2YOIA

Crystal structure of ancestral thioredoxin relative to last eukaryotes common ancestor (leca) from the precambrian period
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
b'MVIQVTNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKHAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECA THIOREDOXIN
publication title Conservation of protein structure over four billion years.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 35
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yoiA00
1X5DA 2EIRA 4O5RA 5KN2A 2BJXA 2HZEA 4HQZA 3KMNA 5DAKB 2OA7A 2FGXA 2FWEA 1K0CA 3L78A 2GDRA 3UARA 5J5NA 3EINA 5G5FA 1PD21 1GWCA 3FZAA 4GSSA 1PRXA 1GLPA 1GTUA 4ML1A 1SD9A 3DVWA 3FRCA 4K1FA 1N8JA 4G9HA 1S3DA 4HQSA 3ZMKA 2H30A 3Q74A 3GYKA 19GSA 1QFNA 2V6KA 3ZTLA 2CZ3A 3KZQA 4MCUA 1OC3A 3DMLA 4YH2A 4XS1A 2YZHA 3A5WA 5EL8A 1M2BA 2I3YA 2DBCA 1M9AA 1B9YC 2BMXA 3FHKA 1N2AA 3VFIA 3C8EA 3AY8A 1M99A 4ACSA 4LA1A 1H75A 5ECOB 4DVCA 3QCPA 3ZLPA 4TR3A 5CAXA 3FK8A 1XW6A 4P3YB 1Y6EA 2DMMA 3VURA 17GSA 5DCGA 4EE0A 1TK8B 1PL1A 4O7HA 2NPBA 2WDUA 2GTUA 2IL3A 4ML6A 5FT3A 2OE1A 5GAPD 2M72A 1U6TA 5IMZA 4MH2A 5ECQB 3I43A 1A0RP 4IN0A 2DMLA 2FNOA 2R37A 2YOIA 1OKTA 2LSTA 1B48A 2VL2C 3NZNA 3L0HA 1VRSD 2GLRA 2V6OA 1O81A 2IFQB 1GSSA 1GNWA 2R3XA 4WR4A 1HYUA 3GTUA 3KTLA 2N5FA 1DSBA 4XTSA 5AIVA 2DLXA 3CBUA 1J9BA 4E8HA 2H75A 2YJ7A 3BD2A 4EC0A 3ED3A 4KA0A 4MJEA 2P5QA 4KB3A 5LCZA 3GFKA 3EU4A 1Z7RA 4GLTA 3IA1A 2KOKA 4Q5NA 3IC4A 3NOFA 1DE1A 1M2AA 5ECIB 2FWGA 1TRWA 4IP6A 3RAZA 1CQHA 2ZUPA 1TKDB 4TW5A 4POMA 1TTZA 1X9SB 5JCWA 4PGTA 1F3AA 2LUSA 4EDYA 3ZIJA 3WT2A 1R26A 1VF2A 3CXGA 1FVJA 4XS4B 1GSYA 3CYNA 3TKSA 1MDKA 3DWVA 4GQFA 2HLSA 5DJLA 3D4TA 2KP2A 4I2UA 3U5RE 1KBNA 2XC2A 5DJMA 1PKWA 1X9WB 3HKRA 3PGTA 4OO4A 2K6VA 5CP1A 1A2MA 4HZ4A 1A8YA 2JZTA 2V32A 3GHAA 2LJRA 4FH8A 4TR4A 2VCQA 3UIWA 1SK2A 3IBHA 5DALA 2EC4A 2H6YA 5ECSA 3IAM2 1ON4A 4KCEA 1EEMA 1FO5A 2LKUA 2FHEA 1FW1A 3GKKA 4BL7A 4EO3A 1NM3A 3KCMA 5ECKB 4WEYA 3LXTA 2MBSA 4EDZA 4IHUA 2FD3A 4PQIA 2E2GA 5ENUA 1EWXA 1VF4A 2B5XA 3CSJA 1RK4A 2P5RA 2R4VA 4NXIA 4ILFA 4KGIA 1GL8A 1I9DA 3TCOA 1PX7A 5EY6A 3GH9A 1AW9A 5C00A 2YN1A 2HXKA 4HUAA 3ERGA 5G31A 4NHWA 3TRXA 2CV4A 2PWJA 3CTFA 2YJHA 1F9MA 2H1GA 1AQXA 5H5QA 1YF1A 4X1UA 2WGRA 1V58A 4JEDA 2QC7A 2I81A 1BX9A 4O32A 4GCIA 3QFBC 13GSA 4XCSA 2RM6A 4MF5A 5J9CA 4CDOA 3I9V2 1A2LA 1QMVA 4WBRD 1HQOA 3FY7A 5FWGA 3QD9A 1XW5A 1Y25A 3H1NA 2VLUA 4KUNA 1NHOA 5COHA 3KGKA 2WJUA 2AV4A 1RQMA 2DJKA 5A4UA 2H8LA 2M80A 1GSQA 2MMOA 3KJYA 3EMXA 2MZCA 2GSSA 2C0FA 3KMOA 5D93A 4BVXA 1ERUA 1IYIA 3UVTA 3UOMA 1WMJA 7GSSA 3A2WA 3VPTA 3FZ5A 4L5LA 2E2MA 3GSTA 1G6YA 2XHFA 3IOSA 3PH9A 5LNKe 3F8UA 3Q6OA 3JCML 4V2MA 3ISOA 3F3RA 2YPMA 1H4OA 1ABAA 5ID2A 1F6MC 2JSZA 5B6MA 3IDVA 3GNJA 5ECLB 2HSHA 4GTUA 5ELGA 4JBBA 4TKYA 1K3YA 3IAS2 3PINA 5D9VA 2J9HA 1UA5A 4XS6A 1XVWA 2E0QA 1YKAA 2NBSA 4V1Ag 4OFNA 3Q18A 3ZIVA 2HT9A 1UC7A 4K7IA 3E0UA 2GVPA 4OD7A 4IBPA 4FO5A 2VAFA 1ERTA 1HNCA 11GSA 3G7YA 1EGRA 6GSSA 2C80A 5KN1A 2J23A 3VI5A 4BPYA 1ERWA 4MJCA 4KX4A 3WD6A 5CNWA 2F8FA 3C1RA 3TJFA 4N0ZA 5IO2A 1KNGA 5IIZA 4OFMA 2WS2A 2L5LA 1YF0A 4WF5A 3MAKA 1SJ6A 4HJ2A 4AF2A 2YZUA 3DRNA 4EF0A 3ZVJA 5IOWA 4GSTA 2VM2A 2OKAA 2GS3A 3GMFA 3KEBA 4O92A 1ML6A 4CHSA 2O7KA 2XBIA 4KSMA 5GZZB 4YQMA 2JU5A 4MF6A 2CA8A 3L9UA 2G0FA 3TGZA 3FEUA 1OAZA 1SKRB 16GSA 22GSA 1ZL9A 2WRTA 4ZB9A 1T8EB 2DIYA 1TOFA 2FA8A 2MMZA 1A23A 3UAPA 4MP4A 3KH7A 4ECIA 5G1LA 5HQPA 2VL2A 5AISA 3WYWA 4AJ6A 2NVLA 2VM1A 3DGQA 3WGEA 4J57E 1SL2B 2LV3A 3QPMA 4POKA 4Q5QA 5AGYA 3ZMLA 2WFCA 4L5OA 3A2VA 4FYCA 4YQVA 4IELA 4ZBBA 4DSSB 3DKSA 3M3MA 5IMCA 3TOTA 3ME8A 1MD4A 1V2AA 2C3NA 3WT1A 3HVSA 4WBJA 1TJDA 1QGVA 9GSSA 3FW2A 1Z5YE 1S3AA 1XWBA 2C3TA 3DD3A 4K2DA 1MDJA 1WJKA 3GH6A 1ACVA 1V57A 2RUEA 3ZZXA 1X9MB 3R2QA 1BYEA 4ECBA 3P8WA 2L6CA 1YKCA 1KEBA 4I5QA 2B5EA 2EIQA 5IMAA 3N9JA 4QQ7A 3ZVJD 2L6DA 1GLQA 3HZ8A 2XPEA 1R5AA 4IQAA 3GV1A 3QMXA 1VGLA 3FYGA 3HVVA 4L0WA 1EOHA 2RIIA 2H6XA 3H4KA 1URMA 2IIYA 5DQSA 1MEKA 2PVQA 1FB6A 3GA4A 4TXVA 2X64A 4MDCA 4TVEA 1AQWA 3VK9A 5A4WA 2IFQA 1CQGA 1GRXA 2Z9SA 2FWHA 2HFDA 4V2NA 1PL2A 1Q98A 2AHEA 5CRHA 3P2AA 5JCUA 3F63A 4RI7A 1XWAA 1G6WA 1TRVA 1QQ2A 1EOGA 1TI1A 2G2QA 4J56E 2GQKA 3G7IA 1XXUA 3M1GA 2DJ3A 2A2SA 1JZOA 4YAVA 2I4AA 4K6XA 3F6DA 4G10A 3DYRA 2EIOA 1XZOA 4IW9A 1W4VA 3IK9A 1T1VA 1X5EA 3IHQA 4XS4A 4OCEA 4OMVA 2LNSA 2K8VA 5LD0A 1R7HA 5DCHA 1IYHA 3EYTA 3QAWA 3KXOA 2IJYA 4BWQA 4DSRA 1YY7A 4IQ1A 3DEXA 2VL3A 1X0RA 4K9ZA 2C1YA 3TB2A 1YEPA 2GZZA 2H0GA 3FZ9A 1R5PA 5D96A 2JL4A 4WF4A 3OR5A 2OBKA 1ZOFA 4PNGA 4ZBAA 4ZILA 5CO3A 5J3RA 1C72A 1I5GA 2JADA 3EMPA 3LXZA 3A2XA 4MPGA 1Z3EA 3TKSE 3UL3A 4ZB6A 2LRCA 1ZMAA 3GKMA 3KTBA 1Z9HA 2VUPA 3BOAA 5D73A 1Z6MA 3RHCA 2VIMA 4K0NA 4CW9A 1BAYA 3L4NA 4OWYA 5JCGA 3APSA 3RPNA 4XRAA 3TRQA 4GXZA 1OC9B 5B6NA 2RLIA 2X8CA 4PUFC 3IXRA 4V2LA 3F0IA 2X99A 5ECMB 3UVHA 2VD0A 3CRUA 5F07A 1XWKA 2OE3A 3LYPA 5ECPB 2DJ0A 2PN8A 4L0UA 3C71A 2LRNA 2O89A 1NSWA 1XOBA 1XBSA 4ULXA 1O8WA 3G9BA 2PU9C 2L4QA 2DC5A 2DJ2A 1BG5A 2H71A 2CT6A 1MD3A 5G5EA 4MLYA 5CRWA 1TU7A 4F2IA 1A8LA 3M9KA 4JE1A 3APOA 4KE3A 3WGXA 2MBTA 3VWUA 2AB6A 5F05A 1GTAA 5C04A 3IR4A 1A24A 4HZ2A 1G7EA 5AN1A 4LLRA 3MSZA 6GSTA 1K0AA 1PMTA 1M9BA 3H93A 1DBYA 3GL3A 4GRFA 4RQXA 1XVQA 1HNAA 1GUKA 1A2JA 4EVMA 1OC8A 2CVDA 2FUG2 3LFLA 3UBLA 4X43A 3KIJA 4TR1B 4Z7XA 2AAWA 1GTIA 1UVZA 2JZRA 3GKNA 2ZCTA 3TUEA 1S3CA 3I6AA 3N5OA 4NV2A 5IOXA 1JHBA 3SBCA 5G30A 1U3IA 1XWCA 3O6TA 1USBA 5JWOB 3C7MA 4HOJA 1E6BA 3IV4A 1THOA 2CVKA 3TKQA 3F4RA 5IO0A 2YV7A 2C0GA 1OE7A 3VPQA 3GRXA 5FHIA 1V98A 4WETA 5GSSA 3TJGA 4EKZA 3QAGA 4JRRA 8GSSA 18GSA 3EVIA 2FLSA 2YWMA 2VCXA 3F9UA 4NHZA 1O73A 4XHMA 3BCIA 4NV5A 4NMUA 2GQLA 3MWHA 2HYXA 3GIXA 4AGSA 5ECNB 3D4MA 5DVBA 3D21A 4TXOB 4KCAA 2B5YA 1HNBA 2GT6A 2NTOA 4MK3A 2ZNMA 4BA7A 3HJMA 4GSNA 2WULA 2HSYA 2C8UA 2GZYA 3VWVA 3HJPA 5IPGA 5ELAA 3RPPA 2VO4A 3TJJA 4MZWA 3PR8A 2TRXA 1O7UA 3QAVA 1TRSA 2IPAA 4KW6A 4IGJA 3ERFA 2XPDA 5INYA 4ZBDA 3LWAA 5HR0A 4ISDA 2LQQA 3BJ5A 1TP9A 4N10A 4WXTA 1F2EA 5HFKA 4YQUA 3IK7A 1XFLA 3HCZA 2YWNA 2K8SA 4F9ZA 1XWGA 1VF3A 4F0CA 4IJIA 1TK5B 4HDEA 5J41A 3MNGA 4OO5A 2ALBA 2I1UA 2H72A 5ECHB 2RUFA 2CZ2A 3V1WA 3VLNA 2NDOA 1EEJA 1V40A 3LJRA 3G7JA 3NIVA 1TDIA 4N30A 3TJBA 4DSSA 1XPVA 4K7OA 2F9SA 1BEDA 2B1LA 2AYTA 1K3OA 3A3TA 2V1MA 3ZFBA 4ZL7A 2GGTA 1WP0A 4PNFA 2IN3A 4QL7A 4ZL8A 4FYUA 4PURA 5IMFA 3IPZA 4D73B 5CRGA 1SKWB 5JWQB 2C0DA 4XRDA 5HFGA 2H19A 4H86A 4AJ7A 4I8BA 2YWIA 2ON7A 2IMDA 2OE0A 3MDKA 4ECCA 4WKWA 3ZFLA 2LJKA 6GSWA 1XCCA 2H74A 2K18A 1SL1B 2VLVA 3C73A 4BVYA 3ZRDA 1M2DA 1ZZYA 1G7OA 1SJIA 3FR9A 1TRUA 4QL9A 3HDCA 3IRAA 1T3BA 3TOUA 3D6IA 2C4JA 1JFUA 2H6ZA 2OBIA 2B3SA 1SENA 1OVNA 1K0DA 3GURA 4JR4A 1E2YA 5IPHA 1ZYEA 5L71A 4KDYA 3LEFA 1SU9A 2D2ZA 4I6XA 2LQOA 4KDXA 3HZ4A 4BWSA 4KAEA 2DSAA 4KH7A 3KD0A 5F06A 2P0GA 5CYYA 2A4VA 1WPIA 3HXSA 4PXOA 2ES7A 1FG4A 3H8QA 2LEGA 4MMMA 2KHPA 3TJKA 2H1BA 1XW9A 3HY2A 3ERWA 1SL0B 2A2RA 3GL5A 4PUAA 1WRYA 1A0FA 2OACA 1ILOA 4ZXGA 1M7TA 4HS1A 4FIWA 4IP1A 5GSTA 2H76A 1U88A 4K8MA 1SD8A 2CVBA 1Z6NA 2IMEA 4GWRA 4KNDA 1AAZA 2AUVA 4MABA 3LGCA 1YZXA 1B8XA 5IMDA 1K0BA 4XIHA 2HRNA 1G0TA 5GAND 3TKPA 1T4ZA 4TRXA 4DSQA 1LU4A 2VD1A 2TRCP 4JR6A 3QDNA 3M9JA 5B7CA 2M46A 1O85A 4ZL9A 2O87A 2JZSA 2F51A 3DVXA 1AXDA 2FCHA 5J4UA 4ZIJA 2HZEB 2N5BA 3O3TA 4AJ8A 2GZPA 5DBQA 5G1KA 1F3BA 1TW9A 1WE0A 2L57A 4KSOA 5CREA 3E9JB 1B9XC 5CRDA 4HU9A 5HR3A 5IQYA 3FR3A 1KTEA 1GSFA 4MZCA 2PUKC 1OC9A 1OYJA 4PQ1A 3F4TA 5E59A 2WB9A 5B8AA 1GSDA 3HYPA 3QOUA 2FA4A 1QK8A 4EL1A 3UBKA 3BBYA 5D8IA 2YCDA 3CMIA 1FVKA 2TIRA 4N0VA 3RHBA 2YV9A 2IMFA 2ON5A 1WWJA 3ME7A 1XOAA 2PBJA 4L8EA 2LNTA 3US3A 1BQ7A 4E8EA 1YDKA 3E3EA 2DJJA 1NHYA 5D9WA 2IWTA 5A5KA 1PX6A 12GSA 4RUVA 1YQ1A 3GX0A 3D22A 1OE8A 2MYGA 1JLVA 1PSQA 3DXBA 1FOVA 5HFIA 1PKZA 3EWLA 3CSHA 2H0IA 4K7NA 2R2JA 1V9WA 1JZWA 3QR6A 4ZB8A 4LL4B 1U3AA 1K0MA 4F82A 3D5JA 1T7PB 5F0GA 2PPTA 2MMAA 4RI6A 2YWOA 1GSUA 5EVOA 1QXHA 2XBQA 4GQCA 2OADA 4OCFA 2FWFA 3UJ1A 3F4SA 3FKFA 3HA9A 2HI7A 2GQMA 5G2ZA 3TKRA 4TR1A 2LJAA 2V2GA 3C1SA 3GTUB 2B1KA 1UN2A 4X0XA 1EV4A 1M0UA 4EXJA 4MJBA 3BCKA 4HI7A 2H66A 4HEA2 1ST9A 1ZCPA 1B4PA 4IKHA 2X8GA 1JLWA 5E4WA 3U6VA 2X8HA 2B6MA 4PQHA 4TOPA 1PA3A 1B4QA 5D9TA 1J08A 2PMTA 2PGTA 2L59A 3EU3A 1SK0A 4KDUA 3GSSA 4NWYA 3APQA 4Q5RA 3LSZA 4TR0A 1TI3A 3EC3A 1EZKA 2YNXA 2R5GA 1FHEA 2IMIA 2AJQB 1YEXA 4LL1B 3TRPA 4JZQA 2QKEA 2LTKA 4MPFA 1X5CA 2MMNA 2H70A 1WOUA 4DEJA 4RQRA 4YAPA 2HZFA 1PGTA 2VOCA 2HNLA 5HR1A 2PVOC 3F6FA 3K8NA 1K0OA 1AIUA 10GSA 3LYKA 3W8JA 3HJOA 3WGDA 3RBTA 4MA9A 4TXOA 4F03A 1PN9A 1QUWA 4MH3A 5A4VA 3CSIA 3J7Yb 1ZYQB 5JWRB 2BTOT 4NPBA 1SYRA 5IM9A 2LRTA 1YJ6A 5IMVA 3EURA 1AQVA 5DALB 3CRTA 3S9FA 3GUSA 4OFTA 1JZRA 1TU8A 2H73A 3UEMA 2KLXA 2H1DA 2YP6A 1J0FA 3IE3A 5J9BA 3ZYWA 3W8SA 1THXA 2CQ9A 2LS5A 4N11A 2V41A 2H0HA 3D0ZA 1ZGNA 3GKXA 1W89A 3KM6A 4J2FA 1SKSB 1SK1A 1GUMA 2E7PA 3FR6A 5H5RA 4IVFA 3QFAC 1R4WA 3KP8A 4LMWA 3VWWA 4TN8A 4JU5A 1JZDA 1GP1A 3TKSC 3ZREA 2KUCA 5B8BA 1FAAA 3P90A 3ZL5A 4ECJA 3O76A 4WR5A 2N5AA 3I69A 4I2TA 4LMVA 1AC1A 2K9FA 3DIEA 5AIXA 1LBKA 6GSYA 2CX4A 5ECRB 5ABRA 4Q5FA 4D73A 5F8BA 2FY6A 14GSA 2P31A 3HD5A 2VLTA 5H5SA 1LJRA 1AUCA 1O8XA 5HR2A 2JSYA 1HD2A 3H79A 2JACA 1SJZA 2YANA 2B7JA 1MDIA 3HVXA 5D9XA 6GSXA 3L9SA 1GUHA 5DQYA 2B7KA 4I97A 3CTGA 2GT5A 2CAQA 4POLA 4ID0A 4MF7A 6GSUA 1DUGA 3W6GA 2VCTA 5KN3A 4F0BA 1WIKA 4MJAA 1GSEA 2QSIA 2H1AA 2VL9A 1GNEA 5DDLA 4IJ3A 1GTBA 1TXXA 2HRFA 3RDWA 2WCIA 4PX1A 2OJLA 4GF0A 3J7Yk 4HU7A 1DE2A 3SWLA 2L5OA 6GSVA 3P7XA 5ID2B 1FB0A 1RW1A 2RM5A 1O6JA 3FZ4A 2O85A 2HE3A 1OKDA 1VF1A 3LORA 1TK0B 3M0FA 2KP1A 1MTCA 1ERVA 2VCVA 3LG6A 4IS0A 4MZBA 1XIYA 3LQ7A 1EV9A 4G2EA 1Z7PA 2VCZA 4HJMA 2C3QA 2REMA 5DAKA 2F8AA 3UMAA 2VCWA 2C0EA 4G19A 1GULA 3EE2A 3GX8A 4NAXA 2DJ1A 3ZITA 3KP9A 3KH9A 1BJXA 1K3LA 2GSRA 1SYXA 2WZ9A 3L9VA 3M8NA 3GN3A 2CX3A 3VWXA 5KEJA 3VI7A 20GSA 1Q4JA 1EP7A 2GSQA 5KN0A 1U87A 3F3QA 4EUYA 1NW2A 1F37A 1T4YA 2QGVA 2H01A 1K0NA 4V1Ap 2O8VB 2PERA 2CAIA 1T00A 3Q19A 5EPFA 3HHVA 1GH2A 2I9HA 2IMKA 3TDGA 4K0GA 2R6KA 2F3MA 1EP8A 4POBA 2L4CA 4FYBA 1EGOA 2GSTA 2DIZA 1PQNA
