2YOIA

Crystal structure of ancestral thioredoxin relative to last eukaryotes common ancestor (leca) from the precambrian period
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
MVIQVTNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKHAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECA THIOREDOXIN
publication title Conservation of protein structure over four billion years.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 35
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yoiA00
5FWGA 5J4UA 2IN3A 1GSEA 1GP1A 3CRUA 2HZEA 3TKPA 5KN3A 2MZCA 2REMA 4JBBA 1DE2A 2JSZA 2ON7A 4PQ1A 3LGCA 3TJGA 1M2BA 3TOTA 1THOA 3MNGA 3CSIA 2ZNMA 4K0GA 5ECLB 5HFKA 1GUKA 2H1DA 4N11A 1SYXA 1V40A 1GTUA 1TRVA 2RIIA 4IHUA 3EU4A 3DIEA 2YPMA 3M0FA 3ZTLA 3CXGA 1F3BA 2YWOA 14GSA 3TDGA 4TVEA 2OE1A 4KW6A 5EL8A 2L6CA 2GS3A 5ECRB 3H79A 2R6KA 2TIRA 3GH6A 4KUNA 1TRUA 1GTBA 3G7YA 3EYTA 4JRRA 1Y25A 3KD0A 5F8BA 4PXOA 2RUEA 2C0GA 5G1KA 1A24A 3GH9A 3KXOA 4DEJA 1ZMAA 3FZ9A 4GTUA 3WD6A 1M2AA 2H73A 1W89A 4GWRA 2IMEA 2I3YA 1B48A 3KCMA 2FCHA 2YCDA 2DJ0A 2H8LA 4G10A 4MZBA 4X43A 5ECIB 2VLUA 4HDEA 2VLTA 2JADA 3CYNA 3KM6A 1A23A 2OA7A 3IXRA 3TKSC 5ECPB 2H76A 5ID2A 1YEPA 2IMKA 3D4TA 2TRXA 1YQ1A 4FYCA 4NV5A 1S3DA 1YJ6A 1FVKA 1EEJA 3F4RA 2DSAA 4PNFA 4HUAA 1T8EB 3HKRA 3MWHA 1V98A 5IIZA 3QFBC 1TOFA 5ABRA 2V41A 2K6VA 1BG5A 3UJ1A 1U3IA 1K3OA 1Y6EA 3GHAA 3KGKA 3Q19A 3HY2A 1AQVA 4ZB6A 1BEDA 4YAPA 1O8XA 1F37A 2JACA 5JWQB 1YKCA 1GUMA 3HVXA 1TDIA 2NDOA 3IOSA 1SJ6A 1F6MC 3ZRDA 3GV1A 4L5LA 5D9TA 2H6XA 2A4VA 2QKEA 2ZUPA 1K0NA 3W8SA 2MMNA 4KCEA 4Z7XA 1H4OA 4O92A 3G7IA 2YWIA 1GSFA 1QMVA 4I2TA 5F0GA 4GSNA 2PUKC 1WOUA 4ZILA 1FB6A 4ZBAA 3L0HA 2ZCTA 1VF4A 2LS5A 2MYGA 4NXIA 2M46A 2C1YA 3TOUA 4HZ2A 3QOUA 1XW9A 1AIUA 4MPGA 3F4TA 5GAPD 2C3NA 2LNSA 2M80A 4MH2A 4K9ZA 2L5OA 3ERFA 2TRCP 3UOMA 2C3TA 3WGXA 2YWMA 17GSA 2AAWA 1GRXA 3ZFBA 4IW9A 3DVWA 6GSVA 22GSA 3H4KA 4ZL7A 3D4MA 4PGTA 2DJ3A 1OE7A 2PN8A 2FHEA 1C72A 3IPZA 3KZQA 1K0AA 4O32A 2HSHA 4F03A 2FNOA 3QR6A 2RUFA 3TRQA 1TKDB 4GCIA 1MEKA 5ECKB 2BMXA 1PL1A 4ZBDA 1HYUA 4LL1B 1K0DA 2NTOA 3M8NA 3TRXA 1XFLA 4K2DA 2PVOC 2ON5A 1S3AA 1GTIA 4Q5RA 3M9KA 5CREA 2WFCA 2G2QA 5A4UA 1T4YA 2HE3A 2FA8A 3IRAA 6GSXA 13GSA 1GNEA 1OAZA 5D8IA 3LXZA 3ZLPA 1YKAA 1R5PA 2NVLA 3LXTA 1ZYQB 3GURA 3LWAA 4EF0A 16GSA 2B1LA 1A0FA 4ECIA 4V2LA 4V2NA 2H0HA 3L9SA 2YJHA 4K7IA 2AB6A 1TRWA 2WB9A 4MF6A 1QK8A 2LSTA 1FHEA 3I6AA 4IJ3A 3IV4A 2IIYA 2FWEA 4NWYA 3N9JA 4RQRA 1URMA 4FIWA 2A2SA 3VPQA 4AGSA 3IK9A 3US3A 1TI1A 1PKZA 3P7XA 5ECMB 4MLYA 1EV4A 2HI7A 3ZMKA 1LJRA 5CRDA 2OBIA 2VCTA 2C3QA 3ZL5A 1MDKA 4IKHA 1GSQA 2JL4A 2XPEA 3C71A 3I69A 3KTLA 3D22A 2GQMA 4XHMA 1ST9A 4NMUA 5CO3A 1SYRA 4HEA2 5B6NA 2I1UA 1XXUA 5CRHA 5H5SA 3IHQA 1HNAA 3I43A 5D9WA 4DVCA 2LTKA 3VWWA 2NPBA 4BVXA 2OKAA 3FRCA 3GSSA 3CSHA 3UVHA 2CX4A 4RQXA 2LEGA 4G9HA 9GSSA 4PURA 3HJMA 1AXDA 1PKWA 5GAND 4LMWA 3BOAA 3F63A 1PQNA 4KCAA 5JWRB 20GSA 4D73B 2V6KA 5DDLA 4TW5A 3NOFA 7GSSA 1OC3A 4NAXA 1EEMA 2OJLA 1JZWA 4JR4A 4BL7A 1GSSA 3FW2A 2E0QA 1NW2A 5ID2B 2BTOT 2NBSA 1A2LA 3WT1A 2PWJA 4MA9A 3EURA 3WT2A 1X5EA 3RBTA 4X0XA 5J5NA 3F6DA 4WR4A 3FK8A 2P5QA 3MAKA 2MBTA 1IYHA 1VGLA 4WF5A 4PX1A 2V6OA 2YZUA 1V58A 3VWXA 3GUSA 1AQXA 3DMLA 3ISOA 1T4ZA 2H1AA 3CBUA 4H86A 3ERWA 4ILFA 2AHEA 3HCZA 2N5BA 1QFNA 2E7PA 1X9MB 2HRNA 4EXJA 4OO5A 1WJKA 4ISDA 1X9WB 4N10A 4MPFA 2V2GA 3LORA 2I4AA 3ZYWA 1Q4JA 1B9YC 3IA1A 4DSQA 1JZRA 2H30A 2H71A 1TK0B 4KGIA 2DJKA 4YH2A 4LMVA 2L6DA 3DXBA 2CAIA 2LJAA 2VAFA 4AJ8A 3UEMA 5ECNB 2PVQA 2OBKA 2LUSA 2L59A 2JSYA 2VCXA 2P31A 5G1LA 4EDZA 2HT9A 1RW1A 1K0BA 4ML1A 4K7NA 4JZQA 3RDWA 2CVBA 3LG6A 4HQZA 4MF7A 1WIKA 5G5EA 12GSA 5ELAA 1O6JA 4L5OA 3KP9A 1Z6MA 4HS1A 1HNBA 1B4PA 5DBQA 2V1MA 2IFQA 3DVXA 4L8EA 3AY8A 4HJ2A 4QQ7A 4MH3A 3IBHA 3LEFA 2B1KA 1YZXA 4XS4B 2KLXA 1T3BA 4K8MA 2DJJA 4IGJA 3TRPA 5G30A 2K18A 2F9SA 3CTFA 3U6VA 3L9UA 3VLNA 1GL8A 2LJKA 2B5EA 5CAXA 3DRNA 2DIYA 2M72A 1OC9B 2DMLA 1PL2A 4TR3A 4EO3A 3M9JA 1Z3EA 1UN2A 4O7HA 3VURA 1RK4A 1XWAA 5JCUA 1SU9A 2VOCA 1GLQA 1SK2A 3VI7A 1SKWB 1EGOA 5DJLA 4EVMA 3J7Yb 1OE8A 5H5QA 1WRYA 3EINA 4QL9A 4KAEA 2FY6A 4YQMA 2DBCA 1K0CA 1YDKA 4KDXA 2CV4A 5HR1A 4F0CA 1Z5YE 5ENUA 4D73A 2VD1A 3DGQA 4OFMA 4RI6A 5DJMA 4K1FA 5DCGA 1ZOFA 3IC4A 5GSSA 2GGTA 4GQCA 1QXHA 2VCVA 2WJUA 4WKWA 2PU9C 1SENA 2VCZA 5EY6A 3FHKA 1EOHA 4MP4A 3MSZA 3C8EA 8GSSA 3QAGA 1TP9A 1THXA 2EC4A 3UAPA 4EKZA 3WGEA 1AQWA 4WBRD 1QUWA 1MTCA 5ELGA 3GKNA 3VFIA 5HR3A 5IQYA 5G2ZA 3TJJA 4GXZA 3ZFLA 1SKSB 3JCML 3KEBA 3F8UA 4XS6A 3HXSA 2PGTA 4TR0A 1V57A 3RAZA 1QQ2A 2GZPA 3A2XA 1K0MA 3LJRA 2KUCA 1M2DA 5ECOB 5E4WA 2QSIA 1O73A 5IOWA 10GSA 4BPYA 4TKYA 2DMMA 4E8EA 1XCCA 1AUCA 1VF3A 4KDYA 2HXKA 3D6IA 2L4QA 2FWFA 2C0FA 1DSBA 2CZ2A 5IO2A 4WEYA 1G7OA 3FKFA 1V2AA 3IR4A 3QAVA 1PA3A 1XW5A 4FYBA 2V32A 4MDCA 2K9FA 1M99A 4AF2A 1KBNA 4V1Ag 3GX0A 4KSMA 2R5GA 4I2UA 2F8FA 2VCQA 3GYKA 1K0OA 4ZIJA 1VF1A 1G6WA 3NZNA 4ZB9A 3F0IA 4PQIA 3LSZA 5AN1A 4GRFA 4I97A 5EVOA 2HZFA 2VO4A 19GSA 4XRAA 2H72A 3EMXA 1BJXA 3WYWA 4TOPA 2H75A 5ECHB 4TRXA 4I5QA 2R4VA 1H75A 2OADA 1EZKA 1I9DA 2OE3A 3V1WA 1N2AA 2PPTA 2IPAA 2ES7A 3W6GA 3DKSA 3GFKA 3HYPA 1ERUA 1ML6A 1YF1A 2LKUA 4Q5FA 4XS4A 2QGVA 4P3YB 1VF2A 3F4SA 1FAAA 1OC9A 3W8JA 3HHVA 5IMAA 5A5KA 2H1GA 5HQPA 1ERWA 1DUGA 2HNLA 2VUPA 2YJ7A 1MDIA 1TTZA 1XW6A 1U6TA 1XBSA 5KN1A 4BVYA 3RPPA 3BJ5A 4IJIA 3QCPA 3E0UA 1T00A 1F9MA 3HJOA 2D2ZA 3A3TA 4ECJA 3D5JA 4IN0A 4TXOB 4F82A 1WPIA 5A4VA 4K7OA 1SD8A 3EE2A 2GLRA 5COHA 4NV2A 2VM1A 1B4QA 4OFTA 2IL3A 4J56E 3KMNA 3H93A 3ME8A 3LYKA 4NPBA 1A0RP 2X8CA 2AYTA 1SL0B 1JZDA 1JLWA 3IAM2 3P2AA 2VL3A 4N30A 1GSUA 4JEDA 3LYPA 4IS0A 1PSQA 5IMFA 2R2JA 2VCWA 2FD3A 3FR6A 1OKTA 2YP6A 3APOA 4KE3A 4JE1A 1JZOA 3F6FA 4HZ4A 3UBKA 3TJKA 1R7HA 4HU9A 2C0EA 1HD2A 1PD21 2R37A 5G5FA 1XVQA 4HI7A 2B7JA 1EP7A 2IFQB 1A2JA 1TXXA 1KNGA 6GSTA 3Q6OA 1NM3A 1ERVA 2FWHA 1ABAA 1GSDA 2O87A 2WZ9A 1LU4A 5IM9A 5AIVA 2WGRA 4OCFA 1G0TA 2E2MA 4DSSB 1SD9A 2GDRA 2WRTA 3DD3A 1R4WA 5DALA 2C4JA 2H6ZA 5E59A 5D9XA 3RHCA 5HR0A 4ACSA 3GL5A 3Q74A 4RUVA 1EOGA 3D0ZA 2B6MA 4POMA 3PINA 5DCHA 4BWSA 3SWLA 1ZGNA 4ID0A 1VRSD 5LCZA 5B6MA 3ZREA 1GWCA 6GSWA 1AAZA 4F0BA 5CYYA 4TR4A 3PR8A 2XPDA 3APSA 3RPNA 2O85A 2GQLA 4POBA 5INYA 1PMTA 1UC7A 3FR3A 3M1GA 2F3MA 4MJBA 1A2MA 2JZRA 1GULA 5B8AA 4MCUA 5HR2A 2L5LA 2GZYA 1O81A 1FO5A 4POLA 4HU7A 4CDOA 2PBJA 2GSSA 2Z9SA 5HFIA 11GSA 1AW9A 2B5YA 2YOIA 1OVNA 3C1SA 4MJEA 4GF0A 5EPFA 3ZITA 2JZSA 2IWTA 3IAS2 3APQA 4XRDA 3G9BA 3IE3A 1EV9A 3FZ5A 2IJYA 2LRTA 1FB0A 3P90A 1GSYA 2C8UA 5IMZA 1SL1B 2F51A 4OMVA 4POKA 2XC2A 3BD2A 4MJCA 4ULXA 3QMXA 3CSJA 1T7PB 2A2RA 2LNTA 1PX7A 6GSYA 1KEBA 4F2IA 4GSTA 1MD3A 4WETA 3N5OA 3E3EA 2KP1A 5J9BA 4E8HA 1WWJA 1JFUA 1LBKA 4TXOA 4PUFC 3IK7A 4K6XA 4TR1B 4EL1A 2CZ3A 2GT5A 3A5WA 1MDJA 4NHZA 1GUHA 4N0ZA 2JZTA 4OO4A 3VWUA 4MMMA 3L9VA 1XWBA 1OC8A 4I6XA 5LNKe 3K8NA 2KHPA 3QPMA 3ZVJA 1PX6A 3SBCA 1XVWA 2LQOA 3H1NA 5KN0A 2I81A 2MBSA 3EMPA 3KIJA 2N5FA 2R3XA 1O85A 3D21A 1M0UA 2LV3A 2FLSA 5DQYA 2KOKA 2CQ9A 3GRXA 4WXTA 4DSRA 5KEJA 1F3AA 5IPGA 4PQHA 2H0IA 3UVTA 1R26A 3EC3A 3O3TA 4ZL8A 2GTUA 3GN3A 3QAWA 2E2GA 3FEUA 2K8SA 4OD7A 1YEXA 2KP2A 2MMAA 4OWYA 1SKRB 4L0WA 1X9SB 3MDKA 4DSSA 2LRCA 3HVVA 1TI3A 3CMIA 1PRXA 5CNWA 5G31A 3F3RA 4ZL9A 2WS2A 5D9VA 3NIVA 5JCGA 2RLIA 1M9AA 4BA7A 2FA4A 1N8JA 5IOXA 5CRWA 1I5GA 4FH8A 1TW9A 2FWGA 4L0UA 2YN1A 3O6TA 1YF0A 3TKQA 2FGXA 2HFDA 1Z7RA 1BX9A 2CVDA 4CHSA 1S3CA 1XOBA 5FHIA 2K8VA 2LJRA 4WR5A 4G19A 1Z9HA 1TJDA 1TRSA 2IMFA 1NSWA 3FZ4A 2PERA 3H8QA 3C1RA 2DC5A 3ME7A 4TXVA 4EDYA 3DEXA 3C73A 2H70A 4J2FA 1E6BA 3TUEA 1GLPA 2MMZA 2VIMA 1XWCA 1Z7PA 1SJIA 3TJFA 2B7KA 5DAKB 5IMDA 4ZBBA 1ERTA 1JLVA 1WMJA 2CT6A 3VI5A 3UARA 1USBA 1FOVA 1U87A 4HJMA 4GQFA 5C00A 3TKSE 3KH7A 4JU5A 1JHBA 3VPTA 3GL3A 2XBIA 4KB3A 3ZVJD 3HZ4A 4HQSA 5AISA 1FW1A 1X0RA 2MMOA 5DALB 1MD4A 2XHFA 4O5RA 4MK3A 4EUYA 2YV9A 1EP8A 5HFGA 1T1VA 4IVFA 1QGVA 1Z6NA 1OKDA 2X8HA 1EWXA 1WE0A 3Q18A 5IMCA 1X5DA 1ZCPA 5J41A 3R2QA 2AUVA 4LA1A 4F9ZA 4TR1A 3ED3A 2YWNA 2GVPA 2O8VB 5CP1A 1J08A 2EIOA 3UIWA 4N0VA 5JWOB 2H66A 1K3LA 5GSTA 3ZIVA 5ECSA 2GSRA 4GSSA 1OYJA 1TK8B 1SK1A 5A4WA 4RI7A 5B7CA 2DJ2A 2C0DA 5J9CA 1F2EA 2B3SA 1K3YA 5FT3A 3GTUB 3O76A 2CX3A 4G2EA 4EE0A 2VL2A 1J0FA 1O8WA 5F05A 4LL4B 3ERGA 3I9V2 3TCOA 1Q98A 4IELA 1ACVA 3LQ7A 3P8WA 5DQSA 1NHOA 1XOAA 2EIQA 3GA4A 5IMVA 2L4CA 4V1Ap 2G0FA 4BWQA 4YQUA 1B8XA 1W4VA 3GSTA 1XZOA 3GMFA 4WBJA 3HVSA 1TK5B 5B8BA 4ZXGA 3GKXA 5CRGA 4XTSA 1M9BA 4Q5NA 2H6YA 4PNGA 2CVKA 2JU5A 5AIXA 1EGRA 3GKMA 3F9UA 3L4NA 2DLXA 3QFAC 1ZL9A 2J23A 1DBYA 2QC7A 3S9FA 3M3MA 5AGYA 1UA5A 2HSYA 4K0NA 3IDVA 2J9HA 1BYEA 4QL7A 4GLTA 3VK9A 3J7Yk 1X5CA 4ML6A 18GSA 3CRTA 2EIRA 1HNCA 2DJ1A 1GNWA 2LQQA 1A8LA 4CW9A 3FR9A 2DIZA 3A2WA 4HOJA 2L57A 2VM2A 4KNDA 3UBLA 3ZIJA 4IQAA 2C80A 1UVZA 5DAKA 1KTEA 3C7MA 3L78A 4FYUA 1XWKA 2HZEB 2N5AA 2X64A 4EC0A 2CAQA 4ZB8A 3U5RE 3UMAA 3BCIA 1ILOA 3TB2A 1BAYA 3PGTA 5D73A 4OFNA 1G7EA 6GSUA 2H01A 5J3RA 4OCEA 5ECQB 2H1BA 3TKSA 2H19A 1NHYA 3TJBA 2VD0A 1O7UA 2HRFA 1U3AA 1J9BA 3EWLA 3E9JB 3GIXA 3UL3A 3BCKA 1ZYEA 2YNXA 3ZZXA 2BJXA 2X99A 2H0GA 2O7KA 3KJYA 2P5RA 4KA0A 3FYGA 2IMIA 3BBYA 2YZHA 3WGDA 1B9XC 3HDCA 2AV4A 2WDUA 1G6YA 3EVIA 4TN8A 4MF5A 1SJZA 2FUG2 3GKKA 5IPHA 2LRNA 1A8YA 4KH7A 4PUAA 1R5AA 4ECCA 1TU7A 2X8GA 4IP1A 5DVBA 4Q5QA 1PN9A 2YV7A 5IO0A 4IP6A 5D93A 4JR6A 5JCWA 3OR5A 2H74A 3GTUA 2O89A 5F07A 3QDNA 2IMDA 4WF4A 1M7TA 3G7JA 1GTAA 3HZ8A 4I8BA 1SL2B 4NHWA 3CTGA 2OACA 4KX4A 1AC1A 3KTBA 1DE1A 4V2MA 1XWGA 4J57E 6GSSA 2GQKA 2I9HA 2HYXA 2VL9A 2ALBA 3PH9A 1U88A 3KP8A 1CQHA 2GSQA 2GT6A 4LLRA 4XCSA 2VLVA 3ZMLA 2HLSA 2OE0A 4KDUA 4MABA 3VWVA 4ECBA 4KSOA 1YY7A 1CQGA 4YQVA 3KMOA 2YANA 1V9WA 3A2VA 1E2YA 1ON4A 4FO5A 5KN2A 2XBQA 3TGZA 1FVJA 3RHBA 4MZCA 5F06A 2AJQB 3TKRA 3FZAA 3LFLA 1TU8A 3EU3A 4IBPA 2CA8A 1FG4A 5H5RA 4YAVA 5LD0A 4AJ7A 4X1UA 1SK0A 2PMTA 1BQ7A 4IQ1A 2RM6A 3DWVA 3F3QA 4XIHA 1XPVA 2WULA 3HD5A 2GZZA 1WP0A 2P0GA 1XIYA 3FY7A 2GSTA 3GX8A 3DYRA 3HJPA 1PGTA 4XS1A 1RQMA 2RM5A 3HA9A 5D96A 5C04A 2B5XA 5L71A 4AJ6A 3KH9A 2VL2C 1ZZYA 3QD9A 1IYIA 2F8AA 1GH2A 5GZZB 2WCIA 1HQOA 4MZWA 4MJAA 3GNJA
