2YOHA

Plasmodium falciparum thymidylate kinase in complex with a urea-alpha- deoxythymidine inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
199
Chain Sequence
DKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Evaluation of Alpha-Thymidine Analogues as Novel Antimalarials.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 77
structure length 199
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yohA00
4DCNA 1NVWQ 2BMDA 2CL6X 3QSYA 3PITA 2V1XA 2H16A 1ZIPA 4FI3C 4DRZA 5HZKA 5ELXA 3SFVA 4EJSC 2FFHA 4G0NA 1X8LA 1E98A 4B2IA 4ZKEA 2B8WA 1U94A 3T1QA 4JVSB 2V3CC 5KNBA 3AUXA 3NEYA 3A1UA 4XSGA 3BIFA 4IVRA 3RHFA 2J46A 2JJ2A 2CNWA 4CEJB 3NKVA 4I81A 1R4AA 1KMQA 4GMXA 4UNPA 2FX3A 2VP0A 4MGZR 3FOZA 1YR8A 3AF4A 4FCWA 4GI7A 2Q9BA 4DLTA 3T06B 5C46F 2ZVPX 2RGCA 1S3SA 4DEYA 4W9MC 4D82A 4MKIA 2J87A 5DN6A 5FI1B 1T8UA 2R65A 4D4MA 2JLRA 1IY2A 1AQYA 1JR6A 4MGKR 1GWNA 2HJGA 1IXRC 4JIMA 3BB4A 5EP3A 2LCFA 4DLWA 2GVZC 2W00A 3CF2A 5KNCA 2DB3A 2W6JA 1CU1A 4XVQA 3N70A 3VHLB 4ZDWA 1X3SA 1T8TA 1RRFA 2ODEA 4BLPA 3EG5A 1F2UA 3GLHA 4LI0A 4EIWA 3KQHA 2D2FA 4TLCA 2G9NA 4B34A 2FGKA 1P7CA 2WPDA 3EWSA 1AK2A 3LBHA 2CJWA 3NHAA 2C8VA 2IUUA 1QHHB 1G7CA 2GCNA 1XD2B 2EFEB 2WWIA 2ORVA 1YR7A 3SQXA 5CDFE 1E0JA 4V0ME 4R71A 2FE4A 3THXB 5FUWA 4HDQB 3CNOA 3B1YA 4S35A 1XD9A 1JR3A 1UBCA 4MKGA 2F3RA 4CRWB 3MCAA 2BCJQ 2B7BA 1EGAA 1MABA 4HZUA 2NTYC 5AWFC 2IYTA 3EXAA 4QM6A 1GIAA 4C0QC 1IONA 1CBUA 2KJQA 4B48A 2O52A 3E2IA 1RRPA 4GSYA 4MRNA 4PHTA 1W36B 1WDTA 4ACBA 4M9QA 4PO9A 2ERXA 1JAIA 2JJ1A 2XX3A 2FMXA 3KJGA 2VEDA 1ZUIA 1II9A 2JAQA 2W6IA 4BQSA 1U8ZA 3GFTA 4MYUA 1TMKA 4X8MA 4M21A 1DS6A 1VHTA 3QF4B 5JJKA 4BUJA 2QE7A 1ANKA 3FKQA 4LHVA 4B3CA 2IA5A 3W8RA 4LOAA 3ZJYA 3GPLA 1Z3IX 1KTVA 2IYZA 1R5OA 4AWXA 4OQNA 1N0VC 3IIMA 4A2PA 4EQ6A 2A78A 5HE9A 4X8OA 4BPBA 2DYKA 2AFIE 2OFOA 3H84A 4DLXA 1EWRA 3VFDA 1BKDR 1KI3A 3P4YA 2ZREA 5KSYA 4IDOA 1ZD9A 4Q7MB 4X8LA 5HCNA 3CWQA 5SZKB 4OHXA 1P5ZB 4NPHA 1VMAA 4H9GA 4B71A 1N6IA 2G0NA 3RC8A 2JA1A 1Z6XA 1U8YA 3W6NA 2OBLA 4OI4A 4DSNA 1S0UA 4LJ8A 4MYCA 4OJQA 2WIAA 2FU5C 1W48A 2QPAA 1YKSA 2XITA 1E2PA 1YR9A 2EWVA 2H17A 2ZE5A 5JJIA 4ZIRB 4NE2A 1SXJD 5M04A 1ONBA 1XEWX 3D31A 1ZUHA 4OQMA 4FCTA 2XJ4A 2XNSA 3AH8A 3RS2A 1DAKA 4K46A 3EZ9A 1IN6A 1E94E 4L9WA 2B92A 1XTSA 2ECKA 1W5TA 2CL7X 1VTKA 1OF1A 4IW3B 2BWJA 2JJ8A 1XPRA 3K0AA 3E70C 2RAPA 3LY5A 1X8KA 2VL7A 4RD3A 3QNUA 1G7TA 2FEMA 2QMEA 2VP2A 5JS7A 2XNDA 3IDQA 4HAVA 4RD6A 1IY0A 4GRAA 1KNXA 3X1WA 1XMJA 4V02A 3DMNA 4EPTA 2H92A 2ASEA 2ZQ5A 5FUYA 5EE9A 2WWHA 6Q21A 1IXSB 2DWQA 4IRUB 1NL3A 2PMDA 4LYJA 3F5FA 1P9WA 2LKCA 1GAJA 2MSCB 1QHSA 1VCMA 2XOKD 4XVRA 3NC1C 1E9BA 4KFRA 4LDJA 1CRQA 3I5XA 3FPAA 3MSXA 3WRYC 4IVQA 3HU2A 4BFZA 3WMGA 4FIDA 4Q1FA 3GLFB 1D6JA 1M8PA 2GVDC 2WICA 4QNRA 4S2EA 4EFLA 1NN5A 2CCJA 2FPKA 4ABYA 2WHXA 4LCBA 1U9IA 3WBKA 1SKYE 3KKOA 3CPJB 3B1XA 1XCPA 4D26A 4HATA 1OH5A 5KUTA 4NCIA 3KJEA 4BFSA 4KITB 1G21E 2XZLA 2FEOA 1QRAA 3BWDD 2YC4C 1KSFX 4M1OA 4HAXA 3FE2A 4MA4A 2G1JA 1HUQA 3KB1A 3ZDQA 1CS4C 4EPVA 2EWWA 3QXXA 3PR1A 1Q12A 4NCKA 3QVUA 5JJLA 2D4HA 1HURA 3KL4A 2ZU0C 4JVNA 1EWQA 1G3UA 4Q9HA 1E79D 3S1AB 1D9XA 4C4PA 2H18A 2HXSA 1AZSC 1CR4A 2ZRPA 4G5OA 1FX0A 4D0NA 2B7CA 2V55B 5FPKA 3U7GA 4WXPA 1NLZA 4Z8YA 1T3SA 2W2TA 1N6KA 3KX2A 1GNPA 3RLFA 1D8TA 3N2EA 3CO5A 1Q1BA 2CHGA 1QHGA 2ZJBA 1KY2A 4LGMA 3OAAA 1LTQA 1R6BX 1WF3A 2OT3B 3PUZA 3ECCA 2GTPA 3BERA 4FN5A 4JS0A 1KO4A 2YOGA 3P4XA 1DBSA 4C0AC 2DY1A 1EK0A 2ZAMA 4HLQB 3GLIB 1OYYA 1MH1A 4AK9A 2IYSA 3R8CA 2GAOA 1R5NA 2WKPA 5FTNA 1OYWA 4LJ7A 3WBJA 1ZIOA 3V4FA 2QI9C 2ZI5A 2XNDD 821PA 3I73A 3MGCA 2NO1A 3BK7A 4JLKA 1KSJA 2R6GA 4IFEA 1NIPA 2QL6A 5FR1A 4QGHA 1SKQA 3GLFA 4V0LA 4ZCIA 4MGYR 1SVOA 1XCGB 3ND9A 4A0FA 1NMXA 3RABA 4EPWA 4QBGB 3NH9A 5DHAA 4E09A 2GEUA 5GJCA 1CXZA 3NVAA 2GJAA 3LNCA 4HDOB 4LPKA 2BVNA 1U2RA 4CZ2A 1M7GA 2JLUA 3KKQA 4XH9B 3TR5A 4M2LA 4XOIA 1HH4A 3H0KA 3N5CA 4TQAA 3OIVA 2QGZA 1COWD 4Q7KA 4GOKA 3IQXA 4R9UC 4TMVA 5E7IA 2C99A 5FPTA 2CNWD 4B33A 3TLXA 3KTAB 3FVQA 1XDBA 2O8CA 1GL9B 4BFTA 2ZPTX 5E3HA 4AKHA 4PC7A 1QG4A 5FTMA 3UXMA 2GEDA 4CIDA 1AS0A 3PEYA 1FX0B 1DPFA 3LXXA 1GL7A 2GF9A 5F98A 5CK4A 5P21A 1TQ4A 1Q1QA 1NP6A 5DGXA 3QQ5A 2WVJA 2CLCX 2B8TA 1GDDA 3UANA 1A1VA 4AKEA 4HLCA 3Q3JB 5EE3A 5EXPA 2F43A 3TAUA 3TNFA 2ODBA 3CF0A 1VDZA 1M7HA 1O87A 2OBMA 5FPHA 1D2EA 2GRJA 2WJHA 1S96A 2WPDD 1W4CA 3CUEF 1E9EA 3IUYA 2ERYA 5TV2A 1TU4A 4YMTA 1UKZA 1DAGA 2G83A 4PPGA 1Z8FA 4YMWA 2Q9CA 1XEFA 3AGQA 1U81A 2OO7A 3MAAC 1NRJB 4HAWA 8OHMA 3L8ZA 3AKDA 2IX3A 4G1UC 5FTJA 2JLXA 2XTZA 1U9IC 4QRHA 2GF0A 2O8BB 1G4UR 1C4OA 1MR3F 1XXHA 4KV9A 3EC2A 3HU3A 4BZQA 1ZNYA 2Y8EA 1I2DA 2ZRKA 1JJVA 3CRQA 2QP4A 4PSAA 1Z0KA 4KLNA 1YZQA 3UKDA 2DWOA 3GJ8A 1YZLA 4BFUA 5L3QA 2JIZA 3E1SA 3W8NA 1OH6A 5FL3A 3QF7A 2RGNA 1R0YA 2J45A 2R8RA 4B44A 4Q48A 4TLEA 5FOTA 1FUKA 3WHLA 5F9FA 1JALA 1MO5A 2GJSA 4JBWA 1Z07A 3VX3A 4N0EA 1G17A 2JASA 4ITRC 1US8A 1IBRA 5EP1A 1IM2A 2R6FA 2FSFA 2JLZA 3K70D 1B23P 2REOA 1YVDA 3Q9LA 4LY6A 4BFXA 4HAYA 4GZMA 4NCNA 5L3RA 1NY6A 1E9FA 2P6UA 4DCTA 1OFTA 3H86A 1KGDA 1KK2A 3QKUA 