2YO2A

Salmonella enterica sada 255-358 fused to gcn4 adaptors (sadak12)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIYSLSQSVADRLGGGASVNSDGTVNAPLYEVGTGIYNNVGSALSALNTSITNTEASVAGLAEDALLWDESISAFSASHTGNASKITNLAAGTLAADSTDAVNGSQMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
total genus 53
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo2A01
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo2A03
5AW0B 4B86A 2W27A 1X8YA 1HBWA 2Q5UA 3VMZA 3V5BA 2XZRA 2WT7A 1CI6A 4GKGA 1MV8A 4I2LC 3A2AA 2R32A 3NFQA 3VMXA 1H88A 3NTNA 4KHXA 1CZQA 2P2UA 1T2KC 1DH3A 1MFZA 2W6AA 2JJLA 2WT7B 4C46A 3O8ZA 5AW1B 1SLQA 1OXZA 1T2KD 1HJBA 2C9NY 3KDPB 1MUUA 5AVTB 4GT1A 2E43A 5AW3B 2C9LY 1CI6B 2Z5HA 3TK1A 2R5BA 4C7NB 1GZLA 2P7JA 5APXA 4HYTB 5APWA 5AVQB 5AW6B 3TYYA 3L35A 3LIEA 1H8AA 1IO4A 3VMYA 3L37A 3P7KA 1GU4A 2N9BA 2YO3A 4C7NA 2E42A 2WPQA 1FOSE 3TNUA 5AW4B 5CMZA 2Z5IA 4AYCA 3A5TA 1HUCA 2IPPA 3A3YB 1JNMA 3LIDA 4AUWA 2WWWA 3VTPC 4EOTA 5APSA 5AW2B 1KQLA 2R5DA 3SWFA 3A7OA 3M0AA 5APTA 1G2CB 1OWAA 1GK6A 2XV5A 3NXSA 4DZOA 2ZFCA 3M06A 2Q7CA 2R3CA 3UIAA 1J2JB 1JUNA 1FAVA 2ZXEB 3M9HA 3MGNA 1YYCA 2Q3IA 3OAKA 5APUA 1GD2E 1HWTC 3I5CA 2KP8A 1S9KE 1A02F 4AQRD 2QM7A 5AVVB 2YNYA 4JYBA 3P32A 3TNUB 2WPSA 5AVZB 5AVWB 3L36A 5AW8B 2BASA 1GU5A 1CSBA 5APQA 3HE5B 1GK4A 5AW5B 3T97A 5AVYB 4RESB 3M91A 3B8EB 4JYCA 5AW9B 4I6MC 5AW7B 1A02J 2P67A 3HE4B 3V4QA 1S9KD 3M0DA 3M9BA 4XE5B 5AVUB 3V4WA 3HTKA 3HE4A 1NAFA 3HE5A 1GTWA 1NWQA 3P8MC 4LC1A 5AVRB 2QM8A 2YO2A 5APYA 5AVXB 2WTYA 5AVSB 2H7HA 1H89A 3VYIA 3NMDA 3VN0A 2WPRA 3IR9A 5APVA 4M3LA 1SP4A 3MD0A 1FOSF 3KQGA 2XU6A 2VRSA
chains in the Genus database with same CATH superfamily
2FYUE 1X8YA 4WY4D 1KYOE 1OX3A 3T97B 2ITAA 5BVZA 3MTUE 3AEGC 4RJTA 1L4AD 4K3AA 3W68A 4PV1C 4DJGA 3FGAD 2B87B 1YI2P 1EQ7A 2SPZA 3AE8C 1NTKE 4GKGA 3GHGC 3HUSB 1SFCA 4I2LC 3A2AA 3NFQA 1KMIZ 1OVUA 3VMXA 4W80A 2QEXP 3Q5SA 1EZVE 1FS0E 1FDIA 3L74G 3GHGB 3ABVC 4UB8E 4GOEA 3RBXA 2JJLA 5CCGD 2L91A 3Q5PA 2K37A 4JQ0D 1M57D 5AW1B 5CCHA 4ZKUA 1GL2D 2N1TD 1N7SA 2I1JA 2V7QH 3AE2C 2H88C 4JBZA 4KT0J 1T2KD 2FYUG 1M1KQ 5KLVJ 2J58A 1JY2P 2BCCE 1SQQG 3L72G 5GTIE 2E43A 3CC2P 1SQQK 3H1KD 2QE7H 1NU1D 5KAIE 2C9LY 2Q1KA 2JWAA 2Z5HA 1VQ5P 5E79E 2D2CC 1SQQD 2R5BA 4N6JA 4C7NB 1W2BO 1KQFB 1RF0A 4HYTB 1RQVA 3M0DC 5APWA 2UWJE 1Y9BA 3GG2A 3FXDA 1XTCC 4Y28J 1PPJD 3CMEP 5CJ0A 2N9BA 3V2RA 4C7NA 1EDLA 2GA1A 2PFXA 2O1JA 2WVRA 3B5NA 3GF7A 1BGYJ 2HFED 3KZIH 5TJHA 3TNUA 2J5UA 3A5TA 1NTZE 1KC8Q 1FE6A 4PD4I 1D7MA 1ZV8A 3HTKB 1IK9A 2YXQB 1EZVI 1LT1A 3H1LD 4OGQB 1S5LX 1G2CA 4H44D 5B66H 3L72D 3PP5A 3CLQA 2KS1B 1LJ2A 2V4HA 3FXEA 4YPCA 4EOTA 1Q90D 4JF7A 1EXJA 2RMZA 1BE3G 5AW2B 1ZRTE 1RE4C 2KK7A 1SQQJ 3AE9C 1JO5A 4WY4B 1G2CB 2E76C 1N7SB 1BE3D 3EQ2A 3H1LJ 3R2PA 3HD7C 2C0WA 1J1DC 1FBMA 2R3CA 1P84D 2KIKA 3KYQA 1EZVG 2KI7B 1YYCA 2ZT9C 2E75B 3OAKA 3H1IE 2B9BA 3Q2YA 3HUSA 3CWBD 1BCCD 1NGMB 1HWTC 1X79B 3I5CA 1NTZJ 3GHGA 2H43A 1JY3N 3EFFK 3RL0C 4PD4E 5AVVB 2WSEJ 3AE4C 5KAFH 2Q9IA 1FZCC 2OQQA 1NTMJ 2P1JA 2YMKA 4GODA 5AVWB 4U3FG 3RL0D 4ASVA 2Y0DA 1AVOA 5CCGA 5L8RJ 1FZCA 5AW8B 2A06D 3CX5E 3AEAC 3SFDC 3WUVA 5KAIH 3W67A 1LP1B 1GK4A 3BASA 2XNXA 3T97A 1KV4A 1U7MA 3WUTA 3CCLP 1K05A 1KILD 2ZVNB 3M91A 1ZLLA 3B8EB 4KJMA 3L73E 4I6MC 1ZOYC 2BEZF 2MJZA 1FZFA 3V4QA 3GMAA 1S9KD 2YKOA 2AEMA 2D2CB 4ZNCA 5KJ7A 2Y9ZA 1N73B 3H1JG 4A7PA 5BU8B 1AQ5A 2PGDA 3CD6P 1DEEG 2E5TA 3M9BA 1Q7YQ 1FU1A 1NTZK 1NTZG 3IN6A 4NPDA 1P84H 4NPEA 3GW6A 3OJAB 3TGUE 3F89A 1L4AB 3KZIE 3O6QB 4BRYA 2OYHA 3OW2O 4LC1A 3CXHH 1NTMG 1U57A 3B71A 1J1DB 5AVRB 2H7HA 1S4XA 5AVSB 1L4AC 1SQBG 2WMMA 2AEFA 3H1JE 3L71J 3VYIA 4DT0A 2YKPA 3AEFC 3B5NC 1L0ND 4H13C 3RK2D 1EXIA 1OW8A 3I56P 4M3LA 5EFWB 2CPBA 1GMJA 3MD0A 3L71E 1SQVK 4NPFX 1QVGO 4IL6E 1FJKA 2FBWC 1BDDA 2XU6A 2YIUB 2E75D 2W90A 4Z1MH 1LP1A 2K9JA 1NU1J 2MKVA 3CWBJ 3P8CE 1PP9D 2FKWB 4U3FD 4B86A 1HBWA 1Q2NA 2IYOA 3L71D 1SQBE 3QH9A 3V5BA 2KLVA 1W5CE 3QWOC 1ZW0A 3H1JJ 1LTGC 1L0LE 2KNCB 1LNQA 4GOFA 1MV8A 1CW5A 3II6A 2R32A 5CHXA 1OW6A 1RY3A 2KUBA 3I55P 1LTAC 1VQ6P 1RHZB 3NTNA 5CJ4A 2KXPB 1RF1B 5H2FH 2WPVB 1BSNA 2WSFH 3H32A 1MFZA 2QG4A 3OA7A 3R4YA 1UIIA 1GL2A 4N78D 4YXWH 