2YPKA

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ypkA01
3RZWA 3UPRB 2VXUL 1YPZF 4AMKH 4A6YH 3QO0B 4LCWA 3UYOD 2FIKA 4KJQD 4GBXD 1P69B 2VDRL 5KVDL 8FABB 1ADQA 1DQMH 1T6VN 3Q5YA 2G9HA 3A67H 3STLA 1JWMB 5IHUH 1IBGL 4EUPB 4U31A 4DKEL 3QUXD 3MV9E 3V4VH 4CRPA 4WTZG 4HS8L 5HBBA 1X5KA 4U1HA 2EDDA 32C2A 1ZTXL 1A0QH 4XCNB 3AU1A 1CVRA 3L3JB 5DVNA 1XIWA 3ARBC 2AXGA 2P46B 1ZWIA 2EDWA 3VFSB 5I17B 2NY3D 1QPPA 1Z6JT 4NQCD 2AJXH 3MRIB 1I9IL 4L8SB 5HHNB 4AQ1B 1ZT1B 3IU3B 5LQBH 2VZOA 3DX8A 4X6EA 5DMJB 3BH8A 3MLYL 1S78C 1MY7A 4QHLA 4ELME 2CD0A 4F3FA 5HGBB 3OF6A 2EIBA 4QXWA 2D3VA 3VH8A 2JB6A 2P7TA 1WBXA 1DUYB 3FFCB 3PIQA 3ZE2E 1DUZA 1EX0A 5E08H 2G75B 3C5ZB 4OV6F 1D5ZB 5DQ9A 3PWUB 2BVUA 1CGUA 1MCWM 2PTTA 5DHYB 2ESVE 2COQA 3MZGB 4EDWL 3CZFA 4LGSB 4OIIL 1WJ3A 2Z31D 1H15B 2J3SA 1AGCB 3NACL 1TVBB 2IADB 5DJDA 4HPOL 1RV6X 1F2QA 4PRHE 1E4XL 1RJCA 2CIIA 1NGWB 4KVCL 1I8IB 4WDIA 2DKMA 5HGHB 1F58L 2GK2A 1F90L 4M5ZL 4UINL 3LKQB 4JVPA 3DSFH 5I74C 1K4DB 1KLUB 2BVOB 1HWGB 1OSPH 1IM9B 2X4UB 4R8WL 2K3TA 3KDMA 1H5BB 1P7QB 2HWZH 1UM6H 5J56B 1D9KD 1TCMA 2GUOB 5EIVA 2H2SD 1MUJA 2WV3A 4HK0A 3MRCB 4YJZL 1GGCL 3GMQB 4JHZA 4K7FB 2QHRL 3D25A 2HKHH 1QFWH 5T5FH 4M7LH 4FMKA 1NDMA 2VLJE 1LEIA 4R6UA 4U1MA 1AY1L 1MCSA 2OMNA 4JZOB 4N8PA 5DJYB 3B2UD 3Q3GB 2FX8L 5D1XD 3BP5B 1NBVH 5E8NB 2BNQE 5D6DC 5IHZB 5JIPA 5JXEA 4N9GB 3U30B 1W0VA 1BWMA 3VWJA 3TJHD 2BVEA 4NRYB 4UUJA 2QSQA 4NNYA 5C0GA 1S5HA 1KV3A 1F4WH 1QBBA 2IF7A 4X80L 3LB6C 4IIQC 4E41D 2ICWJ 4OT1L 4CADA 2ZG1A 1BGXH 4PJ5D 1OD9A 5EORH 1EUUA 3NIDE 3G5XA 4NHCH 3KLAB 3CDYA 5D8JH 3QUKB 4X99B 2ZJSH 3RVVC 3OTTA 4NYLB 2V7HB 3WV0A 1YNKL 3GB7A 4HUNB 2X70B 3B8SA 2R4SH 4UBDD 4NJ9L 1RULL 3IDJA 4X7EC 1OP3K 3SCMB 3STZB 5A40E 3OR6B 1YMMA 1F5WA 3WSQL 4ZG1A 3FO9B 4LL9A 1CXFA 4FQXC 4WV1C 3ZLQC 5ADOH 4Y16D 2LU3A 1KJ2B 2E7CA 2EIZB 3RQ3A 2H1PL 3UEZA 3MTRA 1NCNA 3IDUA 3BPLC 1BFVH 4WWID 4JQIH 5HPMA 1N5AA 1AXSA 3T1FA 4XXDA 1BIIB 1WAAA 3IAGC 1PZUB 5EN2A 4M6ML 4K3EL 4DN4L 5JW3L 4U1LB 1XF3B 3R06A 1RUML 4MDJA 3QHFL 2XRAL 4OZFB 4CU8A 3L3OA 3DMMC 5F97E 5DXWA 4HUVA 4U1JA 4P59H 1OAZH 3KVQA 1QR4A 1TITA 5CIPA 5JHDE 4JN2A 4HLZH 3L9RA 2NYYC 1A6VL 4GW1B 3P0VH 1NAKL 5H35B 5CD3A 1Q9LB 1KPVA 3O6FD 4Z7OE 4BFIA 2UZIL 5AYUL 3DUHA 2ORBL 1K6QH 5D7KD 4LLVB 2ERJB 1XR9B 4X6BB 3FOMB 2NY6C 43C9A 4DCQB 2ZUQB 1S9VA 2GI7A 5BCAA 3O3AB 4ELMA 4G9FE 1D5MB 2BX5A 2GFBA 3D0VB 4EI5C 3MRNA 4LBEA 3EUUA 4GMTL 3RTQA 4YDKL 1QSVA 3SBWC 2VWEC 3K0WA 2BCKA 1XGQA 3EDKA 5EFIB 2EH8H 4BZ1L 4N8VG 4FXLA 2GJJA 5EU3B 3DROB 2FIRT 1A6AA 1LK2B 2RBLA 3X13B 3S35H 1EAJA 4I5BA 1G7HA 3GK8H 4V2BA 2NY0B 4MJ6B 3DGGB 4NUGH 4NKIH 5AUMB 3T1WA 1BFTA 5DJAA 5FDYA 1WT5C 5FK9B 5E5RB 5LGHH 1R3KA 2X1OA 3QJFA 3IFOA 3UROR 4ORZC 4UDTA 4AIXA 4GRLA 3SDDD 3FL7A 4DEPC 1FNSH 4HUWA 5E00B 4WRLA 3FT4A 1S5IL 4WFFE 4Z7UF 5I74B 2FLRT 1X5AA 4RFNC 4HKZB 3TBVA 1QRNB 2XZQH 1MJJA 4Z95H 2VQUA 3FCTB 1IGJA 1MCDA 2D7QA 5FHBH 4OLWL 2OTPA 4XNYH 2FHBA 4E9LA 1DFBL 4MAYD 2HMID 3CZJA 3CC5B 4YLQT 4Q9RL 4X6DB 1YEKH 2VLJA 5FM5M 3MRFB 1PD6A 1H3TA 4MQ7B 4BZ2L 2QQKH 3U0WL 2W91A 4YE4H 1EK3A 3SE8L 1TETH 3FN0H 5LWYH 2DBLH 5HHVL 4R3SA 3P4MA 4JDVB 1GPOH 1IGIL 1RJLA 3V8OA 1F2XK 1N6QH 4GSDH 1ZA6B 3DX9B 3B8YA 3MRDA 3TA3A 4U6VH 3QPQC 4HMDA 1T7YA 2DJUA 2VAJA 4WI2A 1I8MA 3QG7H 4WHCA 3O2WL 5SWSE 4OCWL 1LP9F 4U7KA 3RRQA 1U91B 5JZ7D 1KJ2H 1Q0XH 5DMGC 5D70H 1DVFD 2W07A 4LHQB 1KJMA 1D6VL 4J4PC 2P48B 1X5ZA 1J87A 3KPQB 2X44D 1XF4A 2I5YH 2C3WA 2ICWB 2VTFA 1G6VK 5FYLE 3UTTD 1IT9H 2N4IA 4OQTH 3C87A 4G80A 1VADA 3F7RA 2NXYC 4UV7H 4PG2C 3JXAA 1KG0A 2KPNA 2FL5B 1NGPL 5T5NG 4G9DB 5CJBA 2PUQT 5FA4B 4XVJL 5F6IC 1QSFA 3QQ4B 3MREA 2DJSA 4WV1B 5EOCH 4KV5F 5IW6A 4HKJB 4MNHB 1QTYT 1S7TB 3V52H 4TULL 3OPZL 4X4XB 3VWKB 4NO0A 1R3JB 3WIHH 4O5LL 4FN0A 1ITBB 2XWJB 1NMCB 5EDXA 1ZHKB 3BZDA 2B0SL 2ZCKH 3ZT6A 2VXVL 5DK0A 3N1GC 1UACL 5GS3A 1IGFL 1DJSA 3E2HB 4TPRH 1CGXA 1NEZA 1NKOA 1D5IH 3LN5A 1Q94B 5A16B 3VJ6B 3VRIA 2BJMH 3SDCC 1A7RH 2X4RB 4ISVB 5GJTL 5JHDA 2CKBL 3VD4A 4FTVD 1YEJL 1HSBB 1A1MA 3WKMH 3VI4F 3S9DB 4KDTA 2Y6SC 4UZGA 3KPSD 1WZ1H 3CFDB 2QQLH 1CXEA 4L4VE 3TPUE 5IOPB 2NY6B 2W0KA 1NCAL 4LLQB 2NR6C 1C5BH 4XPFH 5AD0B 3TBWA 1NFIA 3VFMA 4QRRE 5C2BH 1F6AB 1I3VA 4LHUB 3WE6B 1KNOA 2WW8A 2C1OA 4K23H 1FFQA 1MI5D 1WUNT 3N85H 3TNNA 4S1DD 4JO1L 3UCRA 3IJYA 5ICZB 2DQGH 3ZE1F 1P9MC 2QHLA 1DN0B 5F21B 2OR9L 2BC4B 1A6ZA 2R0WL 3MBEB 3DJ9A 1DEEA 2HG5A 2HT4C 1FVEA 2Z93B 3KPRD 4IOIA 4JAMA 4JFOA 3R8QA 1OVZA 5DRNA 5E9DB 3T0EC 4MCZA 5IMOB 