chains in the Genus database with same CATH superfamily
1X5DA 2EIRA 4O5RA 5KN2A 2BJXA 2HZEA 4HQZA 3KMNA 5DAKB 2OA7A 2FGXA 2FWEA 1K0CA 3L78A 2GDRA 3UARA 5J5NA 3EINA 5G5FA 1PD21 1GWCA 3FZAA 4GSSA 1PRXA 1GLPA 1GTUA 4ML1A 1SD9A 3DVWA 3FRCA 4K1FA 1N8JA 2QA1A 4G9HA 1S3DA 4HQSA 3ZMKA 2H30A 3Q74A 3GYKA 19GSA 1QFNA 2V6KA 3ZTLA 2CZ3A 3KZQA 4MCUA 1OC3A 3DMLA 4YH2A 4XS1A 2YZHA 3A5WA 5EL8A 1M2BA 2I3YA 2DBCA 1M9AA 1B9YC 2BMXA 3HVNA 3FHKA 1N2AA 3VFIA 3C8EA 3AY8A 1M99A 4ACSA 4LA1A 1H75A 5ECOB 4DVCA 3QCPA 3ZLPA 4TR3A 4Z2RA 5CAXA 3FK8A 1XW6A 4P3YB 1Y6EA 2DMMA 3VURA 17GSA 5DCGA 4EE0A 1TK8B 1PL1A 4O7HA 2NPBA 2WDUA 2GTUA 2IL3A 4ML6A 5FT3A 2OE1A 5GAPD 2M72A 3CQFA 1U6TA 5IMZA 4MH2A 5ECQB 3I43A 1A0RP 4IN0A 2DMLA 2FNOA 2R37A 2YOIA 1OKTA 2LSTA 1B48A 2VL2C 3NZNA 3L0HA 1VRSD 2GLRA 2V6OA 1O81A 2IFQB 1GSSA 1GNWA 2R3XA 4WR4A 1HYUA 3GTUA 3KTLA 2N5FA 1DSBA 4XTSA 5AIVA 2DLXA 3CBUA 1J9BA 4E8HA 2H75A 2YJ7A 3BD2A 4EC0A 3ED3A 4KA0A 4MJEA 2P5QA 4KB3A 5LCZA 3GFKA 3EU4A 1Z7RA 4GLTA 3IA1A 2KOKA 4Q5NA 2DKHA 3IC4A 3NOFA 1DE1A 1M2AA 5ECIB 2FWGA 1TRWA 4IP6A 3RAZA 1CQHA 2ZUPA 1TKDB 4TW5A 4POMA 1TTZA 1X9SB 5JCWA 4O5QA 4PGTA 1F3AA 2LUSA 4EDYA 3ZIJA 3WT2A 1R26A 1VF2A 3CXGA 1FVJA 4XS4B 1GSYA 3CYNA 3TKSA 1MDKA 3DWVA 4GQFA 2HLSA 5DJLA 3D4TA 2KP2A 2R0CA 4I2UA 4KF9A 3U5RE 1KBNA 2XC2A 5DJMA 1PKWA 1X9WB 3HKRA 3PGTA 4OO4A 2K6VA 5CP1A 1A2MA 4HZ4A 1A8YA 2JZTA 2V32A 3GHAA 2LJRA 4FH8A 4TR4A 2VCQA 3UIWA 1SK2A 3IBHA 5DALA 2EC4A 2H6YA 5ECSA 3IAM2 1ON4A 4KCEA 1EEMA 1FO5A 2LKUA 2FHEA 1FW1A 3GKKA 4BL7A 4EO3A 1NM3A 3KCMA 5ECKB 4WEYA 3LXTA 2MBSA 4EDZA 4IHUA 2FD3A 4PQIA 2E2GA 5ENUA 1EWXA 1VF4A 2B5XA 3CSJA 1RK4A 2P5RA 2R4VA 4NXIA 4ILFA 4KGIA 1GL8A 1I9DA 3FMWA 3TCOA 1PX7A 5EY6A 3GH9A 1AW9A 5C00A 2YN1A 5KOXA 2HXKA 4HUAA 3ERGA 5G31A 4NHWA 4X4JA 2CV4A 3TRXA 2PWJA 3CTFA 2YJHA 1F9MA 2H1GA 1AQXA 5H5QA 1YF1A 4X1UA 2WGRA 1V58A 4JEDA 1S3RA 2QC7A 2I81A 1BX9A 4O32A 4GCIA 3QFBC 13GSA 4XCSA 2RM6A 4MF5A 5J9CA 4CDOA 3I9V2 1A2LA 1QMVA 4WBRD 1HQOA 3FY7A 5FWGA 3QD9A 1XW5A 1Y25A 3H1NA 2VLUA 4KUNA 1NHOA 5COHA 3KGKA 2WJUA 2AV4A 1RQMA 2DJKA 5A4UA 2H8LA 2M80A 1GSQA 2MMOA 3KJYA 2QA2A 3EMXA 2MZCA 2GSSA 2C0FA 3KMOA 5D93A 4BVXA 1ERUA 1IYIA 3UVTA 3UOMA 1WMJA 7GSSA 3A2WA 3VPTA 3FZ5A 4L5LA 2E2MA 3GSTA 1G6YA 2XHFA 3IOSA 3PH9A 5LNKe 3MIXA 3F8UA 3Q6OA 3JCML 4V2MA 3IC8A 3ISOA 3F3RA 2YPMA 1H4OA 1ABAA 5ID2A 1F6MC 2JSZA 5B6MA 3IDVA 3GNJA 2HSHA 5ECLB 4GTUA 5ELGA 4JBBA 4TKYA 1K3YA 3IAS2 3PINA 5D9VA 2J9HA 1UA5A 4XS6A 1XVWA 2E0QA 1YKAA 2NBSA 4V1Ag 4OFNA 3Q18A 3ZIVA 2HT9A 1UC7A 4K7IA 3E0UA 2GVPA 4OD7A 4IBPA 4FO5A 2VAFA 1ERTA 1HNCA 11GSA 3G7YA 1EGRA 6GSSA 2C80A 5KN1A 3PPUA 2J23A 5KOWA 3VI5A 4BPYA 1ERWA 4MJCA 4KX4A 3WD6A 5CNWA 2F8FA 3C1RA 3TJFA 4N0ZA 5IO2A 1KNGA 5IIZA 4OFMA 2WS2A 2L5LA 1YF0A 4WF5A 3MAKA 1SJ6A 4HJ2A 4AF2A 2YZUA 3DRNA 4EF0A 3ZVJA 2A4HA 5IOWA 4GSTA 2VM2A 2OKAA 2GS3A 3GMFA 3KEBA 4O92A 1ML6A 4CHSA 2HRKA 2O7KA 2XBIA 4KSMA 5GZZB 4YQMA 2JU5A 4MF6A 2CA8A 3L9UA 2G0FA 3TGZA 3FEUA 1OAZA 1SKRB 16GSA 22GSA 1ZL9A 2WRTA 4ZB9A 1T8EB 4PTSA 2DIYA 1TOFA 2FA8A 2MMZA 1A23A 3UAPA 4MP4A 3KH7A 4ECIA 5G1LA 5HQPA 2VL2A 5AISA 3WYWA 4AJ6A 2NVLA 2VM1A 3DGQA 3WGEA 4J57E 1SL2B 2LV3A 3QPMA 2X49A 4POKA 4Q5QA 5AGYA 3ZMLA 2WFCA 4L5OA 3A2VA 4FYCA 4YQVA 4IELA 4ZBBA 4DSSB 2R0PA 3DKSA 3M3MA 5IMCA 3TOTA 3ME8A 1MD4A 1V2AA 2C3NA 3WT1A 3HVSA 4WBJA 1TJDA 1QGVA 9GSSA 3FW2A 1Z5YE 4Z2UA 1S3AA 1XWBA 2C3TA 3DD3A 4K2DA 1MDJA 1WJKA 3GH6A 1ACVA 1V57A 2RUEA 3ZZXA 1X9MB 3R2QA 1BYEA 4ECBA 3P8WA 2L6CA 1YKCA 1KEBA 4I5QA 2B5EA 2EIQA 5IMAA 3N9JA 4QQ7A 3ZVJD 2L6DA 1GLQA 3HZ8A 2XPEA 1R5AA 4BVYB 4IQAA 3GV1A 3QMXA 1VGLA 3FYGA 3HVVA 4L0WA 1EOHA 2RIIA 2H6XA 3H4KA 1URMA 4Z2TA 2IIYA 5DQSA 1MEKA 2PVQA 1FB6A 3GA4A 4TXVA 2X64A 4MDCA 4TVEA 1AQWA 3VK9A 5A4WA 2IFQA 1CQGA 1GRXA 2Z9SA 2FWHA 2HFDA 4V2NA 1PL2A 1Q98A 2AHEA 5CRHA 3P2AA 5JCUA 4A5PA 3F63A 4RI7A 1XWAA 1G6WA 1TRVA 1QQ2A 1EOGA 4FQUA 1TI1A 1PFOA 2G2QA 4J56E 2GQKA 3G7IA 1XXUA 3M1GA 2DJ3A 2A2SA 1JZOA 4YAVA 2I4AA 4K6XA 3F6DA 4G10A 3DYRA 2EIOA 1XZOA 4IW9A 2HSMA 1W4VA 3IK9A 1T1VA 1X5EA 3IHQA 4XS4A 4OCEA 4OMVA 2LNSA 2K8VA 5LD0A 1R7HA 5DCHA 1IYHA 3EYTA 3QAWA 3KXOA 2IJYA 4BWQA 4DSRA 1YY7A 4IQ1A 3DEXA 2VL3A 1M3IA 1X0RA 4K9ZA 2C1YA 3TB2A 1YEPA 2GZZA 2H0GA 3FZ9A 1R5PA 5D96A 2JL4A 4WF4A 3OR5A 2OBKA 1ZOFA 4PNGA 4ZBAA 4ZILA 5CO3A 5J3RA 1C72A 1I5GA 2JADA 3EMPA 3LXZA 3A2XA 4MPGA 1Z3EA 3TKSE 3UL3A 4ZB6A 2LRCA 1PN0A 1ZMAA 3GKMA 3KTBA 1Z9HA 2VUPA 3BOAA 5D73A 1Z6MA 1ZYPA 3RHCA 2VIMA 4K0NA 4CW9A 1BAYA 3L4NA 4OWYA 5JCGA 3APSA 3RPNA 4XRAA 3TRQA 4GXZA 1OC9B 5B6NA 2RLIA 2X8CA 4PUFC 3IXRA 4V2LA 3F0IA 2X99A 5ECMB 3UVHA 2VD0A 3CRUA 5F07A 1XWKA 2OE3A 3LYPA 5ECPB 2DJ0A 2PN8A 4L0UA 3C71A 4BIKA 2LRNA 2O89A 1NSWA 1XOBA 1XBSA 4ULXA 1O8WA 3G9BA 2PU9C 2L4QA 2DC5A 4K5SA 2DJ2A 1BG5A 2H71A 2CT6A 1MD3A 5G5EA 4MLYA 5CRWA 1TU7A 4F2IA 1A8LA 3M9KA 4JE1A 3APOA 4KE3A 3WGXA 2MBTA 3VWUA 2AB6A 5F05A 1GTAA 5C04A 3IR4A 1A24A 4HZ2A 1G7EA 5AN1A 4LLRA 3MSZA 6GSTA 1K0AA 1PMTA 1M9BA 3H93A 1DBYA 3GL3A 4GRFA 4RQXA 2A2PA 1XVQA 1HNAA 1GUKA 1A2JA 4EVMA 1OC8A 2CVDA 2FUG2 3LFLA 3UBLA 4X43A 2DKIA 3KIJA 4TR1B 4Z7XA 2AAWA 1GTIA 1ZYNA 1UVZA 2JZRA 3GKNA 2ZCTA 3TUEA 1S3CA 3I6AA 3N5OA 4NV2A 5IOXA 1JHBA 3SBCA 5BRTA 5G30A 1U3IA 1XWCA 3O6TA 1USBA 5JWOB 3C7MA 4HOJA 1E6BA 3A5IA 3IV4A 1THOA 2CVKA 3TKQA 3F4RA 5IO0A 2YV7A 2C0GA 1OE7A 3VPQA 3GRXA 5FHIA 1V98A 4WETA 5GSSA 3TJGA 4EKZA 3QAGA 4JRRA 8GSSA 18GSA 3EVIA 2FLSA 2YWMA 2VCXA 3F9UA 4NHZA 1O73A 4XHMA 3BCIA 4NV5A 4NMUA 2GQLA 3MWHA 2HYXA 3GIXA 4AGSA 5ECNB 3D4MA 5DVBA 3D21A 4TXOB 4KCAA 2B5YA 1HNBA 2GT6A 2NTOA 4MK3A 2ZNMA 4BA7A 3HJMA 4GSNA 2WULA 2HSYA 2C8UA 2GZYA 3VWVA 3HJPA 5IPGA 5ELAA 3RPPA 2VO4A 3TJJA 4MZWA 3PR8A 2TRXA 1O7UA 3QAVA 4KW6A 1TRSA 2IPAA 4G0IA 4IGJA 3IHGA 3ERFA 2XPDA 5INYA 4ZBDA 3LWAA 5HR0A 4ISDA 2LQQA 3BJ5A 1TP9A 4N10A 4WXTA 1F2EA 5BMUA 5HFKA 4YQUA 3IK7A 1XFLA 3HCZA 2YWNA 2K8SA 4F9ZA 1XWGA 1VF3A 4F0CA 4IJIA 1TK5B 4HDEA 5J41A 3MNGA 4OO5A 2ALBA 2I1UA 2H72A 5ECHB 2RUFA 2CZ2A 3V1WA 3VLNA 2NDOA 1EEJA 1V40A 3LJRA 3G7JA 3NIVA 1TDIA 4N30A 3TJBA 4DSSA 1XPVA 4K7OA 2F9SA 1BEDA 2B1LA 2AYTA 1K3OA 3A3TA 2V1MA 3ZFBA 4ZL7A 2GGTA 1WP0A 4PNFA 2IN3A 4QL7A 4ZL8A 4FYUA 4PURA 5IMFA 3IPZA 4D73B 5CRGA 1SKWB 5JWQB 2C0DA 4XRDA 5HFGA 2H19A 4H86A 4AJ7A 4I8BA 2YWIA 2ON7A 1XG8A 2IMDA 2OE0A 3MDKA 4ECCA 4WKWA 3ZFLA 2LJKA 6GSWA 1XCCA 2H74A 2K18A 1SL1B 2VLVA 3C73A 4BVYA 3ZRDA 1M2DA 1ZZYA 1G7OA 1SJIA 3FR9A 1TRUA 4QL9A 3HDCA 3IRAA 1T3BA 3TOUA 3D6IA 2C4JA 1JFUA 2H6ZA 2OBIA 4EIQA 2B3SA 1SENA 1OVNA 1K0DA 3GURA 4JR4A 1E2YA 5IPHA 1ZYEA 5L71A 4KDYA 3LEFA 1SU9A 2D2ZA 4I6XA 4CY6A 2LQOA 4KDXA 3HZ4A 4BWSA 4KAEA 2DSAA 4KH7A 3KD0A 5F06A 2P0GA 5CYYA 2A4VA 1WPIA 3HXSA 4PXOA 2ES7A 1FG4A 3H8QA 2LEGA 4MMMA 2KHPA 3TJKA 2H1BA 1XW9A 3HY2A 3ERWA 1SL0B 2A2RA 3GL5A 4PUAA 1WRYA 1A0FA 2OACA 1ILOA 4ZXGA 1M7TA 4HS1A 4FIWA 4IP1A 5GSTA 2H76A 1U88A 4K8MA 1SD8A 2CVBA 1Z6NA 2IMEA 4GWRA 4KNDA 1AAZA 2AUVA 4MABA 3LGCA 1YZXA 1B8XA 5IMDA 1K0BA 4XIHA 2HRNA 1G0TA 5GAND 3TKPA 1T4ZA 4TRXA 4DSQA 1LU4A 2VD1A 2TRCP 4JR6A 3QDNA 3M9JA 5B7CA 2M46A 1O85A 4ZL9A 2O87A 2JZSA 2F51A 4YKGA 3DVXA 1AXDA 4O5UA 2FCHA 5J4UA 4USSA 4ZIJA 2HZEB 2N5BA 3O3TA 4AJ8A 2GZPA 5DBQA 5G1KA 1F3BA 1TW9A 3R3EA 1WE0A 2L57A 4KSOA 5CREA 3E9JB 1B9XC 5CRDA 4HU9A 5HR3A 5IQYA 3FR3A 1KTEA 1GSFA 4MZCA 4HSCX 2PUKC 1OC9A 1OYJA 4CY8A 4PQ1A 3F4TA 5E59A 2WB9A 5B8AA 1GSDA 3HYPA 3QOUA 2FA4A 1QK8A 4EL1A 3UBKA 3BBYA 5D8IA 2YCDA 3CMIA 1FVKA 2TIRA 4N0VA 3RHBA 2YV9A 2IMFA 2ON5A 1WWJA 3ME7A 1XOAA 2PBJA 4L8EA 2LNTA 3US3A 1BQ7A 4E8EA 1YDKA 3E3EA 2DJJA 1NHYA 5D9WA 2IWTA 5A5KA 1PX6A 12GSA 4RUVA 1YQ1A 3GX0A 3D22A 1OE8A 2MYGA 1JLVA 1PSQA 3DXBA 1FOVA 5HFIA 1PKZA 3EWLA 3CSHA 2H0IA 4K7NA 2R2JA 1V9WA 1JZWA 3QR6A 4ZB8A 4LL4B 1U3AA 1K0MA 4F82A 3D5JA 1T7PB 5F0GA 2PPTA 2MMAA 4MNNA 4RI6A 2YWOA 1GSUA 5EVOA 1QXHA 2XBQA 4GQCA 2OADA 4OCFA 2FWFA 3UJ1A 3F4SA 3FKFA 3HA9A 2HI7A 2GQMA 5G2ZA 3TKRA 4TR1A 2LJAA 2V2GA 3C1SA 3GTUB 2B1KA 1UN2A 4X0XA 1EV4A 1M0UA 4EXJA 4MJBA 3BCKA 4HI7A 2H66A 4HEA2 1ST9A 1ZCPA 1B4PA 2HRAA 2X8GA 4IKHA 1JLWA 5E4WA 3U6VA 2X8HA 2B6MA 4PQHA 4TOPA 1PA3A 1B4QA 5D9TA 1J08A 2PMTA 2PGTA 2L59A 3EU3A 1SK0A 4KDUA 3GSSA 4NWYA 3APQA 4Q5RA 3LSZA 4TR0A 1TI3A 3EC3A 1EZKA 2YNXA 2R5GA 1FHEA 2IMIA 2AJQB 1YEXA 4LL1B 3TRPA 4JZQA 2QKEA 2LTKA 2R0GA 4MPFA 1X5CA 2MMNA 2H70A 1WOUA 4DEJA 4RQRA 4YAPA 2HZFA 1PGTA 2VOCA 2HNLA 5HR1A 2PVOC 3F6FA 3K8NA 1K0OA 1AIUA 3EPTA 10GSA 3LYKA 3W8JA 3HJOA 3WGDA 3RBTA 4MA9A 4TXOA 4F03A 1PN9A 1QUWA 4MH3A 5A4VA 3CSIA 3J7Yb 1ZYQB 5JWRB 2BTOT 4EIPA 3LW9A 4NPBA 1SYRA 5IM9A 2LRTA 1YJ6A 5IMVA 3EURA 1AQVA 5DALB 