2YOLA

West nile virus ns2b-ns3 protease in complex with 3,4- dichlorophenylacetyl-lys-lys-gcma
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
228
structure length
212
Chain Sequence
SHMTDMWIERTADITWESDAEITGSSERVDVRLDDDGNFQLMNDPGVLWDTSPKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGHDEVQMIVVEPGKNVKNVQTKPGVFKTPEGEIGAVTLDYPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Characterization of New Peptidomimetic Inhibitors of the West Nile Virus Ns2B-Ns3 Protease.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase
molecule keywords SERINE PROTEASE SUBUNIT NS2B, SERINE PROTEASE NS3
total genus 44
structure length 212
sequence length 228
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2yolA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2yolA01
2A2QH 1K9OE 1MZDA 2P16A 2TPIZ 2OCVB 4I31A 1VGCC 1XUGA 4OGYA 1DFPA 2ILNA 3F9EA 4DCDA 4AB8A 1TOCB 3ZVCA 1AVWA 1XMNB 3M5NA 1YPLH 1BUIA 1GHAG 2G55A 4O03A 1AWFH 3SJOA 2BDAA 3P70B 5GWZA 4KTCA 1MU6B 2Y7ZA 2O8TA 4CHAB 3QZRA 2ASUB 1IQNA 2CHAC 2ZHQH 2LNCA 4K1TA 1TIOA 1TQ7B 3HKJB 1CT2E 1CA8B 5GPIB 1Z7KA 4OS2A 1GI8B 1PPBH 5FX5A 1WQVH 5B6LA 1GJ9B 2ZECA 5C1YA 1IQLA 2CGAA 3QDZB 1SHHB 1P0SH 1IQEA 1H9LB 4RI0A 1O3MA 1GJ5H 5A8XA 2PKAA 2V3OH 4JMYA 1BA8B 1NFUA 3LKWA 1HJAC 5EOKA 1EUFA 3FVFB 1ANEA 3BTFE 5CHAB 1G3BA 3U8RH 3TH2H 1S6HA 4D76A 4ABAA 1XM1A 3E0PB 1TPOA 2YOLA 1TBQH 2Y6TA 3UNRA 1IAUA 3BTDE 4NSVA 1GCTC 5L2ZH 2VGCB 1CGJE 2GX4A 1TGBA 2FOFA 3KN2A 4AZ2B 3RU4D 3SJIA 3O8CA 2BZ6H 3Q00A 2FM2A 1O32A 1CGIE 1FY8E 2BLQA 1O5FH 1L1NA 1SC8U 1KXDA 2XW9A 3A87A 5JBAS 1WV7H 2FLBH 1O3NA 1JIMA 6ESTA 1E38B 4YOIA 2VJ1A 1Z8IB 1D3DB 3LONA 1DLKB 4R0IA 4INKA 4ZROA 4WMFA 1A7SA 2AMPA 3QK1A 1WTHD 1BMNH 1Y3UA 1SVPA 1SQAA 1MKXH 5C1UA 1AKSB 1TQ0B 2FTLE 2ZU4A 4I32A 2BX3A 2BVRH 3PM3A 1IQGA 2XWAA 1LVMA 3UREA 1GWAA 5FPTA 1UK4A 2P8OB 2Q6GA 4X1NU 5T3HA 3S9AA 1GI5A 2F9OA 3LH1A 3SHAH 1O34A 1OPHB 2HNTF 1TBRH 4X2WA 3VGCB 1C1RA 1GJ7B 2SNWA 3DFLA 4FUGA 2G4UA 4X6NA 1YPMH 2RA3A 1IHSH 1TYNA 2VGCC 2J4IA 1J8AA 1Y5AT 3A7WA 1XUKA 3PMAB 1QBNA 4IMZA 1V2LT 2W3KA 4RSPA 4A1TA 3LT3A 4B6FA 1AFQC 1O3EA 3A7XA 3E0NB 1SI5H 3I78A 3MNXA 4X8VH 5CHAC 1GDUA 2GMTB 3M3VA 1BMLA 2DE8A 1O3HA 1ZHMA 1HAPH 2F3CE 1BOQA 4ABFA 3L3TA 4TWWA 3NZIA 1XX9A 4TPIZ 1ESAA 2Y5FA 3IITA 1H9IE 4DY7B 2HNTE 1SGYE 2FZZA 2Z9KA 2QXGA 3TJUA 1SGCA 1LMWB 2BD5A 4DJZB 4NGAH 5FHTA 1SB1H 2EI6A 1P3CA 4JCNA 1GHZA 2H5DA 1O38A 4DURA 3RXKA 1Z71A 1THPB 1IQMA 5AFYH 1A2CH 1W7GH 1EB1H 1TX8A 1AUTC 2JKHA 1G32B 1INCA 1ELAA 2OD3B 4F49A 1C2DA 1BB0B 1FY1A 2F9PA 3SOSA 4NIVA 3I29A 2QA9E 5FCKA 3M5MA 1OP8A 2P3TB 2ZDLA 4THNH 1ZPCA 1BBRE 1UTNA 3Q77A 4UFDH 1HIAA 1QR3E 2F83A 2ANWA 2XBWA 2ZU1A 3HGNA 2VWMA 5T6FA 1HNEE 4ZXXH 4JZFH 3S9CA 2SGAA 1LVYA 3MOCA 5CE1A 3EDXB 3GCHB 4IMQA 3HATH 1SL3A 4UDWH 1GBCA 3BEFB 3LJJA 4CH2B 3D65E 3PTBA 2WPJS 1C5QA 1GBTA 1AB9B 4MTBA 5L6NH 3T28A 1C1TA 2FODA 2FOAA 3ZVBA 2O8LA 4OS5A 5FXLA 2FX4A 1F0UA 4ABDA 4IS5A 1TWXB 4YM9A 2HPPH 1MTSA 1DPOA 2W5EA 2GKVE 1UTKA 3OX7U 3O8BA 4OGXA 3OTPA 1AZZA 3C1KA 4ZKNU 3TNSA 1ELTA 2O8MA 2ZWLH 4NFFA 1MU8B 4WMEA 3ZZBA 1HDTH 1W13U 1XUJA 1PQ7A 3UWIA 4Y10E 4JYUH 4NWKA 1NRSH 1QL7A 1QURH 3JZ2B 2EI8A 4VGCB 2A1DB 3F68H 1C2FA 3TGKE 2VWNA 5GNDA 1EPTC 2B9LA 1XKAC 2VH0A 1DXPA 3SGBE 4HZHA 2H6MA 1DICA 2FP7B 4J2YB 4R8TB 1FDPA 1QNJA 4BTIB 1GHBG 4B2CA 1UCYH 1NPMA 1UVSH 3BEUA 2HNTC 1RTKA 4YOGA 2WZQA 5DG6A 5TCAA 1P11E 4B2AA 1DLEA 2WUCA 1O2IA 3ITIA 1C4V2 3SU1A 3BIVH 2FOEA 1LPKB 4AYVB 4E06H 1ZHRA 1B0EA 4Z6AH 1SFQB 1SR5C 4ZKRU 1YPEH 1ZRKA 3FZDA 4E7RG 1EPTA 1ESTA 1K1JA 3T5FH 2BQWB 1BMMH 5EXNA 1GI4A 2PW8H 3RXCA 1PFXC 2BVXH 1L1JA 1GVZA 2IJD1 3AAUA 1HCGA 3LGTA 4DOQA 2XCFA 2Z9IA 1GVKB 3PO1C 1ANBA 2ZCHP 1MBQA 1IQFA 3UOPA 2ZA5A 3PV2A 2GZ7A 4YOJA 2BDIA 2QF3A 2ZPQA 2FS8A 3RXIA 1EASA 1H1BA 1NT1A 3MU5A 2BY8X 2WV4A 5C2ZA 1EAXA 1TMTH 2XC5A 2C90B 1ABIH 1G36A 4UD9H 1HIAB 1V2ST 2G5NA 1FMGA 5GXPA 1N8OB 5HM9A 3SNCA 2HALA 3DFJA 1EJMA 1AVGH 1MBMA 2HLCA 1DX5M 5T6GA 1RD3B 2PUQH 2IJOB 1NROH 5BPEA 2A31A 2OBQA 4HTCH 2ZTZA 5GJ4B 1NU9A 3ZZDA 2W3IA 1BRCE 2AMDA 1NN6A 1NFWA 3KL6A 6CHAC 3ZZ3A 3UWJH 4YLUA 3KGPA 5DP4A 2UWLA 1A5IA 1CQQA 1AVXA 1DWBH 1NTPA 4AYYB 5EPYA 1O31A 1FPHH 1O2RA 1G9IE 2CMYA 1W11U 1ELDE 3RC6A 1A0JA 2FI3E 1P9SA 3RMOH 1SGNE 1A3EH 2VH6A 2BDHA 1Y3YA 3SQEE 2OC7A 2UUJB 3TJVA 1GI6A 1C5RA 1GHBF 5LPEA 1TRYA 1EB2A 1SOZA 1EOLA 1WXRA 1EKBB 1MAYA 2A4OA 1MTNC 3HPTB 1JBUH 5I25A 2PGQB 3MYWA 1ZHPA 1DSTA 4YT7H 1TAWA 4X1RU 1T32A 3DA9B 1PQ5A 2STAE 2XC0A 4CBOA 4ZXYH 1GI1A 1EX3A 3MNCA 1V2JT 2BMGB 4XFQA 5E0HA 1CA0C 4WVPE 3TNTA 2NU3E 4GCHF 5GCHG 1C5NH 1LCYA 3MHWU 3AW0A 1QTFA 1J17T 1V2WT 4I8KA 3VXEH 4NCYA 1YBWA 3PYHA 1GJ8B 1LO6A 3FFGA 1UVOA 1O2NA 1V2TT 1YLCA 9LPRA 3N7OA 3RLWH 1GHVH 4FXGH 4KGAA 4Q7ZA 4DVAU 2C8XB 1C1UH 2W7SA 5PTPA 2RCEA 1T4UH 2Z6BD 1SLUB 5HM2A 2G8TA 5C1XA 3HK3B 2ZDKA 4IGDA 2AERH 1MD8A 1UHBA 1FLEE 4KTUA 4Y71A 1P05A 4D7GA 3SNEA 4Y7AA 3SUFA 4NIYA 3RXRA 5B6OA 4HI3A 1BBRK 5JBTA 1VCWA 3A8AA 3SV9A 1BTHH 1RTLA 2H2ZA 1O3DA 1ZTLA 3ESTA 2BQ6B 1ORFA 3PMJA 3OYPA 3ZZ9A 2H9EH 2ZFRH 5FPSA 1ID5H 1L2EA 4RKOB 1Q31A 1FQ3A 2PKSC 2ZHFH 1BRUP 1LDTT 