4W5JA 2WWWA 4F4JA 5CM9C 2IS6A 2ZS7A 1CJTC 3NDPA 2CL0X 2AXNA 4EPRA 4Z54A 1NJGA 2AFHE 4H1VA 2F9LA 1NG1A 1XTIA 2XAUA 5DHFA 2J9RA 5B64A 3LX8A 3U6BA 4RY2A 1WA5A 4UJ3A 2WSSA 1F2UB 1OB5A 5JSZB 2HT6A 1XTKA 4YXWA 4M1YA 1AN0A 2XSZD 1N5KA 4A9AA 3DOFA 1Q0UA 3AKYA 4C30A 2QY9A 2OAQ1 4OHVA 4DC9A 5HKKA 2O8EB 1XZQA 4JLNA 4Q9IA 3I62A 5HZHA 1E96A 5IHPA 4DVGA 1Z6GA 2CLDX 3EASA 3QE0A 1N0UA 3SJCA 2Q3FA 4PR0A 5FOWA 1J2JA 2ODNA 3SOPA 1EX6A 2GZHA 5L3VA 2ZUDA 5TXGA 2IXGA 1G8HA 2Q0HA 1KHTA 1KZGB 4POAA 4OHYA 1NN1A 2IT1A 2X2FA 4B75A 2ZU6A 1NKTA 3AF1A 5D3MA 5FL7A 4KYUA 2CMKA 221PA 1KI4A 1XJQA 2P2LA 2YVUA 2OZEA 4FMDF 2IEYA 2V1UA 5BYKA 3U7EB 2IF0A 2YHSA 4F4CA 2CVFA 3OEHD 1FL9A 2VSOA 4Z1MD 3EARA 4EPYA 1XRJA 4PZZA 4RKFA 3GFOA 1NIJA 3FTQA 2AX4A 4TLBA 4AIIA 4D0GA 1KJYA 3HR8A 4TTRA 4DKXA 2PX0A 4ARZA 2CJWB 3H4MA 4IFBA 2EU8A 4M8NE 4WA7A 1GKUB 3MWJA 1VG0B 1PUJA 3ICQB 1E4VA 2BM0A 1JNYA 3C5CA 4FCVA 4BZPA 4DIDA 1OH7A 2QMHA 4PC3A 5AK0A 4BRUA 2QRNA 1ESNA 4K81B 4NZYA 4GNKA 4JKIA 1E32A 2IYQA 3FB4A 1CULC 1U99A 1EFHA 1W4AA 3EIQA 4M9ZA 5FTKA 1KI8A 2FF7A 5LB4A 1OW3B 4KBGA 1IN4A 1KK3A 5L3SA 4NDZA 2C9OA 3CZQA 5J4YA 1Z63A 2JLQA 3DKVA 1FFHA 5CB6A 1P2VA 4DLRA 2IL1A 1Z6YA 3U3OA 2CK3D 2VYFA 2MMGA 4PZYA 721PA 3PIRA 1NMZA 2VLIA 4Q4HB 1KO8A 1OJLA 1N6HA 4RD2A 4ERNA 4TYWA 3V00A 5JHHB 2BM1A 2OM2A 2BBOA 4N1AA 1AIPA 2F55A 4QJ5A 3QEJA 3GLGA 3CNNA 3MG9A 2RH5A 3GMTA 4FMCB 1T0HB 4WZAE 3U4QB 4Q03A 2QBYB 2X19A 1AKYA 2A5FA 5AUPB 3NC0C 1M2OB 2P0EA 3RAPR 3T1TA 4N0DA 1M34E 4YLGA 1TADA 3Q7PA 1WBDA 5LD2B 3C8UA 5J4VA 3BJIC 1BOFA 4TMWA 4IXNA 1E1RD 2WJJA 3KQUA 4QJ4A 5KNDA 1GILA 5D3MB 1KI6A 4FWIB 3AM1A 3SU8A 3SHWA 3UMRA 2Q3HA 3WHKA 4B2LA 1W0JD 1D9ZA 2OLJA 3CX7A 3U44B 2AK3A 4R2IA 4PSVA 1OXVA 1T9HA 2A5DA 1XBTA 4FW9A 5JI3E 3X1XA 4A0HA 5DN6D 1ZM3A 5CK5A 4YXWD 1WXQA 4DDVA 2C9YA 5KHOC 2F1JA 3EZ7A 2R6DA 4DCUA 1L4UA 1DOAA 5CITA 4B3XA 1IY1A 1SVLA 1LNZA 1UF9A 3U2QA 1N5LA 4NYJQ 2WWYA 5IRCD 5LB2A 1NKSA 1RPZA 1A7JA 1B0UA 1JAHA 4KO8A 5EE5B 1M74A 2IYVA 5CYOA 1G8PA 2A2ZA 2YINC 2QAGB 2O5VA 2GXUA 1HT2E 3GEEA 3L0PA 1N2CE 2FSGA 1II8A 1TF7A 4OJKA 1VHLA 4LHWA 3QG5A 2AD5A 1BMFA 5LDDC 1D5CA 3P26A 2PH1A 2AD1A 3VKGA 1A2KC 1T0JB 1LFDB 3CRRA 2QROA 4UNQA 1G3MA 4M1SA 4V03A 3WYAA 3K0SA 3NBXX 3PG5A 4EFMA 4A1FA 5A0FA 1YZKA 4P4SA 2HF8A 4BLOA 2CBZA 1Q3HA 3WMFA 4OQXA 1G8GA 1Z2AA 4CF7A 1F2TA 1CJKC 1ZM4A 3M0EA 4A2QA 3CRMA 4G5RA 1P2TA 2FFBA 2QM8A 2QZ4A 1KDTA 5H8WA 3B5JA 3PEWA 1U0HC 4M1MA 4DWJA 5L3QB 3JZMA 4Q66C 1YRBA 4FWTA 5LPNA 4O0MA 3THYB 3DM5A 3A58B 2WAXA 3CZPA 3NWJA 2FSIA 4WIAA 1H8HD 2IUTA 3C15C 3ZH9B 3AF3A 2AWNA 2EW1A 1E1RA 3P20A 4RZ3A 2HT1A 2DFLA 1OPXA 1UFQA 2PZGA 3CWZA 3C4JA 2QEQA 3GD7A 4HEJA 4RD4A 1AJEA 3MJHA 4P4TA 5EXTA 2L0XA 3AKEA 1W0JA 1N6LA 4A0RA 1FQJA 3OZXA 3QBTA 5HCIA 3PEVA 4MUAA 5TVKA 4B76A 4W5HA 1X1SA 3FHOA 3HYTA 1RE0A 1EFRD 3BH6A 3U7FB 3GLIE 1BYIA 1E3MA 2ZAOA 3RRMA 1AA9A 3M6AA 4D25A 1OFUX 2HF9A 3NH6A 1T5IA 4IEEA 4FXPA 4BECA 1MV5A 4JSTA 1G8FA 2JDID 4KSBA 2DWPA 3I1FA 2GK7A 1YZTA 3UWKA 2ORWA 4PQYA 4PHFA 4YC7A 2OBNA 1P61B 1S9DA 1SXJA 3KXIA 2A7QA 4PQRA 2I3BA 1G64A 2OG2A 1OIVA 1TUEA 1KO1A 5DSZA 1CLUA 1P62B 2J7PD 1EX7A 3HPQA 3MLEA 4QHYA 1R7RA 1VCIA 2E1RA 5GADl 4URZR 1G18A 1VIAA 3BC1A 5AJZA 3KTAA 3QI2A 4P4SB 4PHHA 2ZM5A 2FG5A 2ONKA 2FPMA 1FPMA 3ZS8A 2G1KA 3UK6A 2GBLA 2VRWA 2ZJOA 4QBHA 5KOYA 3EWAA 1G3IA 5JHGB 1MT0A 2JLSA 2IUSA 3CIOA 2C78A 2WTUA 3ZZTA 4AYXA 1C1YA 1UJ2A 1UKEA 3C41J 4IEIA 4LJ9A 3WNDA 2CHVA 1XF9A 3W9YA 5FBVB 1KYIA 2ZI7A 2QAJA 3WXMA 1SVKA 5EJEA 4HUQA 4R2HA 1SXJE 1FNMA 5FR2A 2GJ8A 4GZLA 1M1YE 4I1VA 3X1ZA 3HJNA 3T1OA 2HEIA 2GAAA 4RFVA 1CRPA 2GKSA 3UWOA 1RRGA 2J0UA 4HZIA 5SZIA 4LWZA 2VP6A 1G7RA 4NBSA 1NSTA 4XVUA 2VSXA 3DDCA 3VR6A 5J47A 1HQYE 4HAZA 5JCZA 2RB4A 2O8DA 1W36D 1JR3E 5CJ2A 4OI1A 3QXCA 3LW7A 1NMYA 5G40A 4XIGS 1OXXK 1L7VC 4JBYA 2GXQA 1BIFA 3X1YA 2ZRGA 1DARA 3SQWA 5F3WB 2P6RA 3TK1A 5DISB 1XZPA 4PSKA 3RS3A 4AKGA 2ZI3A 4KBFA 4QL3A 2A5YB 3RS5A 4DDTA 3ADCA 3AVWA 4OI2A 3M4YA 4BLRA 3O8DA 3ND8A 3FHCB 3KQLA 4HLDA 2BHRA 2ZROA 3AVQA 3OEED 3UIEA 3VKWA 2C77A 2VBCA 1R8QA 3VHXA 1N25A 1Z28A 4JT2A 4HLUC 4BASA 3Q72A 2CLSA 2XB4A 3NXSA 1G19A 3BOSA 4A4DA 2REBA 3B2EA 2HUPA 2O0KA 1RKBA 1G8YA 3EIEA 3L8YA 4YDSA 2O8BA 3GEHA 1E0AA 1XXHB 2R6CA 2F1IA 2FFQA 3W3AA 1AQUA 1XU4A 4A82A 1W0KA 2IYYA 3R20A 2OESA 2GJKA 1COWA 4IKEA 3L2OB 5ANRB 5DO9A 4TMKA 1OFIA 4KFUA 1A82A 2YOFA 3HPRA 3K70B 1HV8A 4MITA 3AVPA 4B32A 4ESVA 1GP2A 2DHRA 1G20E 3K09C 1ZM7A 3QKRB 3AGPA 2ZE8A 5KYKA 1X6VA 4TLAA 3LLUA 2D3WA 4IOJA 4YDHB 2NG1A 1K6MA 1TNDA 2QU8A 4G5QA 1S4QA 5A5GA 3TMKA 3BS4A 1XJ0A 1N5IA 3C5HA 4D0LB 2QE7D 2O8DB 2Z83A 4QG7A 3ZQJA 4QOSA 4C2TA 1F48A 5FPSA 4IDHA 1W46A 1CJMA 4HSEA 4A92A 4E03A 5HR5A 2H1LA 2KSQA 1FNNA 2W0SA 4L5BA 4O3MA 5D3QA 3ADBA 4DUGD 1CTQA 3QF4A 4PAMA 4G01B 2Q3MA 4QGGA 3RRYA 3ZD7A 3BBPA 3LFUA 4Q1BA 2FOLA 2N42A 1JQJC 5TB5A 1PLJA 3PENA 4OI0A 1GVNB 1DEKA 3B60A 2OFWA 4KAXA 1DG3A 4U7DA 4EQ6B 4QGAA 5C18A 5JWRA 4AKIA 3SHFA 3QBVA 1OSNA 4B3FX 4ARZB 3TBKA 2HCBA 1ZAKA 3KQKA 4F93B 1P2UA 4A6XA 2A9KA 3K0CA 4G5SA 2OILA 2FZLA 1FMJA 4DCVA 4JLOA 1NVVR 1T6NA 4HB3A 