chains in the Genus database with same CATH superfamily
5FWGA 5J4UA 2IN3A 1GSEA 1GP1A 3CRUA 2HZEA 3TKPA 5KN3A 2MZCA 1ZYNA 2REMA 4JBBA 1DE2A 2JSZA 2ON7A 4PQ1A 3LGCA 3TJGA 4YKGA 1M2BA 3TOTA 1THOA 3MNGA 3CSIA 2ZNMA 4K0GA 5ECLB 5HFKA 1GUKA 2H1DA 4N11A 1SYXA 1V40A 1GTUA 1TRVA 2RIIA 4IHUA 3EU4A 3DIEA 2YPMA 3M0FA 3ZTLA 3CXGA 1F3BA 2YWOA 14GSA 3TDGA 1FOHA 4TVEA 2OE1A 4KW6A 5EL8A 2L6CA 2GS3A 5ECRB 3H79A 2R6KA 2TIRA 3GH6A 4KUNA 1TRUA 1GTBA 3G7YA 3EYTA 4JRRA 1Y25A 3KD0A 5F8BA 4PXOA 2RUEA 2C0GA 5G1KA 1A24A 3GH9A 3KXOA 4DEJA 1ZMAA 3FZ9A 4GTUA 3WD6A 1M2AA 2H73A 1W89A 4GWRA 2IMEA 2I3YA 1B48A 3KCMA 2FCHA 2YCDA 2DJ0A 2H8LA 4G10A 4MZBA 4X43A 5ECIB 2VLUA 4HDEA 2VLTA 2JADA 3CYNA 3KM6A 1A23A 2OA7A 3IXRA 3TKSC 5ECPB 2H76A 5ID2A 1YEPA 5KOWA 2IMKA 3D4TA 2TRXA 1YQ1A 4FYCA 4NV5A 1S3DA 1YJ6A 1FVKA 1EEJA 3F4RA 2DSAA 4PNFA 4HUAA 1T8EB 3HKRA 3MWHA 1V98A 5IIZA 3QFBC 1TOFA 5ABRA 2V41A 2K6VA 1BG5A 3UJ1A 1U3IA 1K3OA 3EPTA 1Y6EA 3GHAA 3KGKA 3Q19A 3HY2A 1AQVA 4ZB6A 1BEDA 4YAPA 1O8XA 1F37A 2JACA 5JWQB 1YKCA 1GUMA 3HVXA 1TDIA 2NDOA 3IOSA 1SJ6A 1F6MC 2HSMA 3ZRDA 3GV1A 4L5LA 5D9TA 2H6XA 2A4VA 2QKEA 2ZUPA 1K0NA 3W8SA 2MMNA 4KCEA 4Z7XA 1H4OA 4O92A 3G7IA 2YWIA 1GSFA 1QMVA 4I2TA 5F0GA 4GSNA 2PUKC 1WOUA 4ZILA 1FB6A 4ZBAA 3L0HA 2ZCTA 1VF4A 2LS5A 2MYGA 4NXIA 2M46A 2C1YA 3TOUA 4HZ2A 3QOUA 1XW9A 3PPUA 1AIUA 4MPGA 3F4TA 5GAPD 2C3NA 2LNSA 2M80A 4MH2A 4K9ZA 2L5OA 3ERFA 2TRCP 3UOMA 2C3TA 3WGXA 2YWMA 17GSA 2AAWA 1GRXA 3ZFBA 4IW9A 3DVWA 6GSVA 22GSA 3H4KA 4ZL7A 3D4MA 4PGTA 2DJ3A 1OE7A 2PN8A 2FHEA 1C72A 3IPZA 3KZQA 1K0AA 4O32A 2HSHA 2DKIA 4F03A 2FNOA 3QR6A 2RUFA 3TRQA 3IC8A 1TKDB 4GCIA 1MEKA 5ECKB 2R0GA 2BMXA 1PL1A 4ZBDA 1HYUA 4LL1B 1K0DA 2NTOA 3M8NA 3TRXA 1XFLA 4K2DA 2PVOC 2ON5A 1S3AA 1GTIA 4Q5RA 3M9KA 5CREA 2WFCA 2G2QA 5A4UA 1T4YA 2HE3A 2FA8A 3IRAA 6GSXA 13GSA 1GNEA 1OAZA 5D8IA 3LXZA 3ZLPA 1YKAA 1R5PA 4FQUA 2NVLA 3LXTA 1ZYQB 3GURA 3LWAA 4EF0A 16GSA 2B1LA 1A0FA 4ECIA 4V2LA 1S3RA 4V2NA 2H0HA 3L9SA 2YJHA 4K7IA 2AB6A 1TRWA 2WB9A 4MF6A 1QK8A 2LSTA 1FHEA 3I6AA 4IJ3A 3IV4A 2IIYA 4G0LA 2FWEA 4NWYA 3N9JA 4RQRA 1URMA 4FIWA 2A2SA 3VPQA 4AGSA 3IK9A 3US3A 1TI1A 1PKZA 3P7XA 5ECMB 4MLYA 4ICYA 1EV4A 2HI7A 3ZMKA 1LJRA 5CRDA 2OBIA 2VCTA 2C3QA 3ZL5A 5BMUA 1MDKA 4IKHA 1GSQA 2JL4A 2XPEA 3C71A 3I69A 3KTLA 3D22A 2GQMA 2DKHA 4XHMA 1ST9A 4NMUA 5CO3A 1SYRA 4HEA2 5B6NA 2I1UA 1XXUA 5CRHA 5H5SA 3IHQA 1HNAA 3I43A 2HRKA 5D9WA 4DVCA 2LTKA 3VWWA 2NPBA 4BVXA 2OKAA 3FRCA 3GSSA 3CSHA 3UVHA 4CY6A 2CX4A 4RQXA 2LEGA 4G9HA 4KF9A 4PURA 9GSSA 3HJMA 1AXDA 1PKWA 5GAND 4LMWA 3BOAA 3F63A 1PQNA 4KCAA 5JWRB 20GSA 4D73B 2V6KA 5DDLA 4TW5A 3NOFA 7GSSA 1OC3A 4NAXA 1EEMA 2OJLA 1JZWA 4JR4A 4EIQA 4BL7A 1GSSA 3FW2A 2E0QA 1NW2A 5ID2B 2BTOT 2NBSA 1PN0A 1A2LA 3WT1A 2PWJA 4MA9A 4Z2TA 3FMWA 2QA1A 2X4AA 3EURA 3WT2A 1X5EA 3RBTA 4X0XA 5J5NA 3F6DA 4WR4A 3FK8A 2P5QA 3MAKA 2MBTA 1IYHA 1VGLA 4WF5A 4PX1A 2V6OA 2YZUA 1V58A 3VWXA 3GUSA 1AQXA 3DMLA 3ISOA 1T4ZA 2H1AA 3CBUA 4H86A 3ERWA 4ILFA 2AHEA 3HCZA 2N5BA 1QFNA 2E7PA 1X9MB 2HRNA 4EXJA 4OO5A 1WJKA 4ISDA 1X9WB 4N10A 4MPFA 2V2GA 3LORA 2I4AA 3ZYWA 1Q4JA 1B9YC 3IA1A 4DSQA 1JZRA 2H30A 2H71A 1TK0B 4KGIA 2DJKA 4YH2A 4LMVA 2L6DA 3DXBA 2CAIA 2LJAA 2VAFA 4AJ8A 3UEMA 5ECNB 2PVQA 2OBKA 2LUSA 2L59A 2JSYA 2VCXA 2P31A 5G1LA 4EDZA 4USSA 2HT9A 1RW1A 1K0BA 4ML1A 4K7NA 4JZQA 3RDWA 2CVBA 3LG6A 4HQZA 4PTSA 4MF7A 1WIKA 5G5EA 12GSA 5ELAA 1O6JA 4L5OA 3KP9A 1Z6MA 4HS1A 1HNBA 1B4PA 5DBQA 2V1MA 2QA2A 2IFQA 3DVXA 4L8EA 3AY8A 4HJ2A 4QQ7A 4MH3A 3IBHA 3LEFA 2B1KA 1YZXA 4XS4B 2KLXA 1T3BA 4K8MA 2DJJA 4IGJA 3TRPA 5G30A 2K18A 2F9SA 3CTFA 3U6VA 3L9UA 3VLNA 1GL8A 2LJKA 2B5EA 5CAXA 3DRNA 2DIYA 2M72A 1OC9B 2DMLA 1PL2A 4TR3A 4EO3A 3M9JA 1Z3EA 1UN2A 4O7HA 3VURA 1RK4A 1XWAA 5JCUA 1SU9A 2VOCA 1GLQA 1SK2A 3VI7A 1SKWB 1EGOA 5DJLA 4EVMA 3J7Yb 1OE8A 5H5QA 1WRYA 3EINA 1XG8A 4QL9A 4KAEA 2FY6A 4YQMA 2DBCA 1K0CA 1YDKA 4KDXA 2CV4A 5HR1A 4F0CA 1Z5YE 5ENUA 4D73A 2VD1A 3DGQA 4OFMA 4RI6A 5DJMA 4K1FA 5DCGA 1ZOFA 3IC4A 5GSSA 2GGTA 4GQCA 1QXHA 2VCVA 2WJUA 4WKWA 2PU9C 1SENA 4YKFA 2VCZA 5EY6A 3FHKA 1EOHA 4MP4A 3MSZA 3C8EA 8GSSA 3QAGA 1TP9A 1THXA 2EC4A 3UAPA 4EKZA 3WGEA 1AQWA 4WBRD 1QUWA 1MTCA 5ELGA 3GKNA 3VFIA 5HR3A 5IQYA 5G2ZA 3TJJA 4GXZA 3ZFLA 1SKSB 3JCML 3KEBA 3F8UA 4XS6A 3HXSA 2PGTA 4TR0A 1V57A 1M3JA 3RAZA 1QQ2A 2GZPA 3A2XA 1K0MA 3LJRA 2KUCA 1M2DA 5ECOB 5E4WA 2QSIA 1O73A 5IOWA 10GSA 4BPYA 4TKYA 2DMMA 4E8EA 1XCCA 1AUCA 1VF3A 4KDYA 2HXKA 3D6IA 2L4QA 2FWFA 2C0FA 1DSBA 2CZ2A 5IO2A 4WEYA 4BVXB 1G7OA 3FKFA 1V2AA 3IR4A 3QAVA 1PA3A 1XW5A 4FYBA 2V32A 4MDCA 2K9FA 1M99A 4AF2A 1KBNA 4V1Ag 3GX0A 4KSMA 2R5GA 4I2UA 2F8FA 2VCQA 3GYKA 1K0OA 4ZIJA 1VF1A 3R3EA 1G6WA 3NZNA 4ZB9A 3F0IA 4PQIA 3LSZA 5AN1A 4GRFA 4I97A 5EVOA 2HZFA 2VO4A 19GSA 4XRAA 2H72A 3EMXA 4BL7B 1BJXA 3WYWA 4TOPA 5BRTA 2H75A 5ECHB 4TRXA 4I5QA 2R4VA 1H75A 2OADA 1EZKA 1I9DA 2OE3A 3V1WA 1N2AA 2PPTA 2IPAA 2ES7A 3W6GA 3DKSA 3GFKA 3HYPA 1ERUA 4MNNA 1ML6A 1YF1A 2LKUA 4Q5FA 4XS4A 2QGVA 4P3YB 1VF2A 3F4SA 1FAAA 1OC9A 3W8JA 3HHVA 5IMAA 5A5KA 2H1GA 5HQPA 1ERWA 1DUGA 2HNLA 2VUPA 2YJ7A 2HRAA 1MDIA 1TTZA 1XW6A 1U6TA 1XBSA 5KN1A 4BVYA 3RPPA 3BJ5A 4IJIA 3QCPA 3E0UA 1T00A 1F9MA 3HJOA 2D2ZA 4BIKA 3A3TA 4ECJA 3D5JA 4IN0A 4TXOB 4F82A 1WPIA 5A4VA 2UZ8A 4K7OA 1SD8A 3EE2A 2GLRA 5COHA 4NV2A 2VM1A 1B4QA 4OFTA 2IL3A 4J56E 3KMNA 3H93A 3ME8A 3LYKA 4NPBA 1A0RP 2X8CA 2AYTA 1SL0B 1JZDA 1JLWA 3IAM2 3P2AA 2VL3A 4N30A 1GSUA 4JEDA 3LYPA 4IS0A 1M3IA 1PSQA 5IMFA 2R2JA 2VCWA 2FD3A 3FR6A 1OKTA 2YP6A 3APOA 4KE3A 4JE1A 1JZOA 3F6FA 4HZ4A 3UBKA 3TJKA 1R7HA 4HU9A 2C0EA 1HD2A 1PD21 2R37A 5G5FA 1XVQA 4HI7A 2B7JA 1EP7A 2IFQB 1A2JA 1TXXA 1KNGA 4G0IA 6GSTA 3Q6OA 1NM3A 1ERVA 2FWHA 1ABAA 1GSDA 2O87A 2WZ9A 1LU4A 5IM9A 5AIVA 2WGRA 4OCFA 1G0TA 2E2MA 4DSSB 1SD9A 2GDRA 2WRTA 3DD3A 1R4WA 5DALA 2C4JA 4HSCX 2H6ZA 5E59A 5D9XA 3RHCA 5HR0A 4ACSA 3GL5A 3Q74A 4RUVA 4CY8A 1EOGA 3D0ZA 2B6MA 4POMA 3PINA 5DCHA 4BWSA 3SWLA 1ZYPA 1ZGNA 4ID0A 1VRSD 2R0PA 5LCZA 5B6MA 3ZREA 1GWCA 6GSWA 1AAZA 4F0BA 5CYYA 4A5PA 4TR4A 3PR8A 2XPDA 3APSA 3RPNA 2O85A 2GQLA 4POBA 5INYA 1PMTA 1UC7A 3FR3A 3M1GA 2F3MA 4MJBA 1A2MA 2JZRA 4Z2RA 1GULA 5B8AA 4MCUA 5HR2A 2L5LA 2GZYA 1O81A 1FO5A 4POLA 4HU7A 4CDOA 2PBJA 2GSSA 2Z9SA 5HFIA 11GSA 1AW9A 2B5YA 2YOIA 1OVNA 3C1SA 4MJEA 4GF0A 5EPFA 3ZITA 2JZSA 2IWTA 3IAS2 3APQA 4XRDA 3G9BA 3IE3A 1EV9A 3FZ5A 4O5QA 2IJYA 2LRTA 1FB0A 3P90A 1GSYA 2C8UA 5IMZA 1SL1B 2F51A 4OMVA 4POKA 2XC2A 3BD2A 4MJCA 4ULXA 3QMXA 3CSJA 1T7PB 2A2RA 2LNTA 1PX7A 6GSYA 1KEBA 4F2IA 4GSTA 1MD3A 4WETA 3N5OA 3E3EA 2KP1A 5J9BA 4E8HA 1WWJA 1JFUA 1LBKA 4TXOA 4PUFC 3IK7A 4K6XA 4TR1B 2R0CA 4EL1A 2CZ3A 2GT5A 3A5WA 1MDJA 4NHZA 1GUHA 4N0ZA 2JZTA 4OO4A 3VWUA 4MMMA 3L9VA 1XWBA 1OC8A 4I6XA 5LNKe 3K8NA 2KHPA 3QPMA 3ZVJA 1PX6A 3SBCA 1XVWA 2LQOA 3H1NA 5KN0A 2I81A 2MBSA 3EMPA 3KIJA 2N5FA 2R3XA 4K5RA 1O85A 3D21A 1M0UA 2LV3A 2FLSA 5DQYA 2KOKA 2CQ9A 3GRXA 4WXTA 4DSRA 5KEJA 1F3AA 5IPGA 4PQHA 3IHGA 2H0IA 3UVTA 1R26A 3EC3A 3O3TA 4ZL8A 2GTUA 3GN3A 3QAWA 2E2GA 3FEUA 2K8SA 4OD7A 1YEXA 2KP2A 2MMAA 4OWYA 1SKRB 4L0WA 1X9SB 3MDKA 4DSSA 2LRCA 3HVVA 1TI3A 3CMIA 1PRXA 5CNWA 5G31A 3F3RA 4ZL9A 2WS2A 3LW9A 5D9VA 3NIVA 5JCGA 2RLIA 1M9AA 4BA7A 2FA4A 1N8JA 5IOXA 4G0KA 5CRWA 1I5GA 4FH8A 1TW9A 2FWGA 4BVYB 4L0UA 2YN1A 3O6TA 1YF0A 3TKQA 2FGXA 2HFDA 1Z7RA 1BX9A 2CVDA 4CHSA 3CQFA 1S3CA 5KOXA 1XOBA 5FHIA 2K8VA 2LJRA 4WR5A 4G19A 1Z9HA 1TJDA 1TRSA 2IMFA 1NSWA 3FZ4A 2PERA 3H8QA 3C1RA 2DC5A 3ME7A 4TXVA 4EDYA 3DEXA 4Z2UA 3C73A 2H70A 4J2FA 1E6BA 3TUEA 1GLPA 2MMZA 2VIMA 1XWCA 1Z7PA 1SJIA 3TJFA 2B7KA 5DAKB 5IMDA 3MYDA 1ERTA 1JLVA 1WMJA 4ZBBA 2CT6A 3VI5A 3UARA 1USBA 4K5SA 1FOVA 1U87A 4HJMA 4GQFA 5C00A 3TKSE 3KH7A 4JU5A 1JHBA 3VPTA 3GL3A 2XBIA 4KB3A 1PFOA 3ZVJD 3HZ4A 4HQSA 5AISA 1FW1A 1X0RA 2MMOA 5DALB 1MD4A 2XHFA 4O5RA 4MK3A 4EUYA 2YV9A 1EP8A 5HFGA 1T1VA 4IVFA 4EIPA 1QGVA 1Z6NA 1OKDA 2X8HA 1EWXA 1WE0A 3Q18A 5IMCA 1X5DA 1ZCPA 5J41A 3R2QA 2AUVA 4LA1A 4F9ZA 4TR1A 3ED3A 2YWNA 4O5UA 2GVPA 2O8VB 5CP1A 1J08A 2EIOA 3UIWA 4N0VA 5JWOB 2H66A 1K3LA 5GSTA 3ZIVA 5ECSA 2GSRA 4GSSA 1OYJA 1TK8B 1SK1A 5A4WA 4RI7A 5B7CA 2DJ2A 2C0DA 3HVNA 5J9CA 1F2EA 2B3SA 1K3YA 5FT3A 3GTUB 3O76A 2CX3A 4G2EA 4EE0A 2VL2A 1J0FA 1O8WA 5F05A 4LL4B 3ERGA 3I9V2 3TCOA 1Q98A 4IELA 1ACVA 3LQ7A 3P8WA 5DQSA 1NHOA 1XOAA 2EIQA 3GA4A 5IMVA 2L4CA 4V1Ap 2G0FA 4BWQA 4YQUA 1B8XA 1W4VA 3GSTA 1XZOA 3GMFA 4WBJA 3HVSA 1TK5B 5B8BA 4ZXGA 3GKXA 5CRGA 4XTSA 1M9BA 4Q5NA 2H6YA 4PNGA 2CVKA 2JU5A 5AIXA 1EGRA 3GKMA 3F9UA 3L4NA 2DLXA 3QFAC 1ZL9A 2J23A 1DBYA 2QC7A 3S9FA 3M3MA 5AGYA 1UA5A 4X4JA 2HSYA 4K0NA 3IDVA 2J9HA 1BYEA 4QL7A 4GLTA 2X49A 3VK9A 3J7Yk 