2QC2A 4CRBA 1H9HE 1UO6A 2YNAA 4Y0ZE 4BAMB 1GJBB 2A2XH 3H09A 4ABJA 4WXIA 4XDEA 1UCYK 3SU3A 5H4IB 4UFGH 4JZIA 1OWEA 1P2IA 3TK5A 4U2WA 2ZGCA 1BIOA 1T8OA 4J1YA 1HUTH 1E36B 4FUHA 1HAOH 1ABJH 1KLTA 1NESE 3RC5A 2OK5A 3SJ8A 3P8FA 1G30B 1O3OA 4HFPB 1K1MA 3RXEA 4NA7A 3V3MA 1NRNH 1BBRH 1DWCH 3A84A 3P8GA 4GVUA 1GG6B 1TGNA 3SZNA 3I77A 3CENA 4YT6H 2FWWA 3ZVFA 1QIXB 2ZO3H 1C5UA 1IQHA 2QXJA 5FPYA 2SFAA 1AN1E 2GD4B 2OC8A 2ZP0H 1D4PB 1GGDC 3LGVA 2PLXA 3QTOH 2JETC 1RFNA 2ZDMA 2PTCE 2AS9A 1D3TB 2D2DA 1C5WB 1FI8A 2NU1E 1V2NT 5C3NA 3IG6B 1GI3A 3GCTG 4NG9H 5JB9S 4ABIA 1HAZB 4UEHH 5E0GA 4LZ4B 7LPRA 2OXSA 4CH8B 1C2KA 4BTUB 1OKXA 1VGCB 4ZAEA 5JB8S 3TU7H 1FIWA 2C8WB 1U6QA 3RXUA 1GDNA 1HGTH 1UTQA 2QCYA 3LDXH 4IN2A 1OYTH 2OQUA 1B0FA 1C5MD 1G3EA 4QT8C 2F9BH 2ZGJA 1JRSA 1O5AB 1FAXA 5EXMA 4MPUA 4X2XA 4BANB 3RUOA 2AYWA 1K2I1 1OP0A 3MTYA 3GYLB 4X6MA 4AN7A 3SI4H 3A8BA 1MTUA 2IOTA 1F2SE 1P2JA 1VZQH 1QJ1B 4E05H 2B5TB 1TOMH 3SV7A 1UK2A 3R3GB 4LXBH 1C1SA 1TLDA 1TPSA 3M5OA 1TE0A 1P12E 1OXGA 2K1QA 4AB9A 1P04A 1O5BB 3GDVA 5EQSA 1HXEH 1O0DH 1O37A 1O3CA 4DGJA 1P2NA 3K65B 1VITG 1O3PB 1O2HA 1KXCA 2Y80A 1S85A 1ZZZA 5IYTA 2JH6D 2HRVA 1RXPA 2Z94A 3U8OH 3MO3A 2C8YB 2FYQA 2FOHA 2J95A 1KXBA 1W12U 1XUFA 2VVCA 3E3TA 3TK6A 1UMAH 1KY9A 4FUEA 1XUHA 1G3DA 1QB1A 5EXLA 1DY8A 1O2ZA 1YCPH 1QB6A 5GDSH 3A82A 5FAHA 3SHCH 1O5EH 5DP5A 4ISLA 1L4DA 1O2WA 3QUMP 4RKJB 1O5CB 1F7ZA 1FV9A 2SGQE 1SGQE 1ELGA 3ZVGA 2ZHWH 1ZSKA 4FUIA 4OS7A 1EZQA 2ZU5A 4XOJA 3GCNA 2ULLA 2BDYA 3UR9A 3ZZ7A 2J92A 2QF0A 1X7AC 3L33A 3PLBA 1P8VC 1XXFA 1HLTH 4XBBA 3T25A 3OU0A 1C1PA 1TNGA 1ARBA 3VB6A 4E7NA 3V12A 1KIGH 2OC0A 2BY5X 4XBDA 1P09A 2PKSB 1Q2WA 3KQBA 3BG4C 1HJ8A 2A45B 1O2QA 4MNVA 2IPHA 3UTUH 1C2EA 5HXFA 3A7YA 1F0RA 1J15A 3MU1A 2BD9A 3K6ZA 1F5RA 1QCPA 4UFFH 3F6UH 3AASA 2PV9B 1DUEA 5JDUB 2Z9JA 3TH4H 1N6XA 3S7HB 1XXDA 1IQKA 2THFB 1SGIB 2EI7A 3T26A 1EXFA 3BN9A 4I7YH 2ZCKP 4CBNA 5ABWA 3PROA 2A0QB 5J4QA 3RU4T 2HVXA 5EQRA 1MTVA 1UJ1A 1ANDA 4JZ1A 3MMGA 1FY4A 4X1SU 3VB3A 1YPHC 3A7ZA 3TVJB 1C2HA 2AGGX 1VJAU 4U01A 4MVNA 2HPQH 1QY6A 2PHBA 3GY6A 3V13A 1UTJA 1EZUC 4AORA 1BJUA 1DUAA 1GHAF 1Z1IA 1GBFA 1ZYOA 1W0ZU 4B2BA 3TGJE 3SNDA 3ELAH 4IW4E 5DP9A 6LPRA 4B73A 1AWHB 3UFAA 3RMNH 2A5AA 2TGAA 1BTYA 1TONA 4WF8A 1O33A 2Z9LA 1H8DH 3V7TA 4TY7A 5IDKA 3EE0B 1SLXB 7ESTE 2ODQA 3K6YA 3PTNA 3RXFA 3A7TA 1MD7A 1S84A 2PKAB 3TPIZ 4I33A 4I8GA 1MCVA 1ARCA 2SNVA 3QN7A 1ELEE 3KEEA 5F8TA 1KXEA 1PPHE 2CF8H 1DT2A 1ZJKA 2AGIX 5A09A 1G2MA 1GJCB 1JOUB 4D8NA 2FI4E 2QXIA 1EAIA 1MKWK 4GHTA 1AO5A 1GI7B 3GY2A 2CV3A 2AEIH 4ZH8A 1VR1H 1SBWA 1PYTC 4UONA 1ZR0A 2PR3A 1O2KA 2G52A 1FY5A 1TA2A 3VB5A 2A7HA 1YC0A 1QJ7B 1S0QA 2F91A 2V35A 1ACBE 3QLPH 4AGKA 3RDZA 1B7XB 2CF9H 1O3LA 1MUEB 4WMDA 2ZKSA 2BD8A 1NS3A 2GCHG 1C4Y2 2TGTA 1C5PA 1TNIA 2BLOA 1F5LA 3VFEA 1BCUH 1ZRBA 3RXGA 4KKDA 1GG6C 4O97A 1BTZA 1J16A 1PQ8A 1CBWC 3GY3A 3ATLA 1EPTB 3AK5A 2D1JA 3B23B 2B8OH 1EJAA 1P2KA 4WY3A 1DM4B 1UVTH 1C2MA 3LC5A 4Y7BA 3RXVA 1TNJA 1BT7A 1GI0A 2A5IA 2KAIB 2ANKH 3RXBA 1SGPE 2BY7X 2XXLA 2ZHDA 1K28D 2ZHEH 2AIPA 5K0HA 3STJA 3RP2A 2ZFQH 3ATWA 2ZFFH 3GICB 1A1RA 4A1XA 4CR5A 1OWIA 4A92A 4ZUHA 5T6DA 1WUNH 4FU7A 4X8UH 4ZKSU 1E35B 1AB9C 2UWPA 4BAQB 1UVUH 3GYMA 2VVVA 5DJ7A 3ZYDA 1HAXB 2P95A 2G81E 3H5CB 1XVOA 2BD3A 3FZZA 4D7FA 2BB4A 4Q2KA 3KQDA 3M7UA 1YPGH 3LOXA 1GCDA 1AY6H 3QZQA 1L0ZA 3OY5U 4MNYA 4OM9A 5CMXH 4Y6DA 2BTCE 4X1PU 2XTTB 4ABHA 2ZFTA 1SGEE 1N1LA 5TCCA 4ZHMU 1NRRH 2ZFSA 3ZVEA 1C1QA 1A4WH 3BTTE 1FN6A 5DPAA 4OS6A 1DITH 3E16B 1BJVA 1P3EA 1SOTA 1BTPA 3ATIA 3K9XB 3BTGE 4AGJA 4IBLH 4RN6A 1S6FA 2TGPZ 5GIBA 2FTMA 1O2PA 1S83A 1C1VH 1GL1A 4ASHA 1LHEH 1UTMA 2BDBA 3RC4A 1TNLA 2Z7FE 4ISIH 1KXFA 1NY22 1MMJN 1ZLRA 4FVBA 2V0BA 1C5YB 2BLVA 1QL8A 3O8DA 4F4OC 2F4LA 1DANH 4O9VA 2FXRA 1OWHA 2VWLA 3F1SB 3Q76A 3TH3H 3HK6B 2FOBA 4Y8ZA 4FU8A 3U69H 1Z6EA 3JZ1B 4GCHG 1L1GA 2A4GA 3CS0A 1O2XA 4JYTA 1ETRH 4O3UA 5EW2H 3RXMA 2FOGA 3HGPA 3KIDU 1FN8A 2SGFE 1EATA 4DG4A 5EQQA 5F6MA 4AX9H 3SU6A 2FMJA 4H6TA 3UY9A 1HAIH 3ZZ5A 2GZ8A 2ZDNA 2VIOA 1THSH 2BDCA 4I8HA 2C4FH 2JH0D 2BXUH 3GISB 2PTNA 3BV9B 3RXLA 2ALPA 3G01A 1QA7A 2JH5D 4WJG2 1EAUA 3E1XB 3RXSA 5T1VA 3MU4A 4MNXA 4I8LA 1P9UA 1A0LA 1O39A 6CHAB 2J2UA 3T27A 3MH6A 2ZEBA 1DY9A 3NXPA 1AFEH 2PSYA 3SBKA 3GY4A 2QV1A 2VBCA 2P3UB 2O8WA 3PMHB 1T31A 1YPKH 1LQDB 1TX6A 1P10A 3U1JB 2ZC9H 1HV7A 1B5GH 1TMBH 1HAYB 4VGCC 1ELCA 5HMAA 2KAIA 1GMDG 1ZPZA 3ZZCA 4MLFB 2VINA 3DT0H 7KMEH 1IQIA 3UNQA 3KF2A 3QGJA 3O8RA 1T8LA 2O8UA 1O3AA 1CHOF 2P3FH 1A46H 5AHGH 2G51A 2FESH 3F9HA 1K21H 1NZQH 1PJPA 1P2QA 1IQJA 3IWMA 1T8NA 5A0CA 2WV5A 2Q1JA 1P2OA 1W10U 3SORA 4K1SA 4K60A 3OSYA 1QQUA 3PO1B 3PWBA 5ESBA 1YKTA 2ZGBH 1HJAB 1K1PA 2IN2A 1AIXH 2ZPSA 3SU4A 3TGIE 4BXWA 1N6YA 2GV7A 3T62A 1GBJA 5TJXA 1ETSH 3GDUA 3S7KB 2STBE 4NA8A 4MNWA 1V2KT 4OS1A 1ZTKA 2UWOA 4OS4A 1KDQB 1UTLM 4CRFA 4BTTB 5HGGA 4Y11E 1SQOA 1YPJH 8GCHG 2H9TH 5F8ZA 3EA7A 1AZ8A 1TGSZ 1HB0B 2ZIQH 1RS0A 4INLA 2J9NA 1V2QT 2C8ZB 3A83A 2ZGHA 1V2RT 1GMCG 4BAOB 1WTGH 1IHTH 1P02A 1HYLA 1C5XB 4CR9A 2SGEE 3A8CA 1BMAA 4NWLA 3UR6A 1J14A 1SMFE 2BDGA 1FY3A 3RM0H 2WINI 2QAAA 3SU0A 1TBZH 1E0FD 4PROA 3SO3A 3M35A 3R0FA 