4Q9JA 1GITA 4II7A 2BDTA 3OEEA 1LF5A 2G77B 3PQCA 1UKYA 2PT5A 5B57C 5CLQA 4GP7A 2B21A 4ZCMA 4XWAA 3DZ8A 2EVWX 4DBLC 2Q9AA 4TL8A 1XEXA 3LVQE 1KAGA 1XCMA 2IHYA 2RGNC 1GM5A 2G6BA 3PXGA 4B3BA 4ZV4A 1G9XA 3MFYA 3GJ0A 4NKRA 3VQTA 1P6XA 4DSTA 1F6BA 5EP2A 1EESA 2H5EA 2KI5A 3A4NA 3EW9A 4LX0A 2Q21A 4MKHA 121PA 4WOPA 1WBBA 4NYIQ 2XB2A 2I1VB 2QG6A 3QVVA 1E2QA 3FMPB 4JL8A 2GZDA 4TMZA 3REGA 3VR2A 2ZRMA 5BN5A 3I61A 2GCPA 4TLDA 3TSZA 4IDNA 3WNCA 2PEZA 2N46A 2WIBA 1X86B 3QXSA 2YJTD 3EPLA 2Z4SA 3A4LA 3L0OA 1FZQA 1TU3A 1E69A 1WB9A 1UDWA 2AR7A 2AKYA 1N3BA 4TL7A 5SZJA 1S2MA 4L4UA 2C2HA 2IK8A 4NYMQ 1SXJC 3PV0A 1Z0FA 3T15A 2RCNA 4CGZA 4B73A 2PJZA 4EPXA 4Q1EA 5KDLA 3UPUA 3BH0A 2QUZA 2VP9A 3RVBA 2RHMA 4CEIB 3A1SA 2CDNA 5EQTA 4PAQA 3PEUA 4UXIA 2UVQA 2QSZA 1E1QD 2VHJA 2WWFA 4FMCF 5EUQB 4XTRA 2GBLC 3TH5A 3CR8A 2ZITA 4C0HA 3ZGXA 3U7HB 1Q44A 2ATVA 4Q7LA 1TQ2A 2F9MA 2OV2A 2YYZA 1J8MF 1HEIA 2OAP1 3QUSA 3KKPA 3PUYA 1Z0JA 2QT0A 4BRWA 4OK6A 1U0LA 3IEVA 2ZTSA 4DLZA 5G41A 2G3YA 3VX4A 2QSYA 3ICEA 1JBKA 2BEJA 2Z6VA 1MRSA 1TQDA 2YNMA 3PCRB 5F9HA 1TX4B 2QAGA 4L15A 5EXSA 1G5PA 2FFAA 1VYTA 2ZSFA 2ZRDA 1Z6AA 4BE7B 4CW7A 2B6HA 2ZE6A 1K5GA 3TQCA 5FFMA 3MWLA 4NH0A 1VG1A 3S1AA 2YWGA 3ADKA 2DFNA 3EZ6A 3CPEA 4RFSA 1XP8A 4JT4A 4RZXA 3U44A 1XEWY 2X8AA 2RKOA 5FBLB 3CBQA 3U3KA 3ZVNA 1I4LD 2D7DA 2XTMA 2JGNA 4K8OA 4TL6A 5KDOA 5EP4A 3ZIAA 3B1VA 4ZIRA 2G0TA 4M53A 3I5YA 4YQFA 2V7QA 1JR3D 1UEJA 3LRPA 2FSHA 3LX5A 1TF5A 3TR0A 2BC9A 3ZLJA 5FBRB 2WBLC 3GJ6A 2CK3A 3RSOA 4B3DA 4ZKDA 5TY0A 3WP0A 3Q5DA 5DNYB 4OQFA 3QKTA 3TSOA 5IDVA 1II8B 2D62A 4LYHA 4CEIA 3OFNA 4A8JC 2QMUA 1F3OA 3ZS9A 1LS6A 4UQOA 2QQEA 3W5JA 4FD2A 1NVXQ 3G82C 4NMMA 2ZSEA 1D2MA 2C03A 5GJBA 1ZRHA 2R62A 4LJ6A 2HV8A 3WYFA 1N6RA 5AJYA 1ZP6A 2JATA 2ZUBA 4DT1B 2V9PA 5TDHA 1ELOA 2QTHA 4TMTA 1JEDA 4Y0AA 4URUR 1LF0A 2R44A 2P3SA 3B85A 4NL4H 3TUJC 3DM9B 1Y3AA 4UNRA 3U61B 1SXJB 1G6HA 2O8CB 1RW4A 2EFCB 1WP9A 2PCJA 3CRVA 3ASZA 2V6IA 3UG7A 4XWKA 1KJWA 1R0ZA 2GNOA 4OK3A 4BLSA 2FPLA 4JVMA 1VYUA 1OH8A 3D6TB 3BH7A 1E2DA 1OIXA 1QG2A 3CKLA 4M4SA 3VR1A 2ATXA 2EFGA 4HUTA 4C7OB 2IBMA 1CJUC 3A6PC 1Z2CA 3DZDA 1NVUQ 2FNAA 3I72A 3MD0A 4DXAA 5JEEA 3GLFE 5JRZA 2H7VA 2C95A 2BMEA 3FMIA 1KO5A 1OXUA 3C14C 4Q4AA 2NPFA 3L0IB 4OHWA 2UZIR 3O8RA 4AYWA 4A36A 5TMPA 3C7KA 4TN1A 5JRJA 3EPKA 4M22A 2YV5A 1TAGA 2PX3A 5J4KA 2WAYA 2QORA 2F3TA 3SR0A 4QHTA 1JPJA 4TWZA 1G5RA 1HE8B 1GL6A 2FDCA 5JWHA 4LYAA 1NNEA 3OIUA 3I4LA 4OQLA 2IYWA 3RSLA 2E87A 5KO2A 3AKCA 1RJ9B 3IKJA 4D4JA 4JJZA 1TEXA 2WM9B 4RVCA 1UBFA 3TVDA 4TT3A 1P2SA 4NTZA 2Z4RA 4JSYA 2BBSA 5JSZA 1N5JA 4IDQA 3RANA 4M1WA 1FP6A 1G291 3OE7A 2V6JA 4PC1A 2ZJ8A 2WKRA 1BMFD 1GG2A 1RVDA 2C98A 1ZNXA 2GDJA 3NBYC 3LAWA 4XTCS 5BQ5A 2NO7A 5BWMA 1R0XA 2DR3A 1DTSA 4GOJA 2IWHA 1T4GA 4TTPA 3SC3A 1G6OA 1Q22A 4KSCA 2SHKA 5EZ5A 3F0TA 1X1RA 4IXMA 4D80A 4US1R 1DAIA 2IEZA 3W6OA 2NIPA 4L16A 3WP1B 4JLJA 1ZU5A 3L0SA 2REXB 3ADDA 4KVGA 4IDPA 2YOHA 1EG7A 1KSGA 1JJ7A 1W44A 1VIYA 3OIWA 3TSWA 2WSSD 3JVVA 3A1WA 1AGPA 5FOSA 1LW7A 2QGNA 1BH2A 1TQ6A 1E2IA 1QF9A 4TYPA 4V0OA 1Z0AA 3T5GA 3T34A 5FTLA 2IYUA 2NO0A 4V0NA 2ZR9A 5IT5A 4TQUS 3AUYA 3P27A 4US2R 2JDIA 4QKQA 1ZINA 2HDNB 4DDWA 4CEHA 2IW3A 3FFBA 4QGFA 2WMNB 2ZANA 2HXYA 5H70A 5CB8A 2HYIC 1FW6A 1Z06A 1NLYA 1QBKC 1ZJ6A 4DEXA 2O8EA 3LXRA 5DYIA 4P31A 2A5JA 3EA0A 4NHOA 1YJ5A 2CVHA 2OUKA 2PMKA 2MMCA 3MJRA 2PLRA 5C1BA 2BCGY 1NSFA 1SKYB 4TSFA 3UMSA 2J0VA 4I4LA 3LDAA 1PZNA 4LHZA 4JLPA 5CM8B 3Q8XB 5KU1A 2XTNA 4I1SA 1EFRA 2ZJ5A 4DZZA 1SQ5A 1GRRA 1HA3A 1O3YA 3LQQA 4WAUA 1J7KA 1U90A 2IXEA 1I2MA 3GLHB 1Z22A 3NIBA 3V9PA 3N2IA 3QPWA 2NZ8A 1Z08A 3KJHA 3VMFA 2A3RA 1KIMA 3U5ZB 1QVRA 3DEFA 1E2FA 2IYXA 1FOEB 1KMHB 3RDPA 1ZC3A 5KSPA 2VF7A 4OK5A 3REFA 1KI7A 1V5WA 3KQNA 1DAEA 4AURA 3LW8A 4UJ5A 3U4QA 2V54A 2HJVA 2WOJA 2I4IA 4EDHA 3AP1A 4NP6A 3I32A 3B9QA 1XX6A 1WRBA 1MABB 2ZI6A 3IHWA 4MGIR 1MRNA 2ZRBA 4V0KA 2AN9A 4B43A 2LKDA 3UATA 4LJYA 3THOA 2TMKA 3WY9A 4PX9A 2NZJA 3B7GA 2W2VA 5JZVA 3HP1A 3W3ZB 2R2AA 1BYUA 2GZAA 5L3SB 1U98A 4P33A 3BD9A 4YMUA 2PBRA 5IF9A 2Z0MA 3LBIA 4LZZA 4AYTA 1P4SA 4GP6A 1VCNA 1LS1A 3SI7A 4M1TA 2JCSA 3RC3A 3DMDA 3OE7D 5DYGA 4Q9LA 2KBEA 2WJYA 1N0WA 1PV4A 2IC5A 4JZKA 3R9IA 3B82A 1E9DA 2QA5A 3A36A 3K9NA 2J0SA 1XFAA 2XXAA 4ACAA 1XMIA 1VPLA 3TQFA 5DI3B 1KO7A 1PVOA 4MDFA 2GETA 1OXTA 2OCAA 4OKSA 3X1DA 2VSFA 1E2GA 4Q1CA 1E0SA 4AC9A 2NOAA 1DAMA 4ZI2A 1YZNA 2X77A 5C2JB 1A4RA 1AZTA 4KJZA 2CEAA 3P1JA 1XNJA 3B1WA 2FWRA 2O0JA 3UMFA 1DO0A 2IYLD 2BKEA 2C04A 1ZYUA 2RGAA 4ZDKA 4ASUD 2QP9X 2ZRNA 4IOLA 1LB1B 1W1WA 1AGRA 1XMSA 4WXRA 5JLJA 4Q47A 5C4MA 2XGJA 1ZCAA 3WYGA 3EPJA 2J3EA 421PA 2ZYUX 5CDFA 4QHSA 2O8FB 1XEXB 5FBWB 1AS2A 1W7AA 1S1MA 5EXXA 5E95A 3SFZA 2F6RA 1EFCA 1GKYA 1DE0A 1JB1A 1T3HA 4RJLA 4QFMA 1QZXA 4IHQA 5JFGA 2FJUA 3LVRE 1W4RA 3W5IA 4TMXA 3SYLA 3IHLA 2IYRA 4MDEA 3THYA 3AVYA 1CEEA 4DSOA 4KHZA 1W47A 1XTJA 5BXQC 2W2XA 5HPYB 1OB2A 1XTQA 2PL3A 2HYDA 2ZRAA 3CH4B 3KB2A 2JEOA 2RGEA 1PUIA 2P5TB 1SHZA 1E2MA 5AUQA 4E5UA 4ZI3A 3QENA 4KODA 4OL0A 4XJXA 4TYYA 4BLTA 1NBMA 4F38A 2QP3A 3RS4A 2C5LA 1CP2A 2O0HA 2WJGA 4ZCLA 1Z6TA 