5MEPB 4NC0B 5C0FB 1AR1D 4MWFA 2FBJL 4OBRA 2PYFA 4DEPB 2IAMA 2F54B 4KK8C 3QI9C 2OTWB 4ZUTB 4YAQB 1Q1JH 5I15L 3TN0D 3EDEA 4AM0A 2JB5L 4LRNL 4CMHC 4RFNB 3HI1B 2KQNA 2FDBP 2OI9A 1VA9A 2IALB 4JJ5A 2JK5A 1HH9B 2Y9RT 3K2UH 3BYYA 1CL7L 1VEOA 5F88A 2WQ8A 4XH2B 5DS8B 4Z5RB 3CSBA 3OG4B 5JHLL 4MXQA 1IM3A 1CLCA 3AXLB 2IMMA 4MS8A 3D5OF 4PB0H 5IR1A 3S88H 4DKDC 2HN7A 5TQ2L 1P7HL 2CDFA 1JNHA 1G9ML 4F7TB 3VGAC 1WK0A 3NMEA 3IVKA 1T0NA 4NQED 2D7OA 3FQUA 5E8DL 4IM8A 4NQCE 4NPYB 4XBPA 5FIEA 1L7IH 5HI3D 2FECI 2XA3A 1LVEA 2FR4B 3O45B 5I1GH 4U1GC 4X4ME 4P9HC 3QXDB 4EDXB 1NEZG 3HCVB 5DJ6B 1QFPA 2R0ZH 3JSSA 4XPHH 5E95B 5SWSA 3RL1A 4Y1AD 1ULVA 4OKVA 4F7MB 4FQHB 5DA4A 3SDAA 1TZHB 4MHHG 1U8PA 3DRTA 1N6UA 3MMEB 4HWBL 5ESQA 3RWDB 2Y07H 1IGMH 1MAKA 2BSTA 4NZUH 5DD5H 4RFEA 5F9WC 1QYGL 5ANME 3RX7A 3JWOL 5T1DH 4PD4J 1OB1B 4KZDH 2P24B 5CLTA 43CAB 2NXYB 5D2LB 1T1XB 1NEUA 3ELAT 4HLJA 3CAFA 2DICA 1XIWC 3SO3B 5M7QA 1U2HA 4EBQH 2NY5L 1JF5A 3GHEL 1EO5A 4TQEL 1VGKB 2ZUUA 4OCRH 1QO3A 3MYJA 1R6VA 2J88L 4YO0A 3HC3H 2Y23A 2DI7A 3O8XC 4NO2A 4YDJB 1FC2D 2DWEB 3VFNA 1HDMB 4PGDA 2VKWA 3HAEA 3NIFF 2Y36H 5GGQH 4Z7WA 1P2CB 3VFTA 5F93C 3QCTH 3U0PA 2BSSB 1CT8A 1KTDB 3MFFA 5I1IH 2OLDA 3FQTB 1H0DB 3ULSB 4DVBA 1G7QA 3ECBA 2AVGA 2Q6WA 1A3LH 3SDCB 1F00I 2GJZB 3LD8C 1G0YR 3HNVL 3GSOA 5E2UL 1NGQH 4LSTL 1IZJA 4RBPH 3WFCL 3OX8B 1OAXH 4L4VA 4CAGA 3HMXL 1M7IA 3M07A 3RUGB 1IVLA 5FDWA 4E41E 2N7AA 4M6OH 2EYRB 4QRRA 2ARJB 4PJ5E 1CLYH 4AH2A 2RR3A 2PCPB 5D1ZD 5CCKH 4TTGA 2VLKA 3FB7B 3UPAA 3R0MA 2O5ZL 2HRPH 1JI1A 3GO1L 5F3BB 1N5YH 2MSPA 4NP4L 4X5LA 4LF3B 5F8QC 1PLGL 4F33A 4FFWC 4P9MH 4BQBA 4QHUB 3RWEB 2I24N 1ORSB 1QLFB 3T0EB 3CH8A 4P23D 1R5IA 4QRSA 5GS2H 4N0YH 1BFSA 5EZIL 4Y4KD 2BOCA 1DP0A 1BIHA 2XV6B 3M17B 2HAZA 3QI9B 1T2JA 3GRWL 1YEGH 1P53A 4ONGL 4XP1H 2DIJA 1A6TA 3MBXH 4Q9BA 5F7WC 5J6HA 3WEXB 3M1BA 4RAVA 2KZ1B 2V7NB 3U4EB 3VFRA 4P2RD 1U8KA 3P30L 4OFKA 5EZLB 3ZT7A 2VH5L 5GGSA 4X6DF 5GGUA 5IK3A 4PJGE 3D39B 3IFNH 4PGZA 4YHML 4YBQD 1XGYH 4H20L 4LPUA 2HYMA 5IB1A 3NTCH 1KLGA 4KZEH 4NQCA 4ZFZA 1IGCH 1NCDH 2P1YA 4LCIL 3HNSH 5DJZB 5D7KE 3EO1A 5GISL 4JFED 1U58A 2IBBA 2BRRH 4X4MA 2JIXB 3MRKA 5ESAA 5E8OB 1XT5A 3PGFH 3MRMB 3U0TB 4WFED 2PN5A 3EYFA 2AABH 2JJTC 3PV6B 1FGVL 4KTEH 5F9AC 4WUKL 1BZ9A 1YN7B 3ZL4H 1E6OH 4PJBE 3P2TA 2ZOKA 5ADPL 1OTTC 3WKNA 4UT6L 1AR2A 3GI9L 3FT2A 3V8CA 3K74B 3HC4H 2Z31A 4KH2A 5T1LB 4NOFA 1G0XA 3MNZA 4LVOC 5ANMA 2XFXA 2XACC 4LCUA 4GQ9L 5FM5O 2GCYA 5E2TL 4PJXE 1JI2A 2CMRL 2V6HA 5F9WB 3RZCA 2ZG2A 1EHAA 3NVQA 2WAHA 2HKFH 4P4KD 5TDPA 4XP6H 1I1AC 1RPQA 3O6LH 5E1AB 1NJ9B 1SY6L 4YDVB 4YHKH 2CIKA 2G60L 3UC0H 3QUMB 4PJ9C 5KJRH 3JV4B 4ACPA 2VDNL 4QCIB 4XPAL 2YXMA 4HBCL 3SKJH 4X7TB 5JO5B 4Q7DA 3W81A 2ZUVA 4TTDC 4KPHH 1FV1A 2P8LB 3O8XB 3PXHA 4YQXL 5IM7B 4APQD 4OGYH 1VEMA 3RTQC 1NFDE 2Z9TA 4Y4FD 3TM6A 5M95B 3JZ7A 4PP1C 3GSNL 2O61B 2WP3O 3RKDD 2HTLC 1UM5H 4FG6D 4ODVL 3WDJA 3O4LB 1M05B 4UT7L 5CMAA 3LEVH 2NW2A 1IEAA 3LD8B 1VFAA 4E0RA 4GKNB 5F1NB 1T89A 1FLTX 1CGSL 1ACYH 1EGJL 4P48A 1P1ZB 1A7NH 1Z5LA 3CSGA 2CQVA 1G0DA 3U7YH 2XWTB 1K3ZA 2P5WB 4JO4L 5FO9A 3W11C 4XTRD 3D18B 4HFUH 5J7CC 1F97A 1T5WB 5EBGA 4E41A 1G7PB 4AL8H 4GRLC 5CHNA 4LCYA 5DJ2A 4JZJB 4ZO8A 5KVFH 4OI8A 4XP5H 4PJ5A 1BD2D 2Y7QB 4OB5L 4MNQD 1J8HA 5I2IB 3BPCB 1J1XH 4HUXB 4LSRH 3GSUA 5IB5B 3BH9B 1VFBA 3BEVA 5ITBH 3TO4D 1X5IA 1S7SA 5C9KA 2D2OA 1RMFL 3N06B 4F7PB 3VFVA 4BM7A 5KS9B 2DQTL 2X4QB 2VLRA 1IAIH 3UTTE 3T65A 1M4KA 3BXNA 2YA0A 1R24A 2MPAL 3MV8D 5I1DB 3C08L 2OCFD 4QRUA 4I3RH 1VPOH 3NPSC 1DE4B 4Y16A 1NDMB 2VABB 4G7VL 2HLFC 3F58L 1BVZA 1JGDB 2OL3H 1NGZA 5GS0C 3EYOA 2AJVL 12E8H 1XF2B 2B1AH 2YPKB 4HIXL 2QEJA 4YHLH 4M1CC 4ZS6C 4NNXB 2RHEA 2E3VA 2EYSA 1BOGA 5L8LB 3CU7A 4UT9L 3A6BH 1C1EH 3DOSA 3TA3C 2DQUH 2ENSA 3L3IA 1B2WL 4UIKL 5JNYA 2X2YA 4HFWA 4UUJB 1G9NC 5EC2B 2R23A 4IRSD 2Q1EA 3B9AA 2XPGA 1JNLH 4YHPA 5E6YA 5MI0C 4CADB 4P9HH 4Q2ZA 3C2AL 3QDGB 3FAWA 3QEQD 3VFUA 1CFNB 1HKLH 4LASH 5C9JA 3O6FA 3OAZH 1C5DA 4UTBH 5JLZB 5D7IB 3NFNB 1HXYB 1JPSL 5KOMC 3RWJB 4MA7L 3QCVH 3KPSE 2O26U 1W2KT 4DVRL 5EG6C 1IZKA 4EOWL 1ADQH 4L8BA 4I18A 4JHBA 2AJSH 4KMQA 3VG0L 5CZXD 1FGNH 5C07B 5J3HC 4HXBL 1MVUA 3CFJA 4HV8A 1NFKA 5K9OA 4MJ5B 3DETC 3IRPX 2IBZX 1NSNL 2ICES 1A8JH 2Z91A 4P99A 1I1FB 1MI5E 3A6CH 1X7QB 3VMNA 3H9SA 2PYEB 3PNWA 4UB0H 4PJIE 5E6ZA 3P11H 5FECA 5GJSL 5HHMB 2YRPA 5E24E 4JVWA 2ZOLB 1LE5A 2NY1D 4OV5B 3T77A 3KPRE 1MF2L 1KOAA 3LS4L 5D2LF 3MV9B 1TMCA 5HGDA 4CJ1A 4AIOA 3SDDA 1WGOA 3RWHB 5D7SH 