2BZAA 4NZQA 5A2MH 1SSXA 1D9IA 2Z3DA 2DUCA 1M9UA 2GDEH 1LHDH 1YLDA 2ZQ2A 4YESB 1KYNA 3UOUA 2BVSH 1CO7E 1OS8A 1QJ6B 1THRH 2GCHF 2VIQA 3SGQE 5LPFA 3SV2H 1PPCE 2GT8A 1HAVB 3T2NA 1VITH 1C5VA 1TABE 3B8JA 1BQYA 1W7XH 3EYDA 1KLJH 4YLQH 5E2OA 5J4SA 1C1WH 1UVPA 5C5OA 1Z6JH 3EAJA 4X0WU 1Z8RA 5F03A 3FANA 4A7IB 1K1IA 1TRMA 3P92A 4ESTE 1LTOA 3C27B 3M5LA 4Y8YA 1EQ9A 3SUDA 4WXVA 1C5TA 1CT4E 3V0XA 3SU5A 2ODPA 1LKAA 1P06A 4DW2U 1V2OT 2BOKA 4K8BA 2A5KA 3DHKH 3WY8A 2FDAA 3P95A 1ZMNA 1CE5A 1K1OA 1SQTA 1V3XA 3OY6U 4ZHLU 4AG1A 4INHA 5A8ZA 3QGNB 4Q7XA 1IOEA 3M37A 2WUBA 1TMUH 3GY8A 1KTTB 2W26A 1ZMLA 1F92A 2ZTXA 4FUFA 2WYGA 5JPMH 2CHAB 2BXTH 4DT7B 4MPVA 1QB9A 4B1TA 1K22H 1OP2A 2EA3A 4MG3A 1O2JA 1LHCH 4FUCA 1D3PB 1UTOA 1VCQA 2RG3A 1Z1JA 1HAGE 1WSSH 2BY9X 4K3JA 4X8SH 4X6OA 3NCLA 5A0AE 3UQVA 1FJSA 4Q7YA 2GCTB 2VVUA 1V2VT 1SGDE 2R2MB 1E34B 4NIXA 3M7QA 1UCYE 2VB0A 1DOJA 1RGQA 3DUXH 3SI3H 2ZU3A 3S69A 5L2YH 2GMTC 1HFDA 2P59A 1FAKH 2QXHA 4YZUA 1PPEE 1PQAA 1VITF 1ZGIA 2R2WU 3MU0A 3RXAA 3UUZA 4TWYA 7GCHF 1T7CA 2YNBA 1CBWB 1YP9A 2TBSA 4M7GA 4MDSA 1FXYA 2W7UA 3LJOA 2F9NA 1QGFA 1SGRE 3LC3A 2GGVB 1BZXE 4X2YA 2XYAA 2ZQ1A 2XBYA 2VIPA 2VNTA 3TJNA 8GCHF 2UUFB 1V2MT 3M61U 1TGTA 1FIZA 4CRGA 1GBMA 2WPHS 2XBVA 1EZXC 1GBAA 1WAYB 3ZZ8A 1HRTH 1UK3A 3ENSB 2BY6X 2WYJA 4LOYH 4H4FA 5A0BA 5LPRA 3ODDA 1MCTA 4NA9H 3MO6A 2QIQA 1ZMJA 3MI4A 2Q6DA 3E8LA 2CN0H 1LKBA 3PLPA 1DE7H 1CVWH 1O2VA 1OWDA 3P17H 2WPKS 1TB6H 2GP9B 5LGOA 3BIUH 4B71A 3NUMA 1S82A 3D49H 1J9CH 1AE8H 3ZV9A 2BLWA 5JYIA 1Y3XA 2FYRA 1VCPA 2ALVA 3E91A 1QFKH 2G5VA 2VIWA 1V2PT 1H4WA 4CRCA 1GCTB 2NWNA 3GOVB 2GZ9A 3H7TA 1C9PA 4XSKU 1XKBC 5EW1H 3LGIA 5DKMA 3MH7A 1C2LA 1CU1A 1GI2A 2ZNKH 3PV5A 1GDQA 2ANYA 2P94A 1AE5A 4ISHH 1BDAA 1PPGE 5EODA 1T8MA 2D8WA 1HJ9A 1EZSC 1WU1A 1ZPBA 2R9PA 5FX6A 1JMOH 4AFZA 1CHGA 1YCPM 1SGFG 3VEQB 3AVZA 5EGMA 1XVMA 1FNIA 4JZEH 4Q80A 4Y76A 3FP6E 2V3HH 2AGEX 1O5DH 2JETB 4FUDA 1GBBA 1GGDB 1QBVH 1SG8B 1JWTA 3GY7A 2RA0A 1EAWA 1UTPA 5L30H 1H8IH 3MU8A 4BAHB 4CHAC 1GBIA 4UFEH 3U8TH 5HYOA 5FBEA 1PPZA 3MO9A 1C2JA 1F5KU 1O2GH 4CREA 1G3CA 1QRZA 2OBOA 7GCHG 3ZZ6A 3RXOA 1GBEA 5K7RA 2BQ7B 3BG8A 1GBHA 2QY0B 3RXJA 1SLVB 3BG4B 5FCRA 3VB4A 3SJ9A 8LPRA 1Z8JB 2ODYB 1O2UA 1G37A 2FLRH 1A61H 1Y59T 2AH4X 2FS9A 2G00A 4FU9A 3D23A 1O30A 3UQOA 1LHGH 5C20A 2CXVA 3DD2H 1LQEA 2C93B 2ZPRA 5JBCS 3UNSA 4GLYA 6GCHF 3TJOA 3SQHE 1E37B 1DWDH 1NRQH 5AFZH 2BX4A 2Z3EA 1WOFA 1O2SA 4Y8XA 1QRWA 1KXAA 1MQ5A 3S9BA 1EJNA 2XRCA 1SGTA 1WQSA 3UIRA 1SLWB 2ZFPH 3QX5H 2UUYA 2BD2A 1HAHH 1PYTD 2A4RA 1YCPK 2ZI2H 4XBCA 1C5OH 4A6LA 4K2YA 1ZSLA 3FP7E 3ZVAA 3RXTA 1RIWB 1P2MA 4Y0YE 5G4BA 1AQ7A 1VJ9U 1Y8TA 2EC9H 4U30A 3U9AH 1ESBA 3RMLH 5A8YA 3TK9A 3BTHE 1YPHE 3SZEA 1RJXB 1GMDF 2H1UA 1C2GA 4A5TS 2VWOA 4D9QA 1ELVA 2B0FA 4A1VA 2QGRA 4JK5A 1S0RA 4UE7H 3ZYEA 1TPPA 1V2UT 1MTWA 1GBDA 2FEQH 3NK8A 1Z8GA 1GJDB 1NRPH 1SGFA 2R3UA 1DS2E 1F0TA 2XNIA 1GI9B 3KNXA 2R0LA 2TIOA 8KME2 1QBOA 5DO4H 2R0KA 3SN8A 2PWXA 5ESTE 1O3IA 1BTUA 1KLIH 1CT0E 3QO6A 4LK4A 2AMQA 2V6NA 1CGHA 1C5SA 1O3GA 2DE9A 4Z0KA 1YGCH 3LGUA 3FP8E 3A8DA 4M9FA 4TYDA 1WCZA 2J94A 3SJKA 5AVDA 1DVAH 2A7JA 2F9UA 1O2TA 3U98H 4GUXA 4DIHH 3A88A 1O5GH 3MFJA 1QQ4A 1MKWH 1RRKA 1WYKA 4ZMAH 4K69A 1GJAB 3SW2B 3LH3A 1P01A 3SUGA 3A80A 1A5GH 3A7VA 4ABBA 3E6PH 1NFXA 2R3YA 3NPSA 1NC6A 5EU8A 4H42U 2NU0E 2QN5T 3SV8A 4MPWA 4ABEA 4IN1A 1AHTH 2ESTE 3E90B 5DGJA 4AFSA 3VPKA 3LGYA 3LPRA 1T4VH 6GCHG 2Z3CA 2BD7A 1BHXF 5FBIA 1DWEH 2BOHB 3AAVA 3M3TA 4SGBE 1AKSA 2BHGA 2TGDA 1RTFB 3GCOA 3EGKH 3RXHA 2A4QA 1AU8A 2ZDVH 3EA9A 3MH5A 1O3FA 2FO9A 4AOQA 1GBLA 2XWBI 1LVBA 1AD8H 2ZCLP 4ZKOU 3RXQA 4ISOA 2RDLA 1C1MA 2EEKA 2Y5GA 2VIVA 1GPZA 3NWUA 2WPMS 1V6DA 1Y3WA 2ZU2A 3FAOA 5EG4A 3PB1E 1TPAE 1JRTA 2AFQB 2FIRH 1TNHA 2ZZUH 4O3TA 1L4ZA 1D3QB 3MNBA 4XE4A 4K1EA 3EA8A 2A32A 3RLYH 2FPZA 1DXWA 3LGWA 2I6QA 4FUBA 3W94A 3RM2H 4YO9A 4GAWA 1A0HB 1NM6A 3KCGH 3MNSA 4I8JA 1OOKB 4TPYA 1C5ZB 4ISNA 1KSNA 1ELBA 2GV6A 4U32A 1ZTJA 2FX6A 1KDQA 2PFEA 2HWLB 1KTSB 4FVDA 5DP8A 1S81A 2QYIA 1CHOG 1HAVA 1GBKA 2PSXA 5JBBS 2WPLS 1OWJA 1OX1A 2ZG0H 2TRMA 4WH8A 1A3BH 3A89A 3HKIB 3RXDA 5EPNA 2Y5HA 1GJ4H 4TY6A 1BTWA 1C4U2 1TX7A 2GVFA 5DP3A 1QL9A 1TRNA 3T29A 1BTXA 1LPGB 3PWCA 1XUIA 3SNBA 3GY5A 2C3SA 5E0JA 1DDJA 1MH0A 4LZ1H 1BHXB 1O3BA 4NSYA 2GT7A 2M5TA 2SGDE 1O2MA 2ZGXH 1SHYA 2O9QA 4KTSA 5LH8A 3W95A 1ZGVA 3NKKA 2FOCA 2LPRA 1OYQA 5E8EH 3ZV8A 2GDDA 1EP6A 2Z9GA 1P57B 1BRAA 5C5NA 3TLOA 1NU7B 1TA6A 4X2VA 3LU9B 4FUJA 3M3SA 8ESTE 3TIUA 1ETTH 3H7OA 2WPIS 3SV6A 2J38A 1YF4A 3KQEA 3P8OA 2J34A 4B76A 5AF9H 3BTQE 1K1LA 3SU2A 1GVLA 1W0YH 3BTWE 1ELFA 4HGCA 1QHRB 3Q3KA 4YTAA 1GJ6A 1S5SA 2PGBB 3ODFA 2OP9A 3RU4E 1C2IA 1F0SA 3BSQA 1EP5A 1A5HA 4IC6A 3M7TA 3PLKA 1QA0A 3F9GA 2HOBA 2OTVA 2OQ5A 2XC4A 2G4TA 1FONA 3GCHC 3Q3XA 4BXSA 1SFIA 1UHBB 2ZDAH 4K8YA 3S0NA 1HXFH 1Y5UT 3L6PA 4ZHAA 4AG2A 3Q3YA 5DP6A 3AW1A 3SUEA 2XCNA 1O2OA 3SYJA 4B74A 4MQAA 3ATMA 3BTKE 4BOHA 3VB7A 1G2LA 4DIIH 1W14U 1ZJDA 1W3CA 5GCHF 1O36A 2XBXA 1FZZA 1YM0A 3ZZ4A 2Q6FA 1Y3VA 3UPEA 2OUAA 4H6SB 3STIA 2FI5E 5E2PA 2B7DH 2SGPE 3MH4A 1MQ6A 3U1IB 1RIWC 1C5LH 2ZTYA 3F9FA 3B9FH 3K2UA 4NZLA 1N8OC 1O2LA 