1X5CA 4ML6A 18GSA 3CRTA 2EIRA 1HNCA 2DJ1A 1GNWA 2LQQA 1A8LA 4CW9A 3FR9A 2DIZA 3A2WA 4HOJA 2L57A 2VM2A 4KNDA 3UBLA 3ZIJA 4IQAA 2C80A 1UVZA 5DAKA 1KTEA 3C7MA 3L78A 4FYUA 1XWKA 2HZEB 2N5AA 2X64A 4EC0A 4K2XA 2CAQA 4ZB8A 3U5RE 3UMAA 3A5IA 3BCIA 1ILOA 3TB2A 1BAYA 3PGTA 5D73A 4OFNA 1G7EA 6GSUA 2H01A 5J3RA 4OCEA 5ECQB 2H1BA 3TKSA 2H19A 1NHYA 3TJBA 2VD0A 1O7UA 2HRFA 1U3AA 1J9BA 3EWLA 3E9JB 3GIXA 3UL3A 3BCKA 2A4HA 1ZYEA 2YNXA 3ZZXA 2BJXA 2X99A 2H0GA 2O7KA 3KJYA 2P5RA 4KA0A 3FYGA 2IMIA 3BBYA 2YZHA 3WGDA 1B9XC 3HDCA 2AV4A 2WDUA 1G6YA 3EVIA 4TN8A 4MF5A 1SJZA 2FUG2 3GKKA 5IPHA 2LRNA 1A8YA 4KH7A 4PUAA 1R5AA 4ECCA 1TU7A 2X8GA 4IP1A 5DVBA 4Q5QA 1PN9A 2YV7A 5IO0A 4IP6A 5D93A 4JR6A 5JCWA 3OR5A 2H74A 3GTUA 2O89A 5F07A 3QDNA 2IMDA 4WF4A 1M7TA 3G7JA 1GTAA 3HZ8A 4I8BA 1SL2B 4NHWA 3CTGA 2OACA 4KX4A 1AC1A 3KTBA 1DE1A 4V2MA 1XWGA 4J57E 6GSSA 2GQKA 2I9HA 2HYXA 2VL9A 2ALBA 3MIXA 3PH9A 1U88A 3KP8A 1CQHA 2GSQA 2GT6A 4LLRA 4XCSA 2VLVA 3ZMLA 2HLSA 2OE0A 4KDUA 4MABA 3VWVA 4ECBA 4KSOA 1YY7A 1CQGA 4YQVA 3KMOA 2YANA 1V9WA 3A2VA 1E2YA 1ON4A 4FO5A 5KN2A 2XBQA 3TGZA 1FVJA 3RHBA 4MZCA 5F06A 2AJQB 3TKRA 3FZAA 3LFLA 1TU8A 3EU3A 4IBPA 2CA8A 1FG4A 5H5RA 4YAVA 5LD0A 4AJ7A 4X1UA 1SK0A 2PMTA 1BQ7A 4IQ1A 2RM6A 3DWVA 3F3QA 4XIHA 1XPVA 2WULA 3HD5A 2GZZA 2A2PA 1WP0A 2P0GA 1XIYA 3FY7A 2GSTA 3GX8A 3DYRA 3HJPA 1PGTA 4XS1A 1RQMA 2RM5A 3HA9A 5D96A 5C04A 2B5XA 5L71A 4AJ6A 3KH9A 2VL2C 1ZZYA 3QD9A 1IYIA 2F8AA 1GH2A 5GZZB 2WCIA 1HQOA 4MZWA 4MJAA 3GNJA
chains in the Genus database with same CATH topology
5FWGA 5J4UA 2IN3A 1GSEA 1GP1A 3CRUA 2HZEA 3TKPA 5KN3A 2MZCA 1ZYNA 2REMA 4JBBA 1DE2A 2JSZA 2ON7A 4PQ1A 3LGCA 3TJGA 4YKGA 1M2BA 3TOTA 1THOA 3MNGA 3CSIA 2ZNMA 4K0GA 5ECLB 5HFKA 1GUKA 2H1DA 4N11A 1SYXA 1V40A 1GTUA 1TRVA 2RIIA 4IHUA 3EU4A 3DIEA 2YPMA 3M0FA 3ZTLA 3CXGA 1F3BA 2YWOA 14GSA 3TDGA 1FOHA 4TVEA 2OE1A 4KW6A 5EL8A 2L6CA 2GS3A 5ECRB 3H79A 2R6KA 2TIRA 3GH6A 4KUNA 1TRUA 1GTBA 3G7YA 3EYTA 4JRRA 1Y25A 3KD0A 5F8BA 4PXOA 2RUEA 2C0GA 5G1KA 1A24A 3GH9A 3KXOA 4DEJA 1ZMAA 3FZ9A 4GTUA 3WD6A 1M2AA 2H73A 1W89A 4GWRA 2IMEA 2I3YA 1B48A 3KCMA 2FCHA 2YCDA 2DJ0A 2H8LA 4G10A 4MZBA 4X43A 5ECIB 2VLUA 4HDEA 2VLTA 2JADA 3CYNA 3KM6A 1A23A 2OA7A 3IXRA 3TKSC 5ECPB 2H76A 5ID2A 1YEPA 5KOWA 2IMKA 3D4TA 2TRXA 1YQ1A 4FYCA 4NV5A 1S3DA 1YJ6A 1FVKA 1EEJA 3F4RA 2DSAA 4PNFA 4HUAA 1T8EB 3HKRA 3MWHA 1V98A 5IIZA 3QFBC 1TOFA 5ABRA 2V41A 2K6VA 1BG5A 3UJ1A 1U3IA 1K3OA 3EPTA 1Y6EA 3GHAA 3KGKA 3Q19A 3HY2A 1AQVA 4ZB6A 1BEDA 4YAPA 1O8XA 1F37A 2JACA 5JWQB 1YKCA 1GUMA 3HVXA 1TDIA 2NDOA 3IOSA 1SJ6A 1F6MC 2HSMA 3ZRDA 3GV1A 4L5LA 5D9TA 2H6XA 2A4VA 2QKEA 2ZUPA 1K0NA 3W8SA 2MMNA 4KCEA 4Z7XA 1H4OA 4O92A 3G7IA 2YWIA 1GSFA 1QMVA 4I2TA 5F0GA 4GSNA 2PUKC 1WOUA 4ZILA 1FB6A 4ZBAA 3L0HA 2ZCTA 1VF4A 2LS5A 2MYGA 4NXIA 2M46A 2C1YA 3TOUA 4HZ2A 3QOUA 1XW9A 3PPUA 1AIUA 4MPGA 3F4TA 5GAPD 2C3NA 2LNSA 2M80A 4MH2A 4K9ZA 2L5OA 3ERFA 2TRCP 3UOMA 2C3TA 3WGXA 2YWMA 17GSA 2AAWA 1GRXA 3ZFBA 4IW9A 3DVWA 6GSVA 22GSA 3H4KA 4ZL7A 3D4MA 4PGTA 2DJ3A 1OE7A 2PN8A 2FHEA 1C72A 3IPZA 3KZQA 1K0AA 4O32A 2HSHA 2DKIA 4F03A 2FNOA 3QR6A 2RUFA 3TRQA 3IC8A 1TKDB 4GCIA 1MEKA 5ECKB 2R0GA 2BMXA 1PL1A 4ZBDA 1HYUA 4LL1B 1K0DA 2NTOA 3M8NA 3TRXA 1XFLA 4K2DA 2PVOC 2ON5A 1S3AA 1GTIA 4Q5RA 3M9KA 5CREA 2WFCA 2G2QA 5A4UA 1T4YA 2HE3A 2FA8A 3IRAA 6GSXA 13GSA 1GNEA 1OAZA 5D8IA 3LXZA 3ZLPA 1YKAA 1R5PA 4FQUA 2NVLA 3LXTA 1ZYQB 3GURA 3LWAA 4EF0A 16GSA 2B1LA 1A0FA 4ECIA 4V2LA 4V2NA 2H0HA 3L9SA 2YJHA 4K7IA 2AB6A 1TRWA 2WB9A 4MF6A 1QK8A 2LSTA 1FHEA 3I6AA 4IJ3A 3IV4A 2IIYA 4G0LA 2FWEA 4NWYA 3N9JA 4RQRA 1URMA 4FIWA 2A2SA 3VPQA 4AGSA 3IK9A 3US3A 1TI1A 1PKZA 3P7XA 5ECMB 4MLYA 4ICYA 1EV4A 2HI7A 3ZMKA 1LJRA 5CRDA 2OBIA 2VCTA 2C3QA 3ZL5A 5BMUA 1MDKA 4IKHA 1GSQA 2JL4A 2XPEA 3C71A 3I69A 3KTLA 3D22A 2GQMA 2DKHA 4XHMA 1ST9A 4NMUA 5CO3A 1SYRA 4HEA2 5B6NA 2I1UA 1XXUA 5CRHA 5H5SA 3IHQA 1HNAA 3I43A 2HRKA 5D9WA 4DVCA 2LTKA 3VWWA 2NPBA 4BVXA 2OKAA 3FRCA 3GSSA 3CSHA 3UVHA 4CY6A 2CX4A 4RQXA 2LEGA 4G9HA 4KF9A 4PURA 9GSSA 3HJMA 1AXDA 1PKWA 5GAND 4LMWA 3BOAA 3F63A 1PQNA 4KCAA 5JWRB 20GSA 4D73B 2V6KA 5DDLA 4TW5A 3NOFA 7GSSA 1OC3A 4NAXA 1EEMA 2OJLA 1JZWA 4JR4A 4EIQA 4BL7A 1GSSA 3FW2A 2E0QA 1NW2A 5ID2B 2BTOT 2NBSA 1PN0A 1A2LA 3WT1A 2PWJA 4MA9A 4Z2TA 3FMWA 2QA1A 2X4AA 3EURA 3WT2A 1X5EA 3RBTA 4X0XA 5J5NA 3F6DA 4WR4A 3FK8A 2P5QA 3MAKA 2MBTA 1IYHA 1VGLA 4WF5A 4PX1A 2V6OA 2YZUA 1V58A 3VWXA 3GUSA 1AQXA 3DMLA 3ISOA 1T4ZA 2H1AA 3CBUA 4H86A 3ERWA 4ILFA 2AHEA 3HCZA 2N5BA 1QFNA 2E7PA 1X9MB 2HRNA 4EXJA 4OO5A 1WJKA 4ISDA 1X9WB 4N10A 4MPFA 2V2GA 3LORA 2I4AA 3ZYWA 1Q4JA 1B9YC 3IA1A 4DSQA 1JZRA 2H30A 2H71A 1TK0B 4KGIA 2DJKA 4YH2A 4LMVA 2L6DA 3DXBA 2CAIA 2LJAA 2VAFA 4AJ8A 3UEMA 5ECNB 2PVQA 2OBKA 2LUSA 2L59A 2JSYA 2VCXA 2P31A 5G1LA 4EDZA 4USSA 2HT9A 1RW1A 1K0BA 4ML1A 4K7NA 4JZQA 3RDWA 2CVBA 3LG6A 4HQZA 4PTSA 4MF7A 1WIKA 5G5EA 12GSA 5ELAA 1O6JA 4L5OA 3KP9A 1Z6MA 4HS1A 1HNBA 1B4PA 5DBQA 2V1MA 2QA2A 2IFQA 3DVXA 4L8EA 3AY8A 4HJ2A 4QQ7A 4MH3A 3IBHA 3LEFA 2B1KA 1YZXA 4XS4B 2KLXA 1T3BA 4K8MA 2DJJA 4IGJA 3TRPA 5G30A 2K18A 2F9SA 3CTFA 3U6VA 3L9UA 3VLNA 1GL8A 2LJKA 2B5EA 5CAXA 3DRNA 2DIYA 2M72A 1OC9B 2DMLA 1PL2A 4TR3A 4EO3A 3M9JA 1Z3EA 1UN2A 4O7HA 3VURA 1RK4A 1XWAA 5JCUA 1SU9A 2VOCA 1GLQA 1SK2A 3VI7A 1SKWB 1EGOA 5DJLA 4EVMA 3J7Yb 1OE8A 5H5QA 1WRYA 3EINA 4QL9A 4KAEA 2FY6A 4YQMA 2DBCA 1K0CA 1YDKA 4KDXA 2CV4A 5HR1A 4F0CA 1Z5YE 5ENUA 4D73A 2VD1A 3DGQA 4OFMA 4RI6A 5DJMA 4K1FA 5DCGA 1ZOFA 3IC4A 5GSSA 2GGTA 4GQCA 1QXHA 2VCVA 2WJUA 4WKWA 2PU9C 1SENA 4YKFA 2VCZA 5EY6A 3FHKA 1EOHA 4MP4A 3MSZA 3C8EA 8GSSA 3QAGA 1TP9A 1THXA 2EC4A 3UAPA 4EKZA 3WGEA 1AQWA 4WBRD 1QUWA 1MTCA 5ELGA 3GKNA 3VFIA 5HR3A 5IQYA 5G2ZA 3TJJA 4GXZA 3ZFLA 1SKSB 3JCML 3KEBA 3F8UA 4XS6A 3HXSA 2PGTA 4TR0A 1V57A 3RAZA 1QQ2A 2GZPA 3A2XA 1K0MA 3LJRA 2KUCA 1M2DA 5ECOB 5E4WA 2QSIA 1O73A 5IOWA 10GSA 4BPYA 4TKYA 2DMMA 4E8EA 1XCCA 1AUCA 1VF3A 4KDYA 2HXKA 3D6IA 2L4QA 2FWFA 2C0FA 1DSBA 2CZ2A 5IO2A 4WEYA 4BVXB 1G7OA 3FKFA 1V2AA 3IR4A 3QAVA 1PA3A 1XW5A 4FYBA 2V32A 4MDCA 2K9FA 1M99A 4AF2A 1KBNA 4V1Ag 3GX0A 4KSMA 2R5GA 4I2UA 2F8FA 2VCQA 3GYKA 1K0OA 4ZIJA 1VF1A 3R3EA 1G6WA 3NZNA 4ZB9A 3F0IA 4PQIA 3LSZA 5AN1A 4GRFA 4I97A 5EVOA 2HZFA 2VO4A 19GSA 4XRAA 2H72A 3EMXA 4BL7B 1BJXA 3WYWA 4TOPA 5BRTA 2H75A 5ECHB 4TRXA 4I5QA 2R4VA 1H75A 2OADA 1EZKA 1I9DA 2OE3A 3V1WA 1N2AA 2PPTA 2IPAA 2ES7A 3W6GA 3DKSA 3GFKA 3HYPA 1ERUA 4MNNA 1ML6A 1YF1A 2LKUA 4Q5FA 4XS4A 2QGVA 4P3YB 1VF2A 3F4SA 1FAAA 1OC9A 3W8JA 3HHVA 5IMAA 5A5KA 2H1GA 5HQPA 1ERWA 1DUGA 2HNLA 2VUPA 2YJ7A 2HRAA 1MDIA 1TTZA 1XW6A 1U6TA 1XBSA 5KN1A 4BVYA 3RPPA 3BJ5A 4IJIA 3QCPA 3E0UA 1T00A 1F9MA 3HJOA 2D2ZA 3A3TA 4ECJA 3D5JA 4IN0A 4TXOB 4F82A 1WPIA 5A4VA 2UZ8A 4K7OA 1SD8A 3EE2A 2GLRA 5COHA 4NV2A 2VM1A 1B4QA 4OFTA 2IL3A 4J56E 3KMNA 3H93A 3ME8A 3LYKA 4NPBA 1A0RP 2X8CA 2AYTA 1SL0B 1JZDA 1JLWA 3IAM2 3P2AA 2VL3A 4N30A 1GSUA 4JEDA 3LYPA 4IS0A 1PSQA 5IMFA 2R2JA 2VCWA 2FD3A 3FR6A 1OKTA 2YP6A 3APOA 4KE3A 4JE1A 1JZOA 3F6FA 4HZ4A 3UBKA 3TJKA 1R7HA 4HU9A 2C0EA 1HD2A 1PD21 2R37A 5G5FA 1XVQA 4HI7A 2B7JA 1EP7A 2IFQB 1A2JA 1TXXA 1KNGA 4G0IA 6GSTA 3Q6OA 1NM3A 1ERVA 2FWHA 1ABAA 1GSDA 2O87A 2WZ9A 1LU4A 5IM9A 5AIVA 2WGRA 4OCFA 1G0TA 2E2MA 4DSSB 1SD9A 2GDRA 2WRTA 3DD3A 1R4WA 5DALA 2C4JA 2H6ZA 5E59A 5D9XA 3RHCA 5HR0A 4ACSA 3GL5A 3Q74A 4RUVA 4CY8A 1EOGA 3D0ZA 2B6MA 4POMA 3PINA 5DCHA 4BWSA 3SWLA 1ZYPA 1ZGNA 4ID0A 1VRSD 2R0PA 5LCZA 5B6MA 3ZREA 1GWCA 6GSWA 1AAZA 4F0BA 5CYYA 4A5PA 4TR4A 3PR8A 2XPDA 3APSA 3RPNA 2O85A 2GQLA 4POBA 5INYA 1PMTA 1UC7A 3FR3A 3M1GA 2F3MA 4MJBA 1A2MA 2JZRA 4Z2RA 1GULA 5B8AA 4MCUA 5HR2A 2L5LA 2GZYA 1O81A 1FO5A 4POLA 4HU7A 4CDOA 2PBJA 2GSSA 2Z9SA 5HFIA 11GSA 1AW9A 2B5YA 2YOIA 1OVNA 3C1SA 4MJEA 4GF0A 5EPFA 3ZITA 2JZSA 2IWTA 3IAS2 3APQA 4XRDA 3G9BA 3IE3A 1EV9A 3FZ5A 4O5QA 2IJYA 2LRTA 1FB0A 3P90A 1GSYA 2C8UA 5IMZA 1SL1B 2F51A 4OMVA 4POKA 2XC2A 3BD2A 4MJCA 4ULXA 3QMXA 3CSJA 1T7PB 2A2RA 2LNTA 1PX7A 6GSYA 1KEBA 4F2IA 4GSTA 1MD3A 4WETA 3N5OA 3E3EA 2KP1A 5J9BA 4E8HA 1WWJA 1JFUA 1LBKA 4TXOA 4PUFC 3IK7A 4K6XA 4TR1B 2R0CA 4EL1A 2CZ3A 2GT5A 3A5WA 1MDJA 4NHZA 1GUHA 4N0ZA 2JZTA 4OO4A 3VWUA 4MMMA 3L9VA 1XWBA 1OC8A 4I6XA 5LNKe 3K8NA 2KHPA 3QPMA 3ZVJA 1PX6A 3SBCA 1XVWA 2LQOA 3H1NA 5KN0A 2I81A 2MBSA 3EMPA 3KIJA 2N5FA 2R3XA 4K5RA 1O85A 3D21A 1M0UA 2LV3A 2FLSA 5DQYA 2KOKA 2CQ9A 3GRXA 4WXTA 4DSRA 5KEJA 1F3AA 5IPGA 4PQHA 3IHGA 2H0IA 3UVTA 1R26A 3EC3A 3O3TA 4ZL8A 2GTUA 3GN3A 3QAWA 2E2GA 3FEUA 2K8SA 4OD7A 1YEXA 2KP2A 2MMAA 4OWYA 1SKRB 4L0WA 1X9SB 3MDKA 4DSSA 2LRCA 3HVVA 1TI3A 3CMIA 1PRXA 5CNWA 5G31A 3F3RA 4ZL9A 2WS2A 3LW9A 5D9VA 3NIVA 5JCGA 2RLIA 1M9AA 4BA7A 2FA4A 1N8JA 5IOXA 4G0KA 5CRWA 1I5GA 4FH8A 1TW9A 2FWGA 4BVYB 4L0UA 2YN1A 3O6TA 1YF0A 3TKQA 2FGXA 2HFDA 1Z7RA 1BX9A 2CVDA 4CHSA 1S3CA 5KOXA 1XOBA 5FHIA 2K8VA 2LJRA 4WR5A 4G19A 1Z9HA 1TJDA 1TRSA 2IMFA 1NSWA 3FZ4A 2PERA 3H8QA 3C1RA 2DC5A 3ME7A 4TXVA 4EDYA 3DEXA 4Z2UA 3C73A 2H70A 4J2FA 1E6BA 3TUEA 1GLPA 2MMZA 2VIMA 1XWCA 1Z7PA 1SJIA 3TJFA 2B7KA 5DAKB 5IMDA 3MYDA 1ERTA 1JLVA 1WMJA 4ZBBA 2CT6A 3VI5A 3UARA 1USBA 4K5SA 1FOVA 1U87A 4HJMA 4GQFA 5C00A 3TKSE 3KH7A 4JU5A 1JHBA 3VPTA 3GL3A 2XBIA 4KB3A 3ZVJD 3HZ4A 4HQSA 5AISA 1FW1A 1X0RA 2MMOA 5DALB 1MD4A 2XHFA 4O5RA 4MK3A 4EUYA 2YV9A 1EP8A 5HFGA 1T1VA 4IVFA 4EIPA 1QGVA 1Z6NA 1OKDA 2X8HA 1EWXA 1WE0A 3Q18A 5IMCA 1X5DA 1ZCPA 5J41A 3R2QA 2AUVA 4LA1A 4F9ZA 