3CRTA 3S9FA 3GUSA 4OFTA 1JZRA 1TU8A 2H73A 3UEMA 2KLXA 2H1DA 2YP6A 1J0FA 3IE3A 5J9BA 3ZYWA 3W8SA 1THXA 1FOHA 2CQ9A 2LS5A 4N11A 4BL7B 2V41A 2H0HA 3D0ZA 4K5RA 1ZGNA 3GKXA 1W89A 3KM6A 4J2FA 1SKSB 1SK1A 1GUMA 2E7PA 3FR6A 5H5RA 4IVFA 3QFAC 1R4WA 3KP8A 4LMWA 3VWWA 4TN8A 4JU5A 1JZDA 1GP1A 3TKSC 3ZREA 2KUCA 5B8BA 1FAAA 3P90A 3ZL5A 4ECJA 3O76A 4WR5A 2N5AA 3I69A 4I2TA 4LMVA 1AC1A 2K9FA 3MYDA 4ICYA 3DIEA 5AIXA 1LBKA 4K2XA 6GSYA 2CX4A 5ECRB 5ABRA 4Q5FA 4D73A 5F8BA 2FY6A 14GSA 2P31A 3HD5A 2VLTA 5H5SA 1LJRA 1AUCA 1O8XA 5HR2A 2JSYA 1HD2A 3H79A 2JACA 1SJZA 2YANA 2B7JA 1MDIA 3HVXA 5D9XA 6GSXA 3L9SA 1GUHA 5DQYA 2B7KA 4I97A 3CTGA 2GT5A 4YKFA 2CAQA 4BVXB 4POLA 4ID0A 4MF7A 6GSUA 2UZ8A 1DUGA 3W6GA 2VCTA 5KN3A 4F0BA 1WIKA 4MJAA 1GSEA 2QSIA 4G0KA 2H1AA 2VL9A 1GNEA 5DDLA 4IJ3A 1GTBA 1TXXA 2X4AA 2HRFA 3RDWA 2WCIA 4PX1A 2OJLA 4GF0A 3J7Yk 4HU7A 1DE2A 3SWLA 2L5OA 6GSVA 3P7XA 5ID2B 1FB0A 1RW1A 2RM5A 1O6JA 3FZ4A 2O85A 2HE3A 1OKDA 1VF1A 3LORA 1TK0B 3M0FA 2KP1A 1MTCA 1ERVA 2VCVA 3LG6A 4IS0A 4MZBA 1XIYA 3LQ7A 1EV9A 4G2EA 1Z7PA 2VCZA 4HJMA 2C3QA 2REMA 5DAKA 2F8AA 3UMAA 2VCWA 2C0EA 4G19A 1GULA 3EE2A 3GX8A 1M3JA 4NAXA 2DJ1A 3ZITA 3KP9A 3KH9A 1BJXA 1K3LA 2GSRA 1SYXA 2WZ9A 3L9VA 3M8NA 3GN3A 2CX3A 3VWXA 5KEJA 3VI7A 20GSA 1Q4JA 1EP7A 2GSQA 5KN0A 1U87A 3F3QA 4EUYA 1NW2A 1F37A 1T4YA 2QGVA 2H01A 1K0NA 4V1Ap 2O8VB 2PERA 2CAIA 1T00A 3Q19A 5EPFA 3HHVA 1GH2A 2I9HA 2IMKA 4G0LA 3TDGA 4K0GA 2R6KA 2F3MA 1EP8A 4POBA 2L4CA 4FYBA 1EGOA 2GSTA 2DIZA 1PQNA
chains in the Genus database with same CATH topology
1X5DA 2EIRA 4O5RA 5KN2A 2BJXA 2HZEA 4HQZA 3KMNA 5DAKB 2OA7A 2FGXA 2FWEA 1K0CA 3L78A 2GDRA 3UARA 5J5NA 3EINA 5G5FA 1PD21 1GWCA 3FZAA 4GSSA 1PRXA 1GLPA 1GTUA 4ML1A 1SD9A 3DVWA 3FRCA 4K1FA 1N8JA 2QA1A 4G9HA 1S3DA 4HQSA 3ZMKA 2H30A 3Q74A 3GYKA 19GSA 1QFNA 2V6KA 3ZTLA 2CZ3A 3KZQA 4MCUA 1OC3A 3DMLA 4YH2A 4XS1A 2YZHA 3A5WA 5EL8A 1M2BA 2I3YA 2DBCA 1M9AA 1B9YC 2BMXA 3FHKA 1N2AA 3VFIA 3C8EA 3AY8A 1M99A 4ACSA 4LA1A 1H75A 5ECOB 4DVCA 3QCPA 3ZLPA 4TR3A 4Z2RA 5CAXA 3FK8A 1XW6A 4P3YB 1Y6EA 2DMMA 3VURA 17GSA 5DCGA 4EE0A 1TK8B 1PL1A 4O7HA 2NPBA 2WDUA 2GTUA 2IL3A 4ML6A 5FT3A 2OE1A 5GAPD 2M72A 1U6TA 5IMZA 4MH2A 5ECQB 3I43A 1A0RP 4IN0A 2DMLA 2FNOA 2R37A 2YOIA 1OKTA 2LSTA 1B48A 2VL2C 3NZNA 3L0HA 1VRSD 2GLRA 2V6OA 1O81A 2IFQB 1GSSA 1GNWA 2R3XA 4WR4A 1HYUA 3GTUA 3KTLA 2N5FA 1DSBA 4XTSA 5AIVA 2DLXA 3CBUA 1J9BA 4E8HA 2H75A 2YJ7A 3BD2A 4EC0A 3ED3A 4KA0A 4MJEA 2P5QA 4KB3A 5LCZA 3GFKA 3EU4A 1Z7RA 4GLTA 3IA1A 2KOKA 4Q5NA 2DKHA 3IC4A 3NOFA 1DE1A 1M2AA 5ECIB 2FWGA 1TRWA 4IP6A 3RAZA 1CQHA 2ZUPA 1TKDB 4TW5A 4POMA 1TTZA 1X9SB 5JCWA 4O5QA 4PGTA 1F3AA 2LUSA 4EDYA 3ZIJA 3WT2A 1R26A 1VF2A 3CXGA 1FVJA 4XS4B 1GSYA 3CYNA 3TKSA 1MDKA 3DWVA 4GQFA 2HLSA 5DJLA 3D4TA 2KP2A 2R0CA 4I2UA 4KF9A 3U5RE 1KBNA 2XC2A 5DJMA 1PKWA 1X9WB 3HKRA 3PGTA 4OO4A 2K6VA 5CP1A 1A2MA 4HZ4A 1A8YA 2JZTA 2V32A 3GHAA 2LJRA 4FH8A 4TR4A 2VCQA 3UIWA 1SK2A 3IBHA 5DALA 2EC4A 2H6YA 5ECSA 3IAM2 1ON4A 4KCEA 1EEMA 1FO5A 2LKUA 2FHEA 1FW1A 3GKKA 4BL7A 4EO3A 1NM3A 3KCMA 5ECKB 4WEYA 3LXTA 2MBSA 4EDZA 4IHUA 2FD3A 4PQIA 2E2GA 5ENUA 1EWXA 1VF4A 2B5XA 3CSJA 1RK4A 2P5RA 2R4VA 4NXIA 4ILFA 4KGIA 1GL8A 1I9DA 3FMWA 3TCOA 1PX7A 5EY6A 3GH9A 1AW9A 5C00A 2YN1A 5KOXA 2HXKA 4HUAA 3ERGA 5G31A 4NHWA 4X4JA 2CV4A 3TRXA 2PWJA 3CTFA 2YJHA 1F9MA 2H1GA 1AQXA 5H5QA 1YF1A 4X1UA 2WGRA 1V58A 4JEDA 2QC7A 2I81A 1BX9A 4O32A 4GCIA 3QFBC 13GSA 4XCSA 2RM6A 4MF5A 5J9CA 4CDOA 3I9V2 1A2LA 1QMVA 4WBRD 1HQOA 3FY7A 5FWGA 3QD9A 1XW5A 1Y25A 3H1NA 2VLUA 4KUNA 1NHOA 5COHA 3KGKA 2WJUA 2AV4A 1RQMA 2DJKA 5A4UA 2H8LA 2M80A 1GSQA 2MMOA 3KJYA 2QA2A 3EMXA 2MZCA 2GSSA 2C0FA 3KMOA 5D93A 4BVXA 1ERUA 1IYIA 3UVTA 3UOMA 1WMJA 7GSSA 3A2WA 3VPTA 3FZ5A 4L5LA 2E2MA 3GSTA 1G6YA 2XHFA 3IOSA 3PH9A 5LNKe 3MIXA 3F8UA 3Q6OA 3JCML 4V2MA 3IC8A 3ISOA 3F3RA 2YPMA 1H4OA 1ABAA 5ID2A 1F6MC 2JSZA 5B6MA 3IDVA 3GNJA 2HSHA 5ECLB 4GTUA 5ELGA 4JBBA 4TKYA 1K3YA 3IAS2 3PINA 5D9VA 2J9HA 1UA5A 4XS6A 1XVWA 2E0QA 1YKAA 2NBSA 4V1Ag 4OFNA 3Q18A 3ZIVA 2HT9A 1UC7A 4K7IA 3E0UA 2GVPA 4OD7A 4IBPA 4FO5A 2VAFA 1ERTA 1HNCA 11GSA 3G7YA 1EGRA 6GSSA 2C80A 5KN1A 3PPUA 2J23A 5KOWA 3VI5A 4BPYA 1ERWA 4MJCA 4KX4A 3WD6A 5CNWA 2F8FA 3C1RA 3TJFA 4N0ZA 5IO2A 1KNGA 5IIZA 4OFMA 2WS2A 2L5LA 1YF0A 4WF5A 3MAKA 1SJ6A 4HJ2A 4AF2A 2YZUA 3DRNA 4EF0A 3ZVJA 2A4HA 5IOWA 4GSTA 2VM2A 2OKAA 2GS3A 3GMFA 3KEBA 4O92A 1ML6A 4CHSA 2HRKA 2O7KA 2XBIA 4KSMA 5GZZB 4YQMA 2JU5A 4MF6A 2CA8A 3L9UA 2G0FA 3TGZA 3FEUA 1OAZA 1SKRB 16GSA 22GSA 1ZL9A 2WRTA 4ZB9A 1T8EB 4PTSA 2DIYA 1TOFA 2FA8A 2MMZA 1A23A 3UAPA 4MP4A 3KH7A 4ECIA 5G1LA 5HQPA 2VL2A 5AISA 3WYWA 4AJ6A 2NVLA 2VM1A 3DGQA 3WGEA 4J57E 1SL2B 2LV3A 3QPMA 2X49A 4POKA 4Q5QA 5AGYA 3ZMLA 2WFCA 4L5OA 3A2VA 4FYCA 4YQVA 4IELA 4ZBBA 4DSSB 2R0PA 3DKSA 3M3MA 5IMCA 3TOTA 3ME8A 1MD4A 1V2AA 2C3NA 3WT1A 3HVSA 4WBJA 1TJDA 1QGVA 9GSSA 3FW2A 1Z5YE 4Z2UA 1S3AA 1XWBA 2C3TA 3DD3A 4K2DA 1MDJA 1WJKA 3GH6A 1ACVA 1V57A 2RUEA 3ZZXA 1X9MB 3R2QA 1BYEA 4ECBA 3P8WA 2L6CA 1YKCA 1KEBA 4I5QA 2B5EA 2EIQA 5IMAA 3N9JA 4QQ7A 3ZVJD 2L6DA 1GLQA 3HZ8A 2XPEA 1R5AA 4BVYB 4IQAA 3GV1A 3QMXA 1VGLA 3FYGA 3HVVA 4L0WA 1EOHA 2RIIA 2H6XA 3H4KA 1URMA 4Z2TA 2IIYA 5DQSA 1MEKA 2PVQA 1FB6A 3GA4A 4TXVA 2X64A 4MDCA 4TVEA 1AQWA 3VK9A 5A4WA 2IFQA 1CQGA 1GRXA 2Z9SA 2FWHA 2HFDA 4V2NA 1PL2A 1Q98A 2AHEA 5CRHA 3P2AA 5JCUA 4A5PA 3F63A 4RI7A 1XWAA 1G6WA 1TRVA 1QQ2A 1EOGA 4FQUA 1TI1A 2G2QA 4J56E 2GQKA 3G7IA 1XXUA 3M1GA 2DJ3A 2A2SA 1JZOA 4YAVA 2I4AA 4K6XA 3F6DA 4G10A 3DYRA 2EIOA 1XZOA 4IW9A 2HSMA 1W4VA 3IK9A 1T1VA 1X5EA 3IHQA 4XS4A 4OCEA 4OMVA 2LNSA 2K8VA 5LD0A 1R7HA 5DCHA 1IYHA 3EYTA 3QAWA 3KXOA 2IJYA 4BWQA 4DSRA 1YY7A 4IQ1A 3DEXA 2VL3A 1X0RA 4K9ZA 2C1YA 3TB2A 1YEPA 2GZZA 2H0GA 3FZ9A 1R5PA 5D96A 2JL4A 4WF4A 3OR5A 2OBKA 1ZOFA 4PNGA 4ZBAA 4ZILA 5CO3A 5J3RA 1C72A 1I5GA 2JADA 3EMPA 3LXZA 3A2XA 4MPGA 1Z3EA 3TKSE 3UL3A 4ZB6A 2LRCA 1PN0A 1ZMAA 3GKMA 3KTBA 1Z9HA 2VUPA 3BOAA 5D73A 1Z6MA 1ZYPA 3RHCA 2VIMA 4K0NA 4CW9A 1BAYA 3L4NA 4OWYA 5JCGA 3APSA 3RPNA 4XRAA 3TRQA 4GXZA 1OC9B 5B6NA 2RLIA 2X8CA 4PUFC 3IXRA 4V2LA 3F0IA 2X99A 5ECMB 3UVHA 2VD0A 3CRUA 5F07A 1XWKA 2OE3A 3LYPA 5ECPB 2DJ0A 2PN8A 4L0UA 3C71A 2LRNA 2O89A 1NSWA 1XOBA 1XBSA 4ULXA 1O8WA 3G9BA 2PU9C 2L4QA 2DC5A 4K5SA 2DJ2A 1BG5A 2H71A 2CT6A 1MD3A 5G5EA 4MLYA 5CRWA 1TU7A 4F2IA 1A8LA 3M9KA 4JE1A 3APOA 4KE3A 3WGXA 2MBTA 3VWUA 2AB6A 5F05A 1GTAA 5C04A 3IR4A 1A24A 4HZ2A 1G7EA 5AN1A 4LLRA 3MSZA 6GSTA 1K0AA 1PMTA 1M9BA 3H93A 1DBYA 3GL3A 4GRFA 4RQXA 2A2PA 1XVQA 1HNAA 1GUKA 1A2JA 4EVMA 1OC8A 2CVDA 2FUG2 3LFLA 3UBLA 4X43A 2DKIA 3KIJA 4TR1B 4Z7XA 2AAWA 1GTIA 1ZYNA 1UVZA 2JZRA 3GKNA 2ZCTA 3TUEA 1S3CA 3I6AA 3N5OA 4NV2A 5IOXA 1JHBA 3SBCA 5BRTA 5G30A 1U3IA 1XWCA 3O6TA 1USBA 5JWOB 3C7MA 4HOJA 1E6BA 3A5IA 3IV4A 1THOA 2CVKA 3TKQA 3F4RA 5IO0A 2YV7A 2C0GA 1OE7A 3VPQA 3GRXA 5FHIA 1V98A 4WETA 5GSSA 3TJGA 4EKZA 3QAGA 4JRRA 8GSSA 18GSA 3EVIA 2FLSA 2YWMA 2VCXA 3F9UA 4NHZA 1O73A 4XHMA 3BCIA 4NV5A 4NMUA 2GQLA 3MWHA 2HYXA 3GIXA 4AGSA 5ECNB 3D4MA 5DVBA 3D21A 4TXOB 4KCAA 2B5YA 1HNBA 2GT6A 2NTOA 4MK3A 2ZNMA 4BA7A 3HJMA 4GSNA 2WULA 2HSYA 2C8UA 2GZYA 3VWVA 3HJPA 5IPGA 5ELAA 3RPPA 2VO4A 3TJJA 4MZWA 3PR8A 2TRXA 1O7UA 3QAVA 4KW6A 1TRSA 2IPAA 4G0IA 4IGJA 3IHGA 3ERFA 2XPDA 5INYA 4ZBDA 3LWAA 5HR0A 4ISDA 2LQQA 3BJ5A 1TP9A 4N10A 4WXTA 1F2EA 5BMUA 5HFKA 4YQUA 3IK7A 1XFLA 3HCZA 2YWNA 2K8SA 4F9ZA 1XWGA 1VF3A 4F0CA 4IJIA 1TK5B 4HDEA 5J41A 3MNGA 4OO5A 2ALBA 2I1UA 2H72A 5ECHB 2RUFA 2CZ2A 3V1WA 3VLNA 2NDOA 1EEJA 1V40A 3LJRA 3G7JA 3NIVA 1TDIA 4N30A 3TJBA 4DSSA 1XPVA 4K7OA 2F9SA 1BEDA 2B1LA 2AYTA 1K3OA 3A3TA 2V1MA 3ZFBA 4ZL7A 2GGTA 1WP0A 4PNFA 2IN3A 4QL7A 4ZL8A 4FYUA 4PURA 5IMFA 3IPZA 4D73B 5CRGA 1SKWB 5JWQB 2C0DA 4XRDA 5HFGA 2H19A 4H86A 4AJ7A 4I8BA 2YWIA 2ON7A 2IMDA 2OE0A 3MDKA 4ECCA 4WKWA 3ZFLA 2LJKA 6GSWA 1XCCA 2H74A 2K18A 1SL1B 2VLVA 3C73A 4BVYA 3ZRDA 1M2DA 1ZZYA 1G7OA 1SJIA 3FR9A 1TRUA 4QL9A 3HDCA 3IRAA 1T3BA 3TOUA 3D6IA 2C4JA 1JFUA 2H6ZA 2OBIA 4EIQA 2B3SA 1SENA 1OVNA 1K0DA 3GURA 4JR4A 1E2YA 5IPHA 1ZYEA 5L71A 4KDYA 3LEFA 1SU9A 2D2ZA 4I6XA 4CY6A 2LQOA 4KDXA 3HZ4A 4BWSA 4KAEA 2DSAA 4KH7A 3KD0A 5F06A 2P0GA 5CYYA 2A4VA 1WPIA 3HXSA 4PXOA 2ES7A 1FG4A 3H8QA 2LEGA 4MMMA 2KHPA 3TJKA 2H1BA 1XW9A 3HY2A 3ERWA 1SL0B 2A2RA 3GL5A 4PUAA 1WRYA 1A0FA 2OACA 1ILOA 4ZXGA 1M7TA 4HS1A 4FIWA 4IP1A 5GSTA 2H76A 1U88A 4K8MA 1SD8A 2CVBA 1Z6NA 2IMEA 4GWRA 4KNDA 1AAZA 2AUVA 4MABA 3LGCA 1YZXA 1B8XA 5IMDA 1K0BA 4XIHA 2HRNA 1G0TA 5GAND 3TKPA 1T4ZA 4TRXA 4DSQA 1LU4A 2VD1A 2TRCP 4JR6A 3QDNA 3M9JA 5B7CA 2M46A 1O85A 4ZL9A 2O87A 2JZSA 2F51A 4YKGA 3DVXA 1AXDA 4O5UA 2FCHA 5J4UA 4USSA 4ZIJA 2HZEB 2N5BA 3O3TA 4AJ8A 2GZPA 5DBQA 5G1KA 1F3BA 1TW9A 3R3EA 1WE0A 2L57A 4KSOA 5CREA 3E9JB 1B9XC 5CRDA 4HU9A 5HR3A 5IQYA 3FR3A 1KTEA 1GSFA 4MZCA 2PUKC 1OC9A 1OYJA 4CY8A 4PQ1A 3F4TA 5E59A 2WB9A 5B8AA 1GSDA 3HYPA 3QOUA 2FA4A 1QK8A 4EL1A 3UBKA 3BBYA 5D8IA 2YCDA 3CMIA 1FVKA 2TIRA 4N0VA 3RHBA 2YV9A 2IMFA 2ON5A 1WWJA 3ME7A 1XOAA 2PBJA 4L8EA 2LNTA 3US3A 1BQ7A 4E8EA 1YDKA 3E3EA 2DJJA 1NHYA 5D9WA 2IWTA 5A5KA 1PX6A 12GSA 4RUVA 1YQ1A 3GX0A 3D22A 1OE8A 2MYGA 1JLVA 1PSQA 3DXBA 1FOVA 5HFIA 1PKZA 3EWLA 3CSHA 2H0IA 4K7NA 2R2JA 1V9WA 1JZWA 3QR6A 4ZB8A 4LL4B 1U3AA 1K0MA 4F82A 3D5JA 1T7PB 5F0GA 2PPTA 2MMAA 4MNNA 4RI6A 2YWOA 1GSUA 5EVOA 1QXHA 2XBQA 4GQCA 2OADA 4OCFA 2FWFA 3UJ1A 3F4SA 3FKFA 3HA9A 2HI7A 2GQMA 5G2ZA 3TKRA 4TR1A 2LJAA 