1K1NA 4BNRA 1LPZB 5C67A 1HBTH 1C1OA 2WHXA 4ABGA 4Y79A 4JZDH 5DP7A 1W8BH 4GHQA 1AI8H 3MWIU 1OSSA 3EQ0H 2A7CA 2NU4E 3ATKA 4AFUA 5SGAE 4KELA 4NIWA 3A81A 2FOMB 2BM2A 1PPFE 1TFXA 4SGAE 2BYAX 2NU2E 3PMBB 4GSOA 1AFQB 2Y82A 1JIRA 1OWKA 3BTEE 4B6EA 5ETXA 1GL0E 1O3JA 1GMHG 4JK6A 5BRRE 3OTJE 3VXFH 4NFEA 2Y81A 3BEIB 2GTBA 1MAXA 3D62A 1LVOA 4WWYA 3RMMH 1SPJA 2GCTC 3VGCC 1QRXA 2AIQA 1FUJA 2WV9A 1JXPA 1ZSJA 2P8OC 3ZZAA 4BAKB 3URCA 3LIWA 2F9VA 2OLGA 4CRDA 1CSOE 3PV4A 4K5ZA 1TNKA 3QWCH 4D9RA 1AGJA 1D6WA 1W2KH 4AFQA 1C9TA 1YYY1 4KP0A 4X6PA 2Y7XA 1O2YA 2H9HA 3A86A 4X1QU 4MPXA 1LHFH 3P6ZB 3KHVA 3QTVH 4JYVH 1GMHF 2VIDA 3ZVDA 1GHYH 2UUKB 1ANCA 3KQCA 3RXPA 1BRBE 1TALA 1GHXH 3BF6H 3CS7A 1BITA 2ZF0H 3BTME 3SNAA 1ZOMA 5I46H 1FPCH 1TGCA 1EOJA 3GDSA 1AMHA 4CRAA 2PUXB 2OC1A 3CP7A 5F8XA 2CJIA 1WBGB 2HGTH 2OINA 9ESTA 4WH6A 1GMCF 3GCTF 1C1NA 3A85A 3URDA 5DK1A 1CA0B 2ANMH 1O35A 2BD4A 1AUJA 1HPGA 1P03A 1MKXK 3M36A 4IC5A 2D26C 3P8NA 2P93A 4B75A 2I6SA 1NO9H 1NFYA 1GHWH 4GPGA 3SGAE 1DSUA 1Y5BT 2H5CA 4X8TH 1O3KA 2VU8E 1D6RA 3TITA 1Q3XA 1MTNB 1MZAA
chains in the Genus database with same CATH superfamily
2A2QH 1K9OE 1MZDA 2P16A 2TPIZ 2OCVB 4I31A 1VGCC 1XUGA 4OGYA 1DFPA 2ILNA 3F9EA 4DCDA 4AB8A 1TOCB 3ZVCA 1AVWA 1XMNB 3M5NA 1YPLH 1BUIA 1GHAG 2G55A 4O03A 1AWFH 3SJOA 2BDAA 3P70B 5GWZA 4KTCA 3WW7A 1MU6B 2Y7ZA 2O8TA 4CHAB 3QZRA 2ASUB 1IQNA 2CHAC 2ZHQH 2LNCA 4K1TA 1TIOA 1TQ7B 3HKJB 1CT2E 1CA8B 5GPIB 1Z7KA 4OS2A 1GI8B 1PPBH 5FX5A 1WQVH 5B6LA 1GJ9B 2ZECA 5C1YA 1IQLA 2W6ID 2CGAA 3QDZB 1SHHB 1P0SH 1IQEA 1H9LB 4RI0A 1O3MA 1GJ5H 5A8XA 2PKAA 2V3OH 4JMYA 1BA8B 1NFUA 3LKWA 1HJAC 1YY3A 5EOKA 1EUFA 3FVFB 1ANEA 3BTFE 5CHAB 3UB0A 1G3BA 3U8RH 3TH2H 1S6HA 4D76A 4ABAA 1XM1A 3E0PB 1TPOA 2YOLA 1QZ8A 1VKYA 1TBQH 2Y6TA 3UNRA 1IAUA 3BTDE 4NSVA 1GCTC 5L2ZH 2VGCB 1CGJE 2GX4A 1TGBA 2FOFA 3KN2A 4AZ2B 3RU4D 3SJIA 3O8CA 2BZ6H 3Q00A 2FM2A 1O32A 1CGIE 1FY8E 2BLQA 1O5FH 1L1NA 1SC8U 1KXDA 2XW9A 3A87A 5JBAS 1WV7H 2FLBH 1O3NA 1JIMA 6ESTA 1E38B 3KYFA 4YOIA 2VJ1A 1Z8IB 1D3DB 3LONA 1DLKB 4R0IA 4INKA 4ZROA 4WMFA 1A7SA 4HG6A 2AMPA 3QK1A 1WTHD 1BMNH 1Y3UA 1SVPA 1SQAA 1MKXH 5C1UA 1AKSB 1TQ0B 2FTLE 2ZU4A 4I32A 2BX3A 2BVRH 3PM3A 1IQGA 2XWAA 1LVMA 3UREA 1GWAA 5FPTA 1UK4A 2P8OB 2Q6GA 4X1NU 5T3HA 3S9AA 1GI5A 2F9OA 3LH1A 3SHAH 1O34A 1OPHB 2QF4A 2HNTF 1TBRH 4X2WA 3VGCB 1C1RA 1GJ7B 2SNWA 3DFLA 4FUGA 2G4UA 4X6NA 1YPMH 2RA3A 1IHSH 1TYNA 2VGCC 2J4IA 1J8AA 1Y5AT 3A7WA 1XUKA 3PMAB 1NBMD 1SKYE 1QBNA 2XOKD 4IMZA 1V2LT 2W3KA 4RSPA 4A1TA 3LT3A 4B6FA 1AFQC 1O3EA 3A7XA 3E0NB 1SI5H 3I78A 3MNXA 4X8VH 5CHAC 1GDUA 2GMTB 3M3VA 1BMLA 2DE8A 1O3HA 3FKSD 1ZHMA 1HAPH 2F3CE 1BOQA 4ABFA 3L3TA 4TWWA 3NZIA 1XX9A 4TPIZ 1ESAA 2Y5FA 3IITA 1H9IE 4DY7B 2HNTE 1SGYE 3F2GA 2FZZA 2Z9KA 2QXGA 3TJUA 1SGCA 1LMWB 2BD5A 4DJZB 4NGAH 5FHTA 1SB1H 2EI6A 1P3CA 4JCNA 1GHZA 2H5DA 1O38A 4DURA 3RXKA 1Z71A 1THPB 1IQMA 5AFYH 1A2CH 1W7GH 1EB1H 1TX8A 1AUTC 2JKHA 1G32B 1INCA 1ELAA 2OD3B 4F49A 1C2DA 1BB0B 1FY1A 2F9PA 3SOSA 4NIVA 3I29A 2QA9E 5FCKA 4ACAA 3M5MA 1OP8A 2P3TB 2ZDLA 4THNH 1ZPCA 1BBRE 1UTNA 3Q77A 4UFDH 1HIAA 1QR3E 2F83A 2ANWA 2L74A 2XBWA 2ZU1A 2VWMA 3HGNA 5T6FA 1HNEE 4ZXXH 4JZFH 3S9CA 2SGAA 1LVYA 3MOCA 5CE1A 3EDXB 3GCHB 4IMQA 5C17A 3HATH 1SL3A 4UDWH 1GBCA 3BEFB 3LJJA 4CH2B 3D65E 3PTBA 2WPJS 1C5QA 1GBTA 1AB9B 4MTBA 5L6NH 3T28A 1C1TA 2FODA 2FOAA 3ZVBA 2O8LA 4OS5A 5FXLA 2FX4A 5DSFA 1F0UA 4ABDA 4IS5A 1TWXB 4YM9A 2HPPH 1MTSA 4YXWD 1DPOA 2W5EA 2GKVE 1UTKA 3OX7U 3O8BA 4OGXA 3OTPA 1AZZA 3C1KA 4ZKNU 3TNSA 1ELTA 2O8MA 2ZWLH 4NFFA 1MU8B 4WMEA 3ZZBA 1HDTH 1W13U 1XUJA 1PQ7A 3UWIA 4Y10E 4JYUH 4NWKA 5HIYA 1NRSH 1QL7A 1QURH 3JZ2B 2EI8A 4VGCB 2A1DB 3F68H 1C2FA 3TGKE 2VWNA 5GNDA 1EPTC 2B9LA 1XKAC 2VH0A 1DXPA 3SGBE 4HZHA 2H6MA 1DICA 2FP7B 4J2YB 4R8TB 1FDPA 1QNJA 4BTIB 1GHBG 4B2CA 1UCYH 1NPMA 1UVSH 3BEUA 2HNTC 1RTKA 2WZQA 4YOGA 5DG6A 5TCAA 1P11E 4B2AA 1DLEA 2WUCA 1O2IA 3ITIA 1C4V2 3SU1A 1EFRD 3BIVH 2FOEA 1LPKB 4AYVB 4E06H 1ZHRA 1B0EA 4Z6AH 1SFQB 4I86A 1SR5C 4ZKRU 1YPEH 1ZRKA 3FZDA 4E7RG 1EPTA 1ESTA 1K1JA 3T5FH 2BQWB 1BMMH 3OEHD 5EXNA 1GI4A 2PW8H 3RXCA 1PFXC 2BVXH 1L1JA 1GVZA 2IJD1 3AAUA 2YMSC 3EE7A 1HCGA 3LGTA 4DOQA 2XCFA 2Z9IA 1GVKB 3PO1C 1ANBA 2ZCHP 1MBQA 1IQFA 3UOPA 4F55A 2ZA5A 3PV2A 2GZ7A 4YOJA 2BDIA 2QF3A 2ZPQA 2FS8A 3RXIA 1EASA 1H1BA 1NT1A 3MU5A 2BY8X 2WV4A 5C2ZA 1EAXA 1TMTH 2C90B 2XC5A 1ABIH 1G36A 4UD9H 1HIAB 1V2ST 2G5NA 1FMGA 5GXPA 1N8OB 5HM9A 2KM0A 3SNCA 2HALA 3DFJA 1EJMA 5F53A 1AVGH 1MBMA 2HLCA 1DX5M 5T6GA 1RD3B 2PUQH 2IJOB 1NROH 5BPEA 2A31A 2OBQA 4HTCH 2ZTZA 5GJ4B 1NU9A 3ZZDA 2W3IA 1BRCE 2AMDA 1NN6A 1NFWA 3KL6A 6CHAC 3ZZ3A 3UWJH 4YLUA 3KGPA 5DP4A 2UWLA 1A5IA 1CQQA 1AVXA 1DWBH 1NTPA 4AYYB 5EPYA 1O31A 1FPHH 1O2RA 1G9IE 2CMYA 1W11U 1ELDE 3RC6A 1A0JA 2FI3E 1P9SA 3RMOH 1SGNE 1A3EH 2VH6A 2BDHA 1Y3YA 3SQEE 2OC7A 2UUJB 3TJVA 1GI6A 1C5RA 1GHBF 5LPEA 1TRYA 1EB2A 1SOZA 1EOLA 1WXRA 1EKBB 1MAYA 2A4OA 1MTNC 3HPTB 1JBUH 5I25A 2PGQB 3MYWA 1ZHPA 1DSTA 4YT7H 1TAWA 4X1RU 4XD7D 1T32A 3DA9B 1PQ5A 2STAE 2XC0A 4CBOA 4ZXYH 1GI1A 1EX3A 3MNCA 1V2JT 1S6LA 2BMGB 4XFQA 5E0HA 1CA0C 4WVPE 3TNTA 3F3BA 2NU3E 4GCHF 5GCHG 1C5NH 1LCYA 3MHWU 