3TGUD 2WT7B 1YJWP 4HJGH 2K9JB 1IFDA 1SLQA 2HR3A 2IBZD 3IAOA 2Z4EA 3M9QA 2C9NY 3KDPB 1KILB 1MUUA 3WUUA 1ZXGA 4Y99C 2HYNA 4RO0A 4CPGA 3Q3DA 1RF1A 3USSA 1VF5D 3BATA 1JCDA 1QGKB 3EWKA 3L73J 3TK1A 2NPSD 3CXHD 3S1KA 2OYOA 3G4SP 1S2EA 3H25A 1SQPE 1SQVG 2HLOA 2M3EA 1KILE 1QEXA 4HKZH 5AW6B 3TYYA 5M1BA 3D71A 5GTHH 1H8AA 1E79H 2HODA 1W2EA 4ASWA 3C9IA 3L37A 3WMM0 1GW4A 1VQPP 1VQ7P 1IFIA 3MIWA 4TT3H 1FOSE 2PP6A 4DCKA 1NJIQ 1RH5B 2NZ2A 3B5ND 4H13D 4IL6H 2JO1A 1R5LA 2ZAEB 4N3YB 3RK2C 5B5EH 3RL0g 1FOSF 3LIDA 1SFCB 1X0TA 4I7ZC 3BRVB 1NTKK 1URQB 2L5GB 1FZGA 1YJ9P 3VTPC 3BCCE 4XA4A 1RE4A 3CWBE 1KQLA 2IZ1A 1MZ9A 3A7OA 5GTIH 1SQPG 1SQVE 3M0AA 2KOGA 3H1HJ 3ITKA 1VQLP 1QVFO 1GK6A 1MKMA 2P58A 3NXSA 1KZUB 4N78E 1SQPD 4DZOA 3M06A 3BVHA 3L70J 1N73A 1YBKA 1P84I 3UIAA 1J2JB 1J1EB 1SQVJ 3CXHE 1VQMP 1JUNA 3SWYA 1ZP0C 1BE3E 2O01H 1L0LK 3AE7C 1KQGB 2ZVOB 3JCUE 2Q3IA 3L74D 1T3JA 3KPEA 3JCUH 1L0LD 2R3SA 1LGHB 3CC4P 2IBZE 1VQOP 1Q82Q 2A45H 1WRGA 3N7NA 2HPCB 1NKNA 3JSVC 3HRNA 3N4XA 3AE3C 4WWIA 2W6JH 2OTLP 3P32A 3L36A 2KZJA 5B5EE 3LW5J 5GTHE 1MFTA 1L0NE 2N1TC 2BASA 1KB9D 2NPSB 1KB9E 1VQ9P 5APQA 2FYNC 3A0BE 3CCVP 3D6YA 2AXCA 3IFMA 5AW5B 2IYPA 2I8DA 1SQBD 5TISE 1L0NJ 2Y0CA 1JEKA 4RESB 1LT9B 5AVYB 1PP9E 4ZMDA 3P8CD 4U3FE 1PL5A 3L70G 4EDFA 4RKUJ 3CCEP 3E1RA 3MUDC 1FZEA 2P67A 5KJ7C 2HODB 2XNDH 1M1JA 1RF0C 3RK2B 4D6TJ 3B4SA 1FZAA 1NTMK 2BCCD 3M0DA 3MHVA 4IOIH 1AJYA 4I7ZB 4R4MA 1URQC 2YXRB 3L74E 2O3JA 3L75G 1NYHA 3H1JD 4OGQC 1NAFA 1K73Q 2YIUC 3HE5A 2FXPA 2QIWA 1NWQA 1JTHA 3P8MC 1ZMEC 1TU3F 3FWNA 1EZVD 1RE3C 2JP3A 4H44C 1SQVD 2IFNA 2WTYA 1H89A 2E76B 1NTKD 1PGJA 2M8RA 3BCCD 3PHLA 2A06E 3CX5D 2KLUA 2WQYC 5DJTB 3E7KA 1USEA 1FZCB 2BCCJ 4O9BA 2IX7C 5H2FE 3KQGA 3SWKA 1NOHA 4WY4A 2WITA 2RKLA 5AW0B 3L73D 1N8RQ 5B66E 1KD1Q 1JTHB 1DH3A 1DD4A 1WT6A 4L76A 5BU5A 2O01J 3PTZA 2B89A 1SQXJ 1GW3A 1JCCA 1N7SC 2XZRA 1FZBA 2OGUA 3L4FA 4WVZA 2WSEH 3TDKA 2WT7A 3G6EP 1R8EA 1VQ4P 1QX8A 1X22A 4PV1B 2XDJA 1H88A 4I1LA 4KHXA 1CZQA 1HVVA 2QSIA 2H89C 1GL2C 1T2KC 2RN0A 1ZR4A 2W6AA 1NAYA 1L0LG 3SFEC 5CCHD 1N7LA 3MUDA 3O8ZA 4HB1A 3CCRP 3H1IG 3G3ZA 1HJBA 4BRYB 3TSIA 3V2QA 5CCGC 3L75D 3G9RA 3MP7B 2ZYAA 3CCQP 1BE3J 4GT1A 3VP9A 1FJPA 1DD3A 2NPSA 3CCJP 1JOCA 1GL2B 2BCCG 2CPSA 2E74D 3L72E 5AW3B 1URQD 3TF5A 3H1LE 3AE6C 1P84E 1GZLA 5KLVE 3CCUP 5APXA 1AVYA 1NTZD 2DW3A 3V6IA 3S9OA 1PPJG 5CBOA 4YTPC 4UB8H 3CX5H 3L35A 1N86A 3LIEA 1M1JC 1YQ4C 1YHQP 1ZRTD 3AEDC 4U7JA 2YO3A 3AE1C 3ZDMA 3CX5I 2K9YA 2E42A 5KAFE 1KB9I 2H8PD 2P10A 1JB0J 2KS1A 1EC5A 1IFJA 1NO4A 2Z5IA 1DEBA 5CMZA 2GUSA 2JEEA 2K1AA 1JNMA 1L0LJ 1Q81Q 3H1KE 2QJKB 4AUWA 2WZ7A 3V2PA 1HJ0A 2WWWA 2WSCH 4U3FJ 4EIJA 3H1IJ 1G1IA 1X9VA 1JM0A 5APSA 2FYUJ 4H44B 1PPJE 3HUSC 4UB6H 3SWFA 3L72J 3CCSP 1KTMA 2POHA 1LTJA 2OYIA 2OTJP 1OWAA 2G8YA 2ZYDA 2XV5A 2IZ0A 5KLIB 4L74A 2FYZA 3Q1MA 1IO4A 2V7QJ 2QJPB 4WY4C 1NKZB 1SQQE 2FYNB 3BCCG 1LTSC 3RGUA 4DOJA 1HTLC 2KSJA 2ZXXA 3M9HA 3MGNA 4PV1D 1VQ8P 4PJ0H 3TGUG 3D70A 1SFCC 2LR2A 3AEEC 3H1KG 1GD2E 2ZJSE 2R44A 1BGYG 1JY3O 2KP8A 4BXLA 1S9KE 1KYOD 1BCCG 4AQRD 1DIPA 2FYUD 3MZWB 2YNYA 4JYBA 4WB4A 2K88A 1HGZA 1KQSO 2YMYA 1Q86Q 2WPSA 5AVZB 2M5AB 2W8ZA 1E5WA 1KYOI 2KSEA 5KKZC 2E74B 3K5BA 2OTKE 2W83C 2FYUK 1SS1A 1UIXA 2W6BA 2XKMA 1IK7A 3L71G 4W7ZA 1FDOA 2E5YA 1J1EC 2AEJA 1S5LH 2C0XA 1URQA 4OGQD 1G1JA 1KILA 1RF1C 2N9YB 3RBZA 1AA0A 1LWUC 4HH2A 3H1LG 5KLVK 1LWUA 4L73A 4JYCA 2JKVA 5AW9B 1KORA 2JDIH 4PD4D 1H0TA 1A02J 1HF9A 3CWBG 2QJKC 3S4RA 3BCCJ 1NVOA 1OIPA 2JWDA 3CXHI 4Y99B 1YJNP 1QL2A 2OYHB 1JMBA 1BCCE 4OH8B 3CC7P 4OVNF 1AFOA 3TGUJ 1LWUB 1YTZI 3H1ID 1JY2N 3KXDA 3H1KJ 2A45G 4L75A 3V4WA 1SQXD 2I1KA 3HTKA 3AEBC 3HE4A 4H0LD 1BCCJ 1LTJC 2A45I 5E79H 3U1AA 2OYIC 1ZN5A 1KN7A 1T6AA 4H0LC 5TISH 1S1CX 1Z56A 1AV1A 4IFFA 3HD7D 1OMIA 2YO2A 5APYA 3GLMA 2QJPC 5AVXB 2HPCA 3FX0A 2IDBA 1QL1A 3D6ZA 3VN0A 1PGQA 1VPCA 1KYOH 1PV3A 2OARA 2PAJA 3O6QA 2Q3EA 5APVA 3PJSK 3AECC 3VP8A 1SQPK 2J59M 1SP4A 2YKQA 3L73G 1K8AQ 3H32B 3RL0B 1JMMA 3CMAP 2VRSA 1SVFA 1OFCX 2W27A 4GIFA 1IJDB 2GUVA 2Q5UA 3CL3D 1L4AA 3RK3D 2BEQD 1FC2C 1HGVA 3B5NB 4H13B 3VMZA 3VMAA 3U1CA 2FFDB 2CK3H 1LT9C 3G71P 1S72P 1SFCD 1CI6A 3A0BH 1HH0A 4PD4H 1DX7A 2D2CD 