4TR1A 3ED3A 2YWNA 4O5UA 2GVPA 2O8VB 5CP1A 1J08A 2EIOA 3UIWA 4N0VA 5JWOB 2H66A 1K3LA 5GSTA 3ZIVA 5ECSA 2GSRA 4GSSA 1OYJA 1TK8B 1SK1A 5A4WA 4RI7A 5B7CA 2DJ2A 2C0DA 5J9CA 1F2EA 2B3SA 1K3YA 5FT3A 3GTUB 3O76A 2CX3A 4G2EA 4EE0A 2VL2A 1J0FA 1O8WA 5F05A 4LL4B 3ERGA 3I9V2 3TCOA 1Q98A 4IELA 1ACVA 3LQ7A 3P8WA 5DQSA 1NHOA 1XOAA 2EIQA 3GA4A 5IMVA 2L4CA 4V1Ap 2G0FA 4BWQA 4YQUA 1B8XA 1W4VA 3GSTA 1XZOA 3GMFA 4WBJA 3HVSA 1TK5B 5B8BA 4ZXGA 3GKXA 5CRGA 4XTSA 1M9BA 4Q5NA 2H6YA 4PNGA 2CVKA 2JU5A 5AIXA 1EGRA 3GKMA 3F9UA 3L4NA 2DLXA 3QFAC 1ZL9A 2J23A 1DBYA 2QC7A 3S9FA 3M3MA 5AGYA 1UA5A 4X4JA 2HSYA 4K0NA 3IDVA 2J9HA 1BYEA 4QL7A 4GLTA 2X49A 3VK9A 3J7Yk 1X5CA 4ML6A 18GSA 3CRTA 2EIRA 1HNCA 2DJ1A 1GNWA 2LQQA 1A8LA 4CW9A 3FR9A 2DIZA 3A2WA 4HOJA 2L57A 2VM2A 4KNDA 3UBLA 3ZIJA 4IQAA 2C80A 1UVZA 5DAKA 1KTEA 3C7MA 3L78A 4FYUA 1XWKA 2HZEB 2N5AA 2X64A 4EC0A 4K2XA 2CAQA 4ZB8A 3U5RE 3UMAA 3A5IA 3BCIA 1ILOA 3TB2A 1BAYA 3PGTA 5D73A 4OFNA 1G7EA 6GSUA 2H01A 5J3RA 4OCEA 5ECQB 2H1BA 3TKSA 2H19A 1NHYA 3TJBA 2VD0A 1O7UA 2HRFA 1U3AA 1J9BA 3EWLA 3E9JB 3GIXA 3UL3A 3BCKA 2A4HA 1ZYEA 2YNXA 3ZZXA 2BJXA 2X99A 2H0GA 2O7KA 3KJYA 2P5RA 4KA0A 3FYGA 2IMIA 3BBYA 2YZHA 3WGDA 1B9XC 3HDCA 2AV4A 2WDUA 1G6YA 3EVIA 4TN8A 4MF5A 1SJZA 2FUG2 3GKKA 5IPHA 2LRNA 1A8YA 4KH7A 4PUAA 1R5AA 4ECCA 1TU7A 2X8GA 4IP1A 5DVBA 4Q5QA 1PN9A 2YV7A 5IO0A 4IP6A 5D93A 4JR6A 5JCWA 3OR5A 2H74A 3GTUA 2O89A 5F07A 3QDNA 2IMDA 4WF4A 1M7TA 3G7JA 1GTAA 3HZ8A 4I8BA 1SL2B 4NHWA 3CTGA 2OACA 4KX4A 1AC1A 3KTBA 1DE1A 4V2MA 1XWGA 4J57E 6GSSA 2GQKA 2I9HA 2HYXA 2VL9A 2ALBA 3MIXA 3PH9A 1U88A 3KP8A 1CQHA 2GSQA 2GT6A 4LLRA 4XCSA 2VLVA 3ZMLA 2HLSA 2OE0A 4KDUA 4MABA 3VWVA 4ECBA 4KSOA 1YY7A 1CQGA 4YQVA 3KMOA 2YANA 1V9WA 3A2VA 1E2YA 1ON4A 4FO5A 5KN2A 2XBQA 3TGZA 1FVJA 3RHBA 4MZCA 5F06A 2AJQB 3TKRA 3FZAA 3LFLA 1TU8A 3EU3A 4IBPA 2CA8A 1FG4A 5H5RA 4YAVA 5LD0A 4AJ7A 4X1UA 1SK0A 2PMTA 1BQ7A 4IQ1A 2RM6A 3DWVA 3F3QA 4XIHA 1XPVA 2WULA 3HD5A 2GZZA 2A2PA 1WP0A 2P0GA 1XIYA 3FY7A 2GSTA 3GX8A 3DYRA 3HJPA 1PGTA 4XS1A 1RQMA 2RM5A 3HA9A 5D96A 5C04A 2B5XA 5L71A 4AJ6A 3KH9A 2VL2C 1ZZYA 3QD9A 1IYIA 2F8AA 1GH2A 5GZZB 2WCIA 1HQOA 4MZWA 4MJAA 3GNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWG A;  5J4U A;  2IN3 A;  1GSE A;  1GP1 A;  3CRU A;  2HZE A;  3TKP A;  5KN3 A;  2MZC A;  2REM A;  4JBB A;  1DE2 A;  2JSZ A;  2ON7 A;  4PQ1 A;  3LGC A;  3TJG A;  1M2B A;  3TOT A;  1THO A;  3MNG A;  3CSI A;  2ZNM A;  4K0G A;  5ECL B;  5HFK A;  1GUK A;  2H1D A;  4N11 A;  1SYX A;  1V40 A;  1GTU A;  1TRV A;  2RII A;  4IHU A;  3EU4 A;  3DIE A;  2YPM A;  3M0F A;  3ZTL A;  3CXG A;  1F3B A;  2YWO A;  14GS A;  3TDG A;  4TVE A;  2OE1 A;  4KW6 A;  5EL8 A;  2L6C A;  2GS3 A;  5ECR B;  3H79 A;  2R6K A;  2TIR A;  3GH6 A;  4KUN A;  1TRU A;  1GTB A;  3G7Y A;  3EYT A;  4JRR A;  1Y25 A;  3KD0 A;  5F8B A;  4PXO A;  2RUE A;  2C0G A;  5G1K A;  1A24 A;  3GH9 A;  3KXO A;  4DEJ A;  1ZMA A;  3FZ9 A;  4GTU A;  3WD6 A;  1M2A A;  2H73 A;  1W89 A;  4GWR A;  2IME A;  2I3Y A;  1B48 A;  3KCM A;  2FCH A;  2YCD A;  2DJ0 A;  2H8L A;  4G10 A;  4MZB A;  4X43 A;  5ECI B;  2VLU A;  4HDE A;  2VLT A;  2JAD A;  3CYN A;  3KM6 A;  1A23 A;  2OA7 A;  3IXR A;  3TKS C;  5ECP B;  2H76 A;  5ID2 A;  1YEP A;  2IMK A;  3D4T A;  2TRX A;  1YQ1 A;  4FYC A;  4NV5 A;  1S3D A;  1YJ6 A;  1FVK A;  1EEJ A;  3F4R A;  2DSA A;  4PNF A;  4HUA A;  1T8E B;  3HKR A;  3MWH A;  1V98 A;  5IIZ A;  3QFB C;  1TOF A;  5ABR A;  2V41 A;  2K6V A;  1BG5 A;  3UJ1 A;  1U3I A;  1K3O A;  1Y6E A;  3GHA A;  3KGK A;  3Q19 A;  3HY2 A;  1AQV A;  4ZB6 A;  1BED A;  4YAP A;  1O8X A;  1F37 A;  2JAC A;  5JWQ B;  1YKC A;  1GUM A;  3HVX A;  1TDI A;  2NDO A;  3IOS A;  1SJ6 A;  1F6M C;  3ZRD A;  3GV1 A;  4L5L A;  5D9T A;  2H6X A;  2A4V A;  2QKE A;  2ZUP A;  1K0N A;  3W8S A;  2MMN A;  4KCE A;  4Z7X A;  1H4O A;  4O92 A;  3G7I A;  2YWI A;  1GSF A;  1QMV A;  4I2T A;  5F0G A;  4GSN A;  2PUK C;  1WOU A;  4ZIL A;  1FB6 A;  4ZBA A;  3L0H A;  2ZCT A;  1VF4 A;  2LS5 A;  2MYG A;  4NXI A;  2M46 A;  2C1Y A;  3TOU A;  4HZ2 A;  3QOU A;  1XW9 A;  1AIU A;  4MPG A;  3F4T A;  5GAP D;  2C3N A;  2LNS A;  2M80 A;  4MH2 A;  4K9Z A;  2L5O A;  3ERF A;  2TRC P;  3UOM A;  2C3T A;  3WGX A;  2YWM A;  17GS A;  2AAW A;  1GRX A;  3ZFB A;  4IW9 A;  3DVW A;  6GSV A;  22GS A;  3H4K A;  4ZL7 A;  3D4M A;  4PGT A;  2DJ3 A;  1OE7 A;  2PN8 A;  2FHE A;  1C72 A;  3IPZ A;  3KZQ A;  1K0A A;  4O32 A;  2HSH A;  4F03 A;  2FNO A;  3QR6 A;  2RUF A;  3TRQ A;  1TKD B;  4GCI A;  1MEK A;  5ECK B;  2BMX A;  1PL1 A;  4ZBD A;  1HYU A;  4LL1 B;  1K0D A;  2NTO A;  3M8N A;  3TRX A;  1XFL A;  4K2D A;  2PVO C;  2ON5 A;  1S3A A;  1GTI A;  4Q5R A;  3M9K A;  5CRE A;  2WFC A;  2G2Q A;  5A4U A;  1T4Y A;  2HE3 A;  2FA8 A;  3IRA A;  6GSX A;  13GS A;  1GNE A;  1OAZ A;  5D8I A;  3LXZ A;  3ZLP A;  1YKA A;  1R5P A;  2NVL A;  3LXT A;  1ZYQ B;  3GUR A;  3LWA A;  4EF0 A;  16GS A;  2B1L A;  1A0F A;  4ECI A;  4V2L A;  4V2N A;  2H0H A;  3L9S A;  2YJH A;  4K7I A;  2AB6 A;  1TRW A;  2WB9 A;  4MF6 A;  1QK8 A;  2LST A;  1FHE A;  3I6A A;  4IJ3 A;  3IV4 A;  2IIY A;  2FWE A;  4NWY A;  3N9J A;  4RQR A;  1URM A;  4FIW A;  2A2S A;  3VPQ A;  4AGS A;  3IK9 A;  3US3 A;  1TI1 A;  1PKZ A;  3P7X A;  5ECM B;  4MLY A;  1EV4 A;  2HI7 A;  3ZMK A;  1LJR A;  5CRD A;  2OBI A;  2VCT A;  2C3Q A;  3ZL5 A;  1MDK A;  4IKH A;  1GSQ A;  2JL4 A;  2XPE A;  3C71 A;  3I69 A;  3KTL A;  3D22 A;  2GQM A;  4XHM A;  1ST9 A;  4NMU A;  5CO3 A;  1SYR A;  4HEA 2;  5B6N A;  2I1U A;  1XXU A;  5CRH A;  5H5S A;  3IHQ A;  1HNA A;  3I43 A;  5D9W A;  4DVC A;  2LTK A;  3VWW A;  2NPB A;  4BVX A;  2OKA A;  3FRC A;  3GSS A;  3CSH A;  3UVH A;  2CX4 A;  4RQX A;  2LEG A;  4G9H A;  9GSS A;  4PUR A;  3HJM A;  1AXD A;  1PKW A;  5GAN D;  4LMW A;  3BOA A;  3F63 A;  1PQN A;  4KCA A;  5JWR B;  20GS A;  4D73 B;  2V6K A;  5DDL A;  4TW5 A;  3NOF A;  7GSS A;  1OC3 A;  4NAX A;  1EEM A;  2OJL A;  1JZW A;  4JR4 A;  4BL7 A;  1GSS A;  3FW2 A;  2E0Q A;  1NW2 A;  5ID2 B;  2BTO T;  2NBS A;  1A2L A;  3WT1 A;  2PWJ A;  4MA9 A;  3EUR A;  3WT2 A;  1X5E A;  3RBT A;  4X0X A;  5J5N A;  3F6D A;  4WR4 A;  3FK8 A;  2P5Q A;  3MAK A;  2MBT A;  1IYH A;  1VGL A;  4WF5 A;  4PX1 A;  2V6O A;  2YZU A;  1V58 A;  3VWX A;  3GUS A;  1AQX A;  3DML A;  3ISO A;  1T4Z A;  2H1A A;  3CBU A;  4H86 A;  3ERW A;  4ILF A;  2AHE A;  3HCZ A;  2N5B A;  1QFN A;  2E7P A;  1X9M B;  2HRN A;  4EXJ A;  4OO5 A;  1WJK A;  4ISD A;  1X9W B;  4N10 A;  4MPF A;  2V2G A;  3LOR A;  2I4A A;  3ZYW A;  1Q4J A;  1B9Y C;  3IA1 A;  4DSQ A;  1JZR A;  2H30 A;  2H71 A;  1TK0 B;  4KGI A;  2DJK A;  4YH2 A;  4LMV A;  2L6D A;  3DXB A;  2CAI A;  2LJA A;  2VAF A;  4AJ8 A;  3UEM A;  5ECN B;  2PVQ A;  2OBK A;  2LUS A;  2L59 A;  2JSY A;  2VCX A;  2P31 A;  5G1L A;  4EDZ A;  2HT9 A;  1RW1 A;  1K0B A;  4ML1 A;  4K7N A;  4JZQ A;  3RDW A;  2CVB A;  3LG6 A;  4HQZ A;  4MF7 A;  1WIK A;  5G5E A;  12GS A;  5ELA A;  1O6J A;  4L5O A;  3KP9 A;  1Z6M A;  4HS1 A;  1HNB A;  1B4P A;  5DBQ A;  2V1M A;  2IFQ A;  3DVX A;  4L8E A;  3AY8 A;  4HJ2 A;  4QQ7 A;  4MH3 A;  3IBH A;  3LEF A;  2B1K A;  1YZX A;  4XS4 B;  2KLX A;  1T3B A;  4K8M A;  2DJJ A;  4IGJ A;  3TRP A;  5G30 A;  2K18 A;  2F9S A;  3CTF A;  3U6V A;  3L9U A;  3VLN A;  1GL8 A;  2LJK A;  2B5E A;  5CAX A;  3DRN A;  2DIY A;  2M72 A;  1OC9 B;  2DML A;  1PL2 A;  4TR3 A;  4EO3 A;  3M9J A;  1Z3E A;  1UN2 A;  4O7H A;  3VUR A;  1RK4 A;  1XWA A;  5JCU A;  1SU9 A;  2VOC A;  1GLQ A;  1SK2 A;  3VI7 A;  1SKW B;  1EGO A;  5DJL A;  4EVM A;  3J7Y b;  1OE8 A;  5H5Q A;  1WRY A;  3EIN A;  4QL9 A;  4KAE A;  2FY6 A;  4YQM A;  2DBC A;  1K0C A;  1YDK A;  4KDX A;  2CV4 A;  5HR1 A;  4F0C A;  1Z5Y E;  5ENU A;  4D73 A;  2VD1 A;  3DGQ A;  4OFM A;  4RI6 A;  5DJM A;  4K1F A;  5DCG A;  1ZOF A;  3IC4 A;  5GSS A;  2GGT A;  4GQC A;  1QXH A;  2VCV A;  2WJU A;  4WKW A;  2PU9 C;  1SEN A;  2VCZ A;  5EY6 A;  3FHK A;  1EOH A;  4MP4 A;  3MSZ A;  3C8E A;  8GSS A;  3QAG A;  1TP9 A;  1THX A;  2EC4 A;  3UAP A;  4EKZ A;  3WGE A;  1AQW A;  4WBR D;  1QUW A;  1MTC A;  5ELG A;  3GKN A;  3VFI A;  5HR3 A;  5IQY A;  5G2Z A;  3TJJ A;  4GXZ A;  3ZFL A;  1SKS B;  3JCM L;  3KEB A;  3F8U A;  4XS6 A;  3HXS A;  2PGT A;  4TR0 A;  1V57 A;  3RAZ A;  1QQ2 A;  2GZP A;  3A2X A;  1K0M A;  3LJR A;  2KUC A;  1M2D A;  5ECO B;  5E4W A;  2QSI A;  1O73 A;  5IOW A;  10GS A;  4BPY A;  4TKY A;  2DMM A;  4E8E A;  1XCC A;  1AUC A;  1VF3 A;  4KDY A;  2HXK A;  3D6I A;  2L4Q A;  2FWF A;  2C0F A;  1DSB A;  2CZ2 A;  5IO2 A;  4WEY A;  1G7O A;  3FKF A;  1V2A A;  3IR4 A;  3QAV A;  1PA3 A;  1XW5 A;  4FYB A;  2V32 A;  4MDC A;  2K9F A;  1M99 A;  4AF2 A;  1KBN A;  4V1A g;  3GX0 A;  4KSM A;  2R5G A;  4I2U A;  2F8F A;  2VCQ A;  3GYK A;  1K0O A;  4ZIJ A;  1VF1 A;  1G6W A;  3NZN A;  4ZB9 A;  3F0I A;  4PQI A;  3LSZ A;  5AN1 A;  4GRF A;  4I97 A;  5EVO A;  2HZF A;  2VO4 A;  19GS A;  4XRA A;  2H72 A;  3EMX A;  1BJX A;  3WYW A;  4TOP A;  2H75 A;  5ECH B;  4TRX A;  4I5Q A;  2R4V A;  1H75 A;  2OAD A;  1EZK A;  1I9D A;  2OE3 A;  3V1W A;  1N2A A;  2PPT A;  2IPA A;  2ES7 A;  3W6G A;  3DKS A;  3GFK A;  3HYP A;  1ERU A;  1ML6 A;  1YF1 A;  2LKU A;  4Q5F A;  4XS4 A;  2QGV A;  4P3Y B;  1VF2 A;  3F4S A;  1FAA A;  1OC9 A;  3W8J A;  3HHV A;  5IMA A;  5A5K A;  2H1G A;  5HQP A;  1ERW A;  1DUG