4F37K 1HN1A 5DURB 1I1AB 1OP9A 5JR1H 1G6RA 3MQIA 3G6DL 1ZHLB 5GXBB 4L3ED 1WQVT 2VXTH 2EE6A 5CD3B 2CRZA 4HBQA 5GGRA 2RGSA 4V1DD 4PJ9B 3OKDB 4KDTC 3H9ZA 4DJMA 4BQ9A 1DQJA 4PGEA 3MCKA 5LCVH 2BERA 1S9WA 1OP5H 5I16B 4YR6A 4C56D 3HPJB 4J6RL 1CE1L 3QFJB 4FMFA 1LDPL 2WUBH 3QXAA 4DN3H 1AXTL 2QKIA 5K59F 3C5JB 4OD2B 3BE1H 2VJXA 1B6UA 4HK3N 4JY5L 3LS5H 3NABH 3BMVA 1W72L 1JZ5A 2ICCA 4NKOB 5IBUG 1IAII 3GJEA 1ZEAL 4D0CA 4NZTH 5DRXA 4NQEE 2IBZY 2X9XA 2N56A 4FA8A 2ESVB 2AXHA 1V3KA 2D4DA 3HI5H 4ZYKA 1MLBA 1K5NA 5DEFA 5I19H 3VMOA 1MCPL 4JM2D 3MRJB 4PRHB 2B1HH 4NQDB 4Z7VE 3RUGF 1N64L 1V7NH 3OKEB 2FEDC 4R4FH 1JHKL 2IAMC 5LG1A 4Y1AE 4OD1H 3C9NA 1A4KB 4N1HB 1UKSA 5I71C 5J12C 1DVFA 5JDSA 4U3CA 2J4WH 4MQSB 3U2SA 4FQPA 1WEJL 4KKCD 2OI9C 3KPTA 5IKCB 5LVEA 1FNFA 4FQ2H 5FYKD 4OUUB 3UTTA 1MCBA 3LEYH 1KN2L 4XCEB 5GHWL 1R3IH 4MXQC 4BSWA 4XNXL 1GZQB 2Y72A 3GHBL 4MS8C 1MCWW 1EDQA 4NT6A 4LGPB 3QBTB 4DUXA 4LLDB 2RJMA 1JWSB 1J1PL 3EHBC 3MLWH 3C5SA 3QULA 1IL1B 4ZXBC 4PLNC 5HHQB 5JXAH 3ZKNC 5FA3A 3GFUA 3U7WL 2BVQA 1FG2B 1UYWL 1QKZH 5C0CD 1E28A 2BNQB 3C6SA 3SPVA 3FTGB 3DHMA 4GQPH 4KMLB 1KB9J 2WLZA 1P7KB 1I85A 2HJFA 4HGKC 1VKXB 3RA7H 4KC3B 1LQSR 1FBIL 3BVNB 5HYIA 4PR5B 1BBDL 1FN4B 2A9ML 1M7XA 2DOCA 4YPJA 2A73A 4JR9L 4MMZC 3SDAC 4FTVA 4M9PA 4FZ8L 4I0KA 1IC4L 1A3RH 4V3DB 1X5YA 4R97B 4MLIA 4LIQE 4YZFE 1NAML 4Y19D 3DNKA 3KPSA 2AERT 5HHPB 5IGXL 2VISA 1N2RA 1MJ8H 2R8SH 1K8DB 3QNXA 3RAJH 5T1MA 3VXRB 3CUPB 3U36A 3MUZ1 4MA3A 4P3DB 5C8JB 4K07A 4JGMA 4U4BA 2SEBA 1F4YL 4X5XB 2B39A 1JBJA 4R0LA 1MI5A 4W6YB 4WW2B 5CIPH 5HVHB 4WI3A 4TVPL 4XCYB 4PBXA 4HT1H 2BFVL 3ARXA 1T0PB 4PJIA 5BS0B 3O11A 2OMBA 3PHOB 3GMOB 3HZVB 4R96A 1S3KL 3IXTA 4HS3B 5CWSA 1XGTA 3L6FB 5KZCB 4YXLL 1YYLL 3ULVL 3WLWD 3KPRA 4OM1L 3QEUA 3BRFA 1JGEB 1T0MB 3SEPA 5KAQF 3D3VD 1MQKL 4N8CL 4AENA 5ILTL 1V5JA 2ARWA 3LV3B 3VRIB 3MNWB 4YIQA 3CGTA 4NN6C 3MXVL 1U92B 4WVRA 4H26B 3EYVB 3SE9L 2R9HD 3TN0A 4PRAB 2R1XA 2IPKB 3KPNA 4N1CA 3KPMA 5DJCB 1IKFL 3H3PH 4ZFFA 4GOSA 1G7LA 3W39A 1Y0LB 3RIFF 4WFGD 5KW9H 1YUHB 3NZHH 3O3DA 4TOYH 4QRPD 3MA7A 3DX7A 4G9FB 1TZIB 4P2RE 2E7MA 2VLMD 4FP8H 5DUMH 3OJVC 5TH2A 1LE9B 4DGVH 1Z2KA 1OLLA 3IDNB 4I8DA 5FV1L 2X41A 3S97C 1NL0H 1LEKB 4NQEA 4WI4A 5I76A 4XMKH 3TVMD 5DD1H 1ZLSH 1JFQL 4JFEE 5F7DA 1ZK9A 4CVZB 4Z7VA 4ORGB 2DYPB 4WFEE 1ZE3C 5DRNB 1BQLL 5C86A 1FFPB 2DQFA 1HHGB 4L4JA 4JHWH 4LHJB 4NC2B 1HOCA 4Y1AA 3BIAX 5I1LA 5DJXB 5IEKB 1NQBA 1YEIH 3NOIA 4KJQC 1JHTB 3GGWA 4GBXC 2BZDA 5FKPA 3TJEL 4LAJH 1KJVB 4IRZL 3REWA 3GJFK 2LV4A 1N0XL 5GS0H 2XZAH 1UGNA 5KS9F 2X10A 4R90H 2OTUB 2XN9A 4BKLA 4GKZB 4JLRA 5CGYD 3MRBB 1FPTH 3QUXC 5CEXA 5DDHA 3GIZL 4PB9L 3EDDA 4G6AD 4PUBL 2CJUH 5C7XH 3MRLA 2X89D 2W0LA 3HFML 2OZ4H 1G9NH 4GS7C 1MFCL 4ZNEA 3FRPA 3ZKXB 3SKMB 2NY3C 2RIKA 5EPMA 1RZIB 1KJ3L 1MELA 1EJOH 4M8QA 4RZCB 4ZXBB 1T0NB 3FQUB 4QY8A 1F4XL 4HZLB 4TSCL 2BVYA 2A83A 3LRSB 3Q1SH 1T04A 2IGFH 1GZPA 3OV6A 3SJVD 1OAYL 2W38A 5F7EL 4MVBA 3VD5A 3VXUD 4QEGA 3SDYL 4FQQB 4IOSD 3A6OA 1HYSD 3VFOB 4PJCE 4L5FH 1N7MH 5J6GB 2FJFB 1FVDB 1EMTL 5D7IF 3V5HB 3B6SA 4Z9KB 4RFOH 3THMH 3FB5B 1I3GL 1AHWB 3KWWA 4WENB 5CBAB 1VEPA 3MLXL 5DD3L 1FNEB 4NQVA 1D6EB 3VXOB 3HI6H 1A9EB 2EDFA 3MJ9A 4PGJA 3CMOL 3S37L 3Q6GH 4NQXA 1JRHL 2XTLA 1Q72L 2DB8A 2PR4L 3ARQA 3CDCA 1BD2E 3MOQA 5DC0A 3V6ZA 4MNQE 2R2HA 3NCYS 1BX2B 4FQCL 5L8JB 3MGAA 4ODWA 1D9KC 5J8OA 4MCYA 2F15A 1RURH 4LSUL 2H2SC 4XMPL 1A1OB 4POYA 4ZTPL 5DA0B 3MV8E 2FYYB 3WXWL 1V05A 1UB5B 1JHLL 3VFTB 1B0GA 4KTDL 4X6CE 2DLEA 4P23A 2AV1A 3HNTL 3VXNA 1RIUL 3F7QA 4J3TA 1J1OL 2A6JB 4L4TA 4KROD 4Y4KA 3B2UC 2OQJA 1HEZA 1J0IA 5D1XC 4ZDHA 4P2OB 1QZ1A 4KJWD 1VACA 3QIWB 3CFKB 4KFZC 5DHVB 3S34L 1F3JB 3TJHC 5I8EB 1F42A 2AQ1A 5TGBB 3BHBA 3TPUB 3ZYIA 3G5YB 4ELMF 4P2RA 1CVSC 4PYGA 5DD0L 3LEXB 3EOBB 1JWUB 2XY1A 3FRPG 3T4AA 5T5NF 1J0KA 3AY4A 4GO6B 2J5LB 3QEQE 4GG8A 5DD6A 5DK3A 5DHXB 1XAUA 5FM8A 4U3XA 5C6TH 3T08A 2W60A 3CSYB 1CLZL 1AC6A 1U8MB 3EOAB 3G5ZA 4WCYL 3RX8A 4YUEH 2ITDA 4UBDC 2MFNA 1ZLUH 3HZKB 3SGJA 4OFYD 1HQRA 4Y8DC 3PP3H 2H26A 2M26A 2ATKA 2WIMA 2I9LA 1MCJA 3QUZB 1OLZA 1RZGB 3OAUL 3MLPA 2QSTA 3UYRH 4Y16C 5ECJE 3PWJB 2C7UB 4XZUA 5GGTL 4MDIA 1YQ2A 2RCSL 1CG9B 3R1GL 5D93B 2ADIB 4F7CB 1BEYH 5EUKB 4GBXB 2XI9A 5CSZA 1RJZB 3BKCH 5KVGL 3REVA 3UDWA 1U3HA 1QVOB 4XI5D 5B8CA 5D5ME 4NGHL 2HVJA 4EN3D 4UNUA 2FHCA 3PWVB 4M7ZC 1DBBL 4AEIL 1FYTB 2YD3A 1KPRA 3U4AA 3QUXB 4YPGB 4CBPA 3DIFA 4JCLA 4NRZB 4EEEA 1FL3B 5ITFA 4GS7B 3O6FC 1V8HA 3V0VB 4L3EE 3MLVH 4HWZA 1KCVH 