4D6TD 2GM4A 2P2UA 2FFDC 2KYVA 2M0BA 1LTTC 3A0HE 4OWFA 1NU1E 4W7YA 1M8OB 4C46A 3AE5C 4JPZB 1IFPA 1OXZA 1SQBJ 1T3UA 3L70D 1PFIA 2Y9YA 2QA4P 5AVTB 2N1TA 3F5HA 1VL2A 4YXDC 4UB6E 1SQPJ 3CI9A 1IZNB 1R5SA 1USDA 3H1HG 3Q5RA 1CI6B 1KILC 1OVVA 1BGYD 1IFNA 1NU1K 1M7LA 2AXTE 2P7JA 1NU1G 2QJYB 1IC2A 4IFDK 1H0TB 5CCHC 5AVQB 3C8VA 2HG5D 3U59A 4H0LB 4TLFA 5KLIC 2LXBA 3VMYA 3P7KA 1U7JA 1GU4A 2WSSH 1OW7A 4GDOA 2WPQA 1BSHA 5AW4B 3HD7B 4QMAA 2E74C 2M5AA 4AYCA 4MN4C 3PRJA 1HUCA 2IPPA 1L2PA 3A3YB 1M56D 3LW5H 1BGYE 3PH0A 1Y8AA 4XFJA 2O1KA 2FY8A 1EDJA 1RQUA 2E75C 2WSFJ 2ZT9D 3H1HD 3PLNA 1PIXA 1PP9G 2B88A 3L70E 2PRRA 2R5DA 1OZHA 3RK3B 5APTA 4WBAA 1M1JB 1OVRA 3IF4A 5KKZB 3BRTB 2G3AA 1QLED 2ZFCA 4R4LA 2Q7CA 1NTME 1XTGB 3RK3C 3CPWO 1FAVA 3FWLA 1VF5B 1EDIA 2ZXEB 4LGDE 4D6TG 2WSCJ 1LTJB 4C7RA 2OYIB 1EDKA 1JY3P 1AQTA 1S3JA 1K04A 4LLHA 5APUA 4K35A 1NHLA 1WMKA 3H6PA 3L75J 2KNCA 2IBZG 1A02F 3EFGA 1YITP 2E76D 1LTBC 2QM7A 1VQNP 1VF5C 5C39A 1VDFA 2Q6QA 1PGPA 1K9MQ 2O01N 3TNUB 4D6TE 1IFMA 1N7SD 1NTKJ 1YTZT 1YIJP 1LT9A 1S5LE 2FXOA 3C1LA 3GF3A 2NRGA 1CSBA 1PP9J 1GU5A 1KFMA 1SQBK 3HE5B 5CBNA 4IL6X 2A06G 4PJ0E 3SSUA 1M90Q 2JR8A 2N1TB 3CCMP 2NPSC 2FFDA 1GDTA 2K3RA 3JC22 3RK3E 5AW7B 5KLVD 2B87A 2QRXA 3HE4B 2AXTH 4ZKPA 2LKMA 1N2DC 2M3BA 1SQXG 5KJ7D 1SQXK 2KB7P 3V2NA 3L75E 4XE5B 1Y47A 5AVUB 1PZQA 1KB9H 2QVAA 2RH0A 5K5GB 1GTWA 4IFMA 5KTBA 2ZT9B 1NTMD 4EI2A 2FXMA 3L74J 3HD7A 3WU2H 2KZIA 3A0HH 3E1IA 1VQKP 1NTKG 2QM8A 2Y0EA 4BWNA 1SQXE 2IFMA 2LXCB 3NMDA 1BDCA 1JY2O 2IBZI 2WPRA 3IR9A 2QJYC 1YQ3C 3H1HE 3VOPA 4EYYQ 5KLVG 1ZR2A 3WU2E 1FDMA 1L0NK 3KHUA 1L0NG 1NH4A 1PGOA 1KFNA 1N73C 1T8ZA 2ZYGA 2OYHC 1LTIC 1RE3A 5DJUB
chains in the Genus database with same CATH topology
1X8YA 4WY4D 5BVZA 3MTUE 1L4AD 1EQ7A 4GKGA 3GHGC 3HUSB 1SFCA 4I2LC 3A2AA 3NFQA 3VMXA 4W80A 3GHGB 2JJLA 5CCGD 5AW1B 5CCHA 4ZKUA 1GL2D 2N1TD 1N7SA 2I1JA 1T2KD 2J58A 1JY2P 2E43A 1SQQK 2C9LY 2Z5HA 2R5BA 4N6JA 4C7NB 1RF0A 4HYTB 3M0DC 5APWA 1XTCC 5CJ0A 2N9BA 3V2RA 4C7NA 2O1JA 3B5NA 3TNUA 2HFED 3A5TA 1ZV8A 3HTKB 1IK9A 1G2CA 3PP5A 3CLQA 4EOTA 4JF7A 5AW2B 1RE4C 4WY4B 1G2CB 1N7SB 3EQ2A 3R2PA 3HD7C 2C0WA 1J1DC 1FBMA 2R3CA 3KYQA 1YYCA 3OAKA 3HUSA 1HWTC 1X79B 3I5CA 3GHGA 2H43A 1JY3N 3RL0C 5AVVB 2Q9IA 1FZCC 2P1JA 5AVWB 3RL0D 1FZCA 5CCGA 5AW8B 1GK4A 3BASA 2XNXA 3T97A 1KILD 3M91A 1ZLLA 3B8EB 4I6MC 2MJZA 1FZFA 3V4QA 1S9KD 2YKOA 5KJ7A 1N73B 5BU8B 1AQ5A 3M9BA 1FU1A 1NTZK 3OJAB 2OYHA 1L4AB 4LC1A 5AVRB 1J1DB 2H7HA 5AVSB 1L4AC 3VYIA 2YKPA 3B5NC 3RK2D 4M3LA 2CPBA 3MD0A 1FOSF 1SQVK 1FJKA 2XU6A 4B86A 3P8CE 2FKWB 1HBWA 3V5BA 2KLVA 1LTGC 1MV8A 1CW5A 3II6A 2R32A 5CHXA 1RY3A 1LTAC 3NTNA 5CJ4A 1RF1B 2WSFH 4N78D 3H32A 1MFZA 3OA7A 1DH3A 2WT7B 1GL2A 1IFDA 1SLQA 2Z4EA 3M9QA 2C9NY 3KDPB 1KILB 1MUUA 4Y99C 2HYNA 1RF1A 3BATA 1JCDA 3TK1A 2NPSD 2HLOA 5AW6B 3TYYA 1H8AA 1IO4A 2HODA 1W2EA 3C9IA 3L37A 3WMM0 1GW4A 1IFIA 3MIWA 1FOSE 2PP6A 3B5ND 4N3YB 3RK2C 3LIDA 1SFCB 3BRVB 1NTKK 1URQB 2L5GB 1FZGA 3VTPC 4XA4A 1RE4A 1KQLA 1MZ9A 3A7OA 3M0AA 2KOGA 1GK6A 3NXSA 4N78E 1KZUB 4DZOA 3BVHA 3M06A 1N73A 3UIAA 1J2JB 1J1EB 1JUNA 3SWYA 2O01H 1L0LK 2Q3IA 1T3JA 3KPEA 1LGHB 2A45H 1WRGA 3N7NA 2HPCB 1NKNA 3HRNA 3N4XA 3P32A 3L36A 2N1TC 2BASA 2NPSB 5APQA 3IFMA 5AW5B 5AVYB 4RESB 1LT9B 3P8CD 1FZEA 2P67A 5KJ7C 2HODB 1M1JA 1RF0C 3RK2B 1FZAA 1NTMK 3M0DA 1URQC 1NAFA 3HE5A 1NWQA 1JTHA 3P8MC 1RE3C 2IFNA 2WTYA 1H89A 2M8RA 1FZCB 4O9BA 2IX7C 3KQGA 1NOHA 4WY4A 2WITA 5AW0B 1JTHB 1WT6A 5BU5A 1GW3A 1JCCA 1N7SC 2XZRA 1FZBA 2WT7A 3L4FA 1JO5A 2WSEH 2XDJA 1H88A 4I1LA 4KHXA 1CZQA 1HVVA 1GL2C 1T2KC 1ZR4A 2W6AA 5CCHD 1N7LA 3MUDA 3O8ZA 3G3ZA 1HJBA 3TSIA 3V2QA 5CCGC 4GT1A 3VP9A 1FJPA 2NPSA 1JOCA 1GL2B 2CPSA 5AW3B 1URQD 1GZLA 5APXA 3L35A 1N86A 3LIEA 1M1JC 2YO3A 2E42A 2H8PD 1IFJA 1NO4A 2Z5IA 1DEBA 5CMZA 2GUSA 2JEEA 1JNMA 4AUWA 2WZ7A 3V2PA 2WWWA 2WSCH 4EIJA 1G1IA 1X9VA 5APSA 3HUSC 3SWFA 2POHA 1LTJA 2OYIA 1OWAA 2XV5A 2FYZA 4WY4C 1NKZB 1LTSC 4DOJA 1HTLC 2KSJA 3M9HA 3MGNA 1SFCC 1GD2E 1JY3O 2KP8A 1S9KE 4AQRD 2YNYA 4JYBA 4WB4A 1HGZA 2YMYA 2WPSA 5AVZB 1E5WA 2FYUK 2W6BA 4W7ZA 2XKMA 1J1EC 2C0XA 1URQA 1G1JA 1KILA 1RF1C 1LWUC 4HH2A 5KLVK 1LWUA 4JYCA 5AW9B 1A02J 