2OXCA 3IBYA 1IN7A 4KYIB 1EFTA 3AB3A 4ON9A 4PO1A 5CLLA 2JLYA 4MYHA 2XOKA 1Z0IA 1XMVA 1IN8A 1RZ3A 2BJWA 3K9LA 2IS4A 1UM8A 4FMBB 1IQPA 3AF0A 3SJBA 3K09A 1AM4D 3QKSA 3THWA 1L2TA 1H8HA 2A30A 1IJFA 2BEKA 3BFKA 5LD2C 4C0BA 2ZXUA 3AVUA 1E2KA 1NVVQ 2C9CA 1QHIA 3OIYA 1P9NA 5DI9A 4WW0A 4OYHA 1AS3A 1GNRA 4WZ6A 3LA6A 5J4HA 4JJKA 2OCPA 3QPVA 4F92B 2ZYWX 2AHOA 1OV4A 3MUFA 4PC2A 4JLBA 2OLKA 1NBME 3RRNA 3K0EA 1XPUA 2DFKB 1DAHA 1P60A 4KI0A 1P75A 2P6NA 5GVRA 3TW4A 1UKVY 4PPNA 4RKEA 5FUVA 3VAAA 2QPTA 4GT1A 2GESA 5C4GB 3TAHA 1ZW6A 1CR2A 1E2LA 1JECA 1G41A 1MOZA 5AJVB 3CX8A 3IPXA 4JYCA 2IXFA 3X2SA 3GCGA 1NG9A 2Q6TA 3RRZA 2RGXA 4OHZA 4LBWA 2G88A 1JXMA 3LV8A 2RMKA 3QG1A 4D4KA 3NEJA 4UKDA 2P65A 1DG1G 1KI1A 4E22A 5B58C 3H1TA 5IK2D 3VR3A 4Q4HA 2XEXA 3TVTA 1DELA 2W6ID 3T35A 2GCOB 2W0MA 4H1UA 2WJVA 4HI0E 5K8TA 5KPDA 3ONWA 3ZVRA 4JL5A 4FINA 3IO5A 3CR7A 4LJAA 4TL9A 2K5UA 2VA8A 3IEUA 3AP2A 5DLQC 5SZHB 4NONA 1J99A 2CE2X 2ANCA 1CKEA 1GOTA 2WOOA 2YC2C 3B13B 3JZAA 4L9SA 4Q00A 1NI3A 2JLVA 2ZYTX 3O8BA 1KDRA 4C2UA 4LBVA 5CYPA 3U3MA 2RHDA 3PUVA 4DLVA 2KE5A 3BB1A 1G1MA 2BOVA 3GLGE 4E07A 2YWEA 4HYYA 4PPQA 5FPYA 3EPHA 2OSBA 2VP4A 3T12A 3B6EA 4PC6A 4HLUA 4NCJA 3C16C 4LC0A 1P3JA 3AVXA 4PTLA 3BORA 1RFLA 4GDFA 4PO8A 5JEDA 4HUQB 3AP3A 1KJZA 1OKKD 5EUMA 1L4YA 1KZ7B 1R8SA 2KB0A 2LWIA 4Q19A 4QC2A 1E2NA 2ODWA 1PLKA 3EZFA 3FKSD 3IIJA 2YWHA 3KXLA 4FMDB 1VG9B 4KU4A 4BEBA 1E1QA 4GPTA 5B2ZA 5AUNB 2ZSAA 2ZRJA 4U5XA 4RZUA 4BFYA 2J1LA 1NBMD 2Z43A 4MRVA 1OFHA 5AJWA 5FH9A 2UKDA 3CW2A 1ETUA 3D8BA 4MYTA 3CM0A 1Z0DA 1V43A 2XZOA 1WQ1R 3HU1A 3JVUA 3SEAA 2WJIA 2OEPA 3DOEA 1XPOA 1QDEA 2VQSA 1YR6A 1E4YA 3GJXC 3LWNA 3PJRA 5EZ6B 1E2EA 1KI2A 4URYR 2GJ9A 3EIHA 3L82B 2F43B 3ZD6A 4Q5IA 1KKMA 5DI3A 2GCOA 4LJ5A 1C9KA 2F1HA 4B47A 1TUIA 4C7OA 2Z5FA 3TW8B 1VKJA 1JQLB 2WWGA 4PPFA 1W2HA 1IXZA 3PUXA 4LBYA 1S1CA 2GXAA 1PLLA 4GOXA 3OFND 4I99A 4WVFA 1CR0A 2ZRHA 5A4JA 3R7WA 3HDTA 4MRPA 5JS8A 1RYFA 3TIFA 1E0KA 4F7WA 5GJVC 2JJ2D 1IJEA 3A37A 2NMVA 1KDPA 2RGBA 3NBZC 2ORIA 2V8OA 4RSGA 4PQFA 4Q02A 3PFIA 3FMFA 5K8IA 1GKIA 4LC1A 4G5GA 1I4DD 4NYJR 4O2LA 5AUOB 1TPZA 2AXPA 5J5CA 1M6NA 1Q1EA 2OXRA 2BIFA 5FBQB 4D2IA 3U60B 3KKNA 2VHQA 1KKLA 3OESA 521PA 2VHCA 3SN6A 4TTQA 3SE0A 2FGJA 5JBQA 1P9RA 3O47A 4JMPA 3HYRA 2XSZA 1GUAA 3AQ4A 4YONB 4GMDA 5HKKD 3AVVA 2MSEB 3BGWA 3RYTC 4BFWA 2QM7A 4Q4LA 1H8EA 5E4FA 3SDZA 3UG6A 4US0R 2ZR7A 1ZD1A 4NCHA 4W7SA 5G53C 4DUGA 5DIFA 2CE7A 1RC8A 1KAOA 1LY1A 2CHQA 3FKSA 4IVPA 4LK2A 4AD8A 3FHTA 2IS1A 3LH5A 1XWIA 3NHBA 2QT1A 1SVSA 1II0A 3DHWC 2J41A 2J7PA 3OHMA 1ZMXA 2H57A 1E9RA 4Q1DA 2ZRFA 3ASYA 1YHNA 2ZJYA 4P32A 1NLFA 2IWRA 1H65A 4B2PA 2BKUA 4LHXA 4PFSA 1UBEA 2D06A 1U8AA 2HLDD 2UZ3A 1DADA 3GP8A 3TJZA 4KFTA 3D7MA 1ZNWA 4KFSA 1OLOA 2VIIA 2QENA 3IQWA 1Q57A 1E99A 3A4MA 1W49A 4CEHB 1OKKA 2GK6A 1G4AE 3G5UA 1S8FA 3RS7A 3U3JA 3R9WA 3B1ZA 4M9SA 4WBSA 4LYFA 2OCBA 2KBFA 1IN5A 1DVRA 3K0CC 3LLMA 4QBIA 4TT3D 2OFXA 3L43A 3WRXC 1Z47A 5KPJA 3VR4A 4LV5B 4AG6A 2F1RA 4ZPXA 4MRRA 1J70A 5FL7D 1IHUA 3ZZ0A 2ZVQX 1GSIA 5FOVA 4UNSA 1OHHA 2QRZA 3Q7QA 4P0TA 2W58A 5EE0A 5BW8A 4IJMA 5KDDA 3SYKA 1KOFA 1TL7C 4DJTA 1P73A 4M1KA 3W6PA 4B74A 3T61A 4I1OA 1E2HA 2ZYVX 3GQBA 1E9CA 4ZDIA 3DO6A 3AVOA 4Q7JB 3KUCA 3KXKA 4JLMA 1Q1ZA 3BAFA 5KSZA 2VPPA 4B3GA 1OT3A 3CONA 4DLSA 4BLQA 3FFAA 5FOUA 1AKEA 3B8HA 4NU0A 1FP7A 1H8ED 4O25A 4KLZA 3R9XA 5BYJA 1WMSA 2W83A 4B6EA 3WNBA 2X1VA 2BMFA 3CPHA 4Q4JB 5EE1A 4EJSB 5J4LA 1U0JA 4TYNA 2VP5A 3IGFA 4DDUA 2HCJB 4TZ0A 2VO1A 1T5LA 3AF2A 4L8GA 2GA8A 4Z8XA 4LV6A 1NN3A 1XTRA 2MSDB 5CJPA 2D74A 3QY0A 5JCPA 1GNQA 2EFDB 1CIPA 4R7ZA 2WKQA 3IBGA 2J7KA 3A8TA 4CYMA 1E9SA 5CIWA 2EYUA 4JKYA 4UXJA 3ZZUA 3GLGB 4AG5A 1F60A 2JLWA 4CDGA 1G3QA 2GXSA 3KDSE 3VR5A 4KVAA 5FOXA 3VU9B 3FWYA 2ZSDA 3RWMB 3U6KA 3FDIA 4N3NA 2XXAB 4HZUB 1R2QA 2PCLA 3T5DA 1GZSA 4BEJA 1Q20A 5BN4A 3TE6A 4YMVA 1VCOA 5JI2E 2PZEA 1GFIA 3GJ4A 2QN6A 1KY3A 3QOFA 3BE4A 1P72A 1N6NA 1FUUA 3KKMA 4P3YA 1HTWA 4DIEA 1UPTA 1QHYA 1R0WA 1SHKA 4XD7D 3VNUA 2AK2A 2J0QA 2F7SA 2NO9A 2GWHA 1ODFA 3AEZA 4J0QA 4TSFD 3I3SR 621PA 3V4RA 1PJRA 2ANBA 3ZIAD 4PANA 3EZ2A 2ZRIA 4I1UA 1EFUA 1ZM2A 4PHGA 1IAQA 5AJXA 4Q18A 3GLIA 1A5TA 1GRQA 2HLDA 1WCV1 1XD2A 2OHFA 2PLFA 2ZJZA 2YZ2A 2QQ0A 2RGDA 1G3RA 1QVAA 4P4UA 1G5TA 2GEVA 4CVNA 4RD1A 4URWR 2O8FA 2ONJA 3GEIA 2CCKA 2ZETA 3CB4A 3GFPA 5DH9A 4DB4A 3SZRA 4BWYA 4DT1A 4HAUA 4PXAA 4JVLA 3SBEA 2FV8A 5CIQA 3AV0B 3QXJA 1HE1C 4U02A 2FN4A 3QIAA 1MKYA 3I92A 2DCUA 1X8JA 1US8B 4MH0R 4A8JB 5JWOA 1XD8A 2NQ2C 4DCSA 2ZE7A 1UBGA 2IF2A 1OHHD 3J81k 3TGPA 4F91B 2R9VA 4Z51A 1SVMA 1ZD8A 1K8RA 1E2JA 1T91A 3B78A 2ZR0A 4LSGA 1ZCBA 2GHIA 2ZS9A 3I8XA 4ZO4A 1ZBDA 2R6AA 1YE8A 1K5DA 4A15A 3VU9A 1ZVQA 1BS1A 3IO3A 1N6PA 1NY5A 2GILA 1FQKA 5GVSA 1HQCA 4DHEA 4LRWA 5G3ZA 5DE3A 1S3GA 3KZ1E 4Y0VA 4PAOA 2FZ4A 3QKSB 1TTTA 3K0AB 3K9HA 3THWB 3MRSA 2J5XA 2BV3A 5E7JA 2EFHB 4LBZA 2IHBA 2QMOA 2QPOA 1NJFA 4UNNA 4EFNA 5FUXA 3ZQ6A 2KWIA 3EC1A 2QAGC 1GRNA 1MO3A 2BBTA 1RJ9A 3RNLA 1YU9A 1OXSC 2P5SA 4Q9KA 1L8QA 5K8UA 3QXHA 2FH5B 4RZ2A 2AL7A 3GJ3A 3RS0A 3TUZC 3BRWD 1E9AA 4HDCA 4KXFB 5F2EA 5JMTA 