4V1DE 2IMNA 1T03H 5I1HH 3KXFB 4QHNA 3C5ZD 4RWYL 2VDOL 1NMAL 3D6GA 4C56E 4NNPL 4YWGH 5FYLH 1I1YB 3QG6B 3VA2C 4APQA 1CBVL 4Y4FA 1Z3GH 4L1HA 4LPWA 5KTEL 3DO7A 2B7DT 4I13B 2J8UE 4IS6B 1AQDB 4R4NC 1JZ8A 1YEHH 1JTTA 1QR1B 1R5VA 4PJCA 4FQ1L 3NIDF 5EA0H 5K33A 5JOFA 1JZ3A 1HI6B 5DSCA 2UY7A 4ZD3H 3GKWL 4OZIA 3T8XB 1IM9D 2DQHL 4FXGB 1P7QD 5EOQL 3KYKL 5BO1L 3RU8L 4S0UC 2XQYK 5FO8A 3HAEH 2MNUA 1LNUA 3SDDC 1VGEL 3S35X 1BD2A 4MNQA 5JA8B 5J06A 2DJ4A 1AE6L 1YDPB 4MX7A 4Q0XL 3D48R 3TO4A 1K3IA 4U6TA 2VZTA 3HR6A 4Y5YB 4WW2F 5TDNB 4OGZA 1ZLWK 2E9WA 2FD6H 3GIVA 3AS2A 5F3HA 1T2XA 2APFA 1PY9A 3KR3H 1D9KB 4D3CH 5FYKE 2CUHA 3GMRB 4MAYC 1PGRB 1W0YT 2MHAB 3FMGH 2HMIC 2FCBA 3MV8A 2BSED 3N50A 2EDJA 2R1WB 4S1RL 4Y5VB 2VZUA 5TE7L 4MB4A 4WU7A 3ZT5A 4QGYA 5F96H 2FX9H 2B4CH 3EFDL 4Z0XA 4Z7OF 3ARFD 5FCSH 5D1XB 2DS4A 2H45A 5C0CE 2W0FB 2IANA 5D2NE 1NCBH 2UV3A 2VO5A 1TJIH 4HJGB 2WK2A 3U4BH 3O3BB 1FO0L 2PO6D 3VW3H 3BEWB 1R5WB 3DI2B 1ZLVK 4YXHH 2UUDK 3SCMD 5F1IA 1DSFH 5JIHA 1KIUA 3CVHL 3GZKA 5C0EA 2Q7YB 3VRJA 5JZ7C 1MFBL 2VZ1A 3BMWA 3WNMA 2FH6A 15C8L 2YD9A 1DVFC 4I2XA 1EIBA 4QWWD 1WZKA 1P4IH 3M8OL 4ODBD 1CK0H 3CNKA 1RQ5A 2YUVA 3BPNB 3EDFA 4Y19E 1U8HA 1MRDL 4OCYL 3CFEB 4D9QD 2F5BH 4MYWB 1I7TB 5B22A 1R24B 2V2TB 1YMHB 3CLEL 1WTGT 3ARED 3HE7D 2DL2A 1SJXA 1A3QA 5CBEB 2X4PB 4IHOA 5FYJD 4QF1B 1A9BA 5GRVL 1NLBH 5GQBA 1U6AH 2IFFH 1SMOA 1S9XB 1UWGH 3FRUA 3EYOB 4MMXC 1Q8MA 2PNDA 1IFHH 1NCWL 2RQ8A 1UEYA 1QQDB 3KJ4C 4RMTA 2A1WL 4U1SA 3WIIH 1ETZB 2HA1A 4GLRI 4G8IA 4IDJH 5D5MA 4YK4C 4PG9A 3P9MA 1MCCA 1MJUL 2JELH 4CVXA 2XOTA 3D3VE 3MROB 4O2EA 5I66B 1FAIH 4PJGB 5JORA 3T4YA 2EH7L 3BKJH 4L3EA 1HSAA 3FQXA 3TZVD 3LIZH 1EO7A 4V1DA 4Z8FL 4MA1C 1DQQA 2YD1A 4LCCA 4LKCB 5F89A 4TVPD 4DW2L 2GK0A 4L9LA 2YN5A 1OM3L 5ID1A 1ODAA 2EDQA 3V9FA 4QRPE 2DQCH 2NY0D 4PGBB 4LLYA 2VLME 3T0BA 5ALBL 3SDXE 2ADFH 1QBML 2V2XB 4ZSOB 4LP4A 2MTPA 4HUUB 2J8UA 4C54A 4PJBB 3N9GH 3SKOA 4WY7L 1CF8H 4R0LC 4S1DC 4JANB 3O0RH 1F13A 1YPZA 2A6DB 4H8WC 1QRND 5LXGL 3JWDC 4PJXB 1HXMA 1KN4L 3WHXA 4ZQKB 1DBJH 1KCUH 4HIIA 5IT2H 3D9AL 1YC8A 3KLSA 1HHJA 1I3RA 1EHNA 4XAWL 3X3GH 1YY9D 3EOYG 4RIRB 5BVPH 5KN5A 4XHQA 3CH1A 3TN0C 1YECH 2FHFA 3SKNB 4RMUA 2Z8WC 3DUUB 4MJIB 2A6IB 3PWLA 5AZ2H 3RVXD 3O9WA 5HHXH 3RL2A 4LFHG 5CILH 4RQQB 1KT2B 5F7NC 4PGEB 4ZO6A 5BV7L 1S9WB 1T7VA 2F5AL 2Q8AL 1KELH 3KS0J 3ZKSD 4MAYB 3F5WB 3G5VA 1JPST 2AJUL 3WFBL 5MENB 3C09C 7CGTA 1NFDB 3D69A 3QFDB 5T3XD 2YUZA 2O5YL 4CVWA 4HX1B 4I9WD 2EDXA 1PYWB 3U9UA 9CGTA 4PLKD 5L2JB 3MUGB 3P9WB 1QRKA 4KHXH 4G8EA 4AY0A 2ZPKL 4GAJL 5C0CA 4KQ3L 1PX4A 3LH2L 5HI3C 4WFHD 5A2IH 5IFHH 5D2NA 3EOTH 4FQJH 3LKSA 3WL9A 3S98A 4GAYA 2YD4A 1DL7L 3SJVE 1AD0B 2FX7H 2GSGA 1DR9A 5IB4B 1FJ1A 1WCBA 3OWEA 1IAIM 1BLNA 3VXUE 1O5DT 1ZGLP 1BJ8A 3LPFA 2AEWA 4V2CB 4ZAKB 5GPRA 5ABDE 4ODXB 4OBSA 4YHNB 2IBGA 4JHAH 1YZZA 4M43H 5E8EB 4Y19A 4F80A 5CLWA 1EO8H 4JG0H 3O3EB 3UXFA 1HNFA 3I50H 3UYPA 3VWKD 3JTTB 2D0HA 1MHCA 1MFNA 3BD5A 3CK0H 2CGRL 2XNAA 5IBLD 1P4BL 1P4LA 2CK2A 3U6RB 4E5XA 4QXGL 4GAGH 4G6JL 2VXQL 5FA3B 4LQFL 4H0GA 5DGRA 5JUEL 4J3UA 4XVSL 2LVEA 1DBKH 4OZ4B 5SWZB 3KJ4B 3LKRB 4AMKL 4A6YL 1HKFA 1V3JA 1M7DB 3RWGA 3D3VA 1DQML 2R69H 5IB2B 1TPXC 2NY6D 3A67L 2I25N 5E94A 3VE0B 5MHSD 3ARYA 3MGTB 2V2WB 3V4VL 5GRVK 4ELKA 1PQZB 5C0JA 3P4NB 3SE4A 1WV7T 3BP4B 1A0QL 1U8NB 2EKSA 4LHUD 4WHTA 3C6LB 4AIZB 4XCFH 4W4NA 4JG1H 2DQJH 1ITCA 3K8LA 1N2RB 3L5XH 4Z6AT 1C5CH 1CE6B 3QWQB 3LKPA 3VGFA 2AJXL 4ZO9A 1FNHA 5K9QI 1FIGH 2DM7A 4X8XA 3ROOB 3MBED 5LQBL 1K8IA 5ERWA 5D1ZC 4TSBL 3I3BA 5E9DD 4U2ZA 3RP1A 2GTWB 4DQOH 3BGFC 1G6RH 4R0LB 3TVMA 3HB3D 2HFGH 2HJLB 4YHYC 5E08L 1VESA 3MOBH 3IXTB 4J1UB 5DC4B 5BVJB 1A7OH 1Q9OA 5C0DA 3WO4B 1Q9WB 1T4KA 4KMTH 4P23C 1S7XB 5DK2A 2QR0B 2EC9U 4L3CA 5HYEA 3WYRA 2ZSWB 4Y4KC 3TCLA 1XEDA 4TUJA 4UIMA 5IW1A 4BH7B 4G8FA 4WU5A 3S4SB 3BIKB 4ODSH 4MLSA 2FEEI 1BZ7B 4F58H 1ZT4B 3MACH 3B9KD 3S3JA 4PV8A 3AVEA 4QT5B 4W6WB 5EIQA 3RX5A 2YUXA 1EEYA 1ZMYA 1S7UB 1PZ5B 3K2MC 2HWZL 4HXAH 1G7IB 1UM6L 4CNIA 4YBQC 2X89A 1XMWA 1SJEB 3AY4C 3C09B 1JMZA 1UH4A 1BBJA 1KC5H 5IESH 1JGLL 2B5IC 1C16A 1IKNC 3BP6B 5BQ7B 2HKHL 2OXHA 1QFWL 2FSEB 1RHHB 4PJ8D 5T5FL 4M7LL 4WW1B 1DANT 3SGJC 2P5ED 4NO5B 2OSLA 4KRNA 3RI5F 1FFOB 3QPXH 1GOHA 4TNWF 3SJVA 2D0GA 4BH8B 1NBVL 3LMJH 2QSVA 3DRQA 3T04D 3LKNB 1JIBA 1M71A 2DN7A 5DVLA 4K94H 5I1AA 4PLOB 2NW3A 1EXUB 5I30H 2NXYD 4UQ3B 3GMPB 3RFZC 5DUBB 5EU5A 1F4WL 3H9HB 3L7FA 3IYLW 1QBAA 3UDWC 2VAAB 4Z7UA 1BGXL 1BVKA 2MOVA 1WFNA 2KDGA 3QWOB 