4Y99B 1QL2A 2OYHB 1AFOA 4OH8B 1LWUB 1YTZI 1JY2N 2A45G 3V4WA 2I1KA 3HTKA 3HE4A 1LTJC 2A45I 3U1AA 2OYIC 1ZN5A 1Z56A 4IFFA 3HD7D 2YO2A 5APYA 5AVXB 2HPCA 1QL1A 3VN0A 1VPCA 2OARA 2PAJA 5APVA 3VP8A 1SQPK 2J59M 1SP4A 2YKQA 3H32B 3RL0B 1JMMA 2VRSA 1SVFA 2W27A 4GIFA 1IJDB 2GUVA 2Q5UA 3CL3D 1L4AA 3RK3D 3VMZA 3B5NB 1HGVA 3U1CA 2FFDB 1LT9C 1SFCD 1CI6A 1HH0A 1DX7A 2GM4A 2P2UA 2FFDC 2KYVA 1LTTC 4W7YA 4C46A 1OXZA 1T3UA 1PFIA 5AVTB 2N1TA 3CI9A 1CI6B 1KILC 1IFNA 1NU1K 1M7LA 2P7JA 1IC2A 4IFDK 5CCHC 5AVQB 3U59A 2HG5D 3VMYA 3P7KA 1GU4A 2WPQA 5AW4B 3HD7B 4AYCA 1HUCA 2IPPA 3A3YB 3LW5H 2O1KA 2R5DA 3RK3B 5APTA 4WBAA 1M1JB 3BRTB 2ZFCA 2Q7CA 1XTGB 3RK3C 1FAVA 4LGDE 2ZXEB 4C7RA 1LTJB 2OYIB 1JY3P 4LLHA 5APUA 1NHLA 3H6PA 1A02F 3EFGA 1LTBC 2QM7A 1VDFA 3TNUB 1IFMA 1N7SD 1YTZT 1LT9A 1GU5A 1CSBA 1KFMA 1SQBK 3HE5B 2N1TB 2NPSC 2FFDA 1GDTA 5AW7B 3HE4B 4ZKPA 2LKMA 1N2DC 2M3BA 5KJ7D 1SQXK 2KB7P 3V2NA 4XE5B 5AVUB 1GTWA 4IFMA 5KTBA 2FXMA 3HD7A 3E1IA 2QM8A 2IFMA 3NMDA 1JY2O 2WPRA 3IR9A 3VOPA 1FDMA 1ZR2A 1L0NK 1NH4A 2OYHC 1KFNA 1N73C 1T8ZA 1LTIC 1RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW0 B;  4B86 A;  2W27 A;  1X8Y A;  1HBW A;  2Q5U A;  3VMZ A;  3V5B A;  2XZR A;  2WT7 A;  1CI6 A;  4GKG A;  1MV8 A;  4I2L C;  3A2A A;  2R32 A;  3NFQ A;  3VMX A;  1H88 A;  3NTN A;  4KHX A;  1CZQ A;  2P2U A;  1T2K C;  1DH3 A;  1MFZ A;  2W6A A;  2JJL A;  2WT7 B;  4C46 A;  3O8Z A;  5AW1 B;  1SLQ A;  1OXZ A;  1T2K D;  1HJB A;  2C9N Y;  3KDP B;  1MUU A;  5AVT B;  4GT1 A;  2E43 A;  5AW3 B;  2C9L Y;  1CI6 B;  2Z5H A;  3TK1 A;  2R5B A;  4C7N B;  1GZL A;  2P7J A;  5APX A;  4HYT B;  5APW A;  5AVQ B;  5AW6 B;  3TYY A;  3L35 A;  3LIE A;  1H8A A;  1IO4 A;  3VMY A;  3L37 A;  3P7K A;  1GU4 A;  2N9B A;  2YO3 A;  4C7N A;  2E42 A;  2WPQ A;  1FOS E;  3TNU A;  5AW4 B;  5CMZ A;  2Z5I A;  4AYC A;  3A5T A;  1HUC A;  2IPP A;  3A3Y B;  1JNM A;  3LID A;  4AUW A;  2WWW A;  3VTP C;  4EOT A;  5APS A;  5AW2 B;  1KQL A;  2R5D A;  3SWF A;  3A7O A;  3M0A A;  5APT A;  1G2C B;  1OWA A;  1GK6 A;  2XV5 A;  3NXS A;  4DZO A;  2ZFC A;  3M06 A;  2Q7C A;  2R3C A;  3UIA A;  1J2J B;  1JUN A;  1FAV A;  2ZXE B;  3M9H A;  3MGN A;  1YYC A;  2Q3I A;  3OAK A;  5APU A;  1GD2 E;  1HWT C;  3I5C A;  2KP8 A;  1S9K E;  1A02 F;  4AQR D;  2QM7 A;  5AVV B;  2YNY A;  4JYB A;  3P32 A;  3TNU B;  2WPS A;  5AVZ B;  5AVW B;  3L36 A;  5AW8 B;  2BAS A;  1GU5 A;  1CSB A;  5APQ A;  3HE5 B;  1GK4 A;  5AW5 B;  3T97 A;  5AVY B;  4RES B;  3M91 A;  3B8E B;  4JYC A;  5AW9 B;  4I6M C;  5AW7 B;  1A02 J;  2P67 A;  3HE4 B;  3V4Q A;  1S9K D;  3M0D A;  3M9B A;  4XE5 B;  5AVU B;  3V4W A;  3HTK A;  3HE4 A;  1NAF A;  3HE5 A;  1GTW A;  1NWQ A;  3P8M C;  4LC1 A;  5AVR B;  2QM8 A;  2YO2 A;  5APY A;  5AVX B;  2WTY A;  5AVS B;  2H7H A;  1H89 A;  3VYI A;  3NMD A;  3VN0 A;  2WPR A;  3IR9 A;  5APV A;  4M3L A;  1SP4 A;  3MD0 A;  1FOS F;  3KQG A;  2XU6 A;  2VRS A; 
#chains in the Genus database with same CATH topology
 2FYU E;  1X8Y A;  4WY4 D;  1KYO E;  1OX3 A;  3T97 B;  2ITA A;  5BVZ A;  3MTU E;  3AEG C;  4RJT A;  1L4A D;  4K3A A;  3W68 A;  4PV1 C;  4DJG A;  3FGA D;  2B87 B;  1YI2 P;  1EQ7 A;  2SPZ A;  3AE8 C;  1NTK E;  4GKG A;  3GHG C;  3HUS B;  1SFC A;  4I2L C;  3A2A A;  3NFQ A;  1KMI Z;  1OVU A;  3VMX A;  4W80 A;  2QEX P;  3Q5S A;  1EZV E;  1FS0 E;  1FDI A;  3L74 G;  3GHG B;  3ABV C;  4UB8 E;  4GOE A;  3RBX A;  2JJL A;  5CCG D;  2L91 A;  3Q5P A;  2K37 A;  4JQ0 D;  1M57 D;  5AW1 B;  5CCH A;  4ZKU A;  1GL2 D;  2N1T D;  1N7S A;  2I1J A;  2V7Q H;  3AE2 C;  2H88 C;  4JBZ A;  4KT0 J;  1T2K D;  2FYU G;  1M1K Q;  5KLV J;  2J58 A;  1JY2 P;  2BCC E;  1SQQ G;  3L72 G;  5GTI E;  2E43 A;  3CC2 P;  1SQQ K;  3H1K D;  2QE7 H;  1NU1 D;  5KAI E;  2C9L Y;  2Q1K A;  2JWA A;  2Z5H A;  1VQ5 P;  5E79 E;  2D2C C;  1SQQ D;  2R5B A;  4N6J A;  4C7N B;  1W2B O;  1KQF B;  1RF0 A;  4HYT B;  1RQV A;  3M0D C;  5APW A;  2UWJ E;  1Y9B A;  3GG2 A;  3FXD A;  1XTC C;  4Y28 J;  1PPJ D;  3CME P;  5CJ0 A;  2N9B A;  3V2R A;  4C7N A;  1EDL A;  2GA1 A;  2PFX A;  2O1J A;  2WVR A;  3B5N A;  3GF7 A;  1BGY J;  2HFE D;  3KZI H;  5TJH A;  3TNU A;  2J5U A;  3A5T