A;  2HNL A;  2VUP A;  2YJ7 A;  1MDI A;  1TTZ A;  1XW6 A;  1U6T A;  1XBS A;  5KN1 A;  4BVY A;  3RPP A;  3BJ5 A;  4IJI A;  3QCP A;  3E0U A;  1T00 A;  1F9M A;  3HJO A;  2D2Z A;  3A3T A;  4ECJ A;  3D5J A;  4IN0 A;  4TXO B;  4F82 A;  1WPI A;  5A4V A;  4K7O A;  1SD8 A;  3EE2 A;  2GLR A;  5COH A;  4NV2 A;  2VM1 A;  1B4Q A;  4OFT A;  2IL3 A;  4J56 E;  3KMN A;  3H93 A;  3ME8 A;  3LYK A;  4NPB A;  1A0R P;  2X8C A;  2AYT A;  1SL0 B;  1JZD A;  1JLW A;  3IAM 2;  3P2A A;  2VL3 A;  4N30 A;  1GSU A;  4JED A;  3LYP A;  4IS0 A;  1PSQ A;  5IMF A;  2R2J A;  2VCW A;  2FD3 A;  3FR6 A;  1OKT A;  2YP6 A;  3APO A;  4KE3 A;  4JE1 A;  1JZO A;  3F6F A;  4HZ4 A;  3UBK A;  3TJK A;  1R7H A;  4HU9 A;  2C0E A;  1HD2 A;  1PD2 1;  2R37 A;  5G5F A;  1XVQ A;  4HI7 A;  2B7J A;  1EP7 A;  2IFQ B;  1A2J A;  1TXX A;  1KNG A;  6GST A;  3Q6O A;  1NM3 A;  1ERV A;  2FWH A;  1ABA A;  1GSD A;  2O87 A;  2WZ9 A;  1LU4 A;  5IM9 A;  5AIV A;  2WGR A;  4OCF A;  1G0T A;  2E2M A;  4DSS B;  1SD9 A;  2GDR A;  2WRT A;  3DD3 A;  1R4W A;  5DAL A;  2C4J A;  2H6Z A;  5E59 A;  5D9X A;  3RHC A;  5HR0 A;  4ACS A;  3GL5 A;  3Q74 A;  4RUV A;  1EOG A;  3D0Z A;  2B6M A;  4POM A;  3PIN A;  5DCH A;  4BWS A;  3SWL A;  1ZGN A;  4ID0 A;  1VRS D;  5LCZ A;  5B6M A;  3ZRE A;  1GWC A;  6GSW A;  1AAZ A;  4F0B A;  5CYY A;  4TR4 A;  3PR8 A;  2XPD A;  3APS A;  3RPN A;  2O85 A;  2GQL A;  4POB A;  5INY A;  1PMT A;  1UC7 A;  3FR3 A;  3M1G A;  2F3M A;  4MJB A;  1A2M A;  2JZR A;  1GUL A;  5B8A A;  4MCU A;  5HR2 A;  2L5L A;  2GZY A;  1O81 A;  1FO5 A;  4POL A;  4HU7 A;  4CDO A;  2PBJ A;  2GSS A;  2Z9S A;  5HFI A;  11GS A;  1AW9 A;  2B5Y A;  2YOI A;  1OVN A;  3C1S A;  4MJE A;  4GF0 A;  5EPF A;  3ZIT A;  2JZS A;  2IWT A;  3IAS 2;  3APQ A;  4XRD A;  3G9B A;  3IE3 A;  1EV9 A;  3FZ5 A;  2IJY A;  2LRT A;  1FB0 A;  3P90 A;  1GSY A;  2C8U A;  5IMZ A;  1SL1 B;  2F51 A;  4OMV A;  4POK A;  2XC2 A;  3BD2 A;  4MJC A;  4ULX A;  3QMX A;  3CSJ A;  1T7P B;  2A2R A;  2LNT A;  1PX7 A;  6GSY A;  1KEB A;  4F2I A;  4GST A;  1MD3 A;  4WET A;  3N5O A;  3E3E A;  2KP1 A;  5J9B A;  4E8H A;  1WWJ A;  1JFU A;  1LBK A;  4TXO A;  4PUF C;  3IK7 A;  4K6X A;  4TR1 B;  4EL1 A;  2CZ3 A;  2GT5 A;  3A5W A;  1MDJ A;  4NHZ A;  1GUH A;  4N0Z A;  2JZT A;  4OO4 A;  3VWU A;  4MMM A;  3L9V A;  1XWB A;  1OC8 A;  4I6X A;  5LNK e;  3K8N A;  2KHP A;  3QPM A;  3ZVJ A;  1PX6 A;  3SBC A;  1XVW A;  2LQO A;  3H1N A;  5KN0 A;  2I81 A;  2MBS A;  3EMP A;  3KIJ A;  2N5F A;  2R3X A;  1O85 A;  3D21 A;  1M0U A;  2LV3 A;  2FLS A;  5DQY A;  2KOK A;  2CQ9 A;  3GRX A;  4WXT A;  4DSR A;  5KEJ A;  1F3A A;  5IPG A;  4PQH A;  2H0I A;  3UVT A;  1R26 A;  3EC3 A;  3O3T A;  4ZL8 A;  2GTU A;  3GN3 A;  3QAW A;  2E2G A;  3FEU A;  2K8S A;  4OD7 A;  1YEX A;  2KP2 A;  2MMA A;  4OWY A;  1SKR B;  4L0W A;  1X9S B;  3MDK A;  4DSS A;  2LRC A;  3HVV A;  1TI3 A;  3CMI A;  1PRX A;  5CNW A;  5G31 A;  3F3R A;  4ZL9 A;  2WS2 A;  5D9V A;  3NIV A;  5JCG A;  2RLI A;  1M9A A;  4BA7 A;  2FA4 A;  1N8J A;  5IOX A;  5CRW A;  1I5G A;  4FH8 A;  1TW9 A;  2FWG A;  4L0U A;  2YN1 A;  3O6T A;  1YF0 A;  3TKQ A;  2FGX A;  2HFD A;  1Z7R A;  1BX9 A;  2CVD A;  4CHS A;  1S3C A;  1XOB A;  5FHI A;  2K8V A;  2LJR A;  4WR5 A;  4G19 A;  1Z9H A;  1TJD A;  1TRS A;  2IMF A;  1NSW A;  3FZ4 A;  2PER A;  3H8Q A;  3C1R A;  2DC5 A;  3ME7 A;  4TXV A;  4EDY A;  3DEX A;  3C73 A;  2H70 A;  4J2F A;  1E6B A;  3TUE A;  1GLP A;  2MMZ A;  2VIM A;  1XWC A;  1Z7P A;  1SJI A;  3TJF A;  2B7K A;  5DAK B;  5IMD A;  4ZBB A;  1ERT A;  1JLV A;  1WMJ A;  2CT6 A;  3VI5 A;  3UAR A;  1USB A;  1FOV A;  1U87 A;  4HJM A;  4GQF A;  5C00 A;  3TKS E;  3KH7 A;  4JU5 A;  1JHB A;  3VPT A;  3GL3 A;  2XBI A;  4KB3 A;  3ZVJ D;  3HZ4 A;  4HQS A;  5AIS A;  1FW1 A;  1X0R A;  2MMO A;  5DAL B;  1MD4 A;  2XHF A;  4O5R A;  4MK3 A;  4EUY A;  2YV9 A;  1EP8 A;  5HFG A;  1T1V A;  4IVF A;  1QGV A;  1Z6N A;  1OKD A;  2X8H A;  1EWX A;  1WE0 A;  3Q18 A;  5IMC A;  1X5D A;  1ZCP A;  5J41 A;  3R2Q A;  2AUV A;  4LA1 A;  4F9Z A;  4TR1 A;  3ED3 A;  2YWN A;  2GVP A;  2O8V B;  5CP1 A;  1J08 A;  2EIO A;  3UIW A;  4N0V A;  5JWO B;  2H66 A;  1K3L A;  5GST A;  3ZIV A;  5ECS A;  2GSR A;  4GSS A;  1OYJ A;  1TK8 B;  1SK1 A;  5A4W A;  4RI7 A;  5B7C A;  2DJ2 A;  2C0D A;  5J9C A;  1F2E A;  2B3S A;  1K3Y A;  5FT3 A;  3GTU B;  3O76 A;  2CX3 A;  4G2E A;  4EE0 A;  2VL2 A;  1J0F A;  1O8W A;  5F05 A;  4LL4 B;  3ERG A;  3I9V 2;  3TCO A;  1Q98 A;  4IEL A;  1ACV A;  3LQ7 A;  3P8W A;  5DQS A;  1NHO A;  1XOA A;  2EIQ A;  3GA4 A;  5IMV A;  2L4C A;  4V1A p;  2G0F A;  4BWQ A;  4YQU A;  1B8X A;  1W4V A;  3GST A;  1XZO A;  3GMF A;  4WBJ A;  3HVS A;  1TK5 B;  5B8B A;  4ZXG A;  3GKX A;  5CRG A;  4XTS A;  1M9B A;  4Q5N A;  2H6Y A;  4PNG A;  2CVK A;  2JU5 A;  5AIX A;  1EGR A;  3GKM A;  3F9U A;  3L4N A;  2DLX A;  3QFA C;  1ZL9 A;  2J23 A;  1DBY A;  2QC7 A;  3S9F A;  3M3M A;  5AGY A;  1UA5 A;  2HSY A;  4K0N A;  3IDV A;  2J9H A;  1BYE A;  4QL7 A;  4GLT A;  3VK9 A;  3J7Y k;  1X5C A;  4ML6 A;  18GS A;  3CRT A;  2EIR A;  1HNC A;  2DJ1 A;  1GNW A;  2LQQ A;  1A8L A;  4CW9 A;  3FR9 A;  2DIZ A;  3A2W A;  4HOJ A;  2L57 A;  2VM2 A;  4KND A;  3UBL A;  3ZIJ A;  4IQA A;  2C80 A;  1UVZ A;  5DAK A;  1KTE A;  3C7M A;  3L78 A;  4FYU A;  1XWK A;  2HZE B;  2N5A A;  2X64 A;  4EC0 A;  2CAQ A;  4ZB8 A;  3U5R E;  3UMA A;  3BCI A;  1ILO A;  3TB2 A;  1BAY A;  3PGT A;  5D73 A;  4OFN A;  1G7E A;  6GSU A;  2H01 A;  5J3R A;  4OCE A;  5ECQ B;  2H1B A;  3TKS A;  2H19 A;  1NHY A;  3TJB A;  2VD0 A;  1O7U A;  2HRF A;  1U3A A;  1J9B A;  3EWL A;  3E9J B;  3GIX A;  3UL3 A;  3BCK A;  1ZYE A;  2YNX A;  3ZZX A;  2BJX A;  2X99 A;  2H0G A;  2O7K A;  3KJY A;  2P5R A;  4KA0 A;  3FYG A;  2IMI A;  3BBY A;  2YZH A;  3WGD A;  1B9X C;  3HDC A;  2AV4 A;  2WDU A;  1G6Y A;  3EVI A;  4TN8 A;  4MF5 A;  1SJZ A;  2FUG 2;  3GKK A;  5IPH A;  2LRN A;  1A8Y A;  4KH7 A;  4PUA A;  1R5A A;  4ECC A;  1TU7 A;  2X8G A;  4IP1 A;  5DVB A;  4Q5Q A;  1PN9 A;  2YV7 A;  5IO0 A;  4IP6 A;  5D93 A;  4JR6 A;  5JCW A;  3OR5 A;  2H74 A;  3GTU A;  2O89 A;  5F07 A;  3QDN A;  2IMD A;  4WF4 A;  1M7T A;  3G7J A;  1GTA A;  3HZ8 A;  4I8B A;  1SL2 B;  4NHW A;  3CTG A;  2OAC A;  4KX4 A;  1AC1 A;  3KTB A;  1DE1 A;  4V2M A;  1XWG A;  4J57 E;  6GSS A;  2GQK A;  2I9H A;  2HYX A;  2VL9 A;  2ALB A;  3PH9 A;  1U88 A;  3KP8 A;  1CQH A;  2GSQ A;  2GT6 A;  4LLR A;  4XCS A;  2VLV A;  3ZML A;  2HLS A;  2OE0 A;  4KDU A;  4MAB A;  3VWV A;  4ECB A;  4KSO A;  1YY7 A;  1CQG A;  4YQV A;  3KMO A;  2YAN A;  1V9W A;  3A2V A;  1E2Y A;  1ON4 A;  4FO5 A;  5KN2 A;  2XBQ A;  3TGZ A;  1FVJ A;  3RHB A;  4MZC A;  5F06 A;  2AJQ B;  3TKR A;  3FZA A;  3LFL A;  1TU8 A;  3EU3 A;  4IBP A;  2CA8 A;  1FG4 A;  5H5R A;  4YAV A;  5LD0 A;  4AJ7 A;  4X1U A;  1SK0 A;  2PMT A;  1BQ7 A;  4IQ1 A;  2RM6 A;  3DWV A;  3F3Q A;  4XIH A;  1XPV A;  2WUL A;  3HD5 A;  2GZZ A;  1WP0 A;  2P0G A;  1XIY A;  3FY7 A;  2GST A;  3GX8 A;  3DYR A;  3HJP A;  1PGT A;  4XS1 A;  1RQM A;  2RM5 A;  3HA9 A;  5D96 A;  5C04 A;  2B5X A;  5L71 A;  4AJ6 A;  3KH9 A;  2VL2 C;  1ZZY A;  3QD9 A;  1IYI A;  2F8A A;  1GH2 A;  5GZZ B;  2WCI A;  1HQO A;  4MZW A;  4MJA A;  3GNJ A; 
#chains in the Genus database with same CATH topology
 5FWG A;  5J4U A;  2IN3 A;  1GSE A;  1GP1 A;  3CRU A;  2HZE A;  3TKP A;  5KN3 A;  2MZC A;  1ZYN A;  2REM A;  4JBB A;  1DE2 A;  2JSZ A;  2ON7 A;  4PQ1 A;  3LGC A;  3TJG A;  4YKG A;  1M2B A;  3TOT A;  1THO A;  3MNG A;  3CSI A;  2ZNM A;  4K0G A;  5ECL B;  5HFK A;  1GUK A;  2H1D A;  4N11 A;  1SYX A;  1V40 A;  1GTU A;  1TRV A;  2RII A;  4IHU A;  3EU4 A;  3DIE A;  2YPM A;  3M0F A;  3ZTL A;  3CXG A;  1F3B A;  2YWO A;  14GS A;  3TDG A;  1FOH A;  4TVE A;  2OE1 A;  4KW6 A;  5EL8 A;  2L6C A;  2GS3 A;  5ECR B;  3H79 A;  2R6K A;  2TIR A;  3GH6 A;  4KUN A;  1TRU A;  1GTB A;  3G7Y A;  3EYT A;  4JRR A;  1Y25 A;  3KD0 A;  5F8B A;  4PXO A;  2RUE A;  2C0G A;  5G1K A;  1A24 A;  3GH9 A;  3KXO A;  4DEJ A;  1ZMA A;  3FZ9 A;  4GTU A;  3WD6 A;  1M2A A;  2H73 A;  1W89 A;  4GWR A;  2IME A;  2I3Y A;  1B48 A;  3KCM A;  2FCH A;  2YCD A;  2DJ0 A;  2H8L A;  4G10 A;  4MZB A;  4X43 A;  5ECI B;  2VLU A;  4HDE A;  2VLT A;  2JAD A;  3CYN A;  3KM6 A;  1A23 A;  2OA7 A;  3IXR A;  3TKS C;  5ECP B;  2H76 A;  5ID2 A;  1YEP A;  5KOW A;  2IMK A;  3D4T A;  2TRX A;  1YQ1 A;  4FYC A;  4NV5 A;  1S3D A;  1YJ6 A;  1FVK A;  1EEJ A;  3F4R A;  2DSA A;  4PNF A;  4HUA A;  1T8E B;  3HKR A;  3MWH A;  1V98 A;  5IIZ A;  3QFB C;  1TOF A;  5ABR A;  2V41 A;  2K6V A;  1BG5 A;  3UJ1 A;  1U3I A;  1K3O A;  3EPT A;  1Y6E A;  3GHA A;  3KGK A;  3Q19 A;  3HY2 A;  1AQV A;  4ZB6 A;  1BED A;  4YAP A;  1O8X A;  1F37 A;  2JAC A;  5JWQ B;  1YKC A;  1GUM A;  3HVX A;  1TDI A;  2NDO A;  3IOS A;  1SJ6 A;  1F6M C;  2HSM A;  3ZRD A;  3GV1 A;  4L5L A;  5D9T A;  2H6X A;  2A4V A;  2QKE A;  2ZUP A;  1K0N A;  3W8S A;  2MMN A;  4KCE A;  4Z7X A;  1H4O A;  4O92 A;  3G7I A;  2YWI A;  1GSF A;  1QMV A;  4I2T A;  5F0G A;  4GSN A;  2PUK C;  1WOU A;  4ZIL A;  1FB6 A;  4ZBA A;  3L0H A;  2ZCT A;  1VF4 A;  2LS5 A;  2MYG A;  4NXI A;  2M46 A;  2C1Y A;  3TOU A;  4HZ2 A;  3QOU A;  1XW9 A;  3PPU A;  1AIU A;  4MPG A;  3F4T A;  5GAP D;  2C3N A;  2LNS A;  2M80 A;  4MH2 A;  4K9Z A;  2L5O A;  3ERF A;  2TRC P;  