4LJ4A 2PEYA 4C0SA 1UADA 1F2TB 4JL6A 4RFSB 3M1IA 4M0LA 3CNLA 1MO6A 4EUNA 1G7SA 4D4LA 2WWXA 1FTNA 3BXZA 2WV9A 4JLAA 1ESMA 1T3LA 1JEEA 1FMLA 2RGGA 1A2BA 2VTKA 2ZUCA 4V0MA 3LO5A 2FA9A 5B30A 1UAAA 2QBYA 1CF4A 4JLDA 3NBFA 4MQBA 4A8JA 3RWOA 4GBMA 4URVR 3NG1A 3AVTA 2PT7A 2BBWA 1RYHA 2QTFA 4XD7A 4U00A 3T1VA 4LV8B 1W2GA 4BZXA 4AY2A 5H68A 1XJCA 3EX7C 1YZGA 4Q1AA 3SYNA 1YRAA 1KI6B 2ZS8A 2D2EA 3LD9A 2PZFA 5FI0B 3NDBB 4TZ6A 3FMOB 4RD0A 2CCGA 3G0HA 2N1BA 2X2EA 1LV7A 5G3YA 4NYIR 2WZQA 1J90A 1XXHE 5L8VA 2ZRCA 5UKDA 2DBYA 4KCGA 3DVLA 3GJ7A 2VHTA 1E6CA 2BMJA 4Q01A 1QHHA 2AKAB 3VKHA 1IOZA 2D7CA 3P32A 3F3YA 4LHYA 3SJAA 2C96A 4DLYA 3IILA 4B35A 1RIFA 1D2NA 3THXA 4C0LA 1SZPA 2V7QD 3SNHA 5H1YA 1QHXA 4DSUA 4PZLA 1OIWA 3MWYW 1JPNA 4G3XA 4Q4JA 2XZPA 3QEOA 4ILEA 4EJSA 1BO6A 1OE0A 5JECA 2YWFA 4C0JA 3GJ5A 4O2RA 3TRFA 4A0GA 2YKGA 3R7WB 3R8FA 1JI0A 3W90A 1Q21A 2H8KA 1CR1A 1SGWA 4HB0A 5IK2A 2OE2A 4WZBE 1W5SA 4C3ZA 1FTSA 2QTVB 4Q21A 3TUIC 2WMOB 3CH5A 3Q85A 2AWOA 4CT4B 3HR7A 5TARA 4ZDJA 4QM7A 4D6PA 4GL2A 4B6FA 1DAFA 4LPSA 3Q5EA 1EXMA 3TKLA 4QNMA 1W0KD 3CRW1 3ZVMA 3FYHA 3KJIA 4XWOA 2NO6A 2XJ9A 3GLHE 3OF5A 3WMEA 1VECA 4TQ9A 1KI9A 4UXHA 3IPYA 4QJ3A 1M7BA 1MO4A 3LBNA 4Q4AB 3CLVA 4EKDA 3K70C 5K8LA 4OBEA 4XSHA 1UDXA 4BFVA 2J59A 5LBIA 4M9XA 2JIZD 3ETLA 2P67A 4R98A 5GJWC 3SS8A 1N6OA 4AI6A 1ZU4A 4EAQA 1Z5ZA 4D81A 3D3QA 2ZJAA 3LQRA 2E9SA 1HYQA 3K0FB 2I1QA 1CJVC 4RCZA 1HT1E 5HE8A 3MWKA 3W34A 4MRSA 1ZNZA 2ZJ2A 3MMPA 4W5WA 3O8CA 1HY3A 3PVSA 1KMHA 1NF3A 3HWSA 2ZSBA 5J40A 2OCYC 2ZIAA 3BFXA 3KFXA 4A6PA 4NYMR 3I8SA 1R5BA 4RCYA 4A2WA 1Q3TA 4QBFA 3QKRA 1ZUNB 2A5GA 1W36C 4JBXA 3K1JA 4MUBA 3K9GA 3CX6A 3E5HA 4IOKA 2ZI9A 3F8TA 4CEJA 1G16A 1KK0A 4HB2A 4MKFA 3VTKA 2IS2A 1ZM9A 4LUCA 3DKPA 4YMSA 2VH5R 1DO2A 1TF2A 1E79A 2EQBA 1ZC4A 1Y63A 3FGNA 4DLUA 3SJZA 1NN0A 3BB3A 1YZUA 3IIKA 1QHNA 2W6JD 1W4BA 2WSMA 2DFTA 4GFDA 1TEVA 1S9HA 5BN3A 1F5NA 5HTKA 4C0KA 4IOMA 1R10A 3BFVA 3DPUA 1KDOA 1J8YF 1Z29A 4QXAA 3QPUA 4CT5A 1SVIA 1WE2A 3K8YA 3SBDA 4C9BA 5KSOA 2CXXA 3OAAD 3QJYA 4X8HA 3B9PA 2EYQA 3EAQA 2VHUA 1RRCA 3A1VA 3PUWA 5AR1A 1JXOA 2DPXA 2QNRA 1I4TD 1XB2A 4JYBA 2BJVA 4URXR 4DB2A 4ESHA 3CF6R 1Z83A 1GTVA 3U3RA 5KTYA 4JLVA 1KK1A 2V4ZA 3ZYCA 4ASUA 3VNVA 3EA5A 3OEHA 4Z1MA 2PJRA 3H2YA 1SVWA 1SULA 1YQTA 3KUDA 5E7MA 2NPIA 4HB4A 4BGDA 3A1TA 1KSHA 1VYVA 3DL0A 1LVGA 1VG8A 2NGRA 1KNQA 3K0FA 1UEIA 2JJ1D 2ZI4A 2ZEJA 2ZRLA 3NTUA 3K53A 3KFVA 4TYQA 2VF8A 2J0UB 3ZVLA 4F4IA
chains in the Genus database with same CATH superfamily
1KU6A 5ECDA 5TR9A 1MAUA 3DNFA 1MTZA 3G0CA 4R01A 4MVJG 4DCNA 2AMFA 1TA0A 1DIOB 1G42A 3I2JA 4MP8A 5DK4A 1QX3A 4KN8A 4WLUA 2Q29A 4FI3C 1LPOA 2IYFA 3EEIA 3ZC3A 1K7CA 1X8LA 2GBIA 4B2IA 3EDYA 2X8BA 4FFLA 4E15A 3AUXA 3UXEA 2E1PA 4P92A 4OA8A 2IVZA 2OP1A 2CNWA 2WFLA 5AUPB 5JCOC 2LRHA 4D8YA 2R1VB 3B53X 5JSHA 3LJKA 5F77A 5A1TA 3KAKA 1NOKA 2JZOA 2VXYA 2W48A 3DZIA 3B9BA 4FCWA 4GI7A 1Z4LA 4IF4A 1SMKA 2AH5A 4DG5A 4ZD6A 1ZG3A 2SECE 2IPXA 2O4CA 2RGCA 5JNRA 1JDJA 1IQUA 1QYWA 1ZXBA 4H6XA 4DEYA 3CVVA 3CMCO 4MKIA 1THTA 3E4CA 4NECA 3O4HA 5DN6A 4AUMA 3BIWA 5JW6A 4Z4CA 1DEAA 1X38A 1AQYA 2B4KA 4LJKA 1KR5A 3F46A 1IXRC 1HT0A 1JG2A 1XYYA 2X1LA 2GVZC 1ADFA 3CF2A 2DB3A 2GD2A 2W6JA 1CU1A 3SSNA 4I4TF 2B98A 3L49A 4Z3OA 4UEKA 1RRFA 1SQFA 5BUZA 5KTKA 4LI0A 3V42A 2D2FA 3DMRA 3I5UA 3PUKA 4I66A 4GEGA 4I4NA 2OBFA 4TLCA 2G9NA 1I7SB 4QYIB 3LBHA 4UCQA 5ICFA 1DXHA 4PZPA 2GCNA 1I7NA 3KHTA 2FEXA 1ZGJA 3VKFA 1CHDA 2FE4A 1SU6A 2Q3CA 3EVGA 1Z5OA 5DBFA 2XD4A 1GAWA 1XD9A 3MCVA 1JR3A 2FEPA 4MKGA 3OPYI 3DTTA 1WZIA 3EPRA 3IXQA 4KXMA 4C6RA 8ABPA 2BCJQ 1WHSB 5AWFC 5BNFA 2P75A 2FPIB 2I2XB 4KFCA 4QM6A 4IX9A 1QB7A 2KJQA 4GXNA 5JE8A 1V39A 5DT9A 4PHTA 3TQSA 3AI2A 1WDTA 2RG7A 3OICA 4ACBA 3ZHSA 4JI4B 3CLHA 1NJ1A 1VHDA 2XX3A 2WUFA 4WGFA 5LYYA 3TM5A 3A1NA 4Q34A 4EHFA 5IKMA 2VRCA 2X23A 2VHZA 3CZMA 3IT1A 3LE8A 3U9LA 4DCPA 4KBYA 4DR6B 2VBFA 4BQSA 3OTIA 2XEDA 1ABFA 2MSLA 2PQ2A 3GFTA 4M8LA 1SKBA 3BGSA 2R8EA 1JIUA 4ZWNA 1B2RA 2QRLA 1DS6A 3OWHA 4HGYA 3T3DA 3BMCA 1I0LA 2H1IA 5IUNC 1Q14A 1M34B 5CJJA 2HADA 1ANKA 2C97A 3MTDA 1K3UB 1J8VA 3TLEA 2IA5A 4B3CA 2O0LA 5HM6A 2P3QA 4L78A 2G1UA 4E7OA 5AESA 3GPLA 1Z3IX 4J94A 2HREA 3WS7A 1XK7A 3KHKA 4QPCA 2B99A 1SH7A 1ZOPA 2Z2ZA 4TXJA 5HE9A 1EQAA 2DYKA 3EZYA 1QTQA 1VL0A 4N76A 3H84A 2QRMA 1M33A 3AI1A 3KZNA 1YFJA 1L5WA 2OFPA 4EW1A 2AW3A 3BXEA 4X8LA 3PK0A 5AVTA 3C1OA 5DHTA 4XLZA 4R1NA 4XJVA 4P4GA 3DL2A 3MGKA 4NPHA 4OG2A 3R7FA 4B71A 1LQ2A 5C1DA 2FPUA 4W5RA 3RC8A 3JS5A 4ZCSA 1E2UA 3W6NA 1Q0TA 2I33A 5CW2A 4C01A 4EW6A 2I4TA 4AXBA 1IULA 3OJCA 3FYDA 4FU0A 2QPAA 5HF6A 4ARUA 3UAWA 3GUYA 1L5KA 2M6RA 2X5OA 1YR9A 2EWVA 2H17A 4CWAA 2DHCA 1CUDA 2C3UA 3OLYA 4ZIRB 4CPDA 1CDOA 3CCCA 1SXJD 1DWUA 5M04A 1X94A 4W9RA 3U7JA 1V1JA 2BFEA 3U31A 4N01A 1ADBA 4UTZA 4EG1A 5LA6A 4QPJC 1B43A 1NDQA 1Q77A 4X64B 1GPWB 4E5YA 3I9MA 4EJ2A 3IT2A 5E3JA 2FWMX 1VSVA 1E94E 4GPBA 5EJMA 2Y1LA 3WR5A 4L9WA 1XTSA 2G82A 1W5TA 3KBOA 1OF1A 4IW3B 3SHVA 5GZ1A 4HRAA 4DBZA 2IODA 4TTJA 2RAPA 1KFKB 1SFRA 3LY5A 1X8KA 4OP3A 4RD3A 1YDHA 1A5BB 1RBMA 2IH5A 5LCXA 1G7TA 2C4KA 5JS7A 