2V2GA 3C1SA 3GTUB 2B1KA 1UN2A 4X0XA 1EV4A 1M0UA 4EXJA 4MJBA 3BCKA 4HI7A 2H66A 4HEA2 1ST9A 1ZCPA 1B4PA 2HRAA 2X8GA 4IKHA 1JLWA 5E4WA 3U6VA 2X8HA 2B6MA 4PQHA 4TOPA 1PA3A 1B4QA 5D9TA 1J08A 2PMTA 2PGTA 2L59A 3EU3A 1SK0A 4KDUA 3GSSA 4NWYA 3APQA 4Q5RA 3LSZA 4TR0A 1TI3A 3EC3A 1EZKA 2YNXA 2R5GA 1FHEA 2IMIA 2AJQB 1YEXA 4LL1B 3TRPA 4JZQA 2QKEA 2LTKA 2R0GA 4MPFA 1X5CA 2MMNA 2H70A 1WOUA 4DEJA 4RQRA 4YAPA 2HZFA 1PGTA 2VOCA 2HNLA 5HR1A 2PVOC 3F6FA 3K8NA 1K0OA 1AIUA 3EPTA 10GSA 3LYKA 3W8JA 3HJOA 3WGDA 3RBTA 4MA9A 4TXOA 4F03A 1PN9A 1QUWA 4MH3A 5A4VA 3CSIA 3J7Yb 1ZYQB 5JWRB 2BTOT 4EIPA 3LW9A 4NPBA 1SYRA 5IM9A 2LRTA 1YJ6A 5IMVA 3EURA 1AQVA 5DALB 3CRTA 3S9FA 3GUSA 4OFTA 1JZRA 1TU8A 2H73A 3UEMA 2KLXA 2H1DA 2YP6A 1J0FA 3IE3A 5J9BA 3ZYWA 3W8SA 1THXA 1FOHA 2CQ9A 2LS5A 4N11A 4BL7B 2V41A 2H0HA 3D0ZA 4K5RA 1ZGNA 3GKXA 1W89A 3KM6A 4J2FA 1SKSB 1SK1A 1GUMA 2E7PA 3FR6A 5H5RA 4IVFA 3QFAC 1R4WA 3KP8A 4LMWA 3VWWA 4TN8A 4JU5A 1JZDA 1GP1A 3TKSC 3ZREA 2KUCA 5B8BA 1FAAA 3P90A 3ZL5A 4ECJA 3O76A 4WR5A 2N5AA 3I69A 4I2TA 4LMVA 1AC1A 2K9FA 3MYDA 4ICYA 3DIEA 5AIXA 1LBKA 4K2XA 6GSYA 2CX4A 5ECRB 5ABRA 4Q5FA 4D73A 5F8BA 2FY6A 14GSA 2P31A 3HD5A 2VLTA 5H5SA 1LJRA 1AUCA 1O8XA 5HR2A 2JSYA 1HD2A 3H79A 2JACA 1SJZA 2YANA 2B7JA 1MDIA 3HVXA 5D9XA 6GSXA 3L9SA 1GUHA 5DQYA 2B7KA 4I97A 3CTGA 2GT5A 4YKFA 2CAQA 4BVXB 4POLA 4ID0A 4MF7A 6GSUA 2UZ8A 1DUGA 3W6GA 2VCTA 5KN3A 4F0BA 1WIKA 4MJAA 1GSEA 2QSIA 4G0KA 2H1AA 2VL9A 1GNEA 5DDLA 4IJ3A 1GTBA 1TXXA 2X4AA 2HRFA 3RDWA 2WCIA 4PX1A 2OJLA 4GF0A 3J7Yk 4HU7A 1DE2A 3SWLA 2L5OA 6GSVA 3P7XA 5ID2B 1FB0A 1RW1A 2RM5A 1O6JA 3FZ4A 2O85A 2HE3A 1OKDA 1VF1A 3LORA 1TK0B 3M0FA 2KP1A 1MTCA 1ERVA 2VCVA 3LG6A 4IS0A 4MZBA 1XIYA 3LQ7A 1EV9A 4G2EA 1Z7PA 2VCZA 4HJMA 2C3QA 2REMA 5DAKA 2F8AA 3UMAA 2VCWA 2C0EA 4G19A 1GULA 3EE2A 3GX8A 4NAXA 2DJ1A 3ZITA 3KP9A 3KH9A 1BJXA 1K3LA 2GSRA 1SYXA 2WZ9A 3L9VA 3M8NA 3GN3A 2CX3A 3VWXA 5KEJA 3VI7A 20GSA 1Q4JA 1EP7A 2GSQA 5KN0A 1U87A 3F3QA 4EUYA 1NW2A 1F37A 1T4YA 2QGVA 2H01A 1K0NA 4V1Ap 2O8VB 2PERA 2CAIA 1T00A 3Q19A 5EPFA 3HHVA 1GH2A 2I9HA 2IMKA 4G0LA 3TDGA 4K0GA 2R6KA 2F3MA 1EP8A 4POBA 2L4CA 4FYBA 1EGOA 2GSTA 2DIZA 1PQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5D A;  2EIR A;  4O5R A;  5KN2 A;  2BJX A;  2HZE A;  4HQZ A;  3KMN A;  5DAK B;  2OA7 A;  2FGX A;  2FWE A;  1K0C A;  3L78 A;  2GDR A;  3UAR A;  5J5N A;  3EIN A;  5G5F A;  1PD2 1;  1GWC A;  3FZA A;  4GSS A;  1PRX A;  1GLP A;  1GTU A;  4ML1 A;  1SD9 A;  3DVW A;  3FRC A;  4K1F A;  1N8J A;  4G9H A;  1S3D A;  4HQS A;  3ZMK A;  2H30 A;  3Q74 A;  3GYK A;  19GS A;  1QFN A;  2V6K A;  3ZTL A;  2CZ3 A;  3KZQ A;  4MCU A;  1OC3 A;  3DML A;  4YH2 A;  4XS1 A;  2YZH A;  3A5W A;  5EL8 A;  1M2B A;  2I3Y A;  2DBC A;  1M9A A;  1B9Y C;  2BMX A;  3FHK A;  1N2A A;  3VFI A;  3C8E A;  3AY8 A;  1M99 A;  4ACS A;  4LA1 A;  1H75 A;  5ECO B;  4DVC A;  3QCP A;  3ZLP A;  4TR3 A;  5CAX A;  3FK8 A;  1XW6 A;  4P3Y B;  1Y6E A;  2DMM A;  3VUR A;  17GS A;  5DCG A;  4EE0 A;  1TK8 B;  1PL1 A;  4O7H A;  2NPB A;  2WDU A;  2GTU A;  2IL3 A;  4ML6 A;  5FT3 A;  2OE1 A;  5GAP D;  2M72 A;  1U6T A;  5IMZ A;  4MH2 A;  5ECQ B;  3I43 A;  1A0R P;  4IN0 A;  2DML A;  2FNO A;  2R37 A;  2YOI A;  1OKT A;  2LST A;  1B48 A;  2VL2 C;  3NZN A;  3L0H A;  1VRS D;  2GLR A;  2V6O A;  1O81 A;  2IFQ B;  1GSS A;  1GNW A;  2R3X A;  4WR4 A;  1HYU A;  3GTU A;  3KTL A;  2N5F A;  1DSB A;  4XTS A;  5AIV A;  2DLX A;  3CBU A;  1J9B A;  4E8H A;  2H75 A;  2YJ7 A;  3BD2 A;  4EC0 A;  3ED3 A;  4KA0 A;  4MJE A;  2P5Q A;  4KB3 A;  5LCZ A;  3GFK A;  3EU4 A;  1Z7R A;  4GLT A;  3IA1 A;  2KOK A;  4Q5N A;  3IC4 A;  3NOF A;  1DE1 A;  1M2A A;  5ECI B;  2FWG A;  1TRW A;  4IP6 A;  3RAZ A;  1CQH A;  2ZUP A;  1TKD B;  4TW5 A;  4POM A;  1TTZ A;  1X9S B;  5JCW A;  4PGT A;  1F3A A;  2LUS A;  4EDY A;  3ZIJ A;  3WT2 A;  1R26 A;  1VF2 A;  3CXG A;  1FVJ A;  4XS4 B;  1GSY A;  3CYN A;  3TKS A;  1MDK A;  3DWV A;  4GQF A;  2HLS A;  5DJL A;  3D4T A;  2KP2 A;  4I2U A;  3U5R E;  1KBN A;  2XC2 A;  5DJM A;  1PKW A;  1X9W B;  3HKR A;  3PGT A;  4OO4 A;  2K6V A;  5CP1 A;  1A2M A;  4HZ4 A;  1A8Y A;  2JZT A;  2V32 A;  3GHA A;  2LJR A;  4FH8 A;  4TR4 A;  2VCQ A;  3UIW A;  1SK2 A;  3IBH A;  5DAL A;  2EC4 A;  2H6Y A;  5ECS A;  3IAM 2;  1ON4 A;  4KCE A;  1EEM A;  1FO5 A;  2LKU A;  2FHE A;  1FW1 A;  3GKK A;  4BL7 A;  4EO3 A;  1NM3 A;  3KCM A;  5ECK B;  4WEY A;  3LXT A;  2MBS A;  4EDZ A;  4IHU A;  2FD3 A;  4PQI A;  2E2G A;  5ENU A;  1EWX A;  1VF4 A;  2B5X A;  3CSJ A;  1RK4 A;  2P5R A;  2R4V A;  4NXI A;  4ILF A;  4KGI A;  1GL8 A;  1I9D A;  3TCO A;  1PX7 A;  5EY6 A;  3GH9 A;  1AW9 A;  5C00 A;  2YN1 A;  2HXK A;  4HUA A;  3ERG A;  5G31 A;  4NHW A;  3TRX A;  2CV4 A;  2PWJ A;  3CTF A;  2YJH A;  1F9M A;  2H1G A;  1AQX A;  5H5Q A;  1YF1 A;  4X1U A;  2WGR A;  1V58 A;  4JED A;  2QC7 A;  2I81 A;  1BX9 A;  4O32 A;  4GCI A;  3QFB C;  13GS A;  4XCS A;  2RM6 A;  4MF5 A;  5J9C A;  4CDO A;  3I9V 2;  1A2L A;  1QMV A;  4WBR D;  1HQO A;  3FY7 A;  5FWG A;  3QD9 A;  1XW5 A;  1Y25 A;  3H1N A;  2VLU A;  4KUN A;  1NHO A;  5COH A;  3KGK A;  2WJU A;  2AV4 A;  1RQM A;  2DJK A;  5A4U A;  2H8L A;  2M80 A;  1GSQ A;  2MMO A;  3KJY A;  3EMX A;  2MZC A;  2GSS A;  2C0F A;  3KMO A;  5D93 A;  4BVX A;  1ERU A;  1IYI A;  3UVT A;  3UOM A;  1WMJ A;  7GSS A;  3A2W A;  3VPT A;  3FZ5 A;  4L5L A;  2E2M A;  3GST A;  1G6Y A;  2XHF A;  3IOS A;  3PH9 A;  5LNK e;  3F8U A;  3Q6O A;  3JCM L;  4V2M A;  3ISO A;  3F3R A;  2YPM A;  1H4O A;  1ABA A;  5ID2 A;  1F6M C;  2JSZ A;  5B6M A;  3IDV A;  3GNJ A;  5ECL B;  2HSH A;  4GTU A;  5ELG A;  4JBB A;  4TKY A;  1K3Y A;  3IAS 2;  3PIN A;  5D9V A;  2J9H A;  1UA5 A;  4XS6 A;  1XVW A;  2E0Q A;  1YKA A;  2NBS A;  4V1A g;  4OFN A;  3Q18 A;  3ZIV A;  2HT9 A;  1UC7 A;  4K7I A;  3E0U A;  2GVP A;  4OD7 A;  4IBP A;  4FO5 A;  2VAF A;  1ERT A;  1HNC A;  11GS A;  3G7Y A;  1EGR A;  6GSS A;  2C80 A;  5KN1 A;  2J23 A;  3VI5 A;  4BPY A;  1ERW A;  4MJC A;  4KX4 A;  3WD6 A;  5CNW A;  2F8F A;  3C1R A;  3TJF A;  4N0Z A;  5IO2 A;  1KNG A;  5IIZ A;  4OFM A;  2WS2 A;  2L5L A;  1YF0 A;  4WF5 A;  3MAK A;  1SJ6 A;  4HJ2 A;  4AF2 A;  2YZU A;  3DRN A;  4EF0 A;  3ZVJ A;  5IOW A;  4GST A;  2VM2 A;  2OKA A;  2GS3 A;  3GMF A;  3KEB A;  4O92 A;  1ML6 A;  4CHS A;  2O7K A;  2XBI A;  4KSM A;  5GZZ B;  4YQM A;  2JU5 A;  4MF6 A;  2CA8 A;  3L9U A;  2G0F A;  3TGZ A;  3FEU A;  1OAZ A;  1SKR B;  16GS A;  22GS A;  1ZL9 A;  2WRT A;  4ZB9 A;  1T8E B;  2DIY A;  1TOF A;  2FA8 A;  2MMZ A;  1A23 A;  3UAP A;  4MP4 A;  3KH7 A;  4ECI A;  5G1L A;  5HQP A;  2VL2 A;  5AIS A;  3WYW A;  4AJ6 A;  2NVL A;  2VM1 A;  3DGQ A;  3WGE A;  4J57 E;  1SL2 B;  2LV3 A;  3QPM A;  4POK A;  4Q5Q A;  5AGY A;  3ZML A;  2WFC A;  4L5O A;  3A2V A;  4FYC A;  4YQV A;  4IEL A;  4ZBB A;  4DSS B;  3DKS A;  3M3M A;  5IMC A;  3TOT A;  3ME8 A;  1MD4 A;  1V2A A;  2C3N A;  3WT1 A;  3HVS A;  4WBJ A;  1TJD A;  1QGV A;  9GSS A;  3FW2 A;  1Z5Y E;  1S3A A;  1XWB A;  2C3T A;  3DD3 A;  4K2D A;  1MDJ A;  1WJK A;  3GH6 A;  1ACV A;  1V57 A;  2RUE A;  3ZZX A;  1X9M B;  3R2Q A;  1BYE A;  4ECB A;  3P8W A;  2L6C A;  1YKC A;  1KEB A;  4I5Q A;  2B5E A;  2EIQ A;  5IMA A;  3N9J A;  4QQ7 A;  3ZVJ D;  2L6D A;  1GLQ A;  3HZ8 A;  2XPE A;  1R5A A;  4IQA A;  3GV1 A;  3QMX A;  1VGL A;  3FYG A;  3HVV A;  4L0W A;  1EOH A;  2RII A;  2H6X A;  3H4K A;  1URM A;  2IIY A;  5DQS A;  1MEK A;  2PVQ A;  1FB6 A;  3GA4 A;  4TXV A;  2X64 A;  4MDC A;  4TVE A;  1AQW A;  3VK9 A;  5A4W A;  2IFQ A;  1CQG A;  1GRX A;  2Z9S A;  2FWH A;  2HFD A;  4V2N A;  1PL2 A;  1Q98 A;  2AHE A;  5CRH A;  3P2A A;  5JCU A;  3F63 A;  4RI7 A;  1XWA A;  1G6W A;  1TRV A;  1QQ2 A;  1EOG A;  1TI1 A;  2G2Q A;  4J56 E;  2GQK A;  3G7I A;  1XXU A;  3M1G A;  2DJ3 A;  2A2S A;  1JZO A;  4YAV A;  2I4A A;  4K6X A;  3F6D A;  4G10 A;  3DYR A;  2EIO A;  1XZO A;  4IW9 A;  1W4V A;  3IK9 A;  1T1V A;  1X5E A;  3IHQ A;  4XS4 A;  4OCE A;  4OMV A;  2LNS A;  2K8V A;  5LD0 A;  1R7H A;  5DCH A;  1IYH A;  3EYT A;  3QAW A;  3KXO A;  2IJY A;  4BWQ A;  4DSR A;  1YY7 A;  4IQ1 A;  3DEX A;  2VL3 A;  1X0R A;  4K9Z A;  2C1Y A;  3TB2 A;  1YEP A;  2GZZ A;  2H0G A;  3FZ9 A;  1R5P A;  5D96 A;  2JL4 A;  4WF4 A;  3OR5 A;  2OBK A;  1ZOF A;  4PNG A;  4ZBA A;  4ZIL A;  5CO3 A;  5J3R A;  1C72 A;  1I5G A;  2JAD A;  3EMP A;  3LXZ A;  3A2X A;  4MPG A;  1Z3E A;  3TKS E;  3UL3 A;  4ZB6 A;  2LRC A;  1ZMA A;  3GKM A;  3KTB A;  1Z9H A;  2VUP A;  3BOA A;  5D73 A;  1Z6M A;  3RHC A;  2VIM A;  4K0N A;  4CW9 A;  1BAY A;  3L4N A;  4OWY A;  5JCG A;  3APS A;  3RPN A;  4XRA A;  3TRQ A;  4GXZ A;  1OC9 B;  5B6N A;  2RLI A;  2X8C A;  4PUF C;  3IXR A;  4V2L A;  3F0I A;  2X99 A;  5ECM B;  3UVH A;  2VD0 A;  3CRU A;  5F07 A;  1XWK A;  2OE3 A;  3LYP A;  5ECP B;  2DJ0 A;  2PN8 A;  4L0U A;  3C71 A;  2LRN A;  2O89 A;  1NSW A;  1XOB A;  1XBS A;  4ULX A;  1O8W A;  3G9B A;  2PU9 C;  2L4Q A;  2DC5 A;  2DJ2 A;  1BG5 A;  2H71 A;  2CT6 A;  1MD3 A;  5G5E A;  4MLY A;  5CRW A;  1TU7 A;  4F2I A;  1A8L A;  3M9K A;  4JE1 A;  3APO A;  4KE3 A;  3WGX A;  2MBT A;  3VWU A;  2AB6 A;  5F05 A;  1GTA A;  5C04 A;  3IR4 A;  1A24 A;  4HZ2 A;  1G7E A;  5AN1 A;  4LLR A;  3MSZ A;  6GST A;  1K0A A;  1PMT A;  1M9B A;  3H93 A;  1DBY A;  3GL3 A;  4GRF A;  4RQX A;  1XVQ A;  1HNA A;  1GUK