A;  1NTZ E;  1KC8 Q;  1FE6 A;  4PD4 I;  1D7M A;  1ZV8 A;  3HTK B;  1IK9 A;  2YXQ B;  1EZV I;  1LT1 A;  3H1L D;  4OGQ B;  1S5L X;  1G2C A;  4H44 D;  5B66 H;  3L72 D;  3PP5 A;  3CLQ A;  2KS1 B;  1LJ2 A;  2V4H A;  3FXE A;  4YPC A;  4EOT A;  1Q90 D;  4JF7 A;  1EXJ A;  2RMZ A;  1BE3 G;  5AW2 B;  1ZRT E;  1RE4 C;  2KK7 A;  1SQQ J;  3AE9 C;  1JO5 A;  4WY4 B;  1G2C B;  2E76 C;  1N7S B;  1BE3 D;  3EQ2 A;  3H1L J;  3R2P A;  3HD7 C;  2C0W A;  1J1D C;  1FBM A;  2R3C A;  1P84 D;  2KIK A;  3KYQ A;  1EZV G;  2KI7 B;  1YYC A;  2ZT9 C;  2E75 B;  3OAK A;  3H1I E;  2B9B A;  3Q2Y A;  3HUS A;  3CWB D;  1BCC D;  1NGM B;  1HWT C;  1X79 B;  3I5C A;  1NTZ J;  3GHG A;  2H43 A;  1JY3 N;  3EFF K;  3RL0 C;  4PD4 E;  5AVV B;  2WSE J;  3AE4 C;  5KAF H;  2Q9I A;  1FZC C;  2OQQ A;  1NTM J;  2P1J A;  2YMK A;  4GOD A;  5AVW B;  4U3F G;  3RL0 D;  4ASV A;  2Y0D A;  1AVO A;  5CCG A;  5L8R J;  1FZC A;  5AW8 B;  2A06 D;  3CX5 E;  3AEA C;  3SFD C;  3WUV A;  5KAI H;  3W67 A;  1LP1 B;  1GK4 A;  3BAS A;  2XNX A;  3T97 A;  1KV4 A;  1U7M A;  3WUT A;  3CCL P;  1K05 A;  1KIL D;  2ZVN B;  3M91 A;  1ZLL A;  3B8E B;  4KJM A;  3L73 E;  4I6M C;  1ZOY C;  2BEZ F;  2MJZ A;  1FZF A;  3V4Q A;  3GMA A;  1S9K D;  2YKO A;  2AEM A;  2D2C B;  4ZNC A;  5KJ7 A;  2Y9Z A;  1N73 B;  3H1J G;  4A7P A;  5BU8 B;  1AQ5 A;  2PGD A;  3CD6 P;  1DEE G;  2E5T A;  3M9B A;  1Q7Y Q;  1FU1 A;  1NTZ K;  1NTZ G;  3IN6 A;  4NPD A;  1P84 H;  4NPE A;  3GW6 A;  3OJA B;  3TGU E;  3F89 A;  1L4A B;  3KZI E;  3O6Q B;  4BRY A;  2OYH A;  3OW2 O;  4LC1 A;  3CXH H;  1NTM G;  1U57 A;  3B71 A;  1J1D B;  5AVR B;  2H7H A;  1S4X A;  5AVS B;  1L4A C;  1SQB G;  2WMM A;  2AEF A;  3H1J E;  3L71 J;  3VYI A;  4DT0 A;  2YKP A;  3AEF C;  3B5N C;  1L0N D;  4H13 C;  3RK2 D;  1EXI A;  1OW8 A;  3I56 P;  4M3L A;  5EFW B;  2CPB A;  1GMJ A;  3MD0 A;  3L71 E;  1SQV K;  4NPF X;  1QVG O;  4IL6 E;  1FJK A;  2FBW C;  1BDD A;  2XU6 A;  2YIU B;  2E75 D;  2W90 A;  4Z1M H;  1LP1 A;  2K9J A;  1NU1 J;  2MKV A;  3CWB J;  3P8C E;  1PP9 D;  2FKW B;  4U3F D;  4B86 A;  1HBW A;  1Q2N A;  2IYO A;  3L71 D;  1SQB E;  3QH9 A;  3V5B A;  2KLV A;  1W5C E;  3QWO C;  1ZW0 A;  3H1J J;  1LTG C;  1L0L E;  2KNC B;  1LNQ A;  4GOF A;  1MV8 A;  1CW5 A;  3II6 A;  2R32 A;  5CHX A;  1OW6 A;  1RY3 A;  2KUB A;  3I55 P;  1LTA C;  1VQ6 P;  1RHZ B;  3NTN A;  5CJ4 A;  2KXP B;  1RF1 B;  5H2F H;  2WPV B;  1BSN A;  2WSF H;  3H32 A;  1MFZ A;  2QG4 A;  3OA7 A;  3R4Y A;  1UII A;  1GL2 A;  4N78 D;  4YXW H;  3TGU D;  2WT7 B;  1YJW P;  4HJG H;  2K9J B;  1IFD A;  1SLQ A;  2HR3 A;  2IBZ D;  3IAO A;  2Z4E A;  3M9Q A;  2C9N Y;  3KDP B;  1KIL B;  1MUU A;  3WUU A;  1ZXG A;  4Y99 C;  2HYN A;  4RO0 A;  4CPG A;  3Q3D A;  1RF1 A;  3USS A;  1VF5 D;  3BAT A;  1JCD A;  1QGK B;  3EWK A;  3L73 J;  3TK1 A;  2NPS D;  3CXH D;  3S1K A;  2OYO A;  3G4S P;  1S2E A;  3H25 A;  1SQP E;  1SQV G;  2HLO A;  2M3E A;  1KIL E;  1QEX A;  4HKZ H;  5AW6 B;  3TYY A;  5M1B A;  3D71 A;  5GTH H;  1H8A A;  1E79 H;  2HOD A;  1W2E A;  4ASW A;  3C9I A;  3L37 A;  3WMM 0;  1GW4 A;  1VQP P;  1VQ7 P;  1IFI A;  3MIW A;  4TT3 H;  1FOS E;  2PP6 A;  4DCK A;  1NJI Q;  1RH5 B;  2NZ2 A;  3B5N D;  4H13 D;  4IL6 H;  2JO1 A;  1R5L A;  2ZAE B;  4N3Y B;  3RK2 C;  5B5E H;  3RL0 g;  1FOS F;  3LID A;  1SFC B;  1X0T A;  4I7Z C;  3BRV B;  1NTK K;  1URQ B;  2L5G B;  1FZG A;  1YJ9 P;  3VTP C;  3BCC E;  4XA4 A;  1RE4 A;  3CWB E;  1KQL A;  2IZ1 A;  1MZ9 A;  3A7O A;  5GTI H;  1SQP G;  1SQV E;  3M0A A;  2KOG A;  3H1H J;  3ITK A;  1VQL P;  1QVF O;  1GK6 A;  1MKM A;  2P58 A;  3NXS A;  1KZU B;  4N78 E;  1SQP D;  4DZO A;  3M06 A;  3BVH A;  3L70 J;  1N73 A;  1YBK A;  1P84 I;  3UIA A;  1J2J B;  1J1E B;  1SQV J;  3CXH E;  1VQM P;  1JUN A;  3SWY A;  1ZP0 C;  1BE3 E;  2O01 H;  1L0L K;  3AE7 C;  1KQG B;  2ZVO B;  3JCU E;  2Q3I A;  3L74 D;  1T3J A;  3KPE A;  3JCU H;  1L0L D;  2R3S A;  1LGH B;  3CC4 P;  2IBZ E;  1VQO P;  1Q82 Q;  2A45 H;  1WRG A;  3N7N A;  2HPC B;  1NKN A;  3JSV C;  3HRN A;  3N4X A;  3AE3 C;  4WWI A;  2W6J H;  2OTL P;  3P32 A;  3L36 A;  2KZJ A;  5B5E E;  3LW5 J;  5GTH E;  1MFT A;  1L0N E;  2N1T C;  