5B39A 1EFXA 3L3GA 2EC8A 3NAAH 5EBLB 4P4KC 4N8VB 2O5XH 1FIEA 2ZJSL 4EI6A 1MWAA 5J1AA 3VXTB 5IVXE 2WBJC 2R4SL 5LAXA 4Y2OA 2BHYA 3PQYB 5IROA 4WJ5B 1N59B 2FWOA 4ZPTA 1UADC 4DUWA 3G6AA 3RGVB 1O7SA 3RGHA 3SDCD 5ADOL 3CFBB 4U7SA 4AT6B 1NCCH 4QY8B 3IXAB 5HDBE 3KJ6H 2RFXB 3IAPA 2HH0H 1S7VB 4F57H 1SJHA 4FFYH 3VD9A 3QB7C 4LKXA 1BFVL 2B2XH 2Q8BH 4PYHA 4APQC 4JQIL 3EZ8A 3QDAA 4Y4FC 3EYQD 3O6KH 3TLRA 3H7BB 2GAZB 4LLWA 1I9JH 1U8QA 4PJGF 4HWEH 3RKDC 4FG6C 1TPXB 1CD1B 2K9UA 5IJKA 4YNYA 4ALAH 1S7QB 4WI6A 4XC3L 5EU7E 2ENYA 3OKMA 4K7PX 4P59L 1CI5A 1I7ZB 1ZOXA 1OAZL 3X12A 4KRLB 1MFDH 1PSKH 3CMGA 5BRZA 3PWNB 1QP1A 4GG6E 3O2VH 2KUTA 3P0VL 1FFNB 5FGBA 4XTRC 5DQJB 1YEDB 4H8WH 3RWCA 1K6QL 4I0PA 4S2SA 5KSUA 3WFHB 3E6HB 3JWDH 3MLSL 4JQVC 4BK5A 1L4IA 1XGUA 1RJYB 4PJBF 2X4OB 5DYOB 1OSZA 1TVDA 2AAVA 3KYOA 4OF7A 3TO4C 5D1ZB 4QRQA 3UPRA 4OI9A 4G8GD 4OFYA 3QO0A 2EH8L 4YHYB 4D9QE 1DN2A 1BQHB 4PJXF 4DFIA 8FABA 3S35L 3ZHKA 3WXVH 4PJ7B 3GK8L 5IEHB 5DVMA 1JWMA 2AEQH 4NUGL 4NKIL 2AV1B 1XR8B 4EUPA 3VCLB 1ZA3A 4X7SH 5TF1H 4JY4A 1J05B 3X14B 5LGHL 1B4RA 3QHTC 3D39D 5KBNC 4XCNA 3VFPB 5HI4C 3L3JA 1FNSL 1PFCA 3VFSA 5I17A 4K7PY 1CFTB 1KTRL 3KS0H 4S1QL 5ETUB 4EN3A 3AMLA 2JLLA 2VDRH 3MRIA 3UX9B 4L8SA 4KJYB 4LDOB 3BHBB 4IRSC 1ZT1A 5HHNA 3IKKA 3LCYA 3U9PH 3IU3A 2XZQL 5TFSH 4HF5H 4Z95L 3MRRB 1NFDF 5FHBL 1JYVA 1QA9B 4U0QB 4XNYL 2CH8A 1LD9B 3IFLH 2R0LH 3QXUA 5HGBA 5DD6B 4UOW0 4M4RA 3AROA 1DUYA 1YEKL 2BNUB 2G75A 3C5ZA 1D5ZA 4MD0B 3PWUA 4TVPE 2AQ2A 3TV3H 5JW5B 2GSIB 5C0AB 5DHYA 4JFEB 4KK9D 4PJAE 5CZXC 1IC7H 1TETL 1H15A 3FN0L 4KQ4H 1HQ4A 1AGCA 2DBLL 1TVBA 2ATKB 2IADA 5T1LD 5LWYL 2HP4A 1PG7X 3CVIL 2Z35B 1N6QL 1WSST 2DD8H 1I8IA 5I75C 3QRFM 3ILPB 4U6VL 5HGHA 2XZCH 4LAQH 2I9TB 3H3KA 3LKQA 3QG7L 1RIVH 1F8TL 1K4DA 4N90D 1KLUA 1CGTA 2WLYA 2BVOA 2EDYA 1IM9A 2X4UA 4HDIB 3BZEB 4U1NB 2NY1C 1QRNE 1H5BA 1P7QA 4EDWH 1Q0XL 2BOBB 5D70L 4CDGC 3V5KA 1FH5H 3S96B 4P4KB 1V3LA 1AJ7H 1ZKAA 1E4XH 1F3DH 4HEME 6FABH 2DQEL 3V6FB 2WBJB 4FZEH 1FNAA 3MRCA 4OF0A 3GMQA 1IT9L 4OQTL 4K7FA 4UV7L 4JFZH 1CXIA 5FUZH 2ED9A 1FZMA 4U05A 1NPUA 3VD3A 2EE3A 3O4LD 5D72H 4JZOA 5DJYA 2XKNB 3Q3GA 4CW1B 5EOCL 3BP5A 3BSZH 1MFAH 4H88H 4LIQH 5E8NA 2ED8A 5CKGA 3V52L 5IHZA 4N9GA 4EUPG 3WIHL 2ARJQ 4JGJA 5KSBE 4NRYA 3SGDH 2P5WD 5T3XE 1BPVA 4F15C 4G5ZL 4I9WE 2ZCKL 2I27N 4OLYH 4PTUB 5KSVB 1J88A 4FQIH 1X9QA 4N5ED 1QPXA 2M1KA 2ITCB 4TPRL 3S36X 4PRNB 1D5IL 4MAUH 2LABA 2BJML 4JM2C 4WFHE 5JTWA 1A7RL 2AEPH 4B50A 3HTLX 2BMKB 2QTEA 3KLAA 2UZXB 3QUKA 4JO3H 3IDMB 4X99A 4NYLA 2V7HA 2X70A 4URTB 4YHIB 3WKML 1QFUH 3TIEB 3MRPB 1HHIB 3OB8A 4N68A 3SCMA 1LNUB 1WZ1L 2VC2H 3RHWF 3STZA 3U83A 2QQLL 1FP5A 3INUH 1BD2B 3LPGA 3OR6A 4HLZG 3SQBA 1HH6B 5TE6H 3FO9A 1C5BL 3U79A 3KPPB 4XPFL 1KJ2A 4KKCC 2EIZA 1G7MB 2J2ZA 5E99H 1YN6B 2V17H 2BP3A 4PJIF 5C2BL 3IRZA 4O58H 2AJZB 1HINH 2APTA 4K23L 4XAKD 1BIIA 3N85L 5HJ3B 4U1LA 5FO7B 4X6CB 1XF3A 2QV2A 4OZFA 2EKJA 4PRBA 4OCSH 4F8TA 4QTIH 5CEZD 3QDGD 5D2NC 4GW1A 5H35A 2GEEA 4NZRH 4LEOA 4D0DB 3SKUD 4EVNB 4M48H 4J2XA 5IB3B 4LGRB 1Q1JL 1XF1A 2X6MA 4LSPH 5I1CH 1INDH 4LLVA 1UJ3C 1XR9A 2VUYA 4MD5B 4X6BA 3U48A 4IRSB 3FOMA 3DXAB 4DN4H 4DCQA 4PREB 4GMSH 2OP4H 4HPYH 3O3AA 3K2UL 3QHFH 4OUOA 4M7JH 5C07D 4JDZB 1D5MA 3D0VA 3KPOA 4NBYB 4KI1A 2OXGA 5MHSE 4RAUB 4JZNB 3BP7B 3QEQB 4KRMB 3VFGL 5C0RL 5C3LD 5HPOA 1YEFH 4YDLC 3DX6B 4PB0L 5EFIA 3S88L 1XCQA 1E4XI 5EU3A 2WINB 3DROA 3RBSA 3UTPE 1LK2A 4S0SD 2E5EA 3X13A 1U8HB 5CD5C 2UZIH 2PYED 5AYUH 4ZO7A 4MJ6A 5L0QC 3DGGA 4ZFOL 1L7IL 5AUMA 5HHMD 4EIZC 5MEQB 1FL5B 1I8KB 5FK9A 5I1GL 4OFIA 5E9DE 5TPWH 5I75B 3MV9D 4YDKH 2CKBB 3O6MH 3DYOA 1J0YA 1MH5B 1MRCH 5E00A 2R0ZL 1I1AD 4XPHL 5DURD 4CMMA 3N1MC 4BZ1H 1KSRA 3SGDI 3TPKA 4HKZA 4OCXH 5INDB 3EJZD 1QRNA 1RU9H 5GZND 3WLWC 3X11A 3FCTA 1ZAGA 2Y07L 1CFSA 1IGML 5DD5L 4NZUL 3DURB 5ALCH 1RUAH 3EIFA 3QFJD 1AGBB 1CFVH 3CC5A 5T1DL 3HE6D 2R9HC 1UVQB 3FB8B 4X6DA 1RHFA 3U82B 3SE4C 3MRFA 5E4EB 4MQ7A 4LSSH 2DQDL 2QADC 3I9GH 4O02H 1RK0B 2XG5A 1U3YA 3P3YA 4JDVA 4EBQL 3W0WD 4C56B 4MSWB 1RVFL 3IB4A 4LPTA 1RZ8B 4OCRL 1ZA6A 3DX9A 5KSBA 4I48B 3HC3L 5J89A 4NQDD 3MJ7B 5A2LH 5B38B 1UXWB 2Y36L 5GGQL 4F15B 3GDBA 1GHFH 3QCTL 3TVMC 3AS1A 1TJGH 2APWA 5I1IL 4OAWB 2Q7NA 4X9BA 4N0CD 1U91A 1CICD 3BD4A 5EU6D 2P5EE 4YZFF 5ENWB 1A3LL 5BZDB 5L9DH 4JM2B 1ED3B 1AGDB 5HHVH 2CRIA 2EDHA 3KPQA 4OLUH 4HHAB 1NGQL 1OD7A 2ICWA 4FQLH 1MNUH 5FGSA 3MODH 4XBEH 5E6IB 1SM3H 2FL5A 4PJEB 2E6QA 4G9DA 5D2LE 1T7WA 3IDGB 5FA4A 4JRYB 3MCLH 1G1CA 2DL9A 