A;  1A2J A;  4EVM A;  1OC8 A;  2CVD A;  2FUG 2;  3LFL A;  3UBL A;  4X43 A;  3KIJ A;  4TR1 B;  4Z7X A;  2AAW A;  1GTI A;  1UVZ A;  2JZR A;  3GKN A;  2ZCT A;  3TUE A;  1S3C A;  3I6A A;  3N5O A;  4NV2 A;  5IOX A;  1JHB A;  3SBC A;  5G30 A;  1U3I A;  1XWC A;  3O6T A;  1USB A;  5JWO B;  3C7M A;  4HOJ A;  1E6B A;  3IV4 A;  1THO A;  2CVK A;  3TKQ A;  3F4R A;  5IO0 A;  2YV7 A;  2C0G A;  1OE7 A;  3VPQ A;  3GRX A;  5FHI A;  1V98 A;  4WET A;  5GSS A;  3TJG A;  4EKZ A;  3QAG A;  4JRR A;  8GSS A;  18GS A;  3EVI A;  2FLS A;  2YWM A;  2VCX A;  3F9U A;  4NHZ A;  1O73 A;  4XHM A;  3BCI A;  4NV5 A;  4NMU A;  2GQL A;  3MWH A;  2HYX A;  3GIX A;  4AGS A;  5ECN B;  3D4M A;  5DVB A;  3D21 A;  4TXO B;  4KCA A;  2B5Y A;  1HNB A;  2GT6 A;  2NTO A;  4MK3 A;  2ZNM A;  4BA7 A;  3HJM A;  4GSN A;  2WUL A;  2HSY A;  2C8U A;  2GZY A;  3VWV A;  3HJP A;  5IPG A;  5ELA A;  3RPP A;  2VO4 A;  3TJJ A;  4MZW A;  3PR8 A;  2TRX A;  1O7U A;  3QAV A;  1TRS A;  2IPA A;  4KW6 A;  4IGJ A;  3ERF A;  2XPD A;  5INY A;  4ZBD A;  3LWA A;  5HR0 A;  4ISD A;  2LQQ A;  3BJ5 A;  1TP9 A;  4N10 A;  4WXT A;  1F2E A;  5HFK A;  4YQU A;  3IK7 A;  1XFL A;  3HCZ A;  2YWN A;  2K8S A;  4F9Z A;  1XWG A;  1VF3 A;  4F0C A;  4IJI A;  1TK5 B;  4HDE A;  5J41 A;  3MNG A;  4OO5 A;  2ALB A;  2I1U A;  2H72 A;  5ECH B;  2RUF A;  2CZ2 A;  3V1W A;  3VLN A;  2NDO A;  1EEJ A;  1V40 A;  3LJR A;  3G7J A;  3NIV A;  1TDI A;  4N30 A;  3TJB A;  4DSS A;  1XPV A;  4K7O A;  2F9S A;  1BED A;  2B1L A;  2AYT A;  1K3O A;  3A3T A;  2V1M A;  3ZFB A;  4ZL7 A;  2GGT A;  1WP0 A;  4PNF A;  2IN3 A;  4QL7 A;  4ZL8 A;  4FYU A;  4PUR A;  5IMF A;  3IPZ A;  4D73 B;  5CRG A;  1SKW B;  5JWQ B;  2C0D A;  4XRD A;  5HFG A;  2H19 A;  4H86 A;  4AJ7 A;  4I8B A;  2YWI A;  2ON7 A;  2IMD A;  2OE0 A;  3MDK A;  4ECC A;  4WKW A;  3ZFL A;  2LJK A;  6GSW A;  1XCC A;  2H74 A;  2K18 A;  1SL1 B;  2VLV A;  3C73 A;  4BVY A;  3ZRD A;  1M2D A;  1ZZY A;  1G7O A;  1SJI A;  3FR9 A;  1TRU A;  4QL9 A;  3HDC A;  3IRA A;  1T3B A;  3TOU A;  3D6I A;  2C4J A;  1JFU A;  2H6Z A;  2OBI A;  2B3S A;  1SEN A;  1OVN A;  1K0D A;  3GUR A;  4JR4 A;  1E2Y A;  5IPH A;  1ZYE A;  5L71 A;  4KDY A;  3LEF A;  1SU9 A;  2D2Z A;  4I6X A;  2LQO A;  4KDX A;  3HZ4 A;  4BWS A;  4KAE A;  2DSA A;  4KH7 A;  3KD0 A;  5F06 A;  2P0G A;  5CYY A;  2A4V A;  1WPI A;  3HXS A;  4PXO A;  2ES7 A;  1FG4 A;  3H8Q A;  2LEG A;  4MMM A;  2KHP A;  3TJK A;  2H1B A;  1XW9 A;  3HY2 A;  3ERW A;  1SL0 B;  2A2R A;  3GL5 A;  4PUA A;  1WRY A;  1A0F A;  2OAC A;  1ILO A;  4ZXG A;  1M7T A;  4HS1 A;  4FIW A;  4IP1 A;  5GST A;  2H76 A;  1U88 A;  4K8M A;  1SD8 A;  2CVB A;  1Z6N A;  2IME A;  4GWR A;  4KND A;  1AAZ A;  2AUV A;  4MAB A;  3LGC A;  1YZX A;  1B8X A;  5IMD A;  1K0B A;  4XIH A;  2HRN A;  1G0T A;  5GAN D;  3TKP A;  1T4Z A;  4TRX A;  4DSQ A;  1LU4 A;  2VD1 A;  2TRC P;  4JR6 A;  3QDN A;  3M9J A;  5B7C A;  2M46 A;  1O85 A;  4ZL9 A;  2O87 A;  2JZS A;  2F51 A;  3DVX A;  1AXD A;  2FCH A;  5J4U A;  4ZIJ A;  2HZE B;  2N5B A;  3O3T A;  4AJ8 A;  2GZP A;  5DBQ A;  5G1K A;  1F3B A;  1TW9 A;  1WE0 A;  2L57 A;  4KSO A;  5CRE A;  3E9J B;  1B9X C;  5CRD A;  4HU9 A;  5HR3 A;  5IQY A;  3FR3 A;  1KTE A;  1GSF A;  4MZC A;  2PUK C;  1OC9 A;  1OYJ A;  4PQ1 A;  3F4T A;  5E59 A;  2WB9 A;  5B8A A;  1GSD A;  3HYP A;  3QOU A;  2FA4 A;  1QK8 A;  4EL1 A;  3UBK A;  3BBY A;  5D8I A;  2YCD A;  3CMI A;  1FVK A;  2TIR A;  4N0V A;  3RHB A;  2YV9 A;  2IMF A;  2ON5 A;  1WWJ A;  3ME7 A;  1XOA A;  2PBJ A;  4L8E A;  2LNT A;  3US3 A;  1BQ7 A;  4E8E A;  1YDK A;  3E3E A;  2DJJ A;  1NHY A;  5D9W A;  2IWT A;  5A5K A;  1PX6 A;  12GS A;  4RUV A;  1YQ1 A;  3GX0 A;  3D22 A;  1OE8 A;  2MYG A;  1JLV A;  1PSQ A;  3DXB A;  1FOV A;  5HFI A;  1PKZ A;  3EWL A;  3CSH A;  2H0I A;  4K7N A;  2R2J A;  1V9W A;  1JZW A;  3QR6 A;  4ZB8 A;  4LL4 B;  1U3A A;  1K0M A;  4F82 A;  3D5J A;  1T7P B;  5F0G A;  2PPT A;  2MMA A;  4RI6 A;  2YWO A;  1GSU A;  5EVO A;  1QXH A;  2XBQ A;  4GQC A;  2OAD A;  4OCF A;  2FWF A;  3UJ1 A;  3F4S A;  3FKF A;  3HA9 A;  2HI7 A;  2GQM A;  5G2Z A;  3TKR A;  4TR1 A;  2LJA A;  2V2G A;  3C1S A;  3GTU B;  2B1K A;  1UN2 A;  4X0X A;  1EV4 A;  1M0U A;  4EXJ A;  4MJB A;  3BCK A;  4HI7 A;  2H66 A;  4HEA 2;  1ST9 A;  1ZCP A;  1B4P A;  4IKH A;  2X8G A;  1JLW A;  5E4W A;  3U6V A;  2X8H A;  2B6M A;  4PQH A;  4TOP A;  1PA3 A;  1B4Q A;  5D9T A;  1J08 A;  2PMT A;  2PGT A;  2L59 A;  3EU3 A;  1SK0 A;  4KDU A;  3GSS A;  4NWY A;  3APQ A;  4Q5R A;  3LSZ A;  4TR0 A;  1TI3 A;  3EC3 A;  1EZK A;  2YNX A;  2R5G A;  1FHE A;  2IMI A;  2AJQ B;  1YEX A;  4LL1 B;  3TRP A;  4JZQ A;  2QKE A;  2LTK A;  4MPF A;  1X5C A;  2MMN A;  2H70 A;  1WOU A;  4DEJ A;  4RQR A;  4YAP A;  2HZF A;  1PGT A;  2VOC A;  2HNL A;  5HR1 A;  2PVO C;  3F6F A;  3K8N A;  1K0O A;  1AIU A;  10GS A;  3LYK A;  3W8J A;  3HJO A;  3WGD A;  3RBT A;  4MA9 A;  4TXO A;  4F03 A;  1PN9 A;  1QUW A;  4MH3 A;  5A4V A;  3CSI A;  3J7Y b;  1ZYQ B;  5JWR B;  2BTO T;  4NPB A;  1SYR A;  5IM9 A;  2LRT A;  1YJ6 A;  5IMV A;  3EUR A;  1AQV A;  5DAL B;  3CRT A;  3S9F A;  3GUS A;  4OFT A;  1JZR A;  1TU8 A;  2H73 A;  3UEM A;  2KLX A;  2H1D A;  2YP6 A;  1J0F A;  3IE3 A;  5J9B A;  3ZYW A;  3W8S A;  1THX A;  2CQ9 A;  2LS5 A;  4N11 A;  2V41 A;  2H0H A;  3D0Z A;  1ZGN A;  3GKX A;  1W89 A;  3KM6 A;  4J2F A;  1SKS B;  1SK1 A;  1GUM A;  2E7P A;  3FR6 A;  5H5R A;  4IVF A;  3QFA C;  1R4W A;  3KP8 A;  4LMW A;  3VWW A;  4TN8 A;  4JU5 A;  1JZD A;  1GP1 A;  3TKS C;  3ZRE A;  2KUC A;  5B8B A;  1FAA A;  3P90 A;  3ZL5 A;  4ECJ A;  3O76 A;  4WR5 A;  2N5A A;  3I69 A;  4I2T A;  4LMV A;  1AC1 A;  2K9F A;  3DIE A;  5AIX A;  1LBK A;  6GSY A;  2CX4 A;  5ECR B;  5ABR A;  4Q5F A;  4D73 A;  5F8B A;  2FY6 A;  14GS A;  2P31 A;  3HD5 A;  2VLT A;  5H5S A;  1LJR A;  1AUC A;  1O8X A;  5HR2 A;  2JSY A;  1HD2 A;  3H79 A;  2JAC A;  1SJZ A;  2YAN A;  2B7J A;  1MDI A;  3HVX A;  5D9X A;  6GSX A;  3L9S A;  1GUH A;  5DQY A;  2B7K A;  4I97 A;  3CTG A;  2GT5 A;  2CAQ A;  4POL A;  4ID0 A;  4MF7 A;  6GSU A;  1DUG A;  3W6G A;  2VCT A;  5KN3 A;  4F0B A;  1WIK A;  4MJA A;  1GSE A;  2QSI A;  2H1A A;  2VL9 A;  1GNE A;  5DDL A;  4IJ3 A;  1GTB A;  1TXX A;  2HRF A;  3RDW A;  2WCI A;  4PX1 A;  2OJL A;  4GF0 A;  3J7Y k;  4HU7 A;  1DE2 A;  3SWL A;  2L5O A;  6GSV A;  3P7X A;  5ID2 B;  1FB0 A;  1RW1 A;  2RM5 A;  1O6J A;  3FZ4 A;  2O85 A;  2HE3 A;  1OKD A;  1VF1 A;  3LOR A;  1TK0 B;  3M0F A;  2KP1 A;  1MTC A;  1ERV A;  2VCV A;  3LG6 A;  4IS0 A;  4MZB A;  1XIY A;  3LQ7 A;  1EV9 A;  4G2E A;  1Z7P A;  2VCZ A;  4HJM A;  2C3Q A;  2REM A;  5DAK A;  2F8A A;  3UMA A;  2VCW A;  2C0E A;  4G19 A;  1GUL A;  3EE2 A;  3GX8 A;  4NAX A;  2DJ1 A;  3ZIT A;  3KP9 A;  3KH9 A;  1BJX A;  1K3L A;  2GSR A;  1SYX A;  2WZ9 A;  3L9V A;  3M8N A;  3GN3 A;  2CX3 A;  3VWX A;  5KEJ A;  3VI7 A;  20GS A;  1Q4J A;  1EP7 A;  2GSQ A;  5KN0 A;  1U87 A;  3F3Q A;  4EUY A;  1NW2 A;  1F37 A;  1T4Y A;  2QGV A;  2H01 A;  1K0N A;  4V1A p;  2O8V B;  2PER A;  2CAI A;  1T00 A;  3Q19 A;  5EPF A;  3HHV A;  1GH2 A;  2I9H A;  2IMK A;  3TDG A;  4K0G A;  2R6K A;  2F3M A;  1EP8 A;  4POB A;  2L4C A;  4FYB A;  1EGO A;  2GST A;  2DIZ A;  1PQN A; 
#chains in the Genus database with same CATH topology
 1X5D A;  2EIR A;  4O5R A;  5KN2 A;  2BJX A;  2HZE A;  4HQZ A;  3KMN A;  5DAK B;  2OA7 A;  2FGX A;  2FWE A;  1K0C A;  3L78 A;  2GDR A;  3UAR A;  5J5N A;  3EIN A;  5G5F A;  1PD2 1;  1GWC A;  3FZA A;  4GSS A;  1PRX A;  1GLP A;  1GTU A;  4ML1 A;  1SD9 A;  3DVW A;  3FRC A;  4K1F A;  1N8J A;  2QA1 A;  4G9H A;  1S3D A;  4HQS A;  3ZMK A;  2H30 A;  3Q74 A;  3GYK A;  19GS A;  1QFN A;  2V6K A;  3ZTL A;  2CZ3 A;  3KZQ A;  4MCU A;  1OC3 A;  3DML A;  4YH2 A;  4XS1 A;  2YZH A;  3A5W A;  5EL8 A;  1M2B A;  2I3Y A;  2DBC A;  1M9A A;  1B9Y C;  2BMX A;  3HVN A;  3FHK A;  1N2A A;  3VFI A;  3C8E A;  3AY8 A;  1M99 A;  4ACS A;  4LA1 A;  1H75 A;  5ECO B;  4DVC A;  3QCP A;  3ZLP A;  4TR3 A;  4Z2R A;  5CAX A;  3FK8 A;  1XW6 A;  4P3Y B;  1Y6E A;  2DMM A;  3VUR A;  17GS A;  5DCG A;  4EE0 A;  1TK8 B;  1PL1 A;  4O7H A;  2NPB A;  2WDU A;  2GTU A;  2IL3 A;  4ML6 A;  5FT3 A;  2OE1 A;  5GAP D;  2M72 A;  3CQF A;  1U6T A;  5IMZ A;  4MH2 A;  5ECQ B;  3I43 A;  1A0R P;  4IN0 A;  2DML A;  2FNO A;  2R37 A;  2YOI A;  1OKT A;  2LST A;  1B48 A;  2VL2 C;  3NZN A;  3L0H A;  1VRS D;  2GLR A;  2V6O A;  1O81 A;  2IFQ B;  1GSS A;  1GNW A;  2R3X A;  4WR4 A;  1HYU A;  3GTU A;  3KTL A;  2N5F A;  1DSB A;  4XTS A;  5AIV A;  2DLX A;  3CBU A;  1J9B A;  4E8H A;  2H75 A;  2YJ7 A;  3BD2 A;  4EC0 A;  3ED3 A;  4KA0 A;  4MJE A;  2P5Q A;  4KB3 A;  5LCZ A;  3GFK A;  3EU4 A;  1Z7R A;  4GLT A;  3IA1 A;  2KOK A;  4Q5N A;  2DKH A;  3IC4 A;  3NOF A;  1DE1 A;  1M2A A;  5ECI B;  2FWG A;  1TRW A;  4IP6 A;  3RAZ A;  1CQH A;  2ZUP A;  1TKD B;  4TW5 A;  4POM A;  1TTZ A;  1X9S B;  5JCW A;  4O5Q A;  4PGT A;  1F3A A;  2LUS A;  4EDY A;  3ZIJ A;  3WT2 A;  1R26 A;  1VF2 A;  3CXG A;  1FVJ A;  4XS4 B;  1GSY A;  3CYN A;  3TKS A;  1MDK A;  3DWV A;  4GQF A;  2HLS A;  5DJL A;  3D4T A;  2KP2 A;  2R0C A;  4I2U A;  4KF9 A;  3U5R E;  1KBN A;  2XC2 A;  5DJM A;  1PKW A;  1X9W B;  3HKR A;  3PGT A;  4OO4 A;  2K6V A;  5CP1 A;  1A2M A;  4HZ4 A;  1A8Y A;  2JZT A;  2V32 A;  3GHA A;  2LJR A;  4FH8 A;  