3AW0A 1QTFA 1J17T 1V2WT 4I8KA 3VXEH 4NCYA 1YBWA 3PYHA 1GJ8B 1LO6A 3FFGA 1UVOA 1O2NA 1V2TT 1YLCA 9LPRA 3N7OA 4FOUC 3RLWH 1GHVH 4FXGH 2HLDD 4KGAA 4Q7ZA 4DVAU 2C8XB 1C1UH 2W7SA 5PTPA 2RCEA 1T4UH 2Z6BD 1SLUB 5HM2A 2G8TA 5C1XA 3HK3B 2ZDKA 4IGDA 2AERH 1MD8A 1UHBA 1FLEE 4KTUA 4Y71A 1P05A 4D7GA 3SNEA 4Y7AA 3SUFA 4NIYA 3FO8D 3RXRA 5B6OA 4HI3A 1BBRK 5JBTA 1VCWA 2RDEA 3A8AA 3SV9A 1BTHH 1RTLA 2H2ZA 1O3DA 1ZTLA 2L6OA 3ESTA 2BQ6B 1ORFA 2XNDD 3PMJA 3OYPA 3ZZ9A 2H9EH 2ZFRH 5FPSA 1ID5H 1L2EA 4RKOB 1Q31A 1FQ3A 2PKSC 2ZHFH 1BRUP 1LDTT 2QC2A 4CRBA 1H9HE 1UO6A 2YNAA 4Y0ZE 4BAMB 1GJBB 2A2XH 2AHME 3H09A 4ABJA 4WXIA 4XDEA 1UCYK 3SU3A 5H4IB 4UFGH 4JZIA 1OWEA 1P2IA 3TK5A 4U2WA 2KCOA 2ZGCA 1BIOA 1T8OA 4J1YA 1HUTH 1E36B 2V7QD 4FUHA 1HAOH 2J98B 1ABJH 4RT1A 1KLTA 1NESE 2IPQX 3RC5A 2OK5A 3SJ8A 3P8FA 1G30B 1O3OA 4HFPB 1K1MA 3RXEA 4NA7A 3V3MA 1NRNH 1BBRH 1DWCH 3A84A 3P8GA 4GVUA 1GG6B 1TGNA 3SZNA 3I77A 3CENA 4YT6H 2FWWA 4XRNA 3ZVFA 1QIXB 2ZO3H 1C5UA 1IQHA 3OEED 2QXJA 5FPYA 2SFAA 1AN1E 2GD4B 2OC8A 2ZP0H 1D4PB 1GGDC 3LGVA 2PLXA 3QTOH 2JETC 1RFNA 2ZDMA 2PTCE 2AS9A 1D3TB 2D2DA 1C5WB 1FI8A 2NU1E 1V2NT 5C3NA 3IG6B 1GI3A 3GCTG 4NG9H 5JB9S 4ABIA 1HAZB 4UEHH 5E0GA 4LZ4B 5C94A 7LPRA 2OXSA 2J97A 4CH8B 1C2KA 4BTUB 1OKXA 1VGCB 4ZAEA 5JB8S 3TU7H 2YMSD 1FIWA 2C8WB 1U6QA 3RXUA 1GDNA 1HGTH 1UTQA 2QCYA 3LDXH 4IN2A 1OYTH 2OQUA 1B0FA 1C5MD 1G3EA 4QT8C 2F9BH 2ZGJA 1JRSA 1O5AB 1FAXA 5EXMA 4MPUA 3F0PA 4X2XA 4BANB 3RUOA 3N7DA 2AYWA 1K2I1 1OP0A 3MTYA 3GYLB 4X6MA 4AN7A 3SI4H 3A8BA 1MTUA 2IOTA 1F2SE 1P2JA 1VZQH 1QJ1B 4E05H 2B5TB 1TOMH 3SV7A 1UK2A 3R3GB 4LXBH 5KEDA 1C1SA 1TLDA 1TPSA 3M5OA 1TE0A 1P12E 1OXGA 2K1QA 4AB9A 1P04A 1O5BB 3GDVA 5EQSA 1HXEH 1O0DH 1O37A 1O3CA 4DGJA 1P2NA 3K65B 1VITG 1O3PB 1O2HA 1KXCA 2Y80A 1S85A 1ZZZA 5IYTA 2JH6D 2HRVA 1RXPA 2Z94A 3U8OH 3MO3A 2C8YB 2FYQA 2FOHA 2J95A 1KXBA 1W12U 1XUFA 2VVCA 3E3TA 3TK6A 1UMAH 1KY9A 4FUEA 1XUHA 1G3DA 1QB1A 5EXLA 1DY8A 1O2ZA 1YCPH 1QB6A 5GDSH 3A82A 5FAHA 3SHCH 1O5EH 5DP5A 4ISLA 1L4DA 1O2WA 3QUMP 4RKJB 1O5CB 1F7ZA 3DSOA 1FV9A 2SGQE 1SGQE 1ELGA 3ZVGA 2ZHWH 1ZSKA 4FUIA 4OS7A 1EZQA 2ZU5A 4XOJA 3GCNA 4AC9A 2ULLA 2BDYA 3UR9A 3ZZ7A 2J92A 2QF0A 1X7AC 3L33A 3PLBA 1P8VC 1XXFA 1HLTH 4XBBA 3T25A 3OU0A 1C1PA 1TNGA 1ARBA 3VB6A 4E7NA 3V12A 1KIGH 2OC0A 2BY5X 4XBDA 1P09A 2PKSB 1Q2WA 3KQBA 3BG4C 1HJ8A 2CK3D 2A45B 1O2QA 4MNVA 2IPHA 3UTUH 1C2EA 5HXFA 3A7YA 1F0RA 1J15A 3MU1A 1BMFD 2BD9A 3K6ZA 1F5RA 1QCPA 2JDID 4UFFH 3F6UH 3AASA 3N99A 2PV9B 1DUEA 5JDUB 2Z9JA 3TH4H 1N6XA 3S7HB 1XXDA 1IQKA 2THFB 1SGIB 2EI7A 3T26A 1EXFA 3BN9A 4I7YH 2ZCKP 4CBNA 5ABWA 2KCYA 3PROA 2A0QB 5J4QA 3RU4T 2HVXA 3DSPA 5EQRA 1MTVA 1UJ1A 1ANDA 4JZ1A 3MMGA 1FY4A 4X1SU 3VB3A 1YPHC 1MABB 3A7ZA 3TVJB 1C2HA 2AGGX 1VJAU 2LELA 4U01A 4MVNA 2HPQH 1QY6A 2PHBA 3GY6A 3V13A 1UTJA 1EZUC 4AORA 1BJUA 1DUAA 1GHAF 1Z1IA 1GBFA 1ZYOA 1W0ZU 4B2BA 3TGJE 3SNDA 3ELAH 4IW4E 5DP9A 6LPRA 4B73A 1AWHB 3UFAA 3RMNH 2KZ4A 2A5AA 2TGAA 1BTYA 1TONA 4WF8A 1O33A 2Z9LA 1H8DH 3V7TA 4TY7A 5IDKA 3EE0B 1SLXB 7ESTE 2ODQA 3K6YA 3PTNA 3RXFA 3A7TA 1MD7A 1S84A 2PKAB 3TPIZ 4I33A 4I8GA 1MCVA 1ARCA 2SNVA 3QN7A 1ELEE 3KEEA 5F8TA 1KXEA 1PPHE 2CF8H 1DT2A 1ZJKA 2AGIX 5A09A 1G2MA 1GJCB 1JOUB 4D8NA 2FI4E 2QXIA 1EAIA 1MKWK 4GHTA 1AO5A 1GI7B 3GY2A 2CV3A 2AEIH 4ZH8A 1VR1H 1SBWA 1PYTC 4UONA 1ZR0A 2PR3A 1O2KA 2G52A 1FY5A 1TA2A 3VB5A 2W6JD 2A7HA 1YC0A 1QJ7B 1S0QA 2F91A 2V35A 1ACBE 2WPDD 3QLPH 4AGKA 3RDZA 1B7XB 2CF9H 1O3LA 1MUEB 4WMDA 2ZKSA 2BD8A 1NS3A 2GCHG 1C4Y2 2TGTA 1C5PA 1TNIA 2BLOA 1F5LA 3VFEA 1BCUH 1ZRBA 3RXGA 4KKDA 1GG6C 4O97A 1BTZA 1J16A 4TSFD 1PQ8A 1CBWC 3GY3A 3ATLA 1EPTB 3AK5A 2D1JA 3B23B 2B8OH 1EJAA 1P2KA 4WY3A 1DM4B 1UVTH 1C2MA 3LC5A 4Y7BA 3RXVA 1TNJA 1BT7A 1GI0A 2A5IA 2KAIB 2ANKH 3RXBA 1SGPE 2BY7X 2XXLA 2ZHDA 1K28D 2ZHEH 2AIPA 5K0HA 3STJA 3RP2A 2ZFQH 3ATWA 2ZFFH 1E79D 3GICB 1A1RA 4A1XA 4CR5A 1OWIA 4A92A 4ZUHA 5T6DA 1WUNH 4FU7A 4X8UH 4ZKSU 1E35B 1AB9C 2UWPA 4BAQB 1UVUH 3GYMA 4ZCNA 2VVVA 5DJ7A 3ZYDA 1HAXB 2P95A 2G81E 3H5CB 1XVOA 2BD3A 3FZZA 4D7FA 2BB4A 4Q2KA 2QE7D 3KQDA 3M7UA 1YPGH 3LOXA 1NBME 1GCDA 1AY6H 3QZQA 1L0ZA 3OY5U 1WDIA 2EY4C 4MNYA 4OM9A 5CMXH 4Y6DA 2BTCE 4X1PU 2XTTB 1E1QD 4ABHA 2ZFTA 1SGEE 1N1LA 5TCCA 4ZHMU 1NRRH 2ZFSA 3ZVEA 1C1QA 1A4WH 3BTTE 1FN6A 5DPAA 4OS6A 1DITH 3E16B 1BJVA 1P3EA 1SOTA 1BTPA 3ATIA 3K9XB 3BTGE 4AGJA 4IBLH 4RN6A 1S6FA 2TGPZ 5GIBA 2FTMA 1O2PA 1S83A 1C1VH 1GL1A 4ASHA 1LHEH 1UTMA 2BDBA 3RC4A 1TNLA 2Z7FE 4ISIH 1KXFA 1NY22 1MMJN 3VG8A 1ZLRA 4FVBA 2V0BA 1C5YB 2QF5A 2BLVA 1QL8A 5HKKD 3O8DA 4F4OC 2F4LA 1DANH 4O9VA 2FXRA 1OWHA 2VWLA 3F1SB 3Q76A 3TH3H 3HK6B 2FOBA 2K0QA 4FU8A 4Y8ZA 3U69H 1Z6EA 3JZ1B 4GCHG 1L1GA 2A4GA 3CS0A 1O2XA 4JYTA 1ETRH 4O3UA 5EW2H 3RXMA 2FOGA 3HGPA 3KIDU 1FN8A 2SGFE 1EATA 4DG4A 5EQQA 5F6MA 4AX9H 3SU6A 2FMJA 4H6TA 3UY9A 1HAIH 3ZZ5A 2GZ8A 2ZDNA 2VIOA 1THSH 2BDCA 4I8HA 2C4FH 2JH0D 2BXUH 3GISB 2PTNA 3BV9B 3RXLA 2ALPA 3G01A 1QA7A 2JH5D 4WJG2 1EAUA 3E1XB 3RXSA 5T1VA 3MU4A 4MNXA 4I8LA 1P9UA 1A0LA 1O39A 6CHAB 2J2UA 3T27A 3MH6A 2ZEBA 1DY9A 3NXPA 1AFEH 2PSYA 3SBKA 3GY4A 2QV1A 2VBCA 2P3UB 2O8WA 3PMHB 1T31A 1YPKH 3KQ5A 1LQDB 1TX6A 1P10A 3U1JB 2ZC9H 