3UOM A;  2C3T A;  3WGX A;  2YWM A;  17GS A;  2AAW A;  1GRX A;  3ZFB A;  4IW9 A;  3DVW A;  6GSV A;  22GS A;  3H4K A;  4ZL7 A;  3D4M A;  4PGT A;  2DJ3 A;  1OE7 A;  2PN8 A;  2FHE A;  1C72 A;  3IPZ A;  3KZQ A;  1K0A A;  4O32 A;  2HSH A;  2DKI A;  4F03 A;  2FNO A;  3QR6 A;  2RUF A;  3TRQ A;  3IC8 A;  1TKD B;  4GCI A;  1MEK A;  5ECK B;  2R0G A;  2BMX A;  1PL1 A;  4ZBD A;  1HYU A;  4LL1 B;  1K0D A;  2NTO A;  3M8N A;  3TRX A;  1XFL A;  4K2D A;  2PVO C;  2ON5 A;  1S3A A;  1GTI A;  4Q5R A;  3M9K A;  5CRE A;  2WFC A;  2G2Q A;  5A4U A;  1T4Y A;  2HE3 A;  2FA8 A;  3IRA A;  6GSX A;  13GS A;  1GNE A;  1OAZ A;  5D8I A;  3LXZ A;  3ZLP A;  1YKA A;  1R5P A;  4FQU A;  2NVL A;  3LXT A;  1ZYQ B;  3GUR A;  3LWA A;  4EF0 A;  16GS A;  2B1L A;  1A0F A;  4ECI A;  4V2L A;  1S3R A;  4V2N A;  2H0H A;  3L9S A;  2YJH A;  4K7I A;  2AB6 A;  1TRW A;  2WB9 A;  4MF6 A;  1QK8 A;  2LST A;  1FHE A;  3I6A A;  4IJ3 A;  3IV4 A;  2IIY A;  4G0L A;  2FWE A;  4NWY A;  3N9J A;  4RQR A;  1URM A;  4FIW A;  2A2S A;  3VPQ A;  4AGS A;  3IK9 A;  3US3 A;  1TI1 A;  1PKZ A;  3P7X A;  5ECM B;  4MLY A;  4ICY A;  1EV4 A;  2HI7 A;  3ZMK A;  1LJR A;  5CRD A;  2OBI A;  2VCT A;  2C3Q A;  3ZL5 A;  5BMU A;  1MDK A;  4IKH A;  1GSQ A;  2JL4 A;  2XPE A;  3C71 A;  3I69 A;  3KTL A;  3D22 A;  2GQM A;  2DKH A;  4XHM A;  1ST9 A;  4NMU A;  5CO3 A;  1SYR A;  4HEA 2;  5B6N A;  2I1U A;  1XXU A;  5CRH A;  5H5S A;  3IHQ A;  1HNA A;  3I43 A;  2HRK A;  5D9W A;  4DVC A;  2LTK A;  3VWW A;  2NPB A;  4BVX A;  2OKA A;  3FRC A;  3GSS A;  3CSH A;  3UVH A;  4CY6 A;  2CX4 A;  4RQX A;  2LEG A;  4G9H A;  4KF9 A;  4PUR A;  9GSS A;  3HJM A;  1AXD A;  1PKW A;  5GAN D;  4LMW A;  3BOA A;  3F63 A;  1PQN A;  4KCA A;  5JWR B;  20GS A;  4D73 B;  2V6K A;  5DDL A;  4TW5 A;  3NOF A;  7GSS A;  1OC3 A;  4NAX A;  1EEM A;  2OJL A;  1JZW A;  4JR4 A;  4EIQ A;  4BL7 A;  1GSS A;  3FW2 A;  2E0Q A;  1NW2 A;  5ID2 B;  2BTO T;  2NBS A;  1PN0 A;  1A2L A;  3WT1 A;  2PWJ A;  4MA9 A;  4Z2T A;  3FMW A;  2QA1 A;  2X4A A;  3EUR A;  3WT2 A;  1X5E A;  3RBT A;  4X0X A;  5J5N A;  3F6D A;  4WR4 A;  3FK8 A;  2P5Q A;  3MAK A;  2MBT A;  1IYH A;  1VGL A;  4WF5 A;  4PX1 A;  2V6O A;  2YZU A;  1V58 A;  3VWX A;  3GUS A;  1AQX A;  3DML A;  3ISO A;  1T4Z A;  2H1A A;  3CBU A;  4H86 A;  3ERW A;  4ILF A;  2AHE A;  3HCZ A;  2N5B A;  1QFN A;  2E7P A;  1X9M B;  2HRN A;  4EXJ A;  4OO5 A;  1WJK A;  4ISD A;  1X9W B;  4N10 A;  4MPF A;  2V2G A;  3LOR A;  2I4A A;  3ZYW A;  1Q4J A;  1B9Y C;  3IA1 A;  4DSQ A;  1JZR A;  2H30 A;  2H71 A;  1TK0 B;  4KGI A;  2DJK A;  4YH2 A;  4LMV A;  2L6D A;  3DXB A;  2CAI A;  2LJA A;  2VAF A;  4AJ8 A;  3UEM A;  5ECN B;  2PVQ A;  2OBK A;  2LUS A;  2L59 A;  2JSY A;  2VCX A;  2P31 A;  5G1L A;  4EDZ A;  4USS A;  2HT9 A;  1RW1 A;  1K0B A;  4ML1 A;  4K7N A;  4JZQ A;  3RDW A;  2CVB A;  3LG6 A;  4HQZ A;  4PTS A;  4MF7 A;  1WIK A;  5G5E A;  12GS A;  5ELA A;  1O6J A;  4L5O A;  3KP9 A;  1Z6M A;  4HS1 A;  1HNB A;  1B4P A;  5DBQ A;  2V1M A;  2QA2 A;  2IFQ A;  3DVX A;  4L8E A;  3AY8 A;  4HJ2 A;  4QQ7 A;  4MH3 A;  3IBH A;  3LEF A;  2B1K A;  1YZX A;  4XS4 B;  2KLX A;  1T3B A;  4K8M A;  2DJJ A;  4IGJ A;  3TRP A;  5G30 A;  2K18 A;  2F9S A;  3CTF A;  3U6V A;  3L9U A;  3VLN A;  1GL8 A;  2LJK A;  2B5E A;  5CAX A;  3DRN A;  2DIY A;  2M72 A;  1OC9 B;  2DML A;  1PL2 A;  4TR3 A;  4EO3 A;  3M9J A;  1Z3E A;  1UN2 A;  4O7H A;  3VUR A;  1RK4 A;  1XWA A;  5JCU A;  1SU9 A;  2VOC A;  1GLQ A;  1SK2 A;  3VI7 A;  1SKW B;  1EGO A;  5DJL A;  4EVM A;  3J7Y b;  1OE8 A;  5H5Q A;  1WRY A;  3EIN A;  1XG8 A;  4QL9 A;  4KAE A;  2FY6 A;  4YQM A;  2DBC A;  1K0C A;  1YDK A;  4KDX A;  2CV4 A;  5HR1 A;  4F0C A;  1Z5Y E;  5ENU A;  4D73 A;  2VD1 A;  3DGQ A;  4OFM A;  4RI6 A;  5DJM A;  4K1F A;  5DCG A;  1ZOF A;  3IC4 A;  5GSS A;  2GGT A;  4GQC A;  1QXH A;  2VCV A;  2WJU A;  4WKW A;  2PU9 C;  1SEN A;  4YKF A;  2VCZ A;  5EY6 A;  3FHK A;  1EOH A;  4MP4 A;  3MSZ A;  3C8E A;  8GSS A;  3QAG A;  1TP9 A;  1THX A;  2EC4 A;  3UAP A;  4EKZ A;  3WGE A;  1AQW A;  4WBR D;  1QUW A;  1MTC A;  5ELG A;  3GKN A;  3VFI A;  5HR3 A;  5IQY A;  5G2Z A;  3TJJ A;  4GXZ A;  3ZFL A;  1SKS B;  3JCM L;  3KEB A;  3F8U A;  4XS6 A;  3HXS A;  2PGT A;  4TR0 A;  1V57 A;  1M3J A;  3RAZ A;  1QQ2 A;  2GZP A;  3A2X A;  1K0M A;  3LJR A;  2KUC A;  1M2D A;  5ECO B;  5E4W A;  2QSI A;  1O73 A;  5IOW A;  10GS A;  4BPY A;  4TKY A;  2DMM A;  4E8E A;  1XCC A;  1AUC A;  1VF3 A;  4KDY A;  2HXK A;  3D6I A;  2L4Q A;  2FWF A;  2C0F A;  1DSB A;  2CZ2 A;  5IO2 A;  4WEY A;  4BVX B;  1G7O A;  3FKF A;  1V2A A;  3IR4 A;  3QAV A;  1PA3 A;  1XW5 A;  4FYB A;  2V32 A;  4MDC A;  2K9F A;  1M99 A;  4AF2 A;  1KBN A;  4V1A g;  3GX0 A;  4KSM A;  2R5G A;  4I2U A;  2F8F A;  2VCQ A;  3GYK A;  1K0O A;  4ZIJ A;  1VF1 A;  3R3E A;  1G6W A;  3NZN A;  4ZB9 A;  3F0I A;  4PQI A;  3LSZ A;  5AN1 A;  4GRF A;  4I97 A;  5EVO A;  2HZF A;  2VO4 A;  19GS A;  4XRA A;  2H72 A;  3EMX A;  4BL7 B;  1BJX A;  3WYW A;  4TOP A;  5BRT A;  2H75 A;  5ECH B;  4TRX A;  4I5Q A;  2R4V A;  1H75 A;  2OAD A;  1EZK A;  1I9D A;  2OE3 A;  3V1W A;  1N2A A;  2PPT A;  2IPA A;  2ES7 A;  3W6G A;  3DKS A;  3GFK A;  3HYP A;  1ERU A;  4MNN A;  1ML6 A;  1YF1 A;  2LKU A;  4Q5F A;  4XS4 A;  2QGV A;  4P3Y B;  1VF2 A;  3F4S A;  1FAA A;  1OC9 A;  3W8J A;  3HHV A;  5IMA A;  5A5K A;  2H1G A;  5HQP A;  1ERW A;  1DUG A;  2HNL A;  2VUP A;  2YJ7 A;  2HRA A;  1MDI A;  1TTZ A;  1XW6 A;  1U6T A;  1XBS A;  5KN1 A;  4BVY A;  3RPP A;  3BJ5 A;  4IJI A;  3QCP A;  3E0U A;  1T00 A;  1F9M A;  3HJO A;  2D2Z A;  4BIK A;  3A3T A;  4ECJ A;  3D5J A;  4IN0 A;  4TXO B;  4F82 A;  1WPI A;  5A4V A;  2UZ8 A;  4K7O A;  1SD8 A;  3EE2 A;  2GLR A;  5COH A;  4NV2 A;  2VM1 A;  1B4Q A;  4OFT A;  2IL3 A;  4J56 E;  3KMN A;  3H93 A;  3ME8 A;  3LYK A;  4NPB A;  1A0R P;  2X8C A;  2AYT A;  1SL0 B;  1JZD A;  1JLW A;  3IAM 2;  3P2A A;  2VL3 A;  4N30 A;  1GSU A;  4JED A;  3LYP A;  4IS0 A;  1M3I A;  1PSQ A;  5IMF A;  2R2J A;  2VCW A;  2FD3 A;  3FR6 A;  1OKT A;  2YP6 A;  3APO A;  4KE3 A;  4JE1 A;  1JZO A;  3F6F A;  4HZ4 A;  3UBK A;  3TJK A;  1R7H A;  4HU9 A;  2C0E A;  1HD2 A;  1PD2 1;  2R37 A;  5G5F A;  1XVQ A;  4HI7 A;  2B7J A;  1EP7 A;  2IFQ B;  1A2J A;  1TXX A;  1KNG A;  4G0I A;  6GST A;  3Q6O A;  1NM3 A;  1ERV A;  2FWH A;  1ABA A;  1GSD A;  2O87 A;  2WZ9 A;  1LU4 A;  5IM9 A;  5AIV A;  2WGR A;  4OCF A;  1G0T A;  2E2M A;  4DSS B;  1SD9 A;  2GDR A;  2WRT A;  3DD3 A;  1R4W A;  5DAL A;  2C4J A;  4HSC X;  2H6Z A;  5E59 A;  5D9X A;  3RHC A;  5HR0 A;  4ACS A;  3GL5 A;  3Q74 A;  4RUV A;  4CY8 A;  1EOG A;  3D0Z A;  2B6M A;  4POM A;  3PIN A;  5DCH A;  4BWS A;  3SWL A;  1ZYP A;  1ZGN A;  4ID0 A;  1VRS D;  2R0P A;  5LCZ A;  5B6M A;  3ZRE A;  1GWC A;  6GSW A;  1AAZ A;  4F0B A;  5CYY A;  4A5P A;  4TR4 A;  3PR8 A;  2XPD A;  3APS A;  3RPN A;  2O85 A;  2GQL A;  4POB A;  5INY A;  1PMT A;  1UC7 A;  3FR3 A;  3M1G A;  2F3M A;  4MJB A;  1A2M A;  2JZR A;  4Z2R A;  1GUL A;  5B8A A;  4MCU A;  5HR2 A;  2L5L A;  2GZY A;  1O81 A;  1FO5 A;  4POL A;  4HU7 A;  4CDO A;  2PBJ A;  2GSS A;  2Z9S A;  5HFI A;  11GS A;  1AW9 A;  2B5Y A;  2YOI A;  1OVN A;  3C1S A;  4MJE A;  4GF0 A;  5EPF A;  3ZIT A;  2JZS A;  2IWT A;  3IAS 2;  3APQ A;  4XRD A;  3G9B A;  3IE3 A;  1EV9 A;  3FZ5 A;  4O5Q A;  2IJY A;  2LRT A;  1FB0 A;  3P90 A;  1GSY A;  2C8U A;  5IMZ A;  1SL1 B;  2F51 A;  4OMV A;  4POK A;  2XC2 A;  3BD2 A;  4MJC A;  4ULX A;  3QMX A;  3CSJ A;  1T7P B;  2A2R A;  2LNT A;  1PX7 A;  6GSY A;  1KEB A;  4F2I A;  4GST A;  1MD3 A;  4WET A;  3N5O A;  3E3E A;  2KP1 A;  5J9B A;  4E8H A;  1WWJ A;  1JFU A;  1LBK A;  4TXO A;  4PUF C;  3IK7 A;  4K6X A;  4TR1 B;  2R0C A;  4EL1 A;  2CZ3 A;  2GT5 A;  3A5W A;  1MDJ A;  4NHZ A;  1GUH A;  4N0Z A;  2JZT A;  4OO4 A;  3VWU A;  4MMM A;  3L9V A;  1XWB A;  1OC8 A;  4I6X A;  5LNK e;  3K8N A;  2KHP A;  3QPM A;  3ZVJ A;  1PX6 A;  3SBC A;  1XVW A;  2LQO A;  3H1N A;  5KN0 A;  2I81 A;  2MBS A;  3EMP A;  3KIJ A;  2N5F A;  2R3X A;  4K5R A;  1O85 A;  3D21 A;  1M0U A;  2LV3 A;  2FLS A;  5DQY A;  2KOK A;  2CQ9 A;  3GRX A;  4WXT A;  4DSR A;  5KEJ A;  1F3A A;  5IPG A;  4PQH A;  3IHG A;  2H0I A;  3UVT A;  1R26 A;  3EC3 A;  3O3T A;  4ZL8 A;  2GTU A;  3GN3 A;  3QAW A;  2E2G A;  3FEU A;  2K8S A;  4OD7 A;  1YEX A;  2KP2 A;  2MMA A;  4OWY A;  1SKR B;  4L0W A;  1X9S B;  3MDK A;  4DSS A;  2LRC A;  3HVV A;  1TI3 A;  3CMI A;  1PRX A;  5CNW A;  5G31 A;  3F3R A;  4ZL9 A;  2WS2 A;  3LW9 A;  5D9V A;  3NIV A;  5JCG A;  2RLI A;  1M9A A;  4BA7 A;  2FA4 A;  1N8J A;  5IOX A;  4G0K A;  5CRW A;  1I5G A;  4FH8 A;  1TW9 A;  2FWG A;  4BVY B;  4L0U A;  2YN1 A;  3O6T A;  1YF0 A;  3TKQ A;  2FGX A;  2HFD A;  1Z7R A;  1BX9 A;  2CVD A;  4CHS A;  3CQF A;  1S3C A;  5KOX A;  1XOB A;  5FHI A;  2K8V A;  2LJR A;  4WR5 A;  4G19 A;  1Z9H A;  1TJD A;  1TRS A;  2IMF A;  1NSW A;  3FZ4 A;  2PER A;  3H8Q A;  3C1R A;  2DC5 A;  3ME7 A;  4TXV A;  4EDY A;  3DEX A;  4Z2U A;  3C73 A;  2H70 A;  4J2F A;  1E6B A;  3TUE A;  1GLP A;  2MMZ A;  2VIM A;  1XWC A;  1Z7P A;  1SJI A;  3TJF A;  2B7K A;  5DAK B;  5IMD A;  3MYD A;  1ERT A;  1JLV A;  1WMJ A;  4ZBB A;  2CT6 A;  3VI5 A;  3UAR A;  1USB A;  4K5S A;  1FOV A;  1U87 A;  4HJM A;  4GQF A;  5C00 A;  3TKS E;  3KH7 A;  4JU5 A;  1JHB A;  