2BAS A;  1KB9 D;  2NPS B;  1KB9 E;  1VQ9 P;  5APQ A;  2FYN C;  3A0B E;  3CCV P;  3D6Y A;  2AXC A;  3IFM A;  5AW5 B;  2IYP A;  2I8D A;  1SQB D;  5TIS E;  1L0N J;  2Y0C A;  1JEK A;  4RES B;  1LT9 B;  5AVY B;  1PP9 E;  4ZMD A;  3P8C D;  4U3F E;  1PL5 A;  3L70 G;  4EDF A;  4RKU J;  3CCE P;  3E1R A;  3MUD C;  1FZE A;  2P67 A;  5KJ7 C;  2HOD B;  2XND H;  1M1J A;  1RF0 C;  3RK2 B;  4D6T J;  3B4S A;  1FZA A;  1NTM K;  2BCC D;  3M0D A;  3MHV A;  4IOI H;  1AJY A;  4I7Z B;  4R4M A;  1URQ C;  2YXR B;  3L74 E;  2O3J A;  3L75 G;  1NYH A;  3H1J D;  4OGQ C;  1NAF A;  1K73 Q;  2YIU C;  3HE5 A;  2FXP A;  2QIW A;  1NWQ A;  1JTH A;  3P8M C;  1ZME C;  1TU3 F;  3FWN A;  1EZV D;  1RE3 C;  2JP3 A;  4H44 C;  1SQV D;  2IFN A;  2WTY A;  1H89 A;  2E76 B;  1NTK D;  1PGJ A;  2M8R A;  3BCC D;  3PHL A;  2A06 E;  3CX5 D;  2KLU A;  2WQY C;  5DJT B;  3E7K A;  1USE A;  1FZC B;  2BCC J;  4O9B A;  2IX7 C;  5H2F E;  3KQG A;  3SWK A;  1NOH A;  4WY4 A;  2WIT A;  2RKL A;  5AW0 B;  3L73 D;  1N8R Q;  5B66 E;  1KD1 Q;  1JTH B;  1DH3 A;  1DD4 A;  1WT6 A;  4L76 A;  5BU5 A;  2O01 J;  3PTZ A;  2B89 A;  1SQX J;  1GW3 A;  1JCC A;  1N7S C;  2XZR A;  1FZB A;  2OGU A;  3L4F A;  4WVZ A;  2WSE H;  3TDK A;  2WT7 A;  3G6E P;  1R8E A;  1VQ4 P;  1QX8 A;  1X22 A;  4PV1 B;  2XDJ A;  1H88 A;  4I1L A;  4KHX A;  1CZQ A;  1HVV A;  2QSI A;  2H89 C;  1GL2 C;  1T2K C;  2RN0 A;  1ZR4 A;  2W6A A;  1NAY A;  1L0L G;  3SFE C;  5CCH D;  1N7L A;  3MUD A;  3O8Z A;  4HB1 A;  3CCR P;  3H1I G;  3G3Z A;  1HJB A;  4BRY B;  3TSI A;  3V2Q A;  5CCG C;  3L75 D;  3G9R A;  3MP7 B;  2ZYA A;  3CCQ P;  1BE3 J;  4GT1 A;  3VP9 A;  1FJP A;  1DD3 A;  2NPS A;  3CCJ P;  1JOC A;  1GL2 B;  2BCC G;  2CPS A;  2E74 D;  3L72 E;  5AW3 B;  1URQ D;  3TF5 A;  3H1L E;  3AE6 C;  1P84 E;  1GZL A;  5KLV E;  3CCU P;  5APX A;  1AVY A;  1NTZ D;  2DW3 A;  3V6I A;  3S9O A;  1PPJ G;  5CBO A;  4YTP C;  4UB8 H;  3CX5 H;  3L35 A;  1N86 A;  3LIE A;  1M1J C;  1YQ4 C;  1YHQ P;  1ZRT D;  3AED C;  4U7J A;  2YO3 A;  3AE1 C;  3ZDM A;  3CX5 I;  2K9Y A;  2E42 A;  5KAF E;  1KB9 I;  2H8P D;  2P10 A;  1JB0 J;  2KS1 A;  1EC5 A;  1IFJ A;  1NO4 A;  2Z5I A;  1DEB A;  5CMZ A;  2GUS A;  2JEE A;  2K1A A;  1JNM A;  1L0L J;  1Q81 Q;  3H1K E;  2QJK B;  4AUW A;  2WZ7 A;  3V2P A;  1HJ0 A;  2WWW A;  2WSC H;  4U3F J;  4EIJ A;  3H1I J;  1G1I A;  1X9V A;  1JM0 A;  5APS A;  2FYU J;  4H44 B;  1PPJ E;  3HUS C;  4UB6 H;  3SWF A;  3L72 J;  3CCS P;  1KTM A;  2POH A;  1LTJ A;  2OYI A;  2OTJ P;  1OWA A;  2G8Y A;  2ZYD A;  2XV5 A;  2IZ0 A;  5KLI B;  4L74 A;  2FYZ A;  3Q1M A;  1IO4 A;  2V7Q J;  2QJP B;  4WY4 C;  1NKZ B;  1SQQ E;  2FYN B;  3BCC G;  1LTS C;  3RGU A;  4DOJ A;  1HTL C;  2KSJ A;  2ZXX A;  3M9H A;  3MGN A;  4PV1 D;  1VQ8 P;  4PJ0 H;  3TGU G;  3D70 A;  1SFC C;  2LR2 A;  3AEE C;  3H1K G;  1GD2 E;  2ZJS E;  2R44 A;  1BGY G;  1JY3 O;  2KP8 A;  4BXL A;  1S9K E;  1KYO D;  1BCC G;  4AQR D;  1DIP A;  2FYU D;  3MZW B;  2YNY A;  4JYB A;  4WB4 A;  2K88 A;  1HGZ A;  1KQS O;  2YMY A;  1Q86 Q;  2WPS A;  5AVZ B;  2M5A B;  2W8Z A;  1E5W A;  1KYO I;  2KSE A;  5KKZ C;  2E74 B;  3K5B A;  2OTK E;  2W83 C;  2FYU K;  1SS1 A;  1UIX A;  2W6B A;  2XKM A;  1IK7 A;  3L71 G;  4W7Z A;  1FDO A;  2E5Y A;  1J1E C;  2AEJ A;  1S5L H;  2C0X A;  1URQ A;  4OGQ D;  1G1J A;  1KIL A;  1RF1 C;  2N9Y B;  3RBZ A;  1AA0 A;  1LWU C;  4HH2 A;  3H1L G;  5KLV K;  1LWU A;  4L73 A;  4JYC A;  2JKV A;  5AW9 B;  1KOR A;  2JDI H;  4PD4 D;  1H0T A;  1A02 J;  1HF9 A;  3CWB G;  2QJK C;  3S4R A;  3BCC J;  1NVO A;  1OIP A;  2JWD A;  3CXH I;  4Y99 B;  1YJN P;  1QL2 A;  2OYH B;  1JMB A;  1BCC E;  4OH8 B;  3CC7 P;  4OVN F;  1AFO A;  3TGU J;  1LWU B;  1YTZ I;  3H1I D;  1JY2 N;  3KXD A;  3H1K J;  2A45 G;  4L75 A;  3V4W A;  1SQX D;  2I1K A;  3HTK A;  3AEB C;  3HE4 A;  4H0L D;  1BCC J;  1LTJ C;  2A45 I;  5E79 H;  3U1A A;  2OYI C;  1ZN5 A;  1KN7 A;  1T6A A;  4H0L C;  5TIS H;  1S1C X;  1Z56 A;  1AV1 A;  4IFF A;  3HD7 D;  1OMI A;  2YO2 A;  5APY A;  3GLM A;  2QJP C;  5AVX B;  2HPC A;  3FX0 A;  2IDB A;  1QL1 A;  3D6Z A;  3VN0 A;  1PGQ A;  1VPC A;  1KYO H;  1PV3 A;  2OAR A;  2PAJ A;  3O6Q