5EJZA 1HV7A 1B5GH 1TMBH 1HAYB 4VGCC 1ELCA 5HMAA 2KAIA 1GMDG 1ZPZA 3ZZCA 4MLFB 2VINA 3DT0H 7KMEH 1IQIA 3UNQA 2KCPA 3KF2A 3QGJA 3UAIC 1T8LA 3O8RA 2O8UA 1O3AA 1CHOF 2P3FH 1A46H 5AHGH 2G51A 2FESH 3F9HA 5IK2D 1K21H 1NZQH 1PJPA 1P2QA 1IQJA 3IWMA 1T8NA 5A0CA 2WV5A 2Q1JA 3F2HA 1P2OA 1W10U 3SORA 4K1SA 4K60A 3OSYA 1QQUA 3PO1B 3PWBA 5ESBA 1YKTA 2ZGBH 1HJAB 1K1PA 2IN2A 1AIXH 2ZPSA 3SU4A 3TGIE 4BXWA 1N6YA 2GV7A 3T62A 1GBJA 5TJXA 4Q63A 1ETSH 3GDUA 3S7KB 2STBE 4NA8A 4MNWA 3MQKC 1V2KT 4OS1A 1ZTKA 2UWOA 4OS4A 1KDQB 1UTLM 4CRFA 4BTTB 5HGGA 1W0KD 4Y11E 1SQOA 1YPJH 8GCHG 2H9TH 5F8ZA 3EA7A 1AZ8A 1TGSZ 1HB0B 2ZIQH 1RS0A 4INLA 2J9NA 1V2QT 2C8ZB 3A83A 2ZGHA 1V2RT 1GMCG 4BAOB 1WTGH 1IHTH 1P02A 1HYLA 1C5XB 4CR9A 1FX0B 2SGEE 3A8CA 1BMAA 4NWLA 3UR6A 1J14A 1SMFE 2BDGA 1FY3A 3RM0H 2WINI 2QAAA 3SU0A 1TBZH 2J98A 1E0FD 1H8HD 4PROA 3SO3A 3M35A 3R0FA 2BZAA 4NZQA 5A2MH 1SSXA 1D9IA 2Z3DA 2DUCA 1M9UA 2GDEH 1LHDH 1YLDA 2ZQ2A 4YESB 1KYNA 3GS9A 3UOUA 2BVSH 1CO7E 1OS8A 1QJ6B 1THRH 2GCHF 2VIQA 3SGQE 5LPFA 3SV2H 1PPCE 2GT8A 1HAVB 3T2NA 1VITH 5DN6D 1C5VA 1TABE 3B8JA 1BQYA 1W7XH 3EYDA 1KLJH 4YLQH 5E2OA 5J4SA 1C1WH 1UVPA 5KGOA 5C5OA 1Z6JH 3F2FA 3EAJA 4X0WU 1Z8RA 5F03A 3FANA 4A7IB 1K1IA 1TRMA 3P92A 4ESTE 1LTOA 3C27B 3M5LA 4Y8YA 1EQ9A 3SUDA 4WXVA 1C5TA 1CT4E 3V0XA 3SU5A 2ODPA 1LKAA 1P06A 4DW2U 1V2OT 2LP6A 3PRDA 2BOKA 4K8BA 2A5KA 3DHKH 3WY8A 2FDAA 3P95A 1ZMNA 1CE5A 1K1OA 1SQTA 1V3XA 3OY6U 4ZHLU 4AG1A 4INHA 5A8ZA 5HIZA 1K0HA 3QGNB 4Q7XA 1IOEA 3M37A 2WUBA 1TMUH 3GY8A 1KTTB 2W26A 1ZMLA 1F92A 2ZTXA 4FUFA 2WYGA 5JPMH 2CHAB 2BXTH 4FETA 4DT7B 4MPVA 1QB9A 2KX4A 2JJ1D 4B1TA 1K22H 1OP2A 2EA3A 4MG3A 3OFND 1O2JA 1LHCH 4FUCA 1D3PB 1UTOA 1VCQA 2EQNA 2RG3A 1Z1JA 1HAGE 1WSSH 2BY9X 4K3JA 4X8SH 4X6OA 3NCLA 5A0AE 2V3MA 3UQVA 1FJSA 4Q7YA 2GCTB 2VVUA 3OE7D 1V2VT 1SGDE 2R2MB 2WSSD 1E34B 4NIXA 3M7QA 1UCYE 4ACBA 2VB0A 3ZIAD 1DOJA 1RGQA 3DUXH 4Z1MD 3SI3H 2ZU3A 3S69A 5L2YH 2GMTC 1HFDA 2P59A 1FAKH 2QXHA 4YZUA 1PPEE 1PQAA 1VITF 1ZGIA 2R2WU 3MU0A 3RXAA 3UUZA 4TWYA 7GCHF 1T7CA 2YNBA 1CBWB 1YP9A 2TBSA 4M7GA 4MDSA 1FXYA 2W7UA 3LJOA 2F9NA 1QGFA 1SGRE 3LC3A 2GGVB 1BZXE 4X2YA 3N7EA 2XYAA 2ZQ1A 2XBYA 2VIPA 2VNTA 3TJNA 8GCHF 2UUFB 1V2MT 3M61U 1TGTA 2KCAA 1UW7A 1FIZA 4CRGA 1GBMA 2WPHS 2XBVA 1EZXC 4ASUD 1GBAA 1KMHB 1WAYB 3ZZ8A 1HRTH 1UK3A 3ENSB 2BY6X 2WYJA 4LOYH 4H4FA 5A0BA 5LPRA 3ODDA 1MCTA 4NA9H 3MO6A 2QIQA 1ZMJA 3MI4A 2Q6DA 3E8LA 2CN0H 1LKBA 3PLPA 1DE7H 1CVWH 1O2VA 4RT0A 1OWDA 3P17H 2WPKS 5CDFE 1TB6H 2GP9B 5LGOA 3BIUH 4B71A 3NUMA 1S82A 3D49H 1J9CH 1AE8H 3ZV9A 2BLWA 5JYIA 1Y3XA 3U28C 2FYRA 1VCPA 2ALVA 3E91A 1QFKH 2G5VA 2VIWA 1V2PT 1H4WA 4CRCA 1GCTB 2NWNA 3GOVB 2GZ9A 3H7TA 3KYGA 1C9PA 4XSKU 1XKBC 5EW1H 3LGIA 5DKMA 3MH7A 1C2LA 1CU1A 1GI2A 2ZNKH 3NRLA 3PV5A 1GDQA 2ANYA 2P94A 1AE5A 4ISHH 1BDAA 1PPGE 1OHHD 5EODA 1T8MA 2D8WA 1HJ9A 1EZSC 1WU1A 1ZPBA 2R9PA 5FX6A 1JMOH 4AFZA 1CHGA 1YCPM 1SGFG 3VEQB 3AVZA 5EGMA 1XVMA 1FNIA 4DT4A 4JZEH 4Q80A 4Y76A 3FP6E 2V3HH 2AGEX 1O5DH 2JETB 3FN8A 4FUDA 1GBBA 1GGDB 1QBVH 1SG8B 1JWTA 3GY7A 2RA0A 1EAWA 1UTPA 5L30H 1H8IH 3MU8A 2JIZD 4BAHB 4CHAC 1SQRA 1GBIA 4UFEH 3U8TH 5HYOA 5FBEA 1PPZA 3MO9A 1C2JA 1F5KU 1O2GH 4CREA 1G3CA 1QRZA 2OBOA 7GCHG 3ZZ6A 3RXOA 1GBEA 3FOAA 5K7RA 2BQ7B 3BG8A 1GBHA 2QY0B 3RXJA 1SLVB 3BG4B 5KECA 5FCRA 3VB4A 3SJ9A 8LPRA 1Z8JB 2ODYB 1O2UA 1G37A 2FLRH 1A61H 1Y59T 2AH4X 2FS9A 2G00A 4FU9A 3D23A 1O30A 3UQOA 1LHGH 5C20A 2CXVA 3DD2H 1LQEA 2C93B 2ZPRA 5JBCS 3UNSA 4GLYA 6GCHF 3TJOA 3SQHE 1E37B 1DWDH 1NRQH 5AFZH 2BX4A 2Z3EA 1WOFA 1O2SA 4Y8XA 1QRWA 1KXAA 2JJ2D 1MQ5A 3S9BA 1EJNA 4P00A 2XRCA 1SGTA 1WQSA 3UIRA 1SLWB 2ZFPH 3QX5H 2UUYA 2BD2A 1HAHH 1PYTD 2A4RA 1YCPK 2ZI2H 4P02A 1C5OH 4XBCA 4K2YA 4A6LA 1ZSLA 4F48B 3FP7E 3ZVAA 3RXTA 1RIWB 1P2MA 4Y0YE 5G4BA 1AQ7A 1VJ9U 1Y8TA 2EC9H 4U30A 3U9AH 1ESBA 3RMLH 5A8YA 3TK9A 3BTHE 1YPHE 3SZEA 1RJXB 1GMDF 2H1UA 1C2GA 4A5TS 3WWFA 2VWOA 4D9QA 1ELVA 2B0FA 4A1VA 2QGRA 4JK5A 1S0RA 4UE7H 3ZYEA 1TPPA 1V2UT 1MTWA 1GBDA 2FEQH 3NK8A 1Z8GA 2KFWA 1GJDB 1NRPH 1SGFA 2R3UA 1DS2E 1F0TA 2XNIA 1GI9B 1COWD 3KNXA 2R0LA 2TIOA 8KME2 1QBOA 5DO4H 2R0KA 3SN8A 2PWXA 5ESTE 1O3IA 1BTUA 3F0OA 1KLIH 1CT0E 3QO6A 4LK4A 4TT3D 2AMQA 2V6NA 1CGHA 1C5SA 1O3GA 2DE9A 4Z0KA 1YGCH 3LGUA 3FP8E 3A8DA 4M9FA 4TYDA 1WCZA 2HVYB 2J94A 3SJKA 2KR7A 5AVDA 1DVAH 2A7JA 2F9UA 1O2TA 3U98H 4GUXA 4DIHH 3A88A 1O5GH 3MFJA 1QQ4A 1MKWH 1RRKA 1WYKA 4ZMAH 4K69A 1GJAB 3SW2B 3LH3A 1P01A 3OAAD 3SUGA 3A80A 1A5GH 3A7VA 4ABBA 3E6PH 1NFXA 2R3YA 3NPSA 1NC6A 5EU8A 4H42U 2NU0E 2QN5T 3SV8A 4MPWA 4ABEA 4IN1A 1AHTH 2ESTE 3E90B 5DGJA 4AFSA 3VPKA 3LGYA 3LPRA 1T4VH 6GCHG 2Z3CA 2BD7A 1BHXF 5FBIA 1DWEH 2BOHB 3AAVA 3M3TA 4SGBE 1AKSA 5FL7D 2BHGA 2TGDA 1RTFB 3GCOA 3EGKH 3RXHA 2A4QA 1AU8A 2ZDVH 3EA9A 3MH5A 1O3FA 2FO9A 4AOQA 1GBLA 2XWBI 1LVBA 1AD8H 2ZCLP 4ZKOU 1W0JD 3RXQA 4ISOA 2RDLA 1C1MA 2EEKA 2Y5GA 2VIVA 1GPZA 3NWUA 2WPMS 1V6DA 1Y3WA 2ZU2A 3FAOA 5EG4A 3PB1E 1TPAE 1JRTA 2AFQB 2FIRH 1TNHA 2ZZUH 4O3TA 1L4ZA 1D3QB 3MNBA 4XE4A 4K1EA 3EA8A 2A32A 3RLYH 2FPZA 1DXWA 3LGWA 2I6QA 4FUBA 3W94A 3RM2H 4YO9A 4GAWA 1A0HB 1NM6A 2YMSB 3KCGH 3MNSA 4I8JA 1OOKB 4TPYA 1C5ZB 4ISNA 1KSNA 1ELBA 