3IDQA 4HAVA 4JXKA 2VDKB 4S05A 3CU5A 3OOJA 5D5HA 1KNXA 3X1WA 3ZDEA 2CFRA 4WVLA 3WISA 1XZCA 5JISA 2X6TA 2ASEA 2ZQ5A 4RJTA 1MAVA 8ADHA 1IXSB 4ZI7A 2PMDA 2L18A 2IX3A 4UE2A 1ST3A 2Q41A 3B5EA 4WZBB 1CRQA 3FPAA 3MSXA 2C1ZA 1OROA 2EJCA 1H23A 2X3UA 4IVQA 3WRYC 3D3NA 3WLNA 1RZRA 4EFKA 1M8PA 3EULA 1JSZA 3GVIA 3UJ7A 2FMUA 4RADA 3T34A 1PK8A 2WU1A 4UPVA 3O8OA 2FPKA 5DNDA 2NVBA 2Q7XA 4NULA 5MGNA 5TSDA 1PFYA 3UBMA 3UGJA 1FSGA 2WE8A 3CPJB 1YAHA 2PUAA 4U63A 2EL9A 3B1XA 2P3OA 5B3JA 5JASA 2V9ZA 1DRUA 3AHFA 3SSAA 1C3EA 1LNQA 2W6MA 1QH9A 2PIAA 3DAHA 3RC9A 1MB0A 3WIOA 2ZAYA 4BFSA 7ADHA 2ZBEA 3OH8A 2YC4C 4OHFA 3II6X 4DGQA 1NWCA 4GBED 3FE2A 4Q93A 2BI8A 1EUQA 3WAGA 1Y42X 2PH3A 3AIIA 3ZDZB 1U0FA 5A3RA 1R66A 3FYUB 4UM7A 4U7FA 3QXXA 3PR1A 1Q12A 1MG0A 3WWYA 3T41A 3QV1A 2B4TO 5LQAA 1PGPA 2ZU0C 3O4RA 3QELA 4JVNA 1H2AS 1EWQA 2LD4A 5D6OA 1NV8A 5IP5A 3LIIA 3IC5A 1WMFA 3QYFA 2NU8B 5CX1B 1AZSC 3HCWA 2XQIA 1GARA 2CSUA 3GFRA 1USGA 3HB0A 1E20A 1YB6A 1FX0A 3PKIA 4M86A 5EJIA 1U7XA 2FP3A 4LDRA 4RJIA 4RIFA 4RW0A 3UWDA 1BKSB 4CMJA 3IAXA 1GNPA 3RLFA 1D8TA 2H9AA 2Z5VA 5I9NA 4BGVA 2R85A 2CHGA 4CFYA 5K0TA 4YCSA 1ADCA 1E3DA 2QD1A 4M0EA 2GTPA 2P62A 1DBSA 2BD0A 3DO8A 5IYZB 1YCGA 4DCCA 3E03A 2Z1MA 4BNUA 2IYSA 3K3PA 3RGWS 4F85A 3DWGA 1JF8A 4I9HA 1GGVA 2AFHB 3A04A 3CVXA 3IDZA 2GM5A 4JROA 1H1TA 4Z4QA 5AQ1A 3ZGOA 3D4IA 5GP1A 2NO1A 1NLMA 3PSAA 4JLKA 4J3JA 1E6EA 4BP1A 5E4YA 2DBRA 1M0EA 2HZ7A 3MWDA 5FO0A 2OYCA 2I03A 1CUVA 4BO7A 3S1SA 4GX2A 4GS5A 4UHFA 1PFVA 1SKQA 1SOWA 4HPXB 1JFFA 3WE7A 5A4IS 1EJ6A 3ND5A 5D3ZA 2Y1WA 3ND9A 3WO1A 4A0FA 2EG5A 3F6PA 5TPWB 3CZ4A 4EPWA 4QBGB 3NH9A 5DHAA 3RC1A 2AI1A 2GEUA 1MAWA 4UHHA 4YBRA 1PJSA 2GJAA 3LNCA 3LL7A 2W2NA 3O4IA 4HDOB 2BVNA 4LPKA 4QXOA 3PD1A 1OWMA 2EAUA 3HE3A 3K5IA 4H16A 5EXDA 5ULLA 4AQDA 5AVRA 2XLCA 4ZRMA 3SX0A 3K71B 4LQ4A 1U7TA 4M2LA 2VTDA 3ZV3A 3N5CA 3QBDA 1MXFA 3OIVA 3DAOA 4Q7KA 1K08A 3G2HA 3Q2IA 2C2GA 2C99A 5FPTA 3HBAA 4I50F 4EL0A 1EYZA 2CXTA 3N53A 1OAOA 4A8PA 4B33A 5K0FA 1O0CA 1ABEA 4TLMB 4MDYA 3TLXA 3TTSA 3ZXXA 4CF6A 1XDBA 3GELA 5IUKC 3K9FC 2B0JA 5AM1A 3L1UA 4P38A 2V7BA 2O2XA 5EHGA 2IZOA 2ZPTX 1HFKA 5AVSA 2QUIA 1PJZA 3EXHB 4YH1A 3UXMA 2JAPA 3BRCA 3FN4A 3KUUA 1YC2A 4H1TA 1FX0B 3FPSA 3LXXA 2VHEA 5F98A 5CK4A 5G1NA 1LNSA 4RHFA 1NP6A 1DJOA 3I12A 1PGQA 2IV7A 3N8IA 3WL4A 4V3BA 3AY3A 1THZA 3RFVA 2XDQA 4ZVVA 1X15A 1A1VA 4OB8A 1ZGBA 1UZAA 4KXUA 4QPNA 4DWOA 1U0RA 2A1UB 3H19A 2H85A 3LT5A 3O1HB 3PDWA 5EE3A 3TAUA 3F5DA 3GJZA 2IH2A 1A1SA 1U2ZA 3CF0A 1HDXA 1XUOA 1ZK3A 2LE0A 5GV8A 1OBHA 1T5SA 2GTHA 1D2EA 3R3XA 3M1AA 5FPHA 3HJAA 3ZNNA 2VDWA 5CUQA 3DVRX 5TV2A 4WK2B 3RR2A 1F38A 3IV7A 3WQRA 3I0NA 3ZU4A 1Z8FA 2O2IA 1ZJ4A 3R4CA 1H69A 1XEFA 5HDBB 3MAAC 5DGIA 1TW3A 5BSVA 3P2EA 3GGDA 5EIAA 5C80A 5I3CA 2X0IA 1UWKA 2XTZA 1N8TA 3L1KA 4BNWA 3HJHA 4P84A 4KXLA 2O8BB 1G4UR 3EC2A 1RWPA 1D0SA 3O7WA 3HU3A 1DUSA 1B3RA 1JJVA 4H7IA 3IVCA 5DULA 2NYVA 1Z0KA 3D2CA 3V1NA 1IZYA 1SIOA 2DWOA 1EBUA 4GYYA 1SHTX 5ALHA 2ZDHA 4R84A 5LBUA 3QIVA 4IZIA 4O4LB 3W8NA 1OH6A 1FE8A 5H82A 2BLNA 2MINA 3FVWA 4KO2S 1NVTA 5A0TA 3IUNA 3QVSA 3JW8A 1OFVA 3HSYA 2GEJA 1Z07A 1RM4A 4N0EA 3LOQA 2DT8A 3RREA 1I0IA 1IBRA 3JARB 1L8LA 4FC7A 5EP1A 3KJFA 1P39A 2C00A 3K70D 2REOA 4AECA 3X1KA 3UWMA 3HVUA 3IUJA 4HAYA 5L3RA 1ZH2A 4FM9A 4DCTA 1A7UA 1OFTA 1OOEA 1DCMA 2EGHA 2DF8A 3H86A 5C3UA 3RVLA 2IHNA 4F4JA 5CM9C 1TM2A 3RIEA 4ALLA 1E8MA 1LI4A 2YHIA 3NDPA 4RY0A 5PGMA 1CUJA 2G28A 1NJGA 2VPZA 2AFHE 4R68A 2VZLA 3DZBA 2F9LA 3PXXA 4G9GA 4MUIA 1JYEA 1NG1A 4UD2A 3RG8A 5DCWA 4FDLA 5B64A 2FN3A 4H59A 1VI5A 2C84A 4JITA 1BW9B 1F2UB 2VS1A 1S7CA 4P1ZA 1OB5A 2HT6A 2JC3A 3VAYA 5KQGA 1P4RA 1N32B 4J16C 3A05A 4HNQA 2Q07A 2XSZD 3IUMA 4EJ6A 1Q0UA 4C30A 2QY9A 4LE0A 1CJCA 2FZ5A 1T8PA 3AM4A 3BQNB 3L7NA 4ENRA 1JKMA 3ZNOA 1I36A 4JELA 4JLNA 3EXEB 3S7ZA 3K1YA 3I62A 3VKVA 4LRXA 3KPVA 3HFRA 4QQFA 3K0BA 3ISTA 5JUWA 4DVGA 1YJQA 4Y7DA 2IIQA 2HK7A 4XX1A 3QE0A 1N0UA 1OI7A 1DTWA 2PXHA 4YIHA 1RI1A 1UC9A 2DFVA 3ZE7A 1UBJS 3QE9Y 5FOWA 3OQNA 5FA8A 1J2JA 2ODNA 2OXEA 3IT0A 5F78A 3L8EA 1EX6A 2H9YA 3DBIA 4CIWA 1YNSA 1K8YB 1IIRA 3F4LA 4EGAA 5HKAA 4V0QA 5TXGA 5L3VA 1CYDA 4JQOA 1B16A 4U7HA 4POAA 4WDQA 1NN1A 3NVDA 4QIHA 5ALTA 1AXGA 2ZU6A 5E1OA 4ARBA 4I50B 2O2JA 2CMKA 221PA 4KYUA 1XJQA 5IVHA 4JYMA 3PNVA 3ZBQA 2GM4A 2IQ5A 5FA6A 5BYKA 3U7EB 1T36A 1QH1A 3IV6A 4I55A 5GONB 4E1VA 2VSOA 1V1MB 5BWLA 1X9GA 1GCAA 2HY7A 3GUHA 4PZZA 4DNOA 4Z2YA 1JHDA 3VOTA 4D0GA 3FTQA 2BFAA 2JBHA 4TLBA 4WRRA 2FDRA 2YWRA 3GAZA 4YI5A 3W5UA 1Q74A 2BKLA 2MSNA 5CB4B 2ZJ6A 1TO2E 4IFBA 3H4MA 1NUTA 2EU8A 4ARZA 2B82A 2B5VA 4LDQA 3EK2A 4U6NA 4RK5A 3AF6A 2CV1A 4X62B 4UTOA 1QWOA 2JS7A 4FCVA 1I1QB 1SCAA 4JVOA 5IXYA 1O9BA 2VDMB 4TV8A 1F06A 2QMHA 3NTRA 5AK0A 4R8LA 1Z25A 4RHEA 4K81B 3CJTA 1QKKA 1TD1A 4Q3KA 4B9EA 2BI4A 4F71A 5B3LA 1XZJA 5AXAA 3BX1A 1SBCA 3D54D 5CBPA 3DEJA 1CY4A 5AICA 5D7BA 1W4AA 3EIQA 5DRYA 3QU4A 5LB4A 3QITA 1KK3A 3ILHA 5HJ7A 2C9OA 3CZQA 7ABPA 1AQLA 2JLQA 4EA7A 1BW9A 3DKVA 4XYBA 4R54A 3DZCA 2IYAA 3GEPA 1G8MA 3OZGA 1A8SA 3A0RB 2CK3D 2HA4A 2AV6A 4UOQA 4OHUA 4LYDA 2MMGA 5CW1A 3PIRA 2HA3A 