A;  2Q3E A;  5APV A;  3PJS K;  3AEC C;  3VP8 A;  1SQP K;  2J59 M;  1SP4 A;  2YKQ A;  3L73 G;  1K8A Q;  3H32 B;  3RL0 B;  1JMM A;  3CMA P;  2VRS A;  1SVF A;  1OFC X;  2W27 A;  4GIF A;  1IJD B;  2GUV A;  2Q5U A;  3CL3 D;  1L4A A;  3RK3 D;  2BEQ D;  1FC2 C;  1HGV A;  3B5N B;  4H13 B;  3VMZ A;  3VMA A;  3U1C A;  2FFD B;  2CK3 H;  1LT9 C;  3G71 P;  1S72 P;  1SFC D;  1CI6 A;  3A0B H;  1HH0 A;  4PD4 H;  1DX7 A;  2D2C D;  4D6T D;  2GM4 A;  2P2U A;  2FFD C;  2KYV A;  2M0B A;  1LTT C;  3A0H E;  4OWF A;  1NU1 E;  4W7Y A;  1M8O B;  4C46 A;  3AE5 C;  4JPZ B;  1IFP A;  1OXZ A;  1SQB J;  1T3U A;  3L70 D;  1PFI A;  2Y9Y A;  2QA4 P;  5AVT B;  2N1T A;  3F5H A;  1VL2 A;  4YXD C;  4UB6 E;  1SQP J;  3CI9 A;  1IZN B;  1R5S A;  1USD A;  3H1H G;  3Q5R A;  1CI6 B;  1KIL C;  1OVV A;  1BGY D;  1IFN A;  1NU1 K;  1M7L A;  2AXT E;  2P7J A;  1NU1 G;  2QJY B;  1IC2 A;  4IFD K;  1H0T B;  5CCH C;  5AVQ B;  3C8V A;  2HG5 D;  3U59 A;  4H0L B;  4TLF A;  5KLI C;  2LXB A;  3VMY A;  3P7K A;  1U7J A;  1GU4 A;  2WSS H;  1OW7 A;  4GDO A;  2WPQ A;  1BSH A;  5AW4 B;  3HD7 B;  4QMA A;  2E74 C;  2M5A A;  4AYC A;  4MN4 C;  3PRJ A;  1HUC A;  2IPP A;  1L2P A;  3A3Y B;  1M56 D;  3LW5 H;  1BGY E;  3PH0 A;  1Y8A A;  4XFJ A;  2O1K A;  2FY8 A;  1EDJ A;  1RQU A;  2E75 C;  2WSF J;  2ZT9 D;  3H1H D;  3PLN A;  1PIX A;  1PP9 G;  2B88 A;  3L70 E;  2PRR A;  2R5D A;  1OZH A;  3RK3 B;  5APT A;  4WBA A;  1M1J B;  1OVR A;  3IF4 A;  5KKZ B;  3BRT B;  2G3A A;  1QLE D;  2ZFC A;  4R4L A;  2Q7C A;  1NTM E;  1XTG B;  3RK3 C;  3CPW O;  1FAV A;  3FWL A;  1VF5 B;  1EDI A;  2ZXE B;  4LGD E;  4D6T G;  2WSC J;  1LTJ B;  4C7R A;  2OYI B;  1EDK A;  1JY3 P;  1AQT A;  1S3J A;  1K04 A;  4LLH A;  5APU A;  4K35 A;  1NHL A;  1WMK A;  3H6P A;  3L75 J;  2KNC A;  2IBZ G;  1A02 F;  3EFG A;  1YIT P;  2E76 D;  1LTB C;  2QM7 A;  1VQN P;  1VF5 C;  5C39 A;  1VDF A;  2Q6Q A;  1PGP A;  1K9M Q;  2O01 N;  3TNU B;  4D6T E;  1IFM A;  1N7S D;  1NTK J;  1YTZ T;  1YIJ P;  1LT9 A;  1S5L E;  2FXO A;  3C1L A;  3GF3 A;  2NRG A;  1CSB A;  1PP9 J;  1GU5 A;  1KFM A;  1SQB K;  3HE5 B;  5CBN A;  4IL6 X;  2A06 G;  4PJ0 E;  3SSU A;  1M90 Q;  2JR8 A;  2N1T B;  3CCM P;  2NPS C;  2FFD A;  1GDT A;  2K3R A;  3JC2 2;  3RK3 E;  5AW7 B;  5KLV D;  2B87 A;  2QRX A;  3HE4 B;  2AXT H;  4ZKP A;  2LKM A;  1N2D C;  2M3B A;  1SQX G;  5KJ7 D;  1SQX K;  2KB7 P;  3V2N A;  3L75 E;  4XE5 B;  1Y47 A;  5AVU B;  1PZQ A;  1KB9 H;  2QVA A;  2RH0 A;  5K5G B;  1GTW A;  4IFM A;  5KTB A;  2ZT9 B;  1NTM D;  4EI2 A;  2FXM A;  3L74 J;  3HD7 A;  3WU2 H;  2KZI A;  3A0H H;  3E1I A;  1VQK P;  1NTK G;  2QM8 A;  2Y0E A;  4BWN A;  1SQX E;  2IFM A;  2LXC B;  3NMD A;  1BDC A;  1JY2 O;  2IBZ I;  2WPR A;  3IR9 A;  2QJY C;  1YQ3 C;  3H1H E;  3VOP A;  4EYY Q;  5KLV G;  1ZR2 A;  3WU2 E;  1FDM A;  1L0N K;  3KHU A;  1L0N G;  1NH4 A;  1PGO A;  1KFN A;  1N73 C;  1T8Z A;  2ZYG A;  2OYH C;  1LTI C;  1RE3 A;  5DJU B; 
#chains in the Genus database with same CATH homology
 1X8Y A;  4WY4 D;  5BVZ A;  3MTU E;  1L4A D;  1EQ7 A;  4GKG A;  3GHG C;  3HUS B;  1SFC A;  4I2L C;  3A2A A;  3NFQ A;  3VMX A;  4W80 A;  3GHG B;  2JJL A;  5CCG D;  5AW1 B;  5CCH A;  4ZKU A;  1GL2 D;  2N1T D;  1N7S A;  2I1J A;  1T2K D;  2J58 A;  1JY2 P;  2E43 A;  1SQQ K;  2C9L Y;  2Z5H A;  2R5B A;  4N6J A;  4C7N B;  1RF0 A;  4HYT B;  3M0D C;  5APW A;  1XTC C;  5CJ0 A;  2N9B A;  3V2R A;  4C7N A;  2O1J A;  3B5N A;  3TNU A;  2HFE D;  3A5T A;  1ZV8 A;  3HTK B;  1IK9 A;  1G2C A;  3PP5 A;  3CLQ A;  4EOT A;  4JF7 A;  5AW2 B;  1RE4 C;  4WY4 B;  1G2C B;  1N7S B;  3EQ2 A;  3R2P A;  3HD7 C;  2C0W A;  1J1D C;  1FBM A;  2R3C A;  3KYQ A;  1YYC A;  3OAK A;  3HUS A;  1HWT C;  1X79 B;  3I5C A;  3GHG A;  2H43 A;  1JY3 N;  3RL0 C;  5AVV B;  2Q9I A;  1FZC C;  2P1J A;  5AVW B;  3RL0 D;  1FZC A;  5CCG A;  5AW8 B;  1GK4 A;  3BAS A;  2XNX A;  3T97 A;  1KIL D;  3M91 A;  1ZLL A;  3B8E B;  4I6M C;  2MJZ A;  1FZF A;  3V4Q A;  1S9K D;  2YKO A;  5KJ7 A;  1N73 B;  5BU8 B;  1AQ5 A;  3M9B A;  1FU1 A;  1NTZ K;  3OJA B;  2OYH A;  1L4A B;  4LC1 A;  5AVR B;  1J1D B;  2H7H A;  5AVS B;  1L4A C;  3VYI A;  2YKP A;  