4TR4 A;  2VCQ A;  3UIW A;  1SK2 A;  3IBH A;  5DAL A;  2EC4 A;  2H6Y A;  5ECS A;  3IAM 2;  1ON4 A;  4KCE A;  1EEM A;  1FO5 A;  2LKU A;  2FHE A;  1FW1 A;  3GKK A;  4BL7 A;  4EO3 A;  1NM3 A;  3KCM A;  5ECK B;  4WEY A;  3LXT A;  2MBS A;  4EDZ A;  4IHU A;  2FD3 A;  4PQI A;  2E2G A;  5ENU A;  1EWX A;  1VF4 A;  2B5X A;  3CSJ A;  1RK4 A;  2P5R A;  2R4V A;  4NXI A;  4ILF A;  4KGI A;  1GL8 A;  1I9D A;  3FMW A;  3TCO A;  1PX7 A;  5EY6 A;  3GH9 A;  1AW9 A;  5C00 A;  2YN1 A;  5KOX A;  2HXK A;  4HUA A;  3ERG A;  5G31 A;  4NHW A;  4X4J A;  2CV4 A;  3TRX A;  2PWJ A;  3CTF A;  2YJH A;  1F9M A;  2H1G A;  1AQX A;  5H5Q A;  1YF1 A;  4X1U A;  2WGR A;  1V58 A;  4JED A;  1S3R A;  2QC7 A;  2I81 A;  1BX9 A;  4O32 A;  4GCI A;  3QFB C;  13GS A;  4XCS A;  2RM6 A;  4MF5 A;  5J9C A;  4CDO A;  3I9V 2;  1A2L A;  1QMV A;  4WBR D;  1HQO A;  3FY7 A;  5FWG A;  3QD9 A;  1XW5 A;  1Y25 A;  3H1N A;  2VLU A;  4KUN A;  1NHO A;  5COH A;  3KGK A;  2WJU A;  2AV4 A;  1RQM A;  2DJK A;  5A4U A;  2H8L A;  2M80 A;  1GSQ A;  2MMO A;  3KJY A;  2QA2 A;  3EMX A;  2MZC A;  2GSS A;  2C0F A;  3KMO A;  5D93 A;  4BVX A;  1ERU A;  1IYI A;  3UVT A;  3UOM A;  1WMJ A;  7GSS A;  3A2W A;  3VPT A;  3FZ5 A;  4L5L A;  2E2M A;  3GST A;  1G6Y A;  2XHF A;  3IOS A;  3PH9 A;  5LNK e;  3MIX A;  3F8U A;  3Q6O A;  3JCM L;  4V2M A;  3IC8 A;  3ISO A;  3F3R A;  2YPM A;  1H4O A;  1ABA A;  5ID2 A;  1F6M C;  2JSZ A;  5B6M A;  3IDV A;  3GNJ A;  2HSH A;  5ECL B;  4GTU A;  5ELG A;  4JBB A;  4TKY A;  1K3Y A;  3IAS 2;  3PIN A;  5D9V A;  2J9H A;  1UA5 A;  4XS6 A;  1XVW A;  2E0Q A;  1YKA A;  2NBS A;  4V1A g;  4OFN A;  3Q18 A;  3ZIV A;  2HT9 A;  1UC7 A;  4K7I A;  3E0U A;  2GVP A;  4OD7 A;  4IBP A;  4FO5 A;  2VAF A;  1ERT A;  1HNC A;  11GS A;  3G7Y A;  1EGR A;  6GSS A;  2C80 A;  5KN1 A;  3PPU A;  2J23 A;  5KOW A;  3VI5 A;  4BPY A;  1ERW A;  4MJC A;  4KX4 A;  3WD6 A;  5CNW A;  2F8F A;  3C1R A;  3TJF A;  4N0Z A;  5IO2 A;  1KNG A;  5IIZ A;  4OFM A;  2WS2 A;  2L5L A;  1YF0 A;  4WF5 A;  3MAK A;  1SJ6 A;  4HJ2 A;  4AF2 A;  2YZU A;  3DRN A;  4EF0 A;  3ZVJ A;  2A4H A;  5IOW A;  4GST A;  2VM2 A;  2OKA A;  2GS3 A;  3GMF A;  3KEB A;  4O92 A;  1ML6 A;  4CHS A;  2HRK A;  2O7K A;  2XBI A;  4KSM A;  5GZZ B;  4YQM A;  2JU5 A;  4MF6 A;  2CA8 A;  3L9U A;  2G0F A;  3TGZ A;  3FEU A;  1OAZ A;  1SKR B;  16GS A;  22GS A;  1ZL9 A;  2WRT A;  4ZB9 A;  1T8E B;  4PTS A;  2DIY A;  1TOF A;  2FA8 A;  2MMZ A;  1A23 A;  3UAP A;  4MP4 A;  3KH7 A;  4ECI A;  5G1L A;  5HQP A;  2VL2 A;  5AIS A;  3WYW A;  4AJ6 A;  2NVL A;  2VM1 A;  3DGQ A;  3WGE A;  4J57 E;  1SL2 B;  2LV3 A;  3QPM A;  2X49 A;  4POK A;  4Q5Q A;  5AGY A;  3ZML A;  2WFC A;  4L5O A;  3A2V A;  4FYC A;  4YQV A;  4IEL A;  4ZBB A;  4DSS B;  2R0P A;  3DKS A;  3M3M A;  5IMC A;  3TOT A;  3ME8 A;  1MD4 A;  1V2A A;  2C3N A;  3WT1 A;  3HVS A;  4WBJ A;  1TJD A;  1QGV A;  9GSS A;  3FW2 A;  1Z5Y E;  4Z2U A;  1S3A A;  1XWB A;  2C3T A;  3DD3 A;  4K2D A;  1MDJ A;  1WJK A;  3GH6 A;  1ACV A;  1V57 A;  2RUE A;  3ZZX A;  1X9M B;  3R2Q A;  1BYE A;  4ECB A;  3P8W A;  2L6C A;  1YKC A;  1KEB A;  4I5Q A;  2B5E A;  2EIQ A;  5IMA A;  3N9J A;  4QQ7 A;  3ZVJ D;  2L6D A;  1GLQ A;  3HZ8 A;  2XPE A;  1R5A A;  4BVY B;  4IQA A;  3GV1 A;  3QMX A;  1VGL A;  3FYG A;  3HVV A;  4L0W A;  1EOH A;  2RII A;  2H6X A;  3H4K A;  1URM A;  4Z2T A;  2IIY A;  5DQS A;  1MEK A;  2PVQ A;  1FB6 A;  3GA4 A;  4TXV A;  2X64 A;  4MDC A;  4TVE A;  1AQW A;  3VK9 A;  5A4W A;  2IFQ A;  1CQG A;  1GRX A;  2Z9S A;  2FWH A;  2HFD A;  4V2N A;  1PL2 A;  1Q98 A;  2AHE A;  5CRH A;  3P2A A;  5JCU A;  4A5P A;  3F63 A;  4RI7 A;  1XWA A;  1G6W A;  1TRV A;  1QQ2 A;  1EOG A;  4FQU A;  1TI1 A;  1PFO A;  2G2Q A;  4J56 E;  2GQK A;  3G7I A;  1XXU A;  3M1G A;  2DJ3 A;  2A2S A;  1JZO A;  4YAV A;  2I4A A;  4K6X A;  3F6D A;  4G10 A;  3DYR A;  2EIO A;  1XZO A;  4IW9 A;  2HSM A;  1W4V A;  3IK9 A;  1T1V A;  1X5E A;  3IHQ A;  4XS4 A;  4OCE A;  4OMV A;  2LNS A;  2K8V A;  5LD0 A;  1R7H A;  5DCH A;  1IYH A;  3EYT A;  3QAW A;  3KXO A;  2IJY A;  4BWQ A;  4DSR A;  1YY7 A;  4IQ1 A;  3DEX A;  2VL3 A;  1M3I A;  1X0R A;  4K9Z A;  2C1Y A;  3TB2 A;  1YEP A;  2GZZ A;  2H0G A;  3FZ9 A;  1R5P A;  5D96 A;  2JL4 A;  4WF4 A;  3OR5 A;  2OBK A;  1ZOF A;  4PNG A;  4ZBA A;  4ZIL A;  5CO3 A;  5J3R A;  1C72 A;  1I5G A;  2JAD A;  3EMP A;  3LXZ A;  3A2X A;  4MPG A;  1Z3E A;  3TKS E;  3UL3 A;  4ZB6 A;  2LRC A;  1PN0 A;  1ZMA A;  3GKM A;  3KTB A;  1Z9H A;  2VUP A;  3BOA A;  5D73 A;  1Z6M A;  1ZYP A;  3RHC A;  2VIM A;  4K0N A;  4CW9 A;  1BAY A;  3L4N A;  4OWY A;  5JCG A;  3APS A;  3RPN A;  4XRA A;  3TRQ A;  4GXZ A;  1OC9 B;  5B6N A;  2RLI A;  2X8C A;  4PUF C;  3IXR A;  4V2L A;  3F0I A;  2X99 A;  5ECM B;  3UVH A;  2VD0 A;  3CRU A;  5F07 A;  1XWK A;  2OE3 A;  3LYP A;  5ECP B;  2DJ0 A;  2PN8 A;  4L0U A;  3C71 A;  4BIK A;  2LRN A;  2O89 A;  1NSW A;  1XOB A;  1XBS A;  4ULX A;  1O8W A;  3G9B A;  2PU9 C;  2L4Q A;  2DC5 A;  4K5S A;  2DJ2 A;  1BG5 A;  2H71 A;  2CT6 A;  1MD3 A;  5G5E A;  4MLY A;  5CRW A;  1TU7 A;  4F2I A;  1A8L A;  3M9K A;  4JE1 A;  3APO A;  4KE3 A;  3WGX A;  2MBT A;  3VWU A;  2AB6 A;  5F05 A;  1GTA A;  5C04 A;  3IR4 A;  1A24 A;  4HZ2 A;  1G7E A;  5AN1 A;  4LLR A;  3MSZ A;  6GST A;  1K0A A;  1PMT A;  1M9B A;  3H93 A;  1DBY A;  3GL3 A;  4GRF A;  4RQX A;  2A2P A;  1XVQ A;  1HNA A;  1GUK A;  1A2J A;  4EVM A;  1OC8 A;  2CVD A;  2FUG 2;  3LFL A;  3UBL A;  4X43 A;  2DKI A;  3KIJ A;  4TR1 B;  4Z7X A;  2AAW A;  1GTI A;  1ZYN A;  1UVZ A;  2JZR A;  3GKN A;  2ZCT A;  3TUE A;  1S3C A;  3I6A A;  3N5O A;  4NV2 A;  5IOX A;  1JHB A;  3SBC A;  5BRT A;  5G30 A;  1U3I A;  1XWC A;  3O6T A;  1USB A;  5JWO B;  3C7M A;  4HOJ A;  1E6B A;  3A5I A;  3IV4 A;  1THO A;  2CVK A;  3TKQ A;  3F4R A;  5IO0 A;  2YV7 A;  2C0G A;  1OE7 A;  3VPQ A;  3GRX A;  5FHI A;  1V98 A;  4WET A;  5GSS A;  3TJG A;  4EKZ A;  3QAG A;  4JRR A;  8GSS A;  18GS A;  3EVI A;  2FLS A;  2YWM A;  2VCX A;  3F9U A;  4NHZ A;  1O73 A;  4XHM A;  3BCI A;  4NV5 A;  4NMU A;  2GQL A;  3MWH A;  2HYX A;  3GIX A;  4AGS A;  5ECN B;  3D4M A;  5DVB A;  3D21 A;  4TXO B;  4KCA A;  2B5Y A;  1HNB A;  2GT6 A;  2NTO A;  4MK3 A;  2ZNM A;  4BA7 A;  3HJM A;  4GSN A;  2WUL A;  2HSY A;  2C8U A;  2GZY A;  3VWV A;  3HJP A;  5IPG A;  5ELA A;  3RPP A;  2VO4 A;  3TJJ A;  4MZW A;  3PR8 A;  2TRX A;  1O7U A;  3QAV A;  4KW6 A;  1TRS A;  2IPA A;  4G0I A;  4IGJ A;  3IHG A;  3ERF A;  2XPD A;  5INY A;  4ZBD A;  3LWA A;  5HR0 A;  4ISD A;  2LQQ A;  3BJ5 A;  1TP9 A;  4N10 A;  4WXT A;  1F2E A;  5BMU A;  5HFK A;  4YQU A;  3IK7 A;  1XFL A;  3HCZ A;  2YWN A;  2K8S A;  4F9Z A;  1XWG A;  1VF3 A;  4F0C A;  4IJI A;  1TK5 B;  4HDE A;  5J41 A;  3MNG A;  4OO5 A;  2ALB A;  2I1U A;  2H72 A;  5ECH B;  2RUF A;  2CZ2 A;  3V1W A;  3VLN A;  2NDO A;  1EEJ A;  1V40 A;  3LJR A;  3G7J A;  3NIV A;  1TDI A;  4N30 A;  3TJB A;  4DSS A;  1XPV A;  4K7O A;  2F9S A;  1BED A;  2B1L A;  2AYT A;  1K3O A;  3A3T A;  2V1M A;  3ZFB A;  4ZL7 A;  2GGT A;  1WP0 A;  4PNF A;  2IN3 A;  4QL7 A;  4ZL8 A;  4FYU A;  4PUR A;  5IMF A;  3IPZ A;  4D73 B;  5CRG A;  1SKW B;  5JWQ B;  2C0D A;  4XRD A;  5HFG A;  2H19 A;  4H86 A;  4AJ7 A;  4I8B A;  2YWI A;  2ON7 A;  1XG8 A;  2IMD A;  2OE0 A;  3MDK A;  4ECC A;  4WKW A;  3ZFL A;  2LJK A;  6GSW A;  1XCC A;  2H74 A;  2K18 A;  1SL1 B;  2VLV A;  3C73 A;  4BVY A;  3ZRD A;  1M2D A;  1ZZY A;  1G7O A;  1SJI A;  3FR9 A;  1TRU A;  4QL9 A;  3HDC A;  3IRA A;  1T3B A;  3TOU A;  3D6I A;  2C4J A;  1JFU A;  2H6Z A;  2OBI A;  4EIQ A;  2B3S A;  1SEN A;  1OVN A;  1K0D A;  3GUR A;  4JR4 A;  1E2Y A;  5IPH A;  1ZYE A;  5L71 A;  4KDY A;  3LEF A;  1SU9 A;  2D2Z A;  4I6X A;  4CY6 A;  2LQO A;  4KDX A;  3HZ4 A;  4BWS A;  4KAE A;  2DSA A;  4KH7 A;  3KD0 A;  5F06 A;  2P0G A;  5CYY A;  2A4V A;  1WPI A;  3HXS A;  4PXO A;  2ES7 A;  1FG4 A;  3H8Q A;  2LEG A;  4MMM A;  2KHP A;  3TJK A;  2H1B A;  1XW9 A;  3HY2 A;  3ERW A;  1SL0 B;  2A2R A;  3GL5 A;  4PUA A;  1WRY A;  1A0F A;  2OAC A;  1ILO A;  4ZXG A;  1M7T A;  4HS1 A;  4FIW A;  4IP1 A;  5GST A;  2H76 A;  1U88 A;  4K8M A;  1SD8 A;  2CVB A;  1Z6N A;  2IME A;  4GWR A;  4KND A;  1AAZ A;  2AUV A;  4MAB A;  3LGC A;  1YZX A;  1B8X A;  5IMD A;  1K0B A;  4XIH A;  2HRN A;  1G0T A;  5GAN D;  3TKP A;  1T4Z A;  4TRX A;  4DSQ A;  1LU4 A;  2VD1 A;  2TRC P;  4JR6 A;  3QDN A;  3M9J A;  5B7C A;  2M46 A;  1O85 A;  4ZL9 A;  2O87 A;  2JZS A;  2F51 A;  4YKG A;  3DVX A;  1AXD A;  4O5U A;  2FCH A;  5J4U A;  4USS A;  4ZIJ A;  2HZE B;  2N5B A;  3O3T A;  4AJ8 A;  2GZP A;  5DBQ A;  5G1K A;  1F3B A;  1TW9 A;  3R3E A;  1WE0 A;  2L57 A;  4KSO A;  5CRE A;  3E9J B;  1B9X C;  5CRD A;  4HU9 A;  5HR3 A;  5IQY A;  3FR3 A;  1KTE A;  1GSF A;  4MZC A;  4HSC X;  2PUK C;  1OC9 A;  1OYJ A;  4CY8 A;  4PQ1 A;  3F4T A;  5E59 A;  2WB9 A;  5B8A A;  1GSD A;  3HYP A;  3QOU A;  2FA4 A;  1QK8 A;  4EL1 A;  3UBK A;  3BBY A;  5D8I A;  2YCD A;  3CMI A;  1FVK A;  2TIR A;  4N0V A;  3RHB A;  2YV9 A;  2IMF A;  2ON5 A;  1WWJ A;  3ME7 A;  1XOA A;  2PBJ A;  4L8E A;  2LNT A;  3US3 A;  1BQ7 A;  4E8E A;  1YDK A;  3E3E A;  2DJJ A;  1NHY A;  5D9W A;  2IWT A;  5A5K A;  1PX6 A;  12GS A;  4RUV A;  1YQ1 A;  3GX0 A;  3D22 A;  1OE8 A;  2MYG A;  1JLV A;  1PSQ A;  3DXB A;  1FOV A;  5HFI A;  1PKZ A;  