1EX9A 1NMZA 1PDVA 3EXHC 1DMRA 3V8EA 1OJLA 4ERNA 2DERA 3JR3A 4E5DA 1KQPA 1Z12A 2NU7A 5A7FA 3OJEA 3R5SA 3O1LA 2EF1A 3AY0A 3AHIA 3GLGA 1FLDA 2ODAA 1Z15A 3D7KA 1T0HB 4WZAE 1K66A 5K3DA 1Q0PA 2X19A 2X8WA 1VLLA 3PXEA 1RXIA 4OH1A 4ZP1A 1BXZA 2QVCA 1GLGA 1TADA 4G9BA 4MMXB 3LPAA 1UOOA 4X1OA 4YLGA 2FR8A 3C8UA 2IPNA 2R79A 3Q0EA 4XX0A 1BFUA 2WVGA 1UK9A 2QRHA 1GO2A 1BVUA 1QRRA 3BJIC 1QV9A 1H22A 1G6Q1 1JHZA 1X8XA 1B7GO 2J30A 2CVPA 4NZ9A 1IU9A 4PAWA 3ZCSA 1UOPA 3C3MA 4QJ4A 1GILA 2H1WA 3TNDA 3GCZA 5KVCA 4I50A 1Z75A 2QX8A 3VYTB 1P91A 1B6TA 5CYGA 5LYJB 2VNKA 1LU9A 3C87A 3SU8A 5GZ6A 3SHWA 1E3LA 1TGVA 3FDZB 4BMOB 4EKGA 3Q7SA 4B2LA 3PCXA 1D9ZA 3CX7A 2D54A 3FTNA 4A73A 5GMOA 1T5OA 4CV3A 4QYWA 1NI4B 1FSFA 4AJNA 4E4RA 4A0HA 1GKLA 3L02A 1AT1A 4X85A 5CK5A 4YXWD 1R5JA 2BF7A 4DILA 2CJFA 1DRKA 4P86A 3ZWAA 2G67A 3KWJA 4N5HX 4DM4A 2F1JA 1JLRA 3OCWA 4DCUA 1U6JA 3ESYA 3R6LA 1IY1A 3U2QA 1NLUA 1ZY2A 1J5XA 3LRXA 4DQLA 1ISRA 4E4YA 3HNPA 2J4CA 2YN4A 5LB2A 3LGSA 1E18A 2O50A 3LUFA 4OOFA 2IYVA 1SA0B 2A2ZA 3WLQA 2O5VA 5JD5A 3AFIA 3GRVA 1GCIA 2VKTA 3GEEA 3LQ4A 1K06A 1N2CE 4RVHA 1II8A 1TD9A 1TYEB 4PCLA 4Z9BA 5TGDA 2PUJA 3MK31 3QG5A 1XALA 2AD5A 4JBLA 4MCJA 5BSGA 3PXBA 4ZT6A 3O7MA 4E5SA 5LDDC 4EB8A 1D5CA 1OGJA 3Q98A 3MN1A 3BL5A 3VKGA 2RB5A 2FF5A 1XCOA 2XPCA 3OX2A 5ALDA 1EB9A 4EHAA 4LQLA 4P6VF 4PINA 4V03A 3WYAA 1K8ZB 1YGYA 3NANA 3PG5A 4XUCA 4BX3A 4EFMA 3WO0A 2P27A 1HFEL 2I7DA 3FPKA 1EVEA 4ZMBA 2VRBA 4IO1A 3IERA 4RESA 1L4MA 4Y2RA 3ZWCA 4YUAA 3OLZA 1PP4A 1PGNA 3QRWA 4LVOA 1IIBA 3H97A 2Z09A 3ZHRA 1FXWF 1G8GA 5AW5A 1I3OA 4I5FA 1F2TA 1CJKC 1YR1A 3QFFA 5F2KA 2XDWA 5ALIA 2EZTA 2BGTA 4DDHA 2FFBA 3UICA 5JDIA 3T3GA 1KY5A 3TW6A 4NAUA 1D4OA 1Y33E 2QZ4A 4LAFA 5T6MA 4E0BA 1RU3A 3U4MA 4JYAB 1TM4E 1U0HC 4DWJA 1BCSB 1JIKA 3N8NA 2ZAGA 1WX1A 3JZMA 1YRBA 1XVAA 4FQ7A 4KLCA 3VPGA 2AC2A 4PNPA 2BGMA 2HBRA 4DV7B 4E3WA 2O4UX 3BD7A 3A58B 3K6KA 3CZPA 1P0MA 4S1PA 4M0FA 4F5EA 4OLJA 1H8HD 3LC1O 4WIAA 3WFJA 1YQGA 1PSWA 1VKOA 3AF3A 4XEHA 2HT1A 4RZ3A 1NI4A 3H04A 3UAOA 4GZ6A 2IP1A 2PD3A 2Q6OA 3NWBA 4HEJA 4YT8A 1H2WA 1UDRA 2BHLA 3MJHA 2JAWA 4P4TA 5EXTA 8AT1A 3GZNB 3IEXA 1U0TA 1PTJC 1N6LA 3EGWA 5HJ5A 2HQBA 4F9TA 1PF7E 4MLDA 1Y1KE 3PEVA 4L3OA 2AFIA 5TVKA 3EIOA 5A03A 2C4TA 4K6HA 3G68A 3TB6A 5C9ZA 3RUHA 4GR4A 1KMNA 5KMGB 2Z5LA 3HKEB 1V6AA 3H2BA 3W3AD 5DNAA 1UBKS 3H7AA 5F7JA 4UCXA 2FWPA 3GLIE 2AX3A 1YDEA 1S8OA 4M6WA 1UZUA 4HWSA 2HF9A 3KETA 4UATA 3NH6A 3TZQA 4BECA 3MRXA 4JSTA 1G8FA 5CNIA 4AN1A 2AKEA 4Z0NA 4DBLE 1IPEA 3UWKA 3W5AA 2ORWA 5CFOA 1B76A 4FUQA 4PHFA 1EB8A 4PZUA 4W1SA 4YRJA 4BKUA 1EVYA 2A35A 2IPLA 2A7QA 4OXRA 2FX2A 1SB9A 2PL9A 5AW3A 1KO1A 2WHPB 4HDMB 1XAHA 2J7PD 5IEBA 3FIUA 3GK3A 5AK5A 1VCIA 2CHEA 4F2PA 4BLTA 1J0EA 4J4TA 2WV7A 4E5NA 3OIDA 5GADl 1OR8A 1VIAA 4GX0A 3KTAA 4EITA 2BKXA 3PUJA 4JWTA 2FPMA 2X2OA 2MSKA 3NM4A 3K20A 4K6KA 2IV2X 5LOVA 2WFAA 1IB0A 5KOYA 2VRWA 2ZJOA 1RYDA 1B14A 2NV0A 4UQLA 2AMJA 4DA6A 1MT0A 2QTNA 3VJRA 4EM6A 4FS3A 1NMEA 2HIHA 1YRHA 3RKUA 1LBEA 1KYVA 2YW9A 3EFOB 4IEIA 3BG5A 4LJ9A 4WJLA 2CHVA 1ULUA 1XF9A 1OI3A 4J0JA 3W9YA 4MS3B 1A8PA 5CH5A 2QLNA 1KYIA 1I2AA 2DVMA 4FCCA 3HS3A 5GWXA 3MHPA 3STTA 4AKTA 3OM8A 1Y6GA 1H4TA 2C58A 1SVKA 3BRQA 1SCKA 4MVJP 4UU0A 4L8FA 2Z95A 3E53A 5FR2A 4L0CA 2V7XA 3R7DA 4I1VA 3X1ZA 1LGYA 4WNYA 4A8HA 2GAAA 2PV7A 2GKSA 1OBFO 1PU2A 1RRGA 4M76B 2DTXA 2CVZA 4B4VA 1Z62A 1UK6A 3JXEA 1NSTA 4NBSA 2VSXA 2O2HA 4UEOA 5FXMA 2BMAA 2Q8QA 5J47A 5A7GA 1ZSNA 4RXMA 3DT9A 4HAZA 2RB4A 1W36D 4WXHA 3HKEA 4EHNA 4FKBA 1SK9A 2I6SA 1FDSA 4WKPA 4OFZA 2M6KA 4AZ3B 4HWPA 4ECAA 4B3MB 1RCFA 2V03A 3BTUA 3OO1A 3VH3A 4B9AA 3V3TA 3WRVA 1L7VC 3A6DA 3IOYA 3I52A 3JD0A 4K86A 1BIFA 3EY4A 1TZCA 4N5MA 3SQWA 2ZFUA 2QJTA 5DISB 2PUBA 3P9QA 1UXHA 3MW8A 4Y2UA 2ZI3A 5CB0A 3G8YA 4DDTA 3UCXA 2H8GA 1Y5MA 3IJ5A 4HNHA 5BNIA 3BHMA 5MFPA 2ZCVA 5LMZA 2AZDA 2Q2VA 4MS1B 1UQRA 2D8MA 3VOAA 4W5NA 1TO6A 2BHRA 2WI8A 3ZR4B 2FW9A 4F9FA 2B8JA 3VZRA 2BN4A 4QXRA 2ON6A 3RRXA 4E3ZA 1UH5A 3FSGA 4NAVA 4HLUC 3TE7A 3VYUB 2JIQA 3NXSA 1G19A 3L7DA 5JVDA 4NIMA 2PO5A 4DAEA 1FDWA 3NHJA 5B3KA 2WF5A 1SHLA 1E3JA 3WBFA 5AOAA 1G8YA 4YDSA 3L8YA 1T8WA 4IGEA 5JZSA 3ZDFA 1ENYA 4PM4A 1A5AB 1JP7A 1LBIA 1W581 2HRRA 2UZ0A 3HRIA 4RGBA 3J7AC 3TIXB 1K2WA 4CIVA 5CB8A 1G5HA 4LYEA 4ENPA 4PO3X 4ZT4A 2FXIA 3CUWA 4IKEA 1GSOA 3NRCA 3F1KA 1YI0A 2UVDA 4KQXA 2Z6AA 1Z8NA 4LDAA 4R3NA 2QR2A 5IXSA 4ESVA 3KKEA 4M0CA 1GP2A 2DHRA 4RY9A 4MKRA 4JLWA 1EX1A 1E6LA 1JQKA 4XIIA 5FT9A 5KYKA 1X6VA 4TLAA 1F1BA 2HCFA 4P08A 2CYCA 2ZJ0A 4GGOA 4QULA 5CXUA 1TNDA 4G5QA 1E5XA 2D0IA 3F6CA 3FJYA 3WJ1A 5CDYA 2HTFA 4YREA 3OC0A 4MRAA 2Z83A 4ZO7A 3T7JA 1AXRA 5FPSA 4N7MA 4E03A 4I6JA 4BBAA 1O96A 4BNGA 1KQFA 3A6LA 4DMKA 5HQ3A 4P80A 1D4ZA 1DWPA 3PEFA 4O3MA 3ADBA 1IL0A 1KVQA 3D0RA 2XV1A 3EHEA 4OJYA 2YY5A 2YN0A 4G01B 3ZD7A 4QGGA 1ECPA 3OPXA 3PT5A 4QLBA 4MW2A 1MJFA 1JQJC 1OGIA 5LC1A 3KV3O 4Y2XA 1ITZA 5BMVB 4CG2A 1GVNB 3D7RA 3B60A 2OFWA 3VZBA 4LOLA 1C0KA 1ORDA 3OKCA 4U7DA 3EEFA 1J2EA 5JG7A 1FQWA 3SHFA 2FSVC 4RF5A 1QO7A 2X7XA 2EWMA 3CLUC 2HCBA 4Q3EA 1N9GB 4Y6PA 4XQ9A 4EGSA 4JZYA 1J24A 2VFAA 2HH9A 2IGBA 