3QQ4A 4M6OL 4WV1A 2YN3A 4EZMA 1CLYL 4HKJA 4MNHA 5CGYC 2CRYA 1S7TA 5CCKL 4X4XA 3VWKA 5DT1H 1R3JA 4G6AC 2HRPL 4N0RA 3HRPA 1N5YL 2XWJA 1ZHKA 4KJPD 4NFDA 3WN5B 3MC0A 1YNTB 2VR5A 1BVLB 1UFUA 2XQBL 1NGPH 5HHOD 3UTSB 4F9LA 3E2HA 4P9ML 1U41A 1SEQH 2EIDA 4L29B 3VJ6A 5A16A 1Q94A 5D4QA 4H1LB 5DF0A 2FATH 2X4RA 1FLRH 4ISVA 1WBZB 5FUOL 3QQ9D 4N0YL 1JUFB 1ZGLB 1HSBA 3NH7H 5M94B 3BZFB 2D7PA 1YEGL 4O5LH 3CFDA 2HT3D 1MCHA 4LSQH 4XP1L 2WWKO 3BAEH 4RMQA 1UJ3B 2B0SH 5CS7A 1C08B 5IOPA 1CN4A 2ID5A 1HYSC 3KNBB 1GL4B 4LLQA 3KPLB 3VXRD 4PRPD 5AD0A 4OZGB 5EULV 5BXFB 5HI5D 2CKBH 3IFNL 1T1WB 3VDAA 1F6AA 4LHUA 1YEJH 3WE6A 4JFFB 1XGYL 1ZANH 3EYSH 1CGWA 2F8OA 3NTCL 4LOUD 1YC7A 4KZEL 1CXHA 1IGCL 5ICZA 5BS0D 1NCDL 1BM3H 5CGTA 1DN0A 1INQB 4HUKB 1A5FH 3G9VA 2BC4A 2KBGA 3AM8A 3MBEA 4IDLA 3QA3B 5KZCD 2BRRL 1EVUA 2Z93A 2YR3A 5E9DA 5IROC 1AKJB 5IMOA 4E5XB 1EEQA 2AABL 5C0FA 4KTEL 1R3LB 1CDJA 1E6OL 5FCUH 3MV7D 3ZL4L 4G8GE 5DQDL 3VGGA 2OTWA 4MZ3A 4ZUTA 4YAQA 3K80A 2ZCLH 3HI1A 5DLMH 1LO4H 5F72S 2W0PA 1KCKA 3HC4L 4KY1H 4TYUA 1SEBB 2IALA 1HH9A 1TQCC 3V4UL 2C3XA 2OR9H 2IWGA 1UWEH 1IJ9A 4XH2A 5DS8A 4Z5RA 4KROC 1JN6B 4G9FD 2VKXA 4WEMB 3AXLA 2AJ3B 4ONOA 2HKFL 1R3HB 3D39E 4XP6L 4KJWC 2ATPB 3L3HB 2BK8A 2FBJH 3O6LL 4F7TA 5FHAL 1SBBA 4YHKL 5FGBC 3CDGB 3UC0L 4NM8H 2MCPH 1RZKC 2QADB 4NPYA 5HYJD 5KJRL 3V7MA 4QRPB 5T1KB 5FGCE 5SV4A 4YHOH 5T33H 2G5RA 3WJJA 3AMKA 2FR4A 3O45A 2EEDA 3SDXB 3OZ9H 5D9SB 1YNLH 1I75A 4KPHL 3QXDA 4EDXA 2DYPD 3HCVA 4OI7A 1DANU 5DJ6A 4K7PL 2JTDA 4KHTH 1B88A 4PJCF 3CLFL 4OGYL 5EU4B 2LFGA 3JUZA 4F7MA 4FQHA 4WGVB 3QDHA 4M3JA 1KCSL 5DWUH 1UM5L 3MMEA 1FE8H 3C8KB 3RWDA 2MQ3A 2QQNH 1U8IB 5FYKH 3W9EB 1ACYL 1OB1A 1FDLL 1A7NL 1QHOA 1UM4H 2P24A 5HYSB 5I1EH 4RISH 3QJHB 43CAA 5D2LA 3U7YL 1T1XA 4PG2A 2GTZB 4HFUL 3O41B 2VDLH 4JPVH 2NCMA 5HDQL 3LKOB 4N90E 5KVFL 4XP5L 4XI5C 4Z77B 2BHUA 3U46B 4EN3C 2H3NB 3OJ2C 1J1XL 5SV3A 1VGKA 2VDQH 1ORQB 4L8SC 2APVA 4NQSB 1U8OB 1T83A 5F8RC 2BVPB 4YDJA 2DWEA 4C55A 1HDMA 4X6CF 4RBPK 1IAIL 1I4FB 1P2CA 2FB4H 2BSSA 1KTDA 3FQTA 1X4YA 1OAKH 5DEGB 1H0DA 3ULSA 1QNZH 2A6KB 3P77B 4I3RL 1VPOL 3C5ZC 3SY0B 5J9PB 2OR8A 3SDCA 4K9EH 5HY9B 2E6PA 3O4LE 2GJZA 1ZVYA 4X7DC 2NZ9D 2VIRA 1U93B 4JQXA 1HHHB 1CXKA 2OL3L 4JEGB 1JTOA 12E8L 1Z9SA 2B1AL 3OX8A 4YHLL 2Q87A 4K3GA 3WFDH 3A6BL 3VXUB 4P57A 1C1EL 2DQUL 2P5WE 3BISA 3RUGA 1EVTC 3PGCB 1FNGB 1GC1C 1MJ7H 2EYRA 4UV4H 2ARJA 2YD5A 1JNLL 2PCPA 3ZYJA 4HCRA 4P9HL 3B3IB 3FB7A 4BFEA 1HCVA 1H5BC 1T6WA 1HKLL 1JV5B 3BO8B 1U42A 3H8NA 2I60L 4LASL 5DTFB 4Z0BH 1J0ZA 4UTBL 4XB7A 5B39B 4RDQF 4LF3A 3ME0A 3NZ8B 4NHUE 3V0WH 3BT2H 3QCVL 4NQUA 3VFWA 2HJKB 5LAXB 1A7QL 3RWEA 1ADQL 3GSNB 1ORSA 3QDMD 2AJSL 3T0EA 1CIUA 5DMIH 1FGNL 1E4JA 2BRQA 5A2KH 3AGVA 1JPTH 1NC4B 3PL6B 1HYRC 4CVUA 2D4FA 3OKNB 1CL7I 2FGWH 2VERN 3CDFA 3DVIA 3M17A 3P9LB 3QI9A 5D5MF 4P2OD 3UBXB 4BUGA 4XAKE 3A6CL 3FB6B 3QAZC 3QIWD 4LKXB 4M7LT 4C57C 4POUB 3LOWA 3TWCH 4UB0L 1TQCB 4NKDB 3HPLA 3U4EA 5INCB 5GSVB 4OQ1A 2XTJB 3MRGB 5EZLA 5EU7C 4KROB 3ARFC 2YS4A 4M93C 3D39A 5IQ9B 3QDGE 4X5WB 3V2AR 2ADJB 5D7SL 2C9AA 3DYPA 3PDDA 5CINH 5JR1L 1KCRH 1F6FB 2PO6C 3QSKB 1JCKA 2FNBA 1FAKT 4M6NH 2VXTL 2D7NA 3C8HA 5DJZA 5I8KL 3SCMC 1T7XA 4JB9H 2YC1B 4S0TD 5IMLB 1MHHB 2JIXA 2DMBA 2HRLA 1XCTA 5LCVL 3X3FL 5E8OA 5BMFH 3MRMA 3WLBB 3U0TA 4ONHB 3R4DA 5C07E 2J8UF 4U6YB 3MLUH 3QUZD 3PV6A 1QBLH 4QWWC 1KGCD 1YN7A 1NGXB 4DN3L 3DI3B 4P2CG 3BE1L 2APXA 4PRDB 2VSDA 2JKXA 4HZAA 3LS5L 5CUSH 3NABL 4JM2F 1VB9A 2PYEE 1X5JA 1ZVSB 3AREC 5T1LA 3HE7C 3HI5L 1ZVHA 5HHME 4QLRA 1EHXA 1FYTD 1I9EA 2EEAA 4PJEF 2B1HL 1ZA3B 3MNVB 1YJDC 4JY4B 1V7NL 5E1AA 4GRWB 4BQCA 1NJ9A 4YDVA 1IQDB 4R4FL 1EAPB 1DDHB 3Q2CA 5C0IA 3QEHB 3QUMA 4UT6H 4OD1L 3JV4A 4LNRB 5IFJB 5JPNB 4QCIA 5SX5H 3BRDA 4EN3B 3KXFD 4X7TA 2ERJC 5JO5A 3LZFH 2J4WL 4PY7B 2ZUQC 3Q5OA 2ZCHL 2P8LA 3O8XA 4XWOD 3QFJE 5KVMC 5IM7A 3TZVC 3NA9H 1R3IL 1ZSDB 1IAOB 2E8YA 4P5MB 2DIAA 1RUKL 2X4TB 3OKLB 2O61A 3O4LA 1CXLA 4OIBA 1M05A 3RIAK 1ZHBB 4ETQA 3MLWL 1BAFH 4HBCH 4JM4H 2VE6B 3W0WE 2IC2A 4GKNA 5F1NA 2NY0C 1HQ4B 2MKLC 1P1ZA 5F6HJ 2XWTA 2P5WA 4NQDE 1MWAH 3D18A 3FQRB 1T1ZB 1T5WA 2D7TH 2ZUWA 1G7PA 4LPXA 4N5EA 4JZJA 3RA7L 3EO9H 2YD8A 2Y7QA 3GMNB 4W68A 1INEH 5I2IA 5D7JB 3BPCA 4HUXA 5EU6E 5IB5A 3BH9A 4UT7H 5CJQH 3QDJE 4KVNH 1TCRB 4PIRF 1GVIA 1A3RL 4F7PA 1CGSH 5H8DA 2EDLA 3PP4H 3V5KB 4EIGB 5KS9A 2X4QA 5IVXB 1OTSD 3MR9B 5GGSY 1X4ZA 3JV5A 4JO4H 1AQKH 1YY9C 4HH9B 3P4OB 4LVEA 5I1DA 1MJ8L 2R8SL 1JYNA 3B9EA 3DVFA 1GGUA 3PV7A 3RAJL 