3EWL A;  3CSH A;  2H0I A;  4K7N A;  2R2J A;  1V9W A;  1JZW A;  3QR6 A;  4ZB8 A;  4LL4 B;  1U3A A;  1K0M A;  4F82 A;  3D5J A;  1T7P B;  5F0G A;  2PPT A;  2MMA A;  4MNN A;  4RI6 A;  2YWO A;  1GSU A;  5EVO A;  1QXH A;  2XBQ A;  4GQC A;  2OAD A;  4OCF A;  2FWF A;  3UJ1 A;  3F4S A;  3FKF A;  3HA9 A;  2HI7 A;  2GQM A;  5G2Z A;  3TKR A;  4TR1 A;  2LJA A;  2V2G A;  3C1S A;  3GTU B;  2B1K A;  1UN2 A;  4X0X A;  1EV4 A;  1M0U A;  4EXJ A;  4MJB A;  3BCK A;  4HI7 A;  2H66 A;  4HEA 2;  1ST9 A;  1ZCP A;  1B4P A;  2HRA A;  2X8G A;  4IKH A;  1JLW A;  5E4W A;  3U6V A;  2X8H A;  2B6M A;  4PQH A;  4TOP A;  1PA3 A;  1B4Q A;  5D9T A;  1J08 A;  2PMT A;  2PGT A;  2L59 A;  3EU3 A;  1SK0 A;  4KDU A;  3GSS A;  4NWY A;  3APQ A;  4Q5R A;  3LSZ A;  4TR0 A;  1TI3 A;  3EC3 A;  1EZK A;  2YNX A;  2R5G A;  1FHE A;  2IMI A;  2AJQ B;  1YEX A;  4LL1 B;  3TRP A;  4JZQ A;  2QKE A;  2LTK A;  2R0G A;  4MPF A;  1X5C A;  2MMN A;  2H70 A;  1WOU A;  4DEJ A;  4RQR A;  4YAP A;  2HZF A;  1PGT A;  2VOC A;  2HNL A;  5HR1 A;  2PVO C;  3F6F A;  3K8N A;  1K0O A;  1AIU A;  3EPT A;  10GS A;  3LYK A;  3W8J A;  3HJO A;  3WGD A;  3RBT A;  4MA9 A;  4TXO A;  4F03 A;  1PN9 A;  1QUW A;  4MH3 A;  5A4V A;  3CSI A;  3J7Y b;  1ZYQ B;  5JWR B;  2BTO T;  4EIP A;  3LW9 A;  4NPB A;  1SYR A;  5IM9 A;  2LRT A;  1YJ6 A;  5IMV A;  3EUR A;  1AQV A;  5DAL B;  3CRT A;  3S9F A;  3GUS A;  4OFT A;  1JZR A;  1TU8 A;  2H73 A;  3UEM A;  2KLX A;  2H1D A;  2YP6 A;  1J0F A;  3IE3 A;  5J9B A;  3ZYW A;  3W8S A;  1THX A;  1FOH A;  2CQ9 A;  2LS5 A;  4N11 A;  4BL7 B;  2V41 A;  2H0H A;  3D0Z A;  4K5R A;  1ZGN A;  3GKX A;  1W89 A;  3KM6 A;  4J2F A;  1SKS B;  1SK1 A;  1GUM A;  2E7P A;  3FR6 A;  5H5R A;  4IVF A;  3QFA C;  1R4W A;  3KP8 A;  4LMW A;  3VWW A;  4TN8 A;  4JU5 A;  1JZD A;  1GP1 A;  3TKS C;  3ZRE A;  2KUC A;  5B8B A;  1FAA A;  3P90 A;  3ZL5 A;  4ECJ A;  3O76 A;  4WR5 A;  2N5A A;  3I69 A;  4I2T A;  4LMV A;  1AC1 A;  2K9F A;  3MYD A;  4ICY A;  3DIE A;  5AIX A;  1LBK A;  4K2X A;  6GSY A;  2CX4 A;  5ECR B;  5ABR A;  4Q5F A;  4D73 A;  5F8B A;  2FY6 A;  14GS A;  2P31 A;  3HD5 A;  2VLT A;  5H5S A;  1LJR A;  1AUC A;  1O8X A;  5HR2 A;  2JSY A;  1HD2 A;  3H79 A;  2JAC A;  1SJZ A;  2YAN A;  2B7J A;  1MDI A;  3HVX A;  5D9X A;  6GSX A;  3L9S A;  1GUH A;  5DQY A;  2B7K A;  4I97 A;  3CTG A;  2GT5 A;  4YKF A;  2CAQ A;  4BVX B;  4POL A;  4ID0 A;  4MF7 A;  6GSU A;  2UZ8 A;  1DUG A;  3W6G A;  2VCT A;  5KN3 A;  4F0B A;  1WIK A;  4MJA A;  1GSE A;  2QSI A;  4G0K A;  2H1A A;  2VL9 A;  1GNE A;  5DDL A;  4IJ3 A;  1GTB A;  1TXX A;  2X4A A;  2HRF A;  3RDW A;  2WCI A;  4PX1 A;  2OJL A;  4GF0 A;  3J7Y k;  4HU7 A;  1DE2 A;  3SWL A;  2L5O A;  6GSV A;  3P7X A;  5ID2 B;  1FB0 A;  1RW1 A;  2RM5 A;  1O6J A;  3FZ4 A;  2O85 A;  2HE3 A;  1OKD A;  1VF1 A;  3LOR A;  1TK0 B;  3M0F A;  2KP1 A;  1MTC A;  1ERV A;  2VCV A;  3LG6 A;  4IS0 A;  4MZB A;  1XIY A;  3LQ7 A;  1EV9 A;  4G2E A;  1Z7P A;  2VCZ A;  4HJM A;  2C3Q A;  2REM A;  5DAK A;  2F8A A;  3UMA A;  2VCW A;  2C0E A;  4G19 A;  1GUL A;  3EE2 A;  3GX8 A;  1M3J A;  4NAX A;  2DJ1 A;  3ZIT A;  3KP9 A;  3KH9 A;  1BJX A;  1K3L A;  2GSR A;  1SYX A;  2WZ9 A;  3L9V A;  3M8N A;  3GN3 A;  2CX3 A;  3VWX A;  5KEJ A;  3VI7 A;  20GS A;  1Q4J A;  1EP7 A;  2GSQ A;  5KN0 A;  1U87 A;  3F3Q A;  4EUY A;  1NW2 A;  1F37 A;  1T4Y A;  2QGV A;  2H01 A;  1K0N A;  4V1A p;  2O8V B;  2PER A;  2CAI A;  1T00 A;  3Q19 A;  5EPF A;  3HHV A;  1GH2 A;  2I9H A;  2IMK A;  4G0L A;  3TDG A;  4K0G A;  2R6K A;  2F3M A;  1EP8 A;  4POB A;  2L4C A;  4FYB A;  1EGO A;  2GST A;  2DIZ A;  1PQN A; 
#chains in the Genus database with same CATH homology
 1X5D A;  2EIR A;  4O5R A;  5KN2 A;  2BJX A;  2HZE A;  4HQZ A;  3KMN A;  5DAK B;  2OA7 A;  2FGX A;  2FWE A;  1K0C A;  3L78 A;  2GDR A;  3UAR A;  5J5N A;  3EIN A;  5G5F A;  1PD2 1;  1GWC A;  3FZA A;  4GSS A;  1PRX A;  1GLP A;  1GTU A;  4ML1 A;  1SD9 A;  3DVW A;  3FRC A;  4K1F A;  1N8J A;  2QA1 A;  4G9H A;  1S3D A;  4HQS A;  3ZMK A;  2H30 A;  3Q74 A;  3GYK A;  19GS A;  1QFN A;  2V6K A;  3ZTL A;  2CZ3 A;  3KZQ A;  4MCU A;  1OC3 A;  3DML A;  4YH2 A;  4XS1 A;  2YZH A;  3A5W A;  5EL8 A;  1M2B A;  2I3Y A;  2DBC A;  1M9A A;  1B9Y C;  2BMX A;  3FHK A;  1N2A A;  3VFI A;  3C8E A;  3AY8 A;  1M99 A;  4ACS A;  4LA1 A;  1H75 A;  5ECO B;  4DVC A;  3QCP A;  3ZLP A;  4TR3 A;  4Z2R A;  5CAX A;  3FK8 A;  1XW6 A;  4P3Y B;  1Y6E A;  2DMM A;  3VUR A;  17GS A;  5DCG A;  4EE0 A;  1TK8 B;  1PL1 A;  4O7H A;  2NPB A;  2WDU A;  2GTU A;  2IL3 A;  4ML6 A;  5FT3 A;  2OE1 A;  5GAP D;  2M72 A;  1U6T A;  5IMZ A;  4MH2 A;  5ECQ B;  3I43 A;  1A0R P;  4IN0 A;  2DML A;  2FNO A;  2R37 A;  2YOI A;  1OKT A;  2LST A;  1B48 A;  2VL2 C;  3NZN A;  3L0H A;  1VRS D;  2GLR A;  2V6O A;  1O81 A;  2IFQ B;  1GSS A;  1GNW A;  2R3X A;  4WR4 A;  1HYU A;  3GTU A;  3KTL A;  2N5F A;  1DSB A;  4XTS A;  5AIV A;  2DLX A;  3CBU A;  1J9B A;  4E8H A;  2H75 A;  2YJ7 A;  3BD2 A;  4EC0 A;  3ED3 A;  4KA0 A;  4MJE A;  2P5Q A;  4KB3 A;  5LCZ A;  3GFK A;  3EU4 A;  1Z7R A;  4GLT A;  3IA1 A;  2KOK A;  4Q5N A;  2DKH A;  3IC4 A;  3NOF A;  1DE1 A;  1M2A A;  5ECI B;  2FWG A;  1TRW A;  4IP6 A;  3RAZ A;  1CQH A;  2ZUP A;  1TKD B;  4TW5 A;  4POM A;  1TTZ A;  1X9S B;  5JCW A;  4O5Q A;  4PGT A;  1F3A A;  2LUS A;  4EDY A;  3ZIJ A;  3WT2 A;  1R26 A;  1VF2 A;  3CXG A;  1FVJ A;  4XS4 B;  1GSY A;  3CYN A;  3TKS A;  1MDK A;  3DWV A;  4GQF A;  2HLS A;  5DJL A;  3D4T A;  2KP2 A;  2R0C A;  4I2U A;  4KF9 A;  3U5R E;  1KBN A;  2XC2 A;  5DJM A;  1PKW A;  1X9W B;  3HKR A;  3PGT A;  4OO4 A;  2K6V A;  5CP1 A;  1A2M A;  4HZ4 A;  1A8Y A;  2JZT A;  2V32 A;  3GHA A;  2LJR A;  4FH8 A;  4TR4 A;  2VCQ A;  3UIW A;  1SK2 A;  3IBH A;  5DAL A;  2EC4 A;  2H6Y A;  5ECS A;  3IAM 2;  1ON4 A;  4KCE A;  1EEM A;  1FO5 A;  2LKU A;  2FHE A;  1FW1 A;  3GKK A;  4BL7 A;  4EO3 A;  1NM3 A;  3KCM A;  5ECK B;  4WEY A;  3LXT A;  2MBS A;  4EDZ A;  4IHU A;  2FD3 A;  4PQI A;  2E2G A;  5ENU A;  1EWX A;  1VF4 A;  2B5X A;  3CSJ A;  1RK4 A;  2P5R A;  2R4V A;  4NXI A;  4ILF A;  4KGI A;  1GL8 A;  1I9D A;  3FMW A;  3TCO A;  1PX7 A;  5EY6 A;  3GH9 A;  1AW9 A;  5C00 A;  2YN1 A;  5KOX A;  2HXK A;  4HUA A;  3ERG A;  5G31 A;  4NHW A;  4X4J A;  2CV4 A;  3TRX A;  2PWJ A;  3CTF A;  2YJH A;  1F9M A;  2H1G A;  1AQX A;  5H5Q A;  1YF1 A;  4X1U A;  2WGR A;  1V58 A;  4JED A;  2QC7 A;  2I81 A;  1BX9 A;  4O32 A;  4GCI A;  3QFB C;  13GS A;  4XCS A;  2RM6 A;  4MF5 A;  5J9C A;  4CDO A;  3I9V 2;  1A2L A;  1QMV A;  4WBR D;  1HQO A;  3FY7 A;  5FWG A;  3QD9 A;  1XW5 A;  1Y25 A;  3H1N A;  2VLU A;  4KUN A;  1NHO A;  5COH A;  3KGK A;  2WJU A;  2AV4 A;  1RQM A;  2DJK A;  5A4U A;  2H8L A;  2M80 A;  1GSQ A;  2MMO A;  3KJY A;  2QA2 A;  3EMX A;  2MZC A;  2GSS A;  2C0F A;  3KMO A;  5D93 A;  4BVX A;  1ERU A;  1IYI A;  3UVT A;  3UOM A;  1WMJ A;  7GSS A;  3A2W A;  3VPT A;  3FZ5 A;  4L5L A;  2E2M A;  3GST A;  1G6Y A;  2XHF A;  3IOS A;  3PH9 A;  5LNK e;  3MIX A;  3F8U A;  3Q6O A;  3JCM L;  4V2M A;  3IC8 A;  3ISO A;  3F3R A;  2YPM A;  1H4O A;  1ABA A;  5ID2 A;  1F6M C;  2JSZ A;  5B6M A;  3IDV A;  3GNJ A;  2HSH A;  5ECL B;  4GTU A;  5ELG A;  4JBB A;  4TKY A;  1K3Y A;  3IAS 2;  3PIN A;  5D9V A;  2J9H A;  1UA5 A;  4XS6 A;  1XVW A;  2E0Q A;  1YKA A;  2NBS A;  4V1A g;  4OFN A;  3Q18 A;  3ZIV A;  2HT9 A;  1UC7 A;  4K7I A;  3E0U A;  2GVP A;  4OD7 A;  4IBP A;  4FO5 A;  2VAF A;  1ERT A;  1HNC A;  11GS A;  3G7Y A;  1EGR A;  6GSS A;  2C80 A;  5KN1 A;  3PPU A;  2J23 A;  5KOW A;  3VI5 A;  4BPY A;  1ERW A;  4MJC A;  4KX4 A;  3WD6 A;  5CNW A;  2F8F A;  3C1R A;  3TJF A;  4N0Z A;  5IO2 A;  1KNG A;  5IIZ A;  4OFM A;  2WS2 A;  2L5L A;  1YF0 A;  4WF5 A;  3MAK A;  1SJ6 A;  4HJ2 A;  4AF2 A;  2YZU A;  3DRN A;  4EF0 A;  3ZVJ A;  2A4H A;  5IOW A;  4GST A;  2VM2 A;  2OKA A;  2GS3 A;  3GMF A;  3KEB A;  4O92 A;  1ML6 A;  4CHS A;  2HRK A;  2O7K A;  2XBI A;  4KSM A;  5GZZ B;  4YQM A;  2JU5 A;  4MF6 A;  2CA8 A;  3L9U A;  2G0F A;  3TGZ A;  3FEU A;  1OAZ A;  1SKR B;  16GS A;  22GS A;  1ZL9 A;  2WRT A;  4ZB9 A;  1T8E B;  4PTS A;  2DIY A;  1TOF A;  2FA8 A;  2MMZ A;  1A23 A;  3UAP A;  4MP4 A;  3KH7 A;  4ECI A;  5G1L A;  5HQP A;  2VL2 A;  5AIS A;  3WYW A;  4AJ6 A;  2NVL A;  2VM1 A;  3DGQ A;  3WGE A;  4J57 E;  1SL2 B;  2LV3 A;  3QPM A;  2X49 A;  4POK A;  4Q5Q A;  5AGY A;  3ZML A;  2WFC A;  4L5O A;  3A2V A;  4FYC A;  4YQV A;  4IEL A;  4ZBB A;  4DSS B;  2R0P A;  3DKS A;  3M3M A;  5IMC A;  3TOT A;  3ME8 A;  1MD4 A;  1V2A A;  2C3N A;  3WT1 A;  3HVS A;  4WBJ A;  1TJD A;  1QGV A;  9GSS A;  3FW2 A;  1Z5Y E;  4Z2U A;  1S3A A;  1XWB A;  2C3T A;  3DD3 A;  4K2D A;  1MDJ A;  1WJK A;  3GH6 A;  1ACV A;  1V57 A;  2RUE A;  3ZZX A;  1X9M B;  3R2Q A;  1BYE A;  4ECB A;  3P8W A;  2L6C A;  1YKC A;  1KEB A;  4I5Q A;  2B5E A;  2EIQ A;  5IMA A;  3N9J A;  4QQ7 A;  3ZVJ D;  2L6D A;  1GLQ A;  3HZ8 A;  2XPE A;  1R5A A;  4BVY B;  4IQA A;  3GV1 A;  3QMX A;  1VGL A;  3FYG A;  3HVV A;  4L0W A;  1EOH A;  2RII A;  2H6X A;  3H4K A;  1URM A;  4Z2T A;  2IIY A;  5DQS A;  1MEK A;  2PVQ A;  1FB6 A;  3GA4 A;  4TXV A;  2X64 A;  4MDC A;  4TVE A;  1AQW A;  3VK9 A;  5A4W A;  2IFQ A;  1CQG A;  1GRX A;  2Z9S A;  2FWH A;  2HFD A;  4V2N A;  1PL2 A;  1Q98 A;  2AHE A;  5CRH A;  3P2A A;  5JCU A;  