3VPT A;  3GL3 A;  2XBI A;  4KB3 A;  1PFO A;  3ZVJ D;  3HZ4 A;  4HQS A;  5AIS A;  1FW1 A;  1X0R A;  2MMO A;  5DAL B;  1MD4 A;  2XHF A;  4O5R A;  4MK3 A;  4EUY A;  2YV9 A;  1EP8 A;  5HFG A;  1T1V A;  4IVF A;  4EIP A;  1QGV A;  1Z6N A;  1OKD A;  2X8H A;  1EWX A;  1WE0 A;  3Q18 A;  5IMC A;  1X5D A;  1ZCP A;  5J41 A;  3R2Q A;  2AUV A;  4LA1 A;  4F9Z A;  4TR1 A;  3ED3 A;  2YWN A;  4O5U A;  2GVP A;  2O8V B;  5CP1 A;  1J08 A;  2EIO A;  3UIW A;  4N0V A;  5JWO B;  2H66 A;  1K3L A;  5GST A;  3ZIV A;  5ECS A;  2GSR A;  4GSS A;  1OYJ A;  1TK8 B;  1SK1 A;  5A4W A;  4RI7 A;  5B7C A;  2DJ2 A;  2C0D A;  3HVN A;  5J9C A;  1F2E A;  2B3S A;  1K3Y A;  5FT3 A;  3GTU B;  3O76 A;  2CX3 A;  4G2E A;  4EE0 A;  2VL2 A;  1J0F A;  1O8W A;  5F05 A;  4LL4 B;  3ERG A;  3I9V 2;  3TCO A;  1Q98 A;  4IEL A;  1ACV A;  3LQ7 A;  3P8W A;  5DQS A;  1NHO A;  1XOA A;  2EIQ A;  3GA4 A;  5IMV A;  2L4C A;  4V1A p;  2G0F A;  4BWQ A;  4YQU A;  1B8X A;  1W4V A;  3GST A;  1XZO A;  3GMF A;  4WBJ A;  3HVS A;  1TK5 B;  5B8B A;  4ZXG A;  3GKX A;  5CRG A;  4XTS A;  1M9B A;  4Q5N A;  2H6Y A;  4PNG A;  2CVK A;  2JU5 A;  5AIX A;  1EGR A;  3GKM A;  3F9U A;  3L4N A;  2DLX A;  3QFA C;  1ZL9 A;  2J23 A;  1DBY A;  2QC7 A;  3S9F A;  3M3M A;  5AGY A;  1UA5 A;  4X4J A;  2HSY A;  4K0N A;  3IDV A;  2J9H A;  1BYE A;  4QL7 A;  4GLT A;  2X49 A;  3VK9 A;  3J7Y k;  1X5C A;  4ML6 A;  18GS A;  3CRT A;  2EIR A;  1HNC A;  2DJ1 A;  1GNW A;  2LQQ A;  1A8L A;  4CW9 A;  3FR9 A;  2DIZ A;  3A2W A;  4HOJ A;  2L57 A;  2VM2 A;  4KND A;  3UBL A;  3ZIJ A;  4IQA A;  2C80 A;  1UVZ A;  5DAK A;  1KTE A;  3C7M A;  3L78 A;  4FYU A;  1XWK A;  2HZE B;  2N5A A;  2X64 A;  4EC0 A;  4K2X A;  2CAQ A;  4ZB8 A;  3U5R E;  3UMA A;  3A5I A;  3BCI A;  1ILO A;  3TB2 A;  1BAY A;  3PGT A;  5D73 A;  4OFN A;  1G7E A;  6GSU A;  2H01 A;  5J3R A;  4OCE A;  5ECQ B;  2H1B A;  3TKS A;  2H19 A;  1NHY A;  3TJB A;  2VD0 A;  1O7U A;  2HRF A;  1U3A A;  1J9B A;  3EWL A;  3E9J B;  3GIX A;  3UL3 A;  3BCK A;  2A4H A;  1ZYE A;  2YNX A;  3ZZX A;  2BJX A;  2X99 A;  2H0G A;  2O7K A;  3KJY A;  2P5R A;  4KA0 A;  3FYG A;  2IMI A;  3BBY A;  2YZH A;  3WGD A;  1B9X C;  3HDC A;  2AV4 A;  2WDU A;  1G6Y A;  3EVI A;  4TN8 A;  4MF5 A;  1SJZ A;  2FUG 2;  3GKK A;  5IPH A;  2LRN A;  1A8Y A;  4KH7 A;  4PUA A;  1R5A A;  4ECC A;  1TU7 A;  2X8G A;  4IP1 A;  5DVB A;  4Q5Q A;  1PN9 A;  2YV7 A;  5IO0 A;  4IP6 A;  5D93 A;  4JR6 A;  5JCW A;  3OR5 A;  2H74 A;  3GTU A;  2O89 A;  5F07 A;  3QDN A;  2IMD A;  4WF4 A;  1M7T A;  3G7J A;  1GTA A;  3HZ8 A;  4I8B A;  1SL2 B;  4NHW A;  3CTG A;  2OAC A;  4KX4 A;  1AC1 A;  3KTB A;  1DE1 A;  4V2M A;  1XWG A;  4J57 E;  6GSS A;  2GQK A;  2I9H A;  2HYX A;  2VL9 A;  2ALB A;  3MIX A;  3PH9 A;  1U88 A;  3KP8 A;  1CQH A;  2GSQ A;  2GT6 A;  4LLR A;  4XCS A;  2VLV A;  3ZML A;  2HLS A;  2OE0 A;  4KDU A;  4MAB A;  3VWV A;  4ECB A;  4KSO A;  1YY7 A;  1CQG A;  4YQV A;  3KMO A;  2YAN A;  1V9W A;  3A2V A;  1E2Y A;  1ON4 A;  4FO5 A;  5KN2 A;  2XBQ A;  3TGZ A;  1FVJ A;  3RHB A;  4MZC A;  5F06 A;  2AJQ B;  3TKR A;  3FZA A;  3LFL A;  1TU8 A;  3EU3 A;  4IBP A;  2CA8 A;  1FG4 A;  5H5R A;  4YAV A;  5LD0 A;  4AJ7 A;  4X1U A;  1SK0 A;  2PMT A;  1BQ7 A;  4IQ1 A;  2RM6 A;  3DWV A;  3F3Q A;  4XIH A;  1XPV A;  2WUL A;  3HD5 A;  2GZZ A;  2A2P A;  1WP0 A;  2P0G A;  1XIY A;  3FY7 A;  2GST A;  3GX8 A;  3DYR A;  3HJP A;  1PGT A;  4XS1 A;  1RQM A;  2RM5 A;  3HA9 A;  5D96 A;  5C04 A;  2B5X A;  5L71 A;  4AJ6 A;  3KH9 A;  2VL2 C;  1ZZY A;  3QD9 A;  1IYI A;  2F8A A;  1GH2 A;  5GZZ B;  2WCI A;  1HQO A;  4MZW A;  4MJA A;  3GNJ A; 
#chains in the Genus database with same CATH homology
 5FWG A;  5J4U A;  2IN3 A;  1GSE A;  1GP1 A;  3CRU A;  2HZE A;  3TKP A;  5KN3 A;  2MZC A;  1ZYN A;  2REM A;  4JBB A;  1DE2 A;  2JSZ A;  2ON7 A;  4PQ1 A;  3LGC A;  3TJG A;  4YKG A;  1M2B A;  3TOT A;  1THO A;  3MNG A;  3CSI A;  2ZNM A;  4K0G A;  5ECL B;  5HFK A;  1GUK A;  2H1D A;  4N11 A;  1SYX A;  1V40 A;  1GTU A;  1TRV A;  2RII A;  4IHU A;  3EU4 A;  3DIE A;  2YPM A;  3M0F A;  3ZTL A;  3CXG A;  1F3B A;  2YWO A;  14GS A;  3TDG A;  1FOH A;  4TVE A;  2OE1 A;  4KW6 A;  5EL8 A;  2L6C A;  2GS3 A;  5ECR B;  3H79 A;  2R6K A;  2TIR A;  3GH6 A;  4KUN A;  1TRU A;  1GTB A;  3G7Y A;  3EYT A;  4JRR A;  1Y25 A;  3KD0 A;  5F8B A;  4PXO A;  2RUE A;  2C0G A;  5G1K A;  1A24 A;  3GH9 A;  3KXO A;  4DEJ A;  1ZMA A;  3FZ9 A;  4GTU A;  3WD6 A;  1M2A A;  2H73 A;  1W89 A;  4GWR A;  2IME A;  2I3Y A;  1B48 A;  3KCM A;  2FCH A;  2YCD A;  2DJ0 A;  2H8L A;  4G10 A;  4MZB A;  4X43 A;  5ECI B;  2VLU A;  4HDE A;  2VLT A;  2JAD A;  3CYN A;  3KM6 A;  1A23 A;  2OA7 A;  3IXR A;  3TKS C;  5ECP B;  2H76 A;  5ID2 A;  1YEP A;  5KOW A;  2IMK A;  3D4T A;  2TRX A;  1YQ1 A;  4FYC A;  4NV5 A;  1S3D A;  1YJ6 A;  1FVK A;  1EEJ A;  3F4R A;  2DSA A;  4PNF A;  4HUA A;  1T8E B;  3HKR A;  3MWH A;  1V98 A;  5IIZ A;  3QFB C;  1TOF A;  5ABR A;  2V41 A;  2K6V A;  1BG5 A;  3UJ1 A;  1U3I A;  1K3O A;  3EPT A;  1Y6E A;  3GHA A;  3KGK A;  3Q19 A;  3HY2 A;  1AQV A;  4ZB6 A;  1BED A;  4YAP A;  1O8X A;  1F37 A;  2JAC A;  5JWQ B;  1YKC A;  1GUM A;  3HVX A;  1TDI A;  2NDO A;  3IOS A;  1SJ6 A;  1F6M C;  2HSM A;  3ZRD A;  3GV1 A;  4L5L A;  5D9T A;  2H6X A;  2A4V A;  2QKE A;  2ZUP A;  1K0N A;  3W8S A;  2MMN A;  4KCE A;  4Z7X A;  1H4O A;  4O92 A;  3G7I A;  2YWI A;  1GSF A;  1QMV A;  4I2T A;  5F0G A;  4GSN A;  2PUK C;  1WOU A;  4ZIL A;  1FB6 A;  4ZBA A;  3L0H A;  2ZCT A;  1VF4 A;  2LS5 A;  2MYG A;  4NXI A;  2M46 A;  2C1Y A;  3TOU A;  4HZ2 A;  3QOU A;  1XW9 A;  3PPU A;  1AIU A;  4MPG A;  3F4T A;  5GAP D;  2C3N A;  2LNS A;  2M80 A;  4MH2 A;  4K9Z A;  2L5O A;  3ERF A;  2TRC P;  3UOM A;  2C3T A;  3WGX A;  2YWM A;  17GS A;  2AAW A;  1GRX A;  3ZFB A;  4IW9 A;  3DVW A;  6GSV A;  22GS A;  3H4K A;  4ZL7 A;  3D4M A;  4PGT A;  2DJ3 A;  1OE7 A;  2PN8 A;  2FHE A;  1C72 A;  3IPZ A;  3KZQ A;  1K0A A;  4O32 A;  2HSH A;  2DKI A;  4F03 A;  2FNO A;  3QR6 A;  2RUF A;  3TRQ A;  3IC8 A;  1TKD B;  4GCI A;  1MEK A;  5ECK B;  2R0G A;  2BMX A;  1PL1 A;  4ZBD A;  1HYU A;  4LL1 B;  1K0D A;  2NTO A;  3M8N A;  3TRX A;  1XFL A;  4K2D A;  2PVO C;  2ON5 A;  1S3A A;  1GTI A;  4Q5R A;  3M9K A;  5CRE A;  2WFC A;  2G2Q A;  5A4U A;  1T4Y A;  2HE3 A;  2FA8 A;  3IRA A;  6GSX A;  13GS A;  1GNE A;  1OAZ A;  5D8I A;  3LXZ A;  3ZLP A;  1YKA A;  1R5P A;  4FQU A;  2NVL A;  3LXT A;  1ZYQ B;  3GUR A;  3LWA A;  4EF0 A;  16GS A;  2B1L A;  1A0F A;  4ECI A;  4V2L A;  4V2N A;  2H0H A;  3L9S A;  2YJH A;  4K7I A;  2AB6 A;  1TRW A;  2WB9 A;  4MF6 A;  1QK8 A;  2LST A;  1FHE A;  3I6A A;  4IJ3 A;  3IV4 A;  2IIY A;  4G0L A;  2FWE A;  4NWY A;  3N9J A;  4RQR A;  1URM A;  4FIW A;  2A2S A;  3VPQ A;  4AGS A;  3IK9 A;  3US3 A;  1TI1 A;  1PKZ A;  3P7X A;  5ECM B;  4MLY A;  4ICY A;  1EV4 A;  2HI7 A;  3ZMK A;  1LJR A;  5CRD A;  2OBI A;  2VCT A;  2C3Q A;  3ZL5 A;  5BMU A;  1MDK A;  4IKH A;  1GSQ A;  2JL4 A;  2XPE A;  3C71 A;  3I69 A;  3KTL A;  3D22 A;  2GQM A;  2DKH A;  4XHM A;  1ST9 A;  4NMU A;  5CO3 A;  1SYR A;  4HEA 2;  5B6N A;  2I1U A;  1XXU A;  5CRH A;  5H5S A;  3IHQ A;  1HNA A;  3I43 A;  2HRK A;  5D9W A;  4DVC A;  2LTK A;  3VWW A;  2NPB A;  4BVX A;  2OKA A;  3FRC A;  3GSS A;  3CSH A;  3UVH A;  4CY6 A;  2CX4 A;  4RQX A;  2LEG A;  4G9H A;  4KF9 A;  4PUR A;  9GSS A;  3HJM A;  1AXD A;  1PKW A;  5GAN D;  4LMW A;  3BOA A;  3F63 A;  1PQN A;  4KCA A;  5JWR B;  20GS A;  4D73 B;  2V6K A;  5DDL A;  4TW5 A;  3NOF A;  7GSS A;  1OC3 A;  4NAX A;  1EEM A;  2OJL A;  1JZW A;  4JR4 A;  4EIQ A;  4BL7 A;  1GSS A;  3FW2 A;  2E0Q A;  1NW2 A;  5ID2 B;  2BTO T;  2NBS A;  1PN0 A;  1A2L A;  3WT1 A;  2PWJ A;  4MA9 A;  4Z2T A;  3FMW A;  2QA1 A;  2X4A A;  3EUR A;  3WT2 A;  1X5E A;  3RBT A;  4X0X A;  5J5N A;  3F6D A;  4WR4 A;  3FK8 A;  2P5Q A;  3MAK A;  2MBT A;  1IYH A;  1VGL A;  4WF5 A;  4PX1 A;  2V6O A;  2YZU A;  1V58 A;  3VWX A;  3GUS A;  1AQX A;  3DML A;  3ISO A;  1T4Z A;  2H1A A;  3CBU A;  4H86 A;  3ERW A;  4ILF A;  2AHE A;  3HCZ A;  2N5B A;  1QFN A;  2E7P A;  1X9M B;  2HRN A;  4EXJ A;  4OO5 A;  1WJK A;  4ISD A;  1X9W B;  4N10 A;  4MPF A;  2V2G A;  3LOR A;  2I4A A;  3ZYW A;  1Q4J A;  1B9Y C;  3IA1 A;  4DSQ A;  1JZR A;  2H30 A;  2H71 A;  1TK0 B;  4KGI A;  2DJK A;  4YH2 A;  4LMV A;  2L6D A;  3DXB A;  2CAI A;  2LJA A;  2VAF A;  4AJ8 A;  3UEM A;  5ECN B;  2PVQ A;  2OBK A;  2LUS A;  2L59 A;  2JSY A;  2VCX A;  2P31 A;  5G1L A;  4EDZ A;  4USS A;  2HT9 A;  1RW1 A;  1K0B A;  4ML1 A;  4K7N A;  4JZQ A;  3RDW A;  2CVB A;  3LG6 A;  4HQZ A;  4PTS A;  4MF7 A;  1WIK A;  5G5E A;  12GS A;  5ELA A;  1O6J A;  4L5O A;  3KP9 A;  1Z6M A;  4HS1 A;  1HNB A;  1B4P A;  5DBQ A;  2V1M A;  2QA2 A;  2IFQ A;  3DVX A;  4L8E A;  3AY8 A;  4HJ2 A;  4QQ7 A;  4MH3 A;  3IBH A;  3LEF A;  2B1K A;  1YZX A;  4XS4 B;  2KLX A;  1T3B A;  4K8M A;  2DJJ A;  4IGJ A;  3TRP A;  5G30 A;  2K18 A;  2F9S A;  3CTF A;  3U6V A;  3L9U A;  3VLN A;  1GL8 A;  2LJK A;  2B5E A;  5CAX A;  3DRN A;  2DIY A;  2M72 A;  1OC9 B;  2DML A;  1PL2 A;  4TR3 A;  4EO3 A;  3M9J A;  1Z3E A;  1UN2 A;  4O7H A;  3VUR A;  1RK4 A;  1XWA A;  5JCU A;  1SU9 A;  2VOC A;  1GLQ A;  1SK2 A;  3VI7 A;  1SKW B;  1EGO A;  5DJL A;  4EVM A;  3J7Y b;  1OE8 A;  5H5Q A;  1WRY A;  3EIN A;  4QL9 A;  4KAE