1W72B 1T2QH 1DE4A 3RVXC 3TO2B 2VABA 3ZDXE 1CR9H 3GJFB 1FZMB 1NLDH 3P0YH 1JGDA 1I7RB 1I9RH 1U8LB 3UTZB 3O2DH 4B41A 5DC9B 1XF2A 2YPKA 4HULB 4M00A 4NNXA 1PX3A 1WC7B 4KUZL 1HE7A 3QAZB 4HT1L 4U6HB 2NPLX 3QIBD 3OB0H 1RZKH 5KAQG 2VOTA 2P4AB 35C8H 4PLKC 5EC2A 2CR3A 4IMLB 5HHOE 5IQ7H 2Z4QB 1UCBH 3L95B 5IMMB 3ARFB 3V5DB 4M93B 3QDGA 3MSPA 1CFNA 5ACZB 3SGKC 1KENH 3BUTA 3K4ZA 4GG6B 5JLZA 5D7IA 2PO6B 4FS0A 3NFNA 1HXYA 3RWJA 3WD5H 4WI5A 1Q0YH 3DV4B 4OF8A 3PUCA 2F74B 3SDXF 3H3PL 4NM4H 5C07A 5KW9L 3VXRE 3ARRA 4TOYL 4P2YA 4HJ0D 3VH8G 4PRPE 1GYAA 3UMTA 3FO0H 4LLUB 4Y5XC 5F7MC 4EUPH 4XBGB 2JJTA 5ICYB 4MJ5A 4FP8L 4OF5A 5DUML 3RIFK 4RGOL 4DGVL 1I1FA 1KEMH 1C7TA 3VWKC 1Z9MA 1X7QA 1NL0L 2LTQC 2PYEA 3HR5B 3WIFA 4ZFGH 4XMKL 1SYVB 2Q76B 4UU9B 4XT1C 1NMCC 3V4PH 5DD1L 5BS0E 4HJJH 1ZLSL 3DHJA 1YY8B 4QOKB 4WNQB 3AREB 3HE7B 5HHMA 3TFKD 2ZOLA 4OV5A 3S3PA 3BQUB 5IBLC 4HXBH 3E2HC 4PRBB 4F9LC 3MV9A 5MEOA 2WNGA 4GT7A 5GRYA 2J7LA 4HKBB 1J9CT 3IGAB 3RWHA 2PXYC 5IWLA 1F11B 1I1AA 5I0DA 2UVFA 5HGGS 1ZHLA 3MV7E 2HTKD 3AAZB 4XMLH 2AXJA 5L2KB 4LEOB 3QEGH 1NAMB 5ICXB 1YEIL 4PJ9A 3OKDA 4S1SH 1RSFA 2D0FA 1U2CA 1LILA 3IF1B 4JPKH 3EYUH 5I16A 1Z0NA 1IAKB 5GS0L 2XZAL 3HPJA 2WUCL 4R90L 4F37F 3QFJA 5JOEA 4OJFH 1FPTL 5HGAB 3C5JA 4OD2A 3KPOB 3TZVB 1IGTB 1QLRB 2CJUL 2VDPH 2RB8A 3UBXI 4TUOB 4NKOA 1GC1H 1G9NL 4N0FB 4FOMA 2UWEB 1XCQB 4R4ND 2G5BB 3GSWB 3MJGX 3VDCA 5FM4A 3E0GA 4OLVH 2ESVA 2F9BT 5HYJE 4PJAB 4J3SA 1EJOL 1UG9A 1OCWH 5F7KC 3BZ4B 1OARH 2VLLB 3AM8C 3MBEC 1L9MA 3RNKB 3MRJA 2Z8SA 4PRHA 4NQDA 3QO1B 1QFHA 1H3PH 3Q1SL 5EO9B 2IGFL 3OKEA 2HVKB 3W82A 3NCYP 3HB3C 5IG7B 4N0CA 4HUMB 4CMMB 3U1SH 2JJUA 1A4KA 4PGCA 1AH1A 1RIHH 4MJID 3L3KB 4L5FL 1NMBH 1N7ML 1WCQA 3X11B 5IKCA 1DLHB 2YK1H 1J18A 4CL7A 2V9RA 4OUUA 1CFSB 4RFOL 4XCEA 1GZQA 5MEND 4LARH 3HI6L 1BFOB 4OF3A 2DDQH 4LLDA 3Q6GL 2EDNA 1JWSA 3B9KC 5HHQA 1IL1A 1FNLA 2CLVA 4P4RB 4NSKB 1FG2A 2BNQA 2A38A 3WJJC 1S8DB 4R7DB 2WM0A 3FTGA 3ZTNH 1RURL 1KN2H 4HMEA 4JRXB 4U0RB 2GY5A 5KSBB 4BSVB 1P7KA 1VKXA 2OZ4A 4KKAD 2VDML 3BVNA 4PJFB 4PR5A 4PJ8C 1FN4A 1WWWX 4ZUVB 5F9OH 5GS1C 1MSPA 4ZAKD 3QP3A 1NC2D 2VNCA 3GMMB 1UYWH 4P49A 1SQ2N 3MZTA 5HHPA 3SE3C 2A77H 3VXSB 3ZTJG 1K8DA 3DVGB 1ES0B 2DKUA 3VXRA 3CUPA 1FBIH 4P3DA 4OZFH 3T2OA 5C8JA 4JFPB 4WUUB 5FYJH 3OHXB 4M4PA 4PJDB 5GGRY 4QHKJ 4X5XA 4Y5XB 3SO3C 2C1PB 4PV9B 4WHDA 3OL2A 1JZ4A 4Q6IB 2D31A 1YJDH 1MCKA 4WW2A 5EBWB 1CQYA 5C6TL 1G84A 4RNRB 4XCYA 4TUKH 1T83C 5BJTB 2LTQB 3IETA 5BS0A 5SWZD 1OWRM 4YUEL 3PHOA 3GMOA 3HZVA 4FFVD 1QACA 4HS3A 2ZKHH 3L6FA 3QIUB 4PTTB 4DGYH 1JGEA 1T0MA 4MJ4A 3QDME 4XP4H 5D1QD 3LV3A 3VXMB 3MNWA 1H3GA 1CIDA 3UYRL 4U7MA 2PXYB 3MV7A 1U92A 1OGAD 4H26A 3EYVA 1S9YB 4JQXC 4NO3B 1N0LA 4PRAA 4OGAD 2IPKA 1VSCA 5F9JA 4TVPH 1BEYL 5DJCA 3C6LD 3EYQC 3BKCL 4ZMAT 1MRFH 1Y0LA 4QXTB 1A1NB 4X9FA 1YUHA 1OGTB 4LCWD 5KOVC 4G9FA 1TZIA 3GMLB 4KDVA 4Z76B 1TZGH 1RUQH 4R4BB 3SN6N 5TQ0H 3F7YB 1LE9A 3LN4B 1OPGL 1KIQB 1NUDA 3IDNA 4MD4B 1I1CA 1QG3A 3RJDA 1II4E 3SE9H 1LEKA 1GH7A 4YXKH 3HUJB 3BGAA 4RCAA 1Q9KB 2CUIA 4KKLD 5I1HL 4PDCE 4CVZA 4D9LH 4G6KH 3GM8A 1T66D 4ORGA 2DYPA 3ULUD 5KSAC 4YWGL 5FYLL 3ORJA 1KGCE 3ARDC 4B7IA 1FFPA 1Z3GL 1HHGA 3L7EB 5EZJB 5DJXA 5IEKA 2DAVA 1JHTA 1S7RB 1SJVA 1YEHL 1KJVA 3OF6D 1T21B 4UDUB 2JCCE 4MNGB 4ZD3L 3JTSB 2NXZB 1U8JB 2OTUA 1L7TH 3CD4A 4GKZA 3MRBA 5IVXF 5I9QC 3MLTB 5D6CB 4D2NA 1FYTE 1DQDH 5EH1A 4YBLB 3T3PE 5T3XH 4IRJB 2W65B 3S36L 3MRHB 2H6PB 4R7NB 1CFBA 1YEEL 3SKMA 1V7MH 3QYCA 1RZIA 3B9KB 3ES6B 5HDBF 1KTLB 4RZCA 4ZXBA 3OGOE 4IRZH 2QSCH 1KCLA 3KXFE 4TSAL 1MIEH 2FD6L 4HZLA 1KF9B 1RZ7H 2IPTH 4JRWA 2BXYA 3KR3L 3LRSA 2YD2A 4D3CL 3TP4A 3KYNB 5HD8D 3FMGL 4P46B 1GOGA 5DRZB 1H3XA 3HFMH 1LO3H 4FQQA 4PJ8B 2APBA 5GS1B 3ABZA 4ZS7L 1DLFL 3VFOA 1B0RB 2P5EB 5D7LB 5J6GA 2FJFA 4KK9C 4MB5A 4WWKC 5F96L 2FX9L 4GG6F 1FVDA 2B4CL 5T3ZH 3V5HA 4KRPB 4CN1A 3LPWA 3CJJA 5CBAA 3FB5A 5ISZB 1AHWA 1B90A 2HLAB 4I77H 4XPTH 3MJ8B 5E2WH 4GKOA 3WS6A 2H9GB 1FNEA 4GH7B 1TJIL 5BW7C 2WIIB 1D6EA 3VW3L 3VXOA 4H0HB 1RUPH 1H8NA 1R0AH 1A9EA 2H32B 4JPWH 4BA8A 3HA0A 3SOBH 4YXHL 1FQ9C 1DSFL 3S5LB 4Z7NE 4OCMC 2C3VB 3G08B 3GSXB 1BX2A 1HILB 3PQYD 1FZOB 2B20A 5F7LB 4XGZB 3RGVD 4TRPH 1P4IL 2X1WL 1CK0L 4M1GH 1A1OA 4P5TB 5DD3H 5C70A 2Q86B 3I6KB 2FYYA 2F5BL 1UB5A 4OLXL 1J5OH 1EPFA 4O51B 5EBMA 4YHZH 2CXGA 4WEUD 1K4CB 3L3DB 5F6HI 3UO1H 5DEZA 3JWNC 2A6JA 4I0CC 1KPUB 25C8H 3QNZB 1HZHL 1NLBL 2D9QB 4P2OA 2VIRB 1U6AL 2IFFL 3GUTB 3IJSB 5FOJA 5C09B 3T3ME 1UWGL 5FFLA 3QIWA 3CFKA 