4A5P A;  3F63 A;  4RI7 A;  1XWA A;  1G6W A;  1TRV A;  1QQ2 A;  1EOG A;  4FQU A;  1TI1 A;  2G2Q A;  4J56 E;  2GQK A;  3G7I A;  1XXU A;  3M1G A;  2DJ3 A;  2A2S A;  1JZO A;  4YAV A;  2I4A A;  4K6X A;  3F6D A;  4G10 A;  3DYR A;  2EIO A;  1XZO A;  4IW9 A;  2HSM A;  1W4V A;  3IK9 A;  1T1V A;  1X5E A;  3IHQ A;  4XS4 A;  4OCE A;  4OMV A;  2LNS A;  2K8V A;  5LD0 A;  1R7H A;  5DCH A;  1IYH A;  3EYT A;  3QAW A;  3KXO A;  2IJY A;  4BWQ A;  4DSR A;  1YY7 A;  4IQ1 A;  3DEX A;  2VL3 A;  1X0R A;  4K9Z A;  2C1Y A;  3TB2 A;  1YEP A;  2GZZ A;  2H0G A;  3FZ9 A;  1R5P A;  5D96 A;  2JL4 A;  4WF4 A;  3OR5 A;  2OBK A;  1ZOF A;  4PNG A;  4ZBA A;  4ZIL A;  5CO3 A;  5J3R A;  1C72 A;  1I5G A;  2JAD A;  3EMP A;  3LXZ A;  3A2X A;  4MPG A;  1Z3E A;  3TKS E;  3UL3 A;  4ZB6 A;  2LRC A;  1PN0 A;  1ZMA A;  3GKM A;  3KTB A;  1Z9H A;  2VUP A;  3BOA A;  5D73 A;  1Z6M A;  1ZYP A;  3RHC A;  2VIM A;  4K0N A;  4CW9 A;  1BAY A;  3L4N A;  4OWY A;  5JCG A;  3APS A;  3RPN A;  4XRA A;  3TRQ A;  4GXZ A;  1OC9 B;  5B6N A;  2RLI A;  2X8C A;  4PUF C;  3IXR A;  4V2L A;  3F0I A;  2X99 A;  5ECM B;  3UVH A;  2VD0 A;  3CRU A;  5F07 A;  1XWK A;  2OE3 A;  3LYP A;  5ECP B;  2DJ0 A;  2PN8 A;  4L0U A;  3C71 A;  2LRN A;  2O89 A;  1NSW A;  1XOB A;  1XBS A;  4ULX A;  1O8W A;  3G9B A;  2PU9 C;  2L4Q A;  2DC5 A;  4K5S A;  2DJ2 A;  1BG5 A;  2H71 A;  2CT6 A;  1MD3 A;  5G5E A;  4MLY A;  5CRW A;  1TU7 A;  4F2I A;  1A8L A;  3M9K A;  4JE1 A;  3APO A;  4KE3 A;  3WGX A;  2MBT A;  3VWU A;  2AB6 A;  5F05 A;  1GTA A;  5C04 A;  3IR4 A;  1A24 A;  4HZ2 A;  1G7E A;  5AN1 A;  4LLR A;  3MSZ A;  6GST A;  1K0A A;  1PMT A;  1M9B A;  3H93 A;  1DBY A;  3GL3 A;  4GRF A;  4RQX A;  2A2P A;  1XVQ A;  1HNA A;  1GUK A;  1A2J A;  4EVM A;  1OC8 A;  2CVD A;  2FUG 2;  3LFL A;  3UBL A;  4X43 A;  2DKI A;  3KIJ A;  4TR1 B;  4Z7X A;  2AAW A;  1GTI A;  1ZYN A;  1UVZ A;  2JZR A;  3GKN A;  2ZCT A;  3TUE A;  1S3C A;  3I6A A;  3N5O A;  4NV2 A;  5IOX A;  1JHB A;  3SBC A;  5BRT A;  5G30 A;  1U3I A;  1XWC A;  3O6T A;  1USB A;  5JWO B;  3C7M A;  4HOJ A;  1E6B A;  3A5I A;  3IV4 A;  1THO A;  2CVK A;  3TKQ A;  3F4R A;  5IO0 A;  2YV7 A;  2C0G A;  1OE7 A;  3VPQ A;  3GRX A;  5FHI A;  1V98 A;  4WET A;  5GSS A;  3TJG A;  4EKZ A;  3QAG A;  4JRR A;  8GSS A;  18GS A;  3EVI A;  2FLS A;  2YWM A;  2VCX A;  3F9U A;  4NHZ A;  1O73 A;  4XHM A;  3BCI A;  4NV5 A;  4NMU A;  2GQL A;  3MWH A;  2HYX A;  3GIX A;  4AGS A;  5ECN B;  3D4M A;  5DVB A;  3D21 A;  4TXO B;  4KCA A;  2B5Y A;  1HNB A;  2GT6 A;  2NTO A;  4MK3 A;  2ZNM A;  4BA7 A;  3HJM A;  4GSN A;  2WUL A;  2HSY A;  2C8U A;  2GZY A;  3VWV A;  3HJP A;  5IPG A;  5ELA A;  3RPP A;  2VO4 A;  3TJJ A;  4MZW A;  3PR8 A;  2TRX A;  1O7U A;  3QAV A;  4KW6 A;  1TRS A;  2IPA A;  4G0I A;  4IGJ A;  3IHG A;  3ERF A;  2XPD A;  5INY A;  4ZBD A;  3LWA A;  5HR0 A;  4ISD A;  2LQQ A;  3BJ5 A;  1TP9 A;  4N10 A;  4WXT A;  1F2E A;  5BMU A;  5HFK A;  4YQU A;  3IK7 A;  1XFL A;  3HCZ A;  2YWN A;  2K8S A;  4F9Z A;  1XWG A;  1VF3 A;  4F0C A;  4IJI A;  1TK5 B;  4HDE A;  5J41 A;  3MNG A;  4OO5 A;  2ALB A;  2I1U A;  2H72 A;  5ECH B;  2RUF A;  2CZ2 A;  3V1W A;  3VLN A;  2NDO A;  1EEJ A;  1V40 A;  3LJR A;  3G7J A;  3NIV A;  1TDI A;  4N30 A;  3TJB A;  4DSS A;  1XPV A;  4K7O A;  2F9S A;  1BED A;  2B1L A;  2AYT A;  1K3O A;  3A3T A;  2V1M A;  3ZFB A;  4ZL7 A;  2GGT A;  1WP0 A;  4PNF A;  2IN3 A;  4QL7 A;  4ZL8 A;  4FYU A;  4PUR A;  5IMF A;  3IPZ A;  4D73 B;  5CRG A;  1SKW B;  5JWQ B;  2C0D A;  4XRD A;  5HFG A;  2H19 A;  4H86 A;  4AJ7 A;  4I8B A;  2YWI A;  2ON7 A;  2IMD A;  2OE0 A;  3MDK A;  4ECC A;  4WKW A;  3ZFL A;  2LJK A;  6GSW A;  1XCC A;  2H74 A;  2K18 A;  1SL1 B;  2VLV A;  3C73 A;  4BVY A;  3ZRD A;  1M2D A;  1ZZY A;  1G7O A;  1SJI A;  3FR9 A;  1TRU A;  4QL9 A;  3HDC A;  3IRA A;  1T3B A;  3TOU A;  3D6I A;  2C4J A;  1JFU A;  2H6Z A;  2OBI A;  4EIQ A;  2B3S A;  1SEN A;  1OVN A;  1K0D A;  3GUR A;  4JR4 A;  1E2Y A;  5IPH A;  1ZYE A;  5L71 A;  4KDY A;  3LEF A;  1SU9 A;  2D2Z A;  4I6X A;  4CY6 A;  2LQO A;  4KDX A;  3HZ4 A;  4BWS A;  4KAE A;  2DSA A;  4KH7 A;  3KD0 A;  5F06 A;  2P0G A;  5CYY A;  2A4V A;  1WPI A;  3HXS A;  4PXO A;  2ES7 A;  1FG4 A;  3H8Q A;  2LEG A;  4MMM A;  2KHP A;  3TJK A;  2H1B A;  1XW9 A;  3HY2 A;  3ERW A;  1SL0 B;  2A2R A;  3GL5 A;  4PUA A;  1WRY A;  1A0F A;  2OAC A;  1ILO A;  4ZXG A;  1M7T A;  4HS1 A;  4FIW A;  4IP1 A;  5GST A;  2H76 A;  1U88 A;  4K8M A;  1SD8 A;  2CVB A;  1Z6N A;  2IME A;  4GWR A;  4KND A;  1AAZ A;  2AUV A;  4MAB A;  3LGC A;  1YZX A;  1B8X A;  5IMD A;  1K0B A;  4XIH A;  2HRN A;  1G0T A;  5GAN D;  3TKP A;  1T4Z A;  4TRX A;  4DSQ A;  1LU4 A;  2VD1 A;  2TRC P;  4JR6 A;  3QDN A;  3M9J A;  5B7C A;  2M46 A;  1O85 A;  4ZL9 A;  2O87 A;  2JZS A;  2F51 A;  4YKG A;  3DVX A;  1AXD A;  4O5U A;  2FCH A;  5J4U A;  4USS A;  4ZIJ A;  2HZE B;  2N5B A;  3O3T A;  4AJ8 A;  2GZP A;  5DBQ A;  5G1K A;  1F3B A;  1TW9 A;  3R3E A;  1WE0 A;  2L57 A;  4KSO A;  5CRE A;  3E9J B;  1B9X C;  5CRD A;  4HU9 A;  5HR3 A;  5IQY A;  3FR3 A;  1KTE A;  1GSF A;  4MZC A;  2PUK C;  1OC9 A;  1OYJ A;  4CY8 A;  4PQ1 A;  3F4T A;  5E59 A;  2WB9 A;  5B8A A;  1GSD A;  3HYP A;  3QOU A;  2FA4 A;  1QK8 A;  4EL1 A;  3UBK A;  3BBY A;  5D8I A;  2YCD A;  3CMI A;  1FVK A;  2TIR A;  4N0V A;  3RHB A;  2YV9 A;  2IMF A;  2ON5 A;  1WWJ A;  3ME7 A;  1XOA A;  2PBJ A;  4L8E A;  2LNT A;  3US3 A;  1BQ7 A;  4E8E A;  1YDK A;  3E3E A;  2DJJ A;  1NHY A;  5D9W A;  2IWT A;  5A5K A;  1PX6 A;  12GS A;  4RUV A;  1YQ1 A;  3GX0 A;  3D22 A;  1OE8 A;  2MYG A;  1JLV A;  1PSQ A;  3DXB A;  1FOV A;  5HFI A;  1PKZ A;  3EWL A;  3CSH A;  2H0I A;  4K7N A;  2R2J A;  1V9W A;  1JZW A;  3QR6 A;  4ZB8 A;  4LL4 B;  1U3A A;  1K0M A;  4F82 A;  3D5J A;  1T7P B;  5F0G A;  2PPT A;  2MMA A;  4MNN A;  4RI6 A;  2YWO A;  1GSU A;  5EVO A;  1QXH A;  2XBQ A;  4GQC A;  2OAD A;  4OCF A;  2FWF A;  3UJ1 A;  3F4S A;  3FKF A;  3HA9 A;  2HI7 A;  2GQM A;  5G2Z A;  3TKR A;  4TR1 A;  2LJA A;  2V2G A;  3C1S A;  3GTU B;  2B1K A;  1UN2 A;  4X0X A;  1EV4 A;  1M0U A;  4EXJ A;  4MJB A;  3BCK A;  4HI7 A;  2H66 A;  4HEA 2;  1ST9 A;  1ZCP A;  1B4P A;  2HRA A;  2X8G A;  4IKH A;  1JLW A;  5E4W A;  3U6V A;  2X8H A;  2B6M A;  4PQH A;  4TOP A;  1PA3 A;  1B4Q A;  5D9T A;  1J08 A;  2PMT A;  2PGT A;  2L59 A;  3EU3 A;  1SK0 A;  4KDU A;  3GSS A;  4NWY A;  3APQ A;  4Q5R A;  3LSZ A;  4TR0 A;  1TI3 A;  3EC3 A;  1EZK A;  2YNX A;  2R5G A;  1FHE A;  2IMI A;  2AJQ B;  1YEX A;  4LL1 B;  3TRP A;  4JZQ A;  2QKE A;  2LTK A;  2R0G A;  4MPF A;  1X5C A;  2MMN A;  2H70 A;  1WOU A;  4DEJ A;  4RQR A;  4YAP A;  2HZF A;  1PGT A;  2VOC A;  2HNL A;  5HR1 A;  2PVO C;  3F6F A;  3K8N A;  1K0O A;  1AIU A;  3EPT A;  10GS A;  3LYK A;  3W8J A;  3HJO A;  3WGD A;  3RBT A;  4MA9 A;  4TXO A;  4F03 A;  1PN9 A;  1QUW A;  4MH3 A;  5A4V A;  3CSI A;  3J7Y b;  1ZYQ B;  5JWR B;  2BTO T;  4EIP A;  3LW9 A;  4NPB A;  1SYR A;  5IM9 A;  2LRT A;  1YJ6 A;  5IMV A;  3EUR A;  1AQV A;  5DAL B;  3CRT A;  3S9F A;  3GUS A;  4OFT A;  1JZR A;  1TU8 A;  2H73 A;  3UEM A;  2KLX A;  2H1D A;  2YP6 A;  1J0F A;  3IE3 A;  5J9B A;  3ZYW A;  3W8S A;  1THX A;  1FOH A;  2CQ9 A;  2LS5 A;  4N11 A;  4BL7 B;  2V41 A;  2H0H A;  3D0Z A;  4K5R A;  1ZGN A;  3GKX A;  1W89 A;  3KM6 A;  4J2F A;  1SKS B;  1SK1 A;  1GUM A;  2E7P A;  3FR6 A;  5H5R A;  4IVF A;  3QFA C;  1R4W A;  3KP8 A;  4LMW A;  3VWW A;  4TN8 A;  4JU5 A;  1JZD A;  1GP1 A;  3TKS C;  3ZRE A;  2KUC A;  5B8B A;  1FAA A;  3P90 A;  3ZL5 A;  4ECJ A;  3O76 A;  4WR5 A;  2N5A A;  3I69 A;  4I2T A;  4LMV A;  1AC1 A;  2K9F A;  3MYD A;  4ICY A;  3DIE A;  5AIX A;  1LBK A;  4K2X A;  6GSY A;  2CX4 A;  5ECR B;  5ABR A;  4Q5F A;  4D73 A;  5F8B A;  2FY6 A;  14GS A;  2P31 A;  3HD5 A;  2VLT A;  5H5S A;  1LJR A;  1AUC A;  1O8X A;  5HR2 A;  2JSY A;  1HD2 A;  3H79 A;  2JAC A;  1SJZ A;  2YAN A;  2B7J A;  1MDI A;  3HVX A;  5D9X A;  6GSX A;  3L9S A;  1GUH A;  5DQY A;  2B7K A;  4I97 A;  3CTG A;  2GT5 A;  4YKF A;  2CAQ A;  4BVX B;  4POL A;  4ID0 A;  4MF7 A;  6GSU A;  2UZ8 A;  1DUG A;  3W6G A;  2VCT A;  5KN3 A;  4F0B A;  1WIK A;  4MJA A;  1GSE A;  2QSI A;  4G0K A;  2H1A A;  2VL9 A;  1GNE A;  5DDL A;  4IJ3 A;  1GTB A;  1TXX A;  2X4A A;  2HRF A;  3RDW A;  2WCI A;  4PX1 A;  2OJL A;  4GF0 A;  3J7Y k;  4HU7 A;  1DE2 A;  3SWL A;  2L5O A;  6GSV A;  3P7X A;  5ID2 B;  1FB0 A;  1RW1 A;  2RM5 A;  1O6J A;  3FZ4 A;  2O85 A;  2HE3 A;  1OKD A;  1VF1 A;  3LOR A;  1TK0 B;  3M0F A;  2KP1 A;  1MTC A;  1ERV A;  2VCV A;  3LG6 A;  4IS0 A;  4MZB A;  1XIY A;  3LQ7 A;  1EV9 A;  4G2E A;  1Z7P A;  2VCZ A;  4HJM A;  2C3Q A;  2REM A;  5DAK A;  2F8A A;  3UMA A;  2VCW A;  2C0E A;  4G19 A;  1GUL A;  3EE2 A;  3GX8 A;  4NAX A;  2DJ1 A;  3ZIT A;  3KP9 A;  3KH9 A;  1BJX A;  1K3L A;  2GSR A;  1SYX A;  2WZ9 A;  3L9V A;  3M8N A;  3GN3 A;  2CX3 A;  3VWX A;  5KEJ A;  3VI7 A;  20GS A;  1Q4J A;  1EP7 A;  2GSQ A;  5KN0 A;  1U87 A;  3F3Q A;  4EUY A;  1NW2 A;  1F37 A;  1T4Y A;  2QGV A;  2H01 A;  1K0N A;  4V1A p;  2O8V B;  2PER A;  2CAI A;  1T00 A;  3Q19 A;  5EPF A;  3HHV A;  1GH2 A;  2I9H A;  2IMK A;  4G0L A;  3TDG A;  4K0G A;  2R6K A;  2F3M A;  1EP8 A;  4POB A;  2L4C A;  4FYB A;  1EGO A;  2GST A;  2DIZ A;  1PQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...