A;  2FY6 A;  4YQM A;  2DBC A;  1K0C A;  1YDK A;  4KDX A;  2CV4 A;  5HR1 A;  4F0C A;  1Z5Y E;  5ENU A;  4D73 A;  2VD1 A;  3DGQ A;  4OFM A;  4RI6 A;  5DJM A;  4K1F A;  5DCG A;  1ZOF A;  3IC4 A;  5GSS A;  2GGT A;  4GQC A;  1QXH A;  2VCV A;  2WJU A;  4WKW A;  2PU9 C;  1SEN A;  4YKF A;  2VCZ A;  5EY6 A;  3FHK A;  1EOH A;  4MP4 A;  3MSZ A;  3C8E A;  8GSS A;  3QAG A;  1TP9 A;  1THX A;  2EC4 A;  3UAP A;  4EKZ A;  3WGE A;  1AQW A;  4WBR D;  1QUW A;  1MTC A;  5ELG A;  3GKN A;  3VFI A;  5HR3 A;  5IQY A;  5G2Z A;  3TJJ A;  4GXZ A;  3ZFL A;  1SKS B;  3JCM L;  3KEB A;  3F8U A;  4XS6 A;  3HXS A;  2PGT A;  4TR0 A;  1V57 A;  3RAZ A;  1QQ2 A;  2GZP A;  3A2X A;  1K0M A;  3LJR A;  2KUC A;  1M2D A;  5ECO B;  5E4W A;  2QSI A;  1O73 A;  5IOW A;  10GS A;  4BPY A;  4TKY A;  2DMM A;  4E8E A;  1XCC A;  1AUC A;  1VF3 A;  4KDY A;  2HXK A;  3D6I A;  2L4Q A;  2FWF A;  2C0F A;  1DSB A;  2CZ2 A;  5IO2 A;  4WEY A;  4BVX B;  1G7O A;  3FKF A;  1V2A A;  3IR4 A;  3QAV A;  1PA3 A;  1XW5 A;  4FYB A;  2V32 A;  4MDC A;  2K9F A;  1M99 A;  4AF2 A;  1KBN A;  4V1A g;  3GX0 A;  4KSM A;  2R5G A;  4I2U A;  2F8F A;  2VCQ A;  3GYK A;  1K0O A;  4ZIJ A;  1VF1 A;  3R3E A;  1G6W A;  3NZN A;  4ZB9 A;  3F0I A;  4PQI A;  3LSZ A;  5AN1 A;  4GRF A;  4I97 A;  5EVO A;  2HZF A;  2VO4 A;  19GS A;  4XRA A;  2H72 A;  3EMX A;  4BL7 B;  1BJX A;  3WYW A;  4TOP A;  5BRT A;  2H75 A;  5ECH B;  4TRX A;  4I5Q A;  2R4V A;  1H75 A;  2OAD A;  1EZK A;  1I9D A;  2OE3 A;  3V1W A;  1N2A A;  2PPT A;  2IPA A;  2ES7 A;  3W6G A;  3DKS A;  3GFK A;  3HYP A;  1ERU A;  4MNN A;  1ML6 A;  1YF1 A;  2LKU A;  4Q5F A;  4XS4 A;  2QGV A;  4P3Y B;  1VF2 A;  3F4S A;  1FAA A;  1OC9 A;  3W8J A;  3HHV A;  5IMA A;  5A5K A;  2H1G A;  5HQP A;  1ERW A;  1DUG A;  2HNL A;  2VUP A;  2YJ7 A;  2HRA A;  1MDI A;  1TTZ A;  1XW6 A;  1U6T A;  1XBS A;  5KN1 A;  4BVY A;  3RPP A;  3BJ5 A;  4IJI A;  3QCP A;  3E0U A;  1T00 A;  1F9M A;  3HJO A;  2D2Z A;  3A3T A;  4ECJ A;  3D5J A;  4IN0 A;  4TXO B;  4F82 A;  1WPI A;  5A4V A;  2UZ8 A;  4K7O A;  1SD8 A;  3EE2 A;  2GLR A;  5COH A;  4NV2 A;  2VM1 A;  1B4Q A;  4OFT A;  2IL3 A;  4J56 E;  3KMN A;  3H93 A;  3ME8 A;  3LYK A;  4NPB A;  1A0R P;  2X8C A;  2AYT A;  1SL0 B;  1JZD A;  1JLW A;  3IAM 2;  3P2A A;  2VL3 A;  4N30 A;  1GSU A;  4JED A;  3LYP A;  4IS0 A;  1PSQ A;  5IMF A;  2R2J A;  2VCW A;  2FD3 A;  3FR6 A;  1OKT A;  2YP6 A;  3APO A;  4KE3 A;  4JE1 A;  1JZO A;  3F6F A;  4HZ4 A;  3UBK A;  3TJK A;  1R7H A;  4HU9 A;  2C0E A;  1HD2 A;  1PD2 1;  2R37 A;  5G5F A;  1XVQ A;  4HI7 A;  2B7J A;  1EP7 A;  2IFQ B;  1A2J A;  1TXX A;  1KNG A;  4G0I A;  6GST A;  3Q6O A;  1NM3 A;  1ERV A;  2FWH A;  1ABA A;  1GSD A;  2O87 A;  2WZ9 A;  1LU4 A;  5IM9 A;  5AIV A;  2WGR A;  4OCF A;  1G0T A;  2E2M A;  4DSS B;  1SD9 A;  2GDR A;  2WRT A;  3DD3 A;  1R4W A;  5DAL A;  2C4J A;  2H6Z A;  5E59 A;  5D9X A;  3RHC A;  5HR0 A;  4ACS A;  3GL5 A;  3Q74 A;  4RUV A;  4CY8 A;  1EOG A;  3D0Z A;  2B6M A;  4POM A;  3PIN A;  5DCH A;  4BWS A;  3SWL A;  1ZYP A;  1ZGN A;  4ID0 A;  1VRS D;  2R0P A;  5LCZ A;  5B6M A;  3ZRE A;  1GWC A;  6GSW A;  1AAZ A;  4F0B A;  5CYY A;  4A5P A;  4TR4 A;  3PR8 A;  2XPD A;  3APS A;  3RPN A;  2O85 A;  2GQL A;  4POB A;  5INY A;  1PMT A;  1UC7 A;  3FR3 A;  3M1G A;  2F3M A;  4MJB A;  1A2M A;  2JZR A;  4Z2R A;  1GUL A;  5B8A A;  4MCU A;  5HR2 A;  2L5L A;  2GZY A;  1O81 A;  1FO5 A;  4POL A;  4HU7 A;  4CDO A;  2PBJ A;  2GSS A;  2Z9S A;  5HFI A;  11GS A;  1AW9 A;  2B5Y A;  2YOI A;  1OVN A;  3C1S A;  4MJE A;  4GF0 A;  5EPF A;  3ZIT A;  2JZS A;  2IWT A;  3IAS 2;  3APQ A;  4XRD A;  3G9B A;  3IE3 A;  1EV9 A;  3FZ5 A;  4O5Q A;  2IJY A;  2LRT A;  1FB0 A;  3P90 A;  1GSY A;  2C8U A;  5IMZ A;  1SL1 B;  2F51 A;  4OMV A;  4POK A;  2XC2 A;  3BD2 A;  4MJC A;  4ULX A;  3QMX A;  3CSJ A;  1T7P B;  2A2R A;  2LNT A;  1PX7 A;  6GSY A;  1KEB A;  4F2I A;  4GST A;  1MD3 A;  4WET A;  3N5O A;  3E3E A;  2KP1 A;  5J9B A;  4E8H A;  1WWJ A;  1JFU A;  1LBK A;  4TXO A;  4PUF C;  3IK7 A;  4K6X A;  4TR1 B;  2R0C A;  4EL1 A;  2CZ3 A;  2GT5 A;  3A5W A;  1MDJ A;  4NHZ A;  1GUH A;  4N0Z A;  2JZT A;  4OO4 A;  3VWU A;  4MMM A;  3L9V A;  1XWB A;  1OC8 A;  4I6X A;  5LNK e;  3K8N A;  2KHP A;  3QPM A;  3ZVJ A;  1PX6 A;  3SBC A;  1XVW A;  2LQO A;  3H1N A;  5KN0 A;  2I81 A;  2MBS A;  3EMP A;  3KIJ A;  2N5F A;  2R3X A;  4K5R A;  1O85 A;  3D21 A;  1M0U A;  2LV3 A;  2FLS A;  5DQY A;  2KOK A;  2CQ9 A;  3GRX A;  4WXT A;  4DSR A;  5KEJ A;  1F3A A;  5IPG A;  4PQH A;  3IHG A;  2H0I A;  3UVT A;  1R26 A;  3EC3 A;  3O3T A;  4ZL8 A;  2GTU A;  3GN3 A;  3QAW A;  2E2G A;  3FEU A;  2K8S A;  4OD7 A;  1YEX A;  2KP2 A;  2MMA A;  4OWY A;  1SKR B;  4L0W A;  1X9S B;  3MDK A;  4DSS A;  2LRC A;  3HVV A;  1TI3 A;  3CMI A;  1PRX A;  5CNW A;  5G31 A;  3F3R A;  4ZL9 A;  2WS2 A;  3LW9 A;  5D9V A;  3NIV A;  5JCG A;  2RLI A;  1M9A A;  4BA7 A;  2FA4 A;  1N8J A;  5IOX A;  4G0K A;  5CRW A;  1I5G A;  4FH8 A;  1TW9 A;  2FWG A;  4BVY B;  4L0U A;  2YN1 A;  3O6T A;  1YF0 A;  3TKQ A;  2FGX A;  2HFD A;  1Z7R A;  1BX9 A;  2CVD A;  4CHS A;  1S3C A;  5KOX A;  1XOB A;  5FHI A;  2K8V A;  2LJR A;  4WR5 A;  4G19 A;  1Z9H A;  1TJD A;  1TRS A;  2IMF A;  1NSW A;  3FZ4 A;  2PER A;  3H8Q A;  3C1R A;  2DC5 A;  3ME7 A;  4TXV A;  4EDY A;  3DEX A;  4Z2U A;  3C73 A;  2H70 A;  4J2F A;  1E6B A;  3TUE A;  1GLP A;  2MMZ A;  2VIM A;  1XWC A;  1Z7P A;  1SJI A;  3TJF A;  2B7K A;  5DAK B;  5IMD A;  3MYD A;  1ERT A;  1JLV A;  1WMJ A;  4ZBB A;  2CT6 A;  3VI5 A;  3UAR A;  1USB A;  4K5S A;  1FOV A;  1U87 A;  4HJM A;  4GQF A;  5C00 A;  3TKS E;  3KH7 A;  4JU5 A;  1JHB A;  3VPT A;  3GL3 A;  2XBI A;  4KB3 A;  3ZVJ D;  3HZ4 A;  4HQS A;  5AIS A;  1FW1 A;  1X0R A;  2MMO A;  5DAL B;  1MD4 A;  2XHF A;  4O5R A;  4MK3 A;  4EUY A;  2YV9 A;  1EP8 A;  5HFG A;  1T1V A;  4IVF A;  4EIP A;  1QGV A;  1Z6N A;  1OKD A;  2X8H A;  1EWX A;  1WE0 A;  3Q18 A;  5IMC A;  1X5D A;  1ZCP A;  5J41 A;  3R2Q A;  2AUV A;  4LA1 A;  4F9Z A;  4TR1 A;  3ED3 A;  2YWN A;  4O5U A;  2GVP A;  2O8V B;  5CP1 A;  1J08 A;  2EIO A;  3UIW A;  4N0V A;  5JWO B;  2H66 A;  1K3L A;  5GST A;  3ZIV A;  5ECS A;  2GSR A;  4GSS A;  1OYJ A;  1TK8 B;  1SK1 A;  5A4W A;  4RI7 A;  5B7C A;  2DJ2 A;  2C0D A;  5J9C A;  1F2E A;  2B3S A;  1K3Y A;  5FT3 A;  3GTU B;  3O76 A;  2CX3 A;  4G2E A;  4EE0 A;  2VL2 A;  1J0F A;  1O8W A;  5F05 A;  4LL4 B;  3ERG A;  3I9V 2;  3TCO A;  1Q98 A;  4IEL A;  1ACV A;  3LQ7 A;  3P8W A;  5DQS A;  1NHO A;  1XOA A;  2EIQ A;  3GA4 A;  5IMV A;  2L4C A;  4V1A p;  2G0F A;  4BWQ A;  4YQU A;  1B8X A;  1W4V A;  3GST A;  1XZO A;  3GMF A;  4WBJ A;  3HVS A;  1TK5 B;  5B8B A;  4ZXG A;  3GKX A;  5CRG A;  4XTS A;  1M9B A;  4Q5N A;  2H6Y A;  4PNG A;  2CVK A;  2JU5 A;  5AIX A;  1EGR A;  3GKM A;  3F9U A;  3L4N A;  2DLX A;  3QFA C;  1ZL9 A;  2J23 A;  1DBY A;  2QC7 A;  3S9F A;  3M3M A;  5AGY A;  1UA5 A;  4X4J A;  2HSY A;  4K0N A;  3IDV A;  2J9H A;  1BYE A;  4QL7 A;  4GLT A;  2X49 A;  3VK9 A;  3J7Y k;  1X5C A;  4ML6 A;  18GS A;  3CRT A;  2EIR A;  1HNC A;  2DJ1 A;  1GNW A;  2LQQ A;  1A8L A;  4CW9 A;  3FR9 A;  2DIZ A;  3A2W A;  4HOJ A;  2L57 A;  2VM2 A;  4KND A;  3UBL A;  3ZIJ A;  4IQA A;  2C80 A;  1UVZ A;  5DAK A;  1KTE A;  3C7M A;  3L78 A;  4FYU A;  1XWK A;  2HZE B;  2N5A A;  2X64 A;  4EC0 A;  4K2X A;  2CAQ A;  4ZB8 A;  3U5R E;  3UMA A;  3A5I A;  3BCI A;  1ILO A;  3TB2 A;  1BAY A;  3PGT A;  5D73 A;  4OFN A;  1G7E A;  6GSU A;  2H01 A;  5J3R A;  4OCE A;  5ECQ B;  2H1B A;  3TKS A;  2H19 A;  1NHY A;  3TJB A;  2VD0 A;  1O7U A;  2HRF A;  1U3A A;  1J9B A;  3EWL A;  3E9J B;  3GIX A;  3UL3 A;  3BCK A;  2A4H A;  1ZYE A;  2YNX A;  3ZZX A;  2BJX A;  2X99 A;  2H0G A;  2O7K A;  3KJY A;  2P5R A;  4KA0 A;  3FYG A;  2IMI A;  3BBY A;  2YZH A;  3WGD A;  1B9X C;  3HDC A;  2AV4 A;  2WDU A;  1G6Y A;  3EVI A;  4TN8 A;  4MF5 A;  1SJZ A;  2FUG 2;  3GKK A;  5IPH A;  2LRN A;  1A8Y A;  4KH7 A;  4PUA A;  1R5A A;  4ECC A;  1TU7 A;  2X8G A;  4IP1 A;  5DVB A;  4Q5Q A;  1PN9 A;  2YV7 A;  5IO0 A;  4IP6 A;  5D93 A;  4JR6 A;  5JCW A;  3OR5 A;  2H74 A;  3GTU A;  2O89 A;  5F07 A;  3QDN A;  2IMD A;  4WF4 A;  1M7T A;  3G7J A;  1GTA A;  3HZ8 A;  4I8B A;  1SL2 B;  4NHW A;  3CTG A;  2OAC A;  4KX4 A;  1AC1 A;  3KTB A;  1DE1 A;  4V2M A;  1XWG A;  4J57 E;  6GSS A;  2GQK A;  2I9H A;  2HYX A;  2VL9 A;  2ALB A;  3MIX A;  3PH9 A;  1U88 A;  3KP8 A;  1CQH A;  2GSQ A;  2GT6 A;  4LLR A;  4XCS A;  2VLV A;  3ZML A;  2HLS A;  2OE0 A;  4KDU A;  4MAB A;  3VWV A;  4ECB A;  4KSO A;  1YY7 A;  1CQG A;  4YQV A;  3KMO A;  2YAN A;  1V9W A;  3A2V A;  1E2Y A;  1ON4 A;  4FO5 A;  5KN2 A;  2XBQ A;  3TGZ A;  1FVJ A;  3RHB A;  4MZC A;  5F06 A;  2AJQ B;  3TKR A;  3FZA A;  3LFL A;  1TU8 A;  3EU3 A;  4IBP A;  2CA8 A;  1FG4 A;  5H5R A;  4YAV A;  5LD0 A;  4AJ7 A;  4X1U A;  1SK0 A;  2PMT A;  1BQ7 A;  4IQ1 A;  2RM6 A;  3DWV A;  3F3Q A;  4XIH A;  1XPV A;  2WUL A;  3HD5 A;  2GZZ A;  2A2P A;  1WP0 A;  2P0G A;  1XIY A;  3FY7 A;  2GST A;  3GX8 A;  3DYR A;  3HJP A;  1PGT A;  4XS1 A;  1RQM A;  2RM5 A;  3HA9 A;  5D96 A;  5C04 A;  2B5X A;  5L71 A;  4AJ6 A;  3KH9 A;  2VL2 C;  1ZZY A;  3QD9 A;  1IYI A;  2F8A A;  1GH2 A;  5GZZ B;  2WCI A;  1HQO A;  4MZW A;  4MJA A;  3GNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...