2GV6A 4U32A 1ZTJA 2FX6A 1KDQA 2PFEA 2HWLB 1KTSB 4FVDA 5DP8A 1S81A 2QYIA 1CHOG 1HAVA 1GBKA 2PSXA 5EJLA 5JBBS 2WPLS 1OWJA 1OX1A 2ZG0H 2TRMA 4WH8A 1A3BH 3A89A 3HKIB 3RXDA 5EPNA 2Y5HA 1GJ4H 4TY6A 1BTWA 1C4U2 1TX7A 2GVFA 5DP3A 3CNRA 1QL9A 1TRNA 3T29A 1BTXA 1LPGB 3PWCA 1XUIA 3SNBA 3GY5A 2C3SA 5E0JA 1DDJA 1MH0A 4LZ1H 1BHXB 1O3BA 4NSYA 2GT7A 2M5TA 2SGDE 1O2MA 2ZGXH 1SHYA 2O9QA 4KTSA 5LH8A 3W95A 1ZGVA 3NKKA 2FOCA 2LPRA 1OYQA 5E8EH 3ZV8A 2GDDA 1EP6A 2Z9GA 3DCLA 2M2AA 1P57B 1BRAA 5C5NA 3TLOA 1NU7B 1TA6A 4X2VA 3LU9B 4FUJA 3M3SA 8ESTE 3TIUA 1ETTH 3H7OA 2WPIS 3SV6A 2J38A 1YF4A 3KQEA 3P8OA 3DSGA 2J34A 4B76A 5AF9H 3BTQE 1K1LA 3SU2A 1GVLA 1W0YH 3BTWE 1ELFA 4HGCA 1QHRB 3Q3KA 4YTAA 1GJ6A 1S5SA 2PGBB 3ODFA 2OP9A 3RU4E 1C2IA 1F0SA 3BSQA 1EP5A 1A5HA 4IC6A 3M7TA 3PLKA 1QA0A 3F9GA 2HOBA 2OTVA 2OQ5A 2XC4A 2G4TA 1FONA 3GCHC 3Q3XA 4Q4LA 4BXSA 1SFIA 1UHBB 2ZDAH 4K8YA 3S0NA 1HXFH 1Y5UT 3L6PA 4ZHAA 4AG2A 3Q3YA 5DP6A 3AW1A 3SUEA 2XCNA 1O2OA 3SYJA 4B74A 4MQAA 3ATMA 3BTKE 4BOHA 3VB7A 1G2LA 4DIIH 1W14U 1ZJDA 1W3CA 5GCHF 1O36A 2XBXA 1FZZA 1YM0A 3ZZ4A 2Q6FA 1Y3VA 3UPEA 2OUAA 4H6SB 3STIA 2FI5E 5E2PA 2B7DH 2SGPE 3MH4A 1MQ6A 2F43B 3U1IB 1RIWC 1C5LH 2ZTYA 3F9FA 3B9FH 3K2UA 4NZLA 1N8OC 1O2LA 1K1NA 4BNRA 1LPZB 5C67A 1HBTH 1C1OA 2WHXA 4ABGA 4Y79A 4JZDH 5DP7A 1W8BH 5C0UA 4GHQA 1AI8H 3MWIU 1OSSA 3EQ0H 2A7CA 2NU4E 3ATKA 4AFUA 5SGAE 1YWUA 4KELA 4NIWA 5C0TA 3A81A 2FOMB 2BM2A 3PRBA 1PPFE 1TFXA 4SGAE 2BYAX 1YLNA 2NU2E 3PMBB 1AFQB 2Y82A 4GSOA 1JIRA 1OWKA 3BTEE 4B6EA 5ETXA 1GL0E 1O3JA 1GMHG 4JK6A 5BRRE 3OTJE 3VXFH 4NFEA 2Y81A 3BEIB 2GTBA 1MAXA 3D62A 1LVOA 4WWYA 3RMMH 1SPJA 2GCTC 3VGCC 1QRXA 2AIQA 1FUJA 2WV9A 1JXPA 1E1RD 1ZSJA 2P8OC 3ZZAA 4BAKB 3URCA 3LIWA 2F9VA 2OLGA 4CRDA 1CSOE 3PV4A 4K5ZA 1TNKA 3QWCH 4D9RA 1AGJA 5CHBA 1D6WA 1W2KH 4AFQA 1C9TA 1YYY1 4KP0A 4X6PA 2Y7XA 1O2YA 2H9HA 3A86A 4X1QU 4MPXA 1LHFH 3P6ZB 3KHVA 3QTVH 4JYVH 2K8IA 1GMHF 5EJ1A 2VIDA 3ZVDA 1GHYH 2UUKB 1ANCA 3KQCA 3RXPA 2GJGA 1BRBE 1TALA 1GHXH 3BF6H 3CS7A 1BITA 2ZF0H 2J5UA 3BTME 3SNAA 1ZOMA 5I46H 1FPCH 1TGCA 1EOJA 3GDSA 1AMHA 4CRAA 2PUXB 5EIYA 2OC1A 3CP7A 5F8XA 2CJIA 1WBGB 2HGTH 2OINA 9ESTA 4WH6A 1GMCF 3GCTF 1C1NA 3A85A 3URDA 5DK1A 1CA0B 2ANMH 1O35A 2BD4A 1AUJA 1HPGA 1P03A 1H8ED 1MKXK 3M36A 4IC5A 2D26C 3P8NA 2P93A 4B75A 2I6SA 1NO9H 3W1EA 1NFYA 1GHWH 4GPGA 3SGAE 2PP6A 1DSUA 1Y5BT 2H5CA 4X8TH 1O3KA 2RFKC 2VU8E 1D6RA 3TITA 1Q3XA 3WWBA 1MTNB 1MZAA
chains in the Genus database with same CATH topology
2A2QH 1K9OE 1MZDA 2P16A 2TPIZ 2OCVB 4I31A 1VGCC 1XUGA 4OGYA 1DFPA 2ILNA 3F9EA 4DCDA 4AB8A 1TOCB 3ZVCA 1AVWA 1XMNB 3M5NA 1YPLH 1BUIA 1GHAG 2G55A 4O03A 1AWFH 3SJOA 2BDAA 3P70B 5GWZA 4KTCA 3WW7A 1MU6B 2Y7ZA 2O8TA 4CHAB 3QZRA 2ASUB 1IQNA 2CHAC 2ZHQH 2LNCA 4K1TA 1TIOA 1TQ7B 3HKJB 1CT2E 1CA8B 5GPIB 1Z7KA 4OS2A 1GI8B 1PPBH 5FX5A 1WQVH 5B6LA 1GJ9B 2ZECA 5C1YA 1IQLA 2W6ID 2CGAA 3QDZB 1SHHB 1P0SH 1IQEA 1H9LB 4RI0A 1O3MA 1GJ5H 5A8XA 2PKAA 2V3OH 4JMYA 1BA8B 1NFUA 3LKWA 1HJAC 5EOKA 1EUFA 3FVFB 1ANEA 3BTFE 5CHAB 3UB0A 1G3BA 3U8RH 3TH2H 1S6HA 4D76A 4ABAA 1XM1A 3E0PB 1TPOA 2YOLA 1TBQH 2Y6TA 3UNRA 1IAUA 3BTDE 4NSVA 1GCTC 5L2ZH 2VGCB 1CGJE 2GX4A 1TGBA 2FOFA 3KN2A 4AZ2B 3RU4D 3SJIA 3O8CA 2BZ6H 3Q00A 2FM2A 1O32A 1CGIE 1FY8E 2BLQA 1O5FH 1L1NA 1SC8U 1KXDA 2XW9A 3A87A 5JBAS 1WV7H 2FLBH 1O3NA 1JIMA 6ESTA 1E38B 4YOIA 2VJ1A 1Z8IB 1D3DB 3LONA 1DLKB 4R0IA 4INKA 4ZROA 4WMFA 1A7SA 2AMPA 3QK1A 1WTHD 1BMNH 1Y3UA 1SVPA 1SQAA 1MKXH 5C1UA 1AKSB 1TQ0B 2FTLE 2ZU4A 4I32A 2BX3A 2BVRH 3PM3A 1IQGA 2XWAA 1LVMA 3UREA 1GWAA 5FPTA 1UK4A 2P8OB 2Q6GA 4X1NU 5T3HA 3S9AA 1GI5A 2F9OA 3LH1A 3SHAH 1O34A 1OPHB 2QF4A 2HNTF 1TBRH 4X2WA 3VGCB 1C1RA 1GJ7B 2SNWA 3DFLA 4FUGA 2G4UA 4X6NA 1YPMH 2RA3A 1IHSH 1TYNA 2VGCC 2J4IA 1J8AA 1Y5AT 3A7WA 1XUKA 3PMAB 1NBMD 1SKYE 1QBNA 2XOKD 4IMZA 1V2LT 2W3KA 4RSPA 4A1TA 3LT3A 4B6FA 1AFQC 1O3EA 3A7XA 3E0NB 1SI5H 3I78A 3MNXA 4X8VH 5CHAC 1GDUA 2GMTB 3M3VA 1BMLA 2DE8A 1O3HA 3FKSD 1ZHMA 1HAPH 2F3CE 1BOQA 4ABFA 3L3TA 4TWWA 3NZIA 1XX9A 4TPIZ 1ESAA 2Y5FA 3IITA 1H9IE 4DY7B 2HNTE 1SGYE 3F2GA 2FZZA 2Z9KA 2QXGA 3TJUA 1SGCA 1LMWB 2BD5A 4DJZB 4NGAH 5FHTA 1SB1H 2EI6A 1P3CA 4JCNA 1GHZA 2H5DA 1O38A 4DURA 3RXKA 1Z71A 1THPB 1IQMA 5AFYH 1A2CH 1W7GH 1EB1H 1TX8A 1AUTC 2JKHA 1G32B 1INCA 1ELAA 2OD3B 4F49A 1C2DA 1BB0B 1FY1A 2F9PA 3SOSA 4NIVA 3I29A 2QA9E 5FCKA 3M5MA 1OP8A 2P3TB 2ZDLA 4THNH 1ZPCA 1BBRE 1UTNA 3Q77A 4UFDH 1HIAA 1QR3E 2F83A 2ANWA 2XBWA 2ZU1A 3HGNA 2VWMA 5T6FA 1HNEE 4ZXXH 4JZFH 3S9CA 2SGAA 1LVYA 3MOCA 5CE1A 3EDXB 3GCHB 4IMQA 5C17A 3HATH 1SL3A 4UDWH 1GBCA 3BEFB 3LJJA 4CH2B 3D65E 3PTBA 2WPJS 1C5QA 1GBTA 1AB9B 4MTBA 5L6NH 3T28A 1C1TA 2FODA 2FOAA 3ZVBA 2O8LA 4OS5A 5FXLA 2FX4A 5DSFA 1F0UA 4ABDA 4IS5A 1TWXB 4YM9A 2HPPH 1MTSA 4YXWD 1DPOA 2W5EA 2GKVE 1UTKA 3OX7U 3O8BA 4OGXA 3OTPA 1AZZA 3C1KA 4ZKNU 3TNSA 1ELTA 2O8MA 2ZWLH 4NFFA 1MU8B 4WMEA 3ZZBA 1HDTH 1W13U 1XUJA 1PQ7A 3UWIA 4Y10E 4JYUH 4NWKA 1NRSH 1QL7A 1QURH 3JZ2B 2EI8A 4VGCB 2A1DB 3F68H 1C2FA 3TGKE 2VWNA 5GNDA 1EPTC 2B9LA 1XKAC 2VH0A 1DXPA 3SGBE 4HZHA 2H6MA 1DICA 2FP7B 4J2YB 4R8TB 1FDPA 1QNJA 4BTIB 1GHBG 4B2CA 1UCYH 1NPMA 1UVSH 3BEUA 2HNTC 1RTKA 