;  2C0X A;  2NPS C;  4IFF A;  2XKM A;  2N1T D;  2WIT A;  1X8Y A;  1J1D C;  1M1J B;  3P32 A;  1JY2 P;  1NWQ A;  2P7J A;  2ZFC A;  3MGN A;  5AW1 B;  5APX A;  2KSJ A;  2WSC H;  3VP9 A;  2IFN A;  4Y99 C;  1H8A A;  3TNU B;  4EOT A;  2IPP A;  5AVS B;  1S9K E;  2H43 A;  4N3Y B;  4AYC A;  1SQP K;  2YKQ A;  3KPE A;  3VOP A;  2VRS A;  5CCH C;  3E1I A;  1JY2 N;  4I1L A;  5BU5 A;  2A45 I;  5APW A;  1G2C B;  1GW4 A;  1MUU A;  2H7H A;  2YO3 A;  3HD7 C;  3P8C D;  1FU1 A;  1ZN5 A;  1SFC B;  1L4A D;  2JEE A;  2Z5I A;  4I6M C;  3N4X A;  1L0L K;  2IFM A;  5APU A;  2M3B A;  3VN0 A;  5AW9 B;  3RK3 C;  1SQB K;  4RES B;  1IK9 A;  1IFD A;  2L5G B;  3MUD A;  2OYI B;  1H88 A;  3MIW A;  1FZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...