2GAIA 2HIGA 4BX0A 3CF4G 2A4MA 1L9KA 1QZTA 3K2EA 1Q1NA 2H1VA 2X4IA 2VAVA 1NVVR 4F56A 5I48A 1IRIA 2P7HA 4YECA 3NNNA 4II7A 2OO5A 3OEEA 3WHIA 2XGOA 3SIRA 4BAGA 1UKYA 1FP4A 2J3KA 2RHRA 2C92A 2MIIA 4F60A 4ZCMA 2UU9B 4AJHA 2Q9AA 4HMOA 4TL8A 3C3YA 3GVHA 5B53A 1KAGA 1XCMA 3H5NA 5KC9A 5B4VA 1OB2A 3CT4A 1NR5A 3PXGA 1TDJA 2DUJA 2RSLA 4B3BA 4KQMA 4MUGA 4PR3A 3FNEA 4RSRA 5KQPA 1S8AA 3E8XA 3MT7A 1CJSA 3LT2A 4UHEA 1NF8A 2W5UA 4DSTA 1F6BA 4GM0A 5EP2A 1CUZA 4BN4A 4EI8A 1T4CB 2KI5A 3O8QA 2PKYX 1MGPA 4PYJA 4LX0A 5HILA 4FGUA 4MKHA 2XNKA 4P58A 4BV3A 1XLUA 3I09A 4N41A 2QG6A 4TMZA 1E2QA 3FMPB 4HTFA 2GZDA 4JL8A 2WFLB 3HGQA 2ZRMA 5DYTA 3I61A 2QUKA 2GCPA 4AQ7A 1OMOA 4FOOA 4QRDA 1TUBB 5FI5A 2WINI 3T7AA 3OD5A 3WNCA 4AJEA 4EGFA 2GTIA 2C0PA 2OGSA 4B6SA 3K05A 5DOZA 2Z4SA 3A4LA 1B00A 4XYLA 5KOJB 2JFBA 1O96B 2RK6A 3AEQB 2H2AA 3C70A 3NEPX 3PC3A 1GPH1 1SCJA 2AR7A 4LRQA 1PO7A 2GHQA 1S2MA 1SKUA 2B25A 2C2HA 4GQAA 3KZVA 1QQTA 2GFIA 3BFPA 3V80A 4CGZA 3RSGA 3ZJVA 3D6AA 2PJZA 3QZUA 3WGKA 1FVFA 3MS2A 3OZIA 4EPXA 3BE8A 2VBIA 2VUHB 3ONNA 5MFZA 3UPUA 5LUAA 2CLFB 3H18A 4TKZA 1FLAA 3SD7A 3A1SA 1S6YA 4U2KA 1MZPA 2CDNA 4LXUA 3I4CA 1PNTA 5A3QA 3JWEA 4FN4A 2QSZA 1VHJA 3KAJA 5JH7B 2CGEA 4KQGA 4IWYA 1KQ3A 3TXXA 4DABA 2BGUA 1GZ5A 3TD9A 1Q44A 2XMPA 3CVYA 4FHZA 4CM9D 2Y0PA 1WZCA 4ESEA 2ZYHA 2DBQA 4J9VA 2B9EA 3KKPA 4HNGA 4MPDA 2OHGA 2CWWA 2QT0A 3IR7A 4OK6A 2RE8A 4AUKA 4Q9AA 3VX4A 2G3YA 3WNVA 1X42A 1U2DA 1JBKA 4FOSA 1MRSA 1A9OA 2C54A 2SICE 2PH7A 3GEDA 1TX4B 1EJ0A 5K3BA 4PNEA 1OI2A 4V3CA 5EXSA 3ZDDA 3JQRA 2WTMA 3MCTA 1Y7TA 1HE5A 1G5PA 2O20A 2REQB 4Q4DA 3DTYA 1QFZA 4CW7A 4FYIA 3FYUA 1P5RA 2JFHA 3F78A 1K5GA 3REQB 1IBCA 4PXYA 1NUSA 2OCXA 3TI9A 4LJSA 2C7OA 4ZC8A 2XD9A 1N2XA 2QK4A 3RVQA 4LCEA 4BMNA 4EO4A 5A4KA 2YWGA 3QNMA 1R18A 2DFNA 2CDBA 3EQ2A 3EZ6A 1PEYA 3NAGA 4QTTB 2C2KA 4RZXA 1K7FB 4P98A 4R9SA 5DZSA 4UMDA 1XEWY 2X8AA 3WV4A 3U3KA 2K87A 3DW1X 3C6MA 2PYZA 4D3XA 1Y82A 3VRHA 4K8OA 3FYSA 2D7DA 3HBMA 3IUPA 2YV1A 2G09A 1WBJB 3M6XA 2G0TA 2I6QA 4G25A 5BR8B 1T2AA 2ZYIA 3MWFA 4YQFA 1KOGA 2V7QA 4HS9A 5IN5A 3OQBA 3UMJA 1M8KA 5ESWA 2JI7A 2FSHA 2E85A 1TF5A 2Q50A 2XLBA 1BA2A 4Y8VA 3TR0A 1L3CA 1S2IA 1R88A 4MTCA 5KYGA 2WBLC 3GJ6A 5B1SA 2DEUA 2CK3A 4FYVA 1HMYA 4HGZA 4B3DA 3VH2A 5LZ7A 5DNYB 5K4HA 2X8LA 3QKTA 3TSOA 3PF8A 4G0QA 3JQ6A 2E4YA 2VDNB 3FNIA 2D62A 3NXKA 4RPJA 4XYEA 3IKTA 2C8KA 4ZEWA 1QE5A 1NM5C 1C4KA 4A8JC 5CMLA 2QMUA 5GIPE 3HWWA 3KE8A 5DB4A 2PDAA 5IC6A 3N5KA 4L5IA 1UQUA 3C74A 3Q0TA 3SDSA 2GYVA 3ZS9A 4UQOA 4CNBA 4YRRA 2QQEA 3F4KA 1IQRA 2J48A 3VZDA 3W5JA 2C3YA 2YNMC 4JGBA 2ID7A 4NMMA 5CAEB 3FCCA 1N1EA 3HXTA 4PXSA 2BKAA 4B6RA 5F4ZA 1JBEA 3WNQA 1KS2A 1K4YA 1HTBA 2YL2A 4U2CA 4XYGA 2P3LA 2EEPA 2PA3A 1VCHA 1N6RA 1B2LA 2VPXA 3TLGB 1P6QA 4KQJA 3HN2A 4PIMA 4YJ2F 3DLHA 3L8DA 2BMVA 5U4QA 2ZPUA 1ISGA 5ICEA 1E6MA 4NDNE 4H6WA 3TJRA 4G2TA 2QTHA 1HR0B 2REQA 3TZ6A 1JEDA 3PGMA 3R8XA 4ZFNA 3KQMA 2R44A 1NVAA 2XW6A 2P3SA 3B85A 3NTXA 3VNRA 1Y3AA 1JVBA 2NAFA 4RH0A 2Q1YA 3ONDA 3LMKA 1RW4A 4LF8B 3RSQA 1WP9A 4J4HA 1M8FA 4NATA 3RVNA 4XWKA 3ASZA 5JXWA 3A6JA 1SBYA 5T8KA 1WEHA 1WPXA 3P5BA 3PYMA 3FTCA 5FNVF 1CZHA 1VYUA 2GCEA 3ZD9A 4DLKA 2O59A 5I7VA 5TJHA 2P30A 4WX2B 2HW8A 1QG2A 5C8YF 4DIKA 4U7WA 1GGHA 3VR1A 2ATXA 2R1TA 2PRSA 4HYTA 4C7OB 3ELYA 1E60A 3OP1A 1L5QA 4KC0A 3A6PC 3DZDA 2FNAA 5JEEA 4ENUA 3GMIA 3GLFE 4RH3A 3I23A 3NCHA 3AM3A 5KYUB 3H9EO 2C95A 4MHTA 4EG5A 3GLKA 3VPHA 1OXUA 1QFJA 3C14C 1F8XA 5EKXA 4AQYB 2H1FA 4OHWA 1P1IA 3ZE1B 3ADPA 3O8RA 3CUYA 1JLMA 2YQZA 4L5JA 3UA3A 4Z9XA 5JRJA 1NQ5A 2KM1A 4K6OA 1ES9A 1M1XB 5J4KA 2WAYA 1S89A 2JRCA 2QIOA 1JSXA 1ZH0A 4S3MA 3M1LA 2PK3A 4TWZA 2DJIA 2FDCA 2XCSB 2KLBA 4M7WA 2WKWA 3R0XA 1QSGA 2QVGA 2IYWA 2BELA 1Q6ZA 2E87A 3IHTA 1HLDA 3LUCA 1XC7A 2Q3JA 3QVOA 4MVYA 3EGXB 3VPFA 1K63A 2R96A 5ALSA 4LVCA 1GPUA 1JSLA 1ZSVA 1DIBA 3LBAA 3NCTA 1K89A 1NM5A 2YZ7A 2Z4RA 5AJTA 2CMFA 4MQ6A 3KQPA 4IDQA 3SM3A 1C7FA 1FP6A 2QVYX 4QLAA 2R25B 2HN9A 5KQMA 1Y48E 5TF0A 2DUUA 5EC8A 3DH0A 4B7CA 4EHHA 1PJCA 1DMSA 3SLRA 5K2OA 3EDMA 2ZBUA 1E5DA 4BEWA 4GP9A 3A6ZA 4YALA 4GOJA 4NR0A 3AG6A 2D0OB 1G6OA 1U80A 3KTOA 1KH3A 4KPGA 2BGKA 1FDVA 1Q22A 2FX5A 1Q17A 1UMBA 2SHKA 2BZSA 4KSCA 1X1RA 5EZ5A 3ROTA 4ZYYA 1DAIA 3PWTA 5BW5A 3KIPA 3OLVA 1ZU5A 4CUJA 4L74A 3EAFA 3H5AA 2V45A 2RGUA 2JVKA 1BEUB 1EG7A 4Y30A 3NAQA 4WHMA 3RJMA 3OIWA 1ECJA 1T0BA 3DC7A 3TBHA 1VJ0A 4H7EA 5FOSA 4O8CA 3E8MA 2PMCA 4MWOA 2GCGA 3PR2B 1E2IA 2IE8A 3IVMA 2F8LA 3O21A 4J8PA 1Z0AA 2EOAA 3MM4A 4EBFA 5FTLA 3D3JA 1OC2A 1P4HA 3H3JA 4U9IS 4TQUS 4JC5A 2AQKA 5IT5A 1NAIA 5FADA 2JBWA 3A9SA 4O4LF 3KAQA 1E5LA 3MPOA 4TZ0A 1RWBA 3FFBA 2WMNB 1CZKA 1O2DA 2ZANA 4NZPA 5CT5A 5H70A 1O97C 3ZZMA 1QBKC 1Y98A 3WX0A 3LXRA 4INJA 4P31A 1XAGA 3AHDA 1KPIA 3ZHOA 4ZTZB 1RZRD 2PMKA 1UBHS 5IVKA 3BA1A 3NM5A 3CH7A 1P5FA 2JA2A 1RI3A 1K97A 3F7NA 3VH4A 3C4VA 1LX6A 2VJYA 4JLPA 4QUKA 4CGYA 3ACCA 5CM8B 5MN5A 4I1SA 2XDAA 3QVGB 4GI2A 1GRRA 5ALPA 3WL6A 2BCEA 5EHIA 2JANA 2NYUA 3MTQA 1SK8A 3N7TA 2FRXA 2J9YB 4WDRA 3SKYA 3ML1A 1J7KA 2XRYA 2IXEA 2XUGA 5AMXA 1XLTC 4S0XA 5H9WA 4KP7A 5FBKA 1GFSA 3F47A 1E8NA