4YOGA 2WZQA 5DG6A 5TCAA 1P11E 4B2AA 1DLEA 2WUCA 1O2IA 3ITIA 1C4V2 3SU1A 1EFRD 3BIVH 2FOEA 1LPKB 4AYVB 4E06H 1ZHRA 1B0EA 4Z6AH 1SFQB 1SR5C 4ZKRU 1YPEH 1ZRKA 3FZDA 4E7RG 1EPTA 1ESTA 1K1JA 3T5FH 2BQWB 1BMMH 5EXNA 3OEHD 1GI4A 2PW8H 3RXCA 1PFXC 2BVXH 1L1JA 1GVZA 2IJD1 3AAUA 2YMSC 1HCGA 3LGTA 4DOQA 2XCFA 2Z9IA 1GVKB 3PO1C 1ANBA 2ZCHP 1MBQA 1IQFA 3UOPA 4F55A 2ZA5A 3PV2A 2GZ7A 4YOJA 2BDIA 2QF3A 2ZPQA 2FS8A 3RXIA 1EASA 1H1BA 1NT1A 3MU5A 2BY8X 2WV4A 5C2ZA 1EAXA 1TMTH 2XC5A 2C90B 1ABIH 1G36A 4UD9H 1HIAB 1V2ST 2G5NA 1FMGA 5GXPA 1N8OB 5HM9A 2KM0A 3SNCA 2HALA 3DFJA 1EJMA 5F53A 1AVGH 1MBMA 2HLCA 1DX5M 5T6GA 1RD3B 2PUQH 2IJOB 1NROH 5BPEA 2A31A 2OBQA 4HTCH 2ZTZA 5GJ4B 1NU9A 3ZZDA 2W3IA 1BRCE 2AMDA 1NN6A 1NFWA 3KL6A 6CHAC 3ZZ3A 3UWJH 4YLUA 3KGPA 5DP4A 2UWLA 1A5IA 1CQQA 1AVXA 1DWBH 1NTPA 4AYYB 5EPYA 1O31A 1FPHH 1O2RA 1G9IE 2CMYA 1W11U 1ELDE 3RC6A 1A0JA 2FI3E 1P9SA 3RMOH 1SGNE 1A3EH 2VH6A 2BDHA 1Y3YA 3SQEE 2OC7A 2UUJB 3TJVA 1GI6A 1C5RA 1GHBF 5LPEA 1TRYA 1EB2A 1SOZA 1EOLA 1WXRA 1EKBB 1MAYA 2A4OA 1MTNC 3HPTB 1JBUH 5I25A 2PGQB 3MYWA 1ZHPA 1DSTA 4YT7H 1TAWA 4X1RU 4XD7D 1T32A 3DA9B 1PQ5A 2STAE 2XC0A 4CBOA 4ZXYH 1GI1A 1EX3A 3MNCA 1V2JT 2BMGB 1S6LA 4XFQA 5E0HA 1CA0C 4WVPE 3TNTA 3F3BA 2NU3E 4GCHF 5GCHG 1C5NH 1LCYA 3MHWU 3AW0A 1QTFA 1J17T 1V2WT 4I8KA 3VXEH 4NCYA 1YBWA 3PYHA 1GJ8B 1LO6A 3FFGA 1UVOA 1O2NA 1V2TT 1YLCA 9LPRA 3N7OA 3RLWH 1GHVH 4FXGH 2HLDD 4KGAA 4Q7ZA 4DVAU 2C8XB 1C1UH 2W7SA 5PTPA 2RCEA 1T4UH 2Z6BD 1SLUB 5HM2A 2G8TA 5C1XA 3HK3B 2ZDKA 4IGDA 2AERH 1MD8A 1UHBA 1FLEE 4KTUA 4Y71A 1P05A 4D7GA 3SNEA 4Y7AA 3SUFA 4NIYA 3FO8D 3RXRA 5B6OA 4HI3A 1BBRK 5JBTA 1VCWA 3A8AA 3SV9A 1BTHH 1RTLA 2H2ZA 1O3DA 1ZTLA 3ESTA 2L6OA 2BQ6B 1ORFA 2XNDD 3PMJA 3OYPA 3ZZ9A 2H9EH 2ZFRH 5FPSA 1ID5H 1L2EA 4RKOB 1Q31A 1FQ3A 2PKSC 2ZHFH 1BRUP 1LDTT 2QC2A 4CRBA 1H9HE 1UO6A 2YNAA 4Y0ZE 4BAMB 1GJBB 2A2XH 2AHME 4ABJA 3H09A 4WXIA 4XDEA 1UCYK 3SU3A 5H4IB 4UFGH 4JZIA 1OWEA 1P2IA 3TK5A 4U2WA 2KCOA 2ZGCA 1BIOA 1T8OA 4J1YA 1HUTH 1E36B 2V7QD 4FUHA 1HAOH 1ABJH 1KLTA 1NESE 3RC5A 2OK5A 3SJ8A 3P8FA 1G30B 1O3OA 4HFPB 1K1MA 3RXEA 4NA7A 3V3MA 1NRNH 1BBRH 1DWCH 3A84A 3P8GA 4GVUA 1GG6B 1TGNA 3SZNA 3I77A 3CENA 4YT6H 2FWWA 3ZVFA 1QIXB 2ZO3H 1C5UA 1IQHA 3OEED 2QXJA 5FPYA 2SFAA 1AN1E 2GD4B 2OC8A 2ZP0H 1D4PB 1GGDC 3LGVA 2PLXA 3QTOH 2JETC 1RFNA 2ZDMA 2PTCE 2AS9A 1D3TB 2D2DA 1C5WB 1FI8A 2NU1E 1V2NT 5C3NA 3IG6B 1GI3A 3GCTG 4NG9H 5JB9S 4ABIA 1HAZB 4UEHH 5E0GA 4LZ4B 7LPRA 2OXSA 4CH8B 1C2KA 4BTUB 1OKXA 1VGCB 4ZAEA 5JB8S 3TU7H 2YMSD 1FIWA 2C8WB 1U6QA 3RXUA 1GDNA 1HGTH 1UTQA 2QCYA 3LDXH 4IN2A 1OYTH 2OQUA 1B0FA 1C5MD 1G3EA 4QT8C 2F9BH 2ZGJA 1JRSA 1O5AB 1FAXA 5EXMA 4MPUA 3F0PA 4X2XA 4BANB 3RUOA 3N7DA 2AYWA 1K2I1 1OP0A 3MTYA 3GYLB 4X6MA 4AN7A 3SI4H 3A8BA 1MTUA 2IOTA 1F2SE 1P2JA 1VZQH 1QJ1B 4E05H 2B5TB 1TOMH 3SV7A 1UK2A 3R3GB 4LXBH 1C1SA 1TLDA 1TPSA 3M5OA 1TE0A 1P12E 1OXGA 2K1QA 4AB9A 1P04A 1O5BB 3GDVA 5EQSA 1HXEH 1O0DH 1O37A 1O3CA 4DGJA 1P2NA 3K65B 1VITG 1O3PB 1O2HA 1KXCA 2Y80A 1S85A 1ZZZA 5IYTA 2JH6D 2HRVA 1RXPA 2Z94A 3U8OH 3MO3A 2C8YB 2FYQA 2FOHA 2J95A 1KXBA 1W12U 1XUFA 2VVCA 3E3TA 3TK6A 1UMAH 1KY9A 4FUEA 1XUHA 1G3DA 1QB1A 5EXLA 1DY8A 1O2ZA 1YCPH 1QB6A 5GDSH 3A82A 5FAHA 3SHCH 1O5EH 5DP5A 4ISLA 1L4DA 1O2WA 3QUMP 4RKJB 1O5CB 1F7ZA 3DSOA 1FV9A 2SGQE 1SGQE 1ELGA 3ZVGA 2ZHWH 1ZSKA 4FUIA 4OS7A 1EZQA 2ZU5A 4XOJA 3GCNA 2ULLA 2BDYA 3UR9A 3ZZ7A 2J92A 2QF0A 1X7AC 3L33A 3PLBA 1P8VC 1XXFA 1HLTH 4XBBA 3T25A 3OU0A 1C1PA 1TNGA 1ARBA 3VB6A 4E7NA 3V12A 1KIGH 2OC0A 2BY5X 4XBDA 1P09A 2PKSB 1Q2WA 3KQBA 3BG4C 1HJ8A 2CK3D 2A45B 1O2QA 4MNVA 2IPHA 3UTUH 1C2EA 5HXFA 3A7YA 1F0RA 1J15A 3MU1A 1BMFD 2BD9A 3K6ZA 1F5RA 1QCPA 2JDID 4UFFH 3F6UH 3AASA 3N99A 2PV9B 1DUEA 5JDUB 2Z9JA 3TH4H 1N6XA 3S7HB 1XXDA 1IQKA 2THFB 1SGIB 2EI7A 3T26A 1EXFA 3BN9A 4I7YH 2ZCKP 4CBNA 5ABWA 2KCYA 3PROA 2A0QB 5J4QA 3RU4T 2HVXA 3DSPA 5EQRA 1MTVA 1UJ1A 1ANDA 4JZ1A 3MMGA 1FY4A 4X1SU 3VB3A 1YPHC 1MABB 3A7ZA 3TVJB 1C2HA 2AGGX 1VJAU 4U01A 2LELA 4MVNA 2HPQH 1QY6A 2PHBA 3GY6A 3V13A 1UTJA 1EZUC 4AORA 1BJUA 1DUAA 1GHAF 1Z1IA 1GBFA 1ZYOA 1W0ZU 4B2BA 3TGJE 3SNDA 3ELAH 4IW4E 5DP9A 6LPRA 4B73A 1AWHB 3UFAA 3RMNH 2KZ4A 2A5AA 2TGAA 1BTYA 1TONA 4WF8A 1O33A 2Z9LA 1H8DH 3V7TA 4TY7A 5IDKA 3EE0B 1SLXB 7ESTE 2ODQA 3K6YA 3PTNA 3RXFA 3A7TA 1MD7A 1S84A 2PKAB 3TPIZ 4I33A 4I8GA 1MCVA 1ARCA 2SNVA 3QN7A 1ELEE 3KEEA 5F8TA 1KXEA 1PPHE 2CF8H 1DT2A 1ZJKA 2AGIX 5A09A 1G2MA 1GJCB 1JOUB 4D8NA 2FI4E 2QXIA 1EAIA 1MKWK 4GHTA 1AO5A 1GI7B 3GY2A 2CV3A 2AEIH 4ZH8A 1VR1H 1SBWA 1PYTC 4UONA 1ZR0A 2PR3A 1O2KA 2G52A 1FY5A 1TA2A 3VB5A 2W6JD 2A7HA 1YC0A 1QJ7B 1S0QA 2F91A 2V35A 1ACBE 3QLPH 2WPDD 4AGKA 3RDZA 1B7XB 2CF9H 1O3LA 1MUEB 4WMDA 2ZKSA 2BD8A 1NS3A 2GCHG 1C4Y2 2TGTA 1C5PA 1TNIA 2BLOA 1F5LA 3VFEA 1BCUH 1ZRBA 3RXGA 4KKDA 1GG6C 4O97A 1BTZA 1J16A 4TSFD 1PQ8A 1CBWC 3GY3A 3ATLA 1EPTB 3AK5A 2D1JA 3B23B 2B8OH 1EJAA 1P2KA 4WY3A 1DM4B 1UVTH 1C2MA 3LC5A 4Y7BA 3RXVA 1TNJA 1BT7A 1GI0A 2A5IA 2KAIB 2ANKH 3RXBA 1SGPE 2BY7X 2XXLA 2ZHDA 1K28D 2ZHEH 2AIPA 5K0HA 3STJA 3RP2A 2ZFQH 3ATWA 2ZFFH 1E79D 3GICB 1A1RA 4A1XA 4CR5A 1OWIA 4A92A 4ZUHA 5T6DA 1WUNH 4FU7A 4X8UH 4ZKSU 1E35B