3B5N C;  3RK2 D;  4M3L A;  2CPB A;  3MD0 A;  1FOS F;  1SQV K;  1FJK A;  2XU6 A;  4B86 A;  3P8C E;  2FKW B;  1HBW A;  3V5B A;  2KLV A;  1LTG C;  1MV8 A;  1CW5 A;  3II6 A;  2R32 A;  5CHX A;  1RY3 A;  1LTA C;  3NTN A;  5CJ4 A;  1RF1 B;  2WSF H;  4N78 D;  3H32 A;  1MFZ A;  3OA7 A;  1DH3 A;  2WT7 B;  1GL2 A;  1IFD A;  1SLQ A;  2Z4E A;  3M9Q A;  2C9N Y;  3KDP B;  1KIL B;  1MUU A;  4Y99 C;  2HYN A;  1RF1 A;  3BAT A;  1JCD A;  3TK1 A;  2NPS D;  2HLO A;  5AW6 B;  3TYY A;  1H8A A;  1IO4 A;  2HOD A;  1W2E A;  3C9I A;  3L37 A;  3WMM 0;  1GW4 A;  1IFI A;  3MIW A;  1FOS E;  2PP6 A;  3B5N D;  4N3Y B;  3RK2 C;  3LID A;  1SFC B;  3BRV B;  1NTK K;  1URQ B;  2L5G B;  1FZG A;  3VTP C;  4XA4 A;  1RE4 A;  1KQL A;  1MZ9 A;  3A7O A;  3M0A A;  2KOG A;  1GK6 A;  3NXS A;  4N78 E;  1KZU B;  4DZO A;  3BVH A;  3M06 A;  1N73 A;  3UIA A;  1J2J B;  1J1E B;  1JUN A;  3SWY A;  2O01 H;  1L0L K;  2Q3I A;  1T3J A;  3KPE A;  1LGH B;  2A45 H;  1WRG A;  3N7N A;  2HPC B;  1NKN A;  3HRN A;  3N4X A;  3P32 A;  3L36 A;  2N1T C;  2BAS A;  2NPS B;  5APQ A;  3IFM A;  5AW5 B;  5AVY B;  4RES B;  1LT9 B;  3P8C D;  1FZE A;  2P67 A;  5KJ7 C;  2HOD B;  1M1J A;  1RF0 C;  3RK2 B;  1FZA A;  1NTM K;  3M0D A;  1URQ C;  1NAF A;  3HE5 A;  1NWQ A;  1JTH A;  3P8M C;  1RE3 C;  2IFN A;  2WTY A;  1H89 A;  2M8R A;  1FZC B;  4O9B A;  2IX7 C;  3KQG A;  1NOH A;  4WY4 A;  2WIT A;  5AW0 B;  1JTH B;  1WT6 A;  5BU5 A;  1GW3 A;  1JCC A;  1N7S C;  2XZR A;  1FZB A;  2WT7 A;  3L4F A;  1JO5 A;  2WSE H;  2XDJ A;  1H88 A;  4I1L A;  4KHX A;  1CZQ A;  1HVV A;  1GL2 C;  1T2K C;  1ZR4 A;  2W6A A;  5CCH D;  1N7L A;  3MUD A;  3O8Z A;  3G3Z A;  1HJB A;  3TSI A;  3V2Q A;  5CCG C;  4GT1 A;  3VP9 A;  1FJP A;  2NPS A;  1JOC A;  1GL2 B;  2CPS A;  5AW3 B;  1URQ D;  1GZL A;  5APX A;  3L35 A;  1N86 A;  3LIE A;  1M1J C;  2YO3 A;  2E42 A;  2H8P D;  1IFJ A;  1NO4 A;  2Z5I A;  1DEB A;  5CMZ A;  2GUS A;  2JEE A;  1JNM A;  4AUW A;  2WZ7 A;  3V2P A;  2WWW A;  2WSC H;  4EIJ A;  1G1I A;  1X9V A;  5APS A;  3HUS C;  3SWF A;  2POH A;  1LTJ A;  2OYI A;  1OWA A;  2XV5 A;  2FYZ A;  4WY4 C;  1NKZ B;  1LTS C;  4DOJ A;  1HTL C;  2KSJ A;  3M9H A;  3MGN A;  1SFC C;  1GD2 E;  1JY3 O;  2KP8 A;  1S9K E;  4AQR D;  2YNY A;  4JYB A;  4WB4 A;  1HGZ A;  2YMY A;  2WPS A;  5AVZ B;  1E5W A;  2FYU K;  2W6B A;  4W7Z A;  2XKM A;  1J1E C;  2C0X A;  1URQ A;  1G1J A;  1KIL A;  1RF1 C;  1LWU C;  4HH2 A;  5KLV K;  1LWU A;  4JYC A;  5AW9 B;  1A02 J;  4Y99 B;  1QL2 A;  2OYH B;  1AFO A;  4OH8 B;  1LWU B;  1YTZ I;  1JY2 N;  2A45 G;  3V4W A;  2I1K A;  3HTK A;  3HE4 A;  1LTJ C;  2A45 I;  3U1A A;  2OYI C;  1ZN5 A;  1Z56 A;  4IFF A;  3HD7 D;  2YO2 A;  5APY A;  5AVX B;  2HPC A;  1QL1 A;  3VN0 A;  1VPC A;  2OAR A;  2PAJ A;  5APV A;  3VP8 A;  1SQP K;  2J59 M;  1SP4 A;  2YKQ A;  3H32 B;  3RL0 B;  1JMM A;  2VRS A;  1SVF A;  2W27 A;  4GIF A;  1IJD B;  2GUV A;  2Q5U A;  3CL3 D;  1L4A A;  3RK3 D;  3VMZ A;  3B5N B;  1HGV A;  3U1C A;  2FFD B;  1LT9 C;  1SFC D;  1CI6 A;  1HH0 A;  1DX7 A;  2GM4 A;  2P2U A;  2FFD C;  2KYV A;  1LTT C;  4W7Y A;  4C46 A;  1OXZ A;  1T3U A;  1PFI A;  5AVT B;  2N1T A;  3CI9 A;  1CI6 B;  1KIL C;  1IFN A;  1NU1 K;  1M7L A;  2P7J A;  1IC2 A;  4IFD K;  5CCH C;  5AVQ B;  3U59 A;  2HG5 D;  3VMY A;  3P7K A;  1GU4 A;  2WPQ A;  5AW4 B;  3HD7 B;  4AYC A;  1HUC A;  2IPP A;  3A3Y B;  3LW5 H;  2O1K A;  2R5D A;  3RK3 B;  5APT A;  4WBA A;  1M1J B;  3BRT B;  2ZFC A;  2Q7C A;  1XTG B;  3RK3 C;  1FAV A;  4LGD E;  2ZXE B;  4C7R A;  1LTJ B;  2OYI B;  1JY3 P;  4LLH A;  5APU A;  1NHL A;  3H6P A;  1A02 F;  3EFG A;  1LTB C;  2QM7 A;  1VDF A;  3TNU B;  1IFM A;  1N7S D;  1YTZ T;  1LT9 A;  1GU5 A;  1CSB A;  1KFM A;  1SQB K;  3HE5 B;  2N1T B;  2NPS C;  2FFD A;  1GDT A;  5AW7 B;  3HE4 B;  4ZKP A;  2LKM A;  1N2D C;  2M3B A;  5KJ7 D;  1SQX K;  2KB7 P;  3V2N A;  4XE5 B;  5AVU B;  1GTW A;  4IFM A;  5KTB A;  2FXM A;  3HD7 A;  3E1I A;  2QM8 A;  2IFM A;  3NMD A;  1JY2 O;  2WPR A;  3IR9 A;  3VOP A;  1FDM A;  1ZR2 A;  1L0N K;  1NH4 A;  2OYH C;  1KFN A;  1N73 C;  1T8Z A;  1LTI C;  1RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...