3PDOB 3N1PC 5DHVA 1IFHL 4GRMB 4LPVA 1F3JA 3WIIL 5I8EA 1ZLVH 5I18H 5TGBA 4IDJL 4BFBD 3TPUA 4P57B 3G5YA 2A74B 2F58H 3DPBA 1ZLUK 3KYAA 1MAJA 2D9CA 1GOFA 3LEXA 3PP3K 4JZJC 4N5EC 2JELL 3EOBA 3HNTH 1JWUA 4NFBA 1JJUA 4YC2B 1N8ZA 3N0PB 1FAIL 2ZNXA 5C0ND 5IUSA 1A6WH 3GKZA 5KANG 5IP4A 3BKJL 3CSYA 1U8MA 3EOAA 3LIZL 3IJHB 4PJAF 2VN7A 3HZKA 5C08B 2BNRB 5DZOA 4HS6B 3CFCH 2Y1VA 4B53A 5GZOD 3QQ3B 3RWFB 5IIEB 3VFWB 4OZHE 1UB6B 1WIPA 1RZGA 3QUZA 5HVWA 3F65A 3SHSA 5KSAB 5CZKA 3UZQA 2YWYA 3PWJA 2C7UA 2ADFL 3ARDB 2CLRB 1CG9A 3N9GL 1LMKA 4G8GB 2IQAB 2AXFB 2ADIA 4F7CA 1CF8L 2ICWI 5EUKA 4GBXA 1RJZA 1B9ZA 3RPKA 1FO0B 3O0RL 4KGLA 1QVOA 4PLJD 1IQWH 4GW4B 1T20B 1BJ1J 3PWVA 1MEXH 1FYTA 3HPLB 5I9QB 3CVHB 5I6XB 3QUXA 4YPGA 4NBXB 3BGMB 5JW4M 3I85A 1WZMA 4NRZA 1KCUL 1J0JA 5IT2L 4NWUH 1FL3A 2YPVH 5AWNL 1CZ8H 3V0VA 4MB3A 3R1GH 3TYFB 4GKSB 2K7PA 3H42H 4MXWH 3PG2A 5BVPL 3KXFA 4GW5B 1YECL 3IS0X 3MV01 5FGCB 3HAEG 5AZ2L 5JW4N 4NGHH 5C0AD 4ZOEA 2WBWB 4NN7C 5CILL 5KSBF 1XCTB 1UA6H 2VXSH 3OKOB 1QEWB 1I1YA 3QG6A 1KELL 1T5XB 5E4IA 5JPMB 4KTYA 4ZSOE 2NNAB 4IS6A 1AQDA 2H32H 1QR1A 4W6XB 1XGPB 4CU6A 2W1NA 3S37X 1G7JB 1HI6A 7FABH 1NDGB 4WWKB 4KHXL 2X05A 1OF2B 3T8XA 2DWDB 1NBZB 5IFHL 4FXGA 5CP7B 3EOTL 4FQJL 1ZGLM 2AI0H 3BUYB 2WWMD 3MLZH 4PS4H 3CCHB 3R8BB 4R2GB 5IWLC 2WBJD 2BDNH 4KGJA 2ZG3A 4FFEX 1WLHA 4LDEB 1YDPA 5C0IB 3EJZC 5GZNC 4Y5YA 5TDNA 3RVUD 1AFVH 4MJIE 1XGRB 3BDYL 3RNQB 2WANA 1W8NA 1OTUD 4UOJA 4JCMA 2VQTA 4JHAL 4NFCA 1D9KA 4M43L 4HK3J 3GMRA 1EO8L 2MHAA 3AFLA 5EOQH 4JG0L 4O2FB 5EZOH 4MXVF 3HE6C 2R1WA 3I50L 3RU8H 1X3DA 4Y5VA 5DFVD 3T0AA 5MENE 3CK0L 3PABB 1WZLA 4BQ6A 1OW0A 2GT9A 4K2UL 4ETQB 2UZYB 4P5KB 4HCRH 5D1XA 4GAGL 4I4WB 1QSFD 3HG1D 2W0FA 5KVEH 4E42B 4HJGA 3CFIC 1MCNA 2NX5E 3O3BA 4JFQB 3TJHA 3BEWA 1KB5A 1R5WA 2Y06H 3BI9X 4XRCB 2X1XR 1RI8A 1CCZA 4XNMA 3WDHA 4N0CC 2Q7YA 1CICC 5JW4R 2R69L 5CP3H 4HAFA 4HC1A 5K9JH 3D0LB 3NFPB 4U3HA 3OJDB 5BV7B 1P6FA 3E3QE 5EIIB 1JP5A 1NUNB 4ERSH 4PJHE 4NHUB 3CFEA 1KXQE 3IAQA 4U1KB 1I7TA 4XCFL 4NWTH 1HHKB 2EDOA 3EJJX 3K3QA 1YMHA 2DQJL 4JG1L 3WCYA 2V2TA 4WHYG 3L5XL 1C5CL 2LQRA 3LHPH 4TNVK 5CBEA 2X4PA 1SVCP 1FIGL 3DTXB 4QTHB 3I6GB 4QF1A 1MFBH 1XZ0B 4HWUA 3MUY1 1S9XA 4NDMB 3FOLB 3ZYOA 2OK0H 4NN5B 2P8PB 1QQDA 1ETZA 1G6RL 5HI4D 4KJPC 4PP2B 5SWZE 4BQ8A 3MUHL 3T2NH 3FO2B 3TFKA 1SHMA 1UT9A 3MOBL 2K7QA 3TNMB 1MREH 5TDOB 3HLAB 3MROA 1A7OL 3TT1H 3DXAD 5I66A 2Q3ZA 3RVTD 4KMTL 3GNML 4PJGA 4LEXH 1PKOA 3QQ9C 5EUOE 3B9VA 1OGAE 2E7HA 2VR4A 4R97C 5K9KB 2J12B 3PGDB 4YEEA 5GRWA 3BDBA 2YOCA 4FABH 2AKRB 4HQQH 4RGMC 4AZ8A 4LKCA 2HT3C 3OGCB 5B4MD 4ODSL 2NLJA 4F58L 3MACL 3BKYL 4LCWE 4NN7B 1AP2B 4JN1H 3VGHA 1P5UA 2IFGA 4PGBA 3D2UB 1L0XA 3VGEA 1JK8B 5TF0A 2V2XA 4ZSOA 5GSRB 5K9QG 5HI5C 4HUUA 3VRLE 1FVCB 4PJBA 5GRJH 3VI3E 5H37G 1RZJC 2ADGB 1CS6A 4CJ0A 2EXWD 3TYGH 2YHGA 5L6YH 1KC5L 4WW2C 5HVHC 5IESL 4JANA 4LOUC 3WIFB 3QUMH 2A6DA 1LO0H 4DW2H 4A6YB 1MVFA 4DZ8B 5E2VH 5CJXC 1A14H 4PJXA 4H0IA 3QPXL 1FSKB 3ULUE 4ZQKA 3C60B 1J10A 3EDJA 5E5UB 1BMGA 5MEOB 4M1DL 3ARGB 3LMJL 5CJ5A 3RI5K 5F70A 2X4SB 4TNWK 4YX2H 4RIRA 4K94L 4MQTB 1VHPA 5GIRB 5I30L 3SKNA 3K81A 3DUUA 4MJIA 4XPGH 2A6IA 4OD3H 4FNLH 3RWIB 4RQQA 1KT2A 5DRWB 1FL6B 3PWPB 1UENA 4MAYA 3F5WA 3LY6A 3ZZ1A 5HYQB 5LBSL 3NAAL 3WJLA 5MENA 3HN3A 1JE6A 3BKMH 2O5XL 3HE6B 1NFDA 3RVWD 2HFFB 3QFDA 1ZS8B 4HX1A 1PYWA 1KYOK 4I3SH 1KFAH 4XAWH 5HDLA 5L2JA 3MUGA 1TVHB 3JBG7 2W92A 1UQSB 4UQ2B 4NZJA 3W0WB 2J6EA 1JGVH 3ALPA 1TLKA 1NCCL 5KG9B 3KJ6L 2HH0L 4F57L 1AD0A 3PHQB 4FFYL 3LQAC 5IB4A 3IKCB 2B2XL 2Q8BL 3IDIA 4K3JH 2YZ8A 5E6ID 5EWIH 4G42B 2VZ3A 2MMXA 4ZAKA 1S7WB 1NC2A 1I9JL 4HWEL 1CICB 3K1DA 4ODXA 1JZ2A 1C12B 4YHNA 5EU6B 4JRYD 1D3CA 3QDJB 4ALAL 4PGCB 4Q6YA 5E8EA 2X7LB 3E3QA 4KDWA 3P4LA 4XNUL 3O3EA 5HVFB 4G3YH 2CK0H 1MFDL 1PSKL 3B2VH 3QWRD 3BESR 3JTTA 3O2VL 3R0NA 3FQWB 3EKCA 2DQIH 5MERB 4QO1A 1CDCA 2V5MA 1X6NA 4F7EB 3OXSB 4NIKB 1KXVC 1X5GA 3HKFA 3BOVA 3JWDL 2YSSB 3ZKXC 3UTSD 3PQYE 3U6RA 5CEZH 2CLVB 2IG2H 4M7KH 5J1TC 4UILH 1T3FB 3HZMB 5C0BB 4OZ4A 5SWZA 1LP9B 3LKRA 2PW2B 3FHQA 4HH8A 1FRGH 1SVZA 3OR7B 4Y4HB 1M7DA 4JPIB 1QLEH 3GSRB 3TT3H 5HHOB 5D1QA 5F9DC 3WXVL 5IB2A 3RY5A 3OKKB 3VE0A 2AEQL 3MGTA 4CU7A 2NZ9C 5FOBB 2V2WA 2AV7B 3N1QC 4NUJB 5JOPD 5TF1L 1PQZA 2E9BA 3HS0B 3P4NA 3Q48A 5I1JL 2FZ3B 3BP4A 5I8CB 1U8NA 1AHWC 2CXKA 2J1KA 3C6LA 4AIZA 4JFFD 4QRTB 4RGMB 4QXUH 3WS6C 1RZFH 3GBLA 4IJ3B 5MP6H 5CD5D 1CE6A 3L1OL 5L7XH 5EOCJ 1L6ZA 4HIJB 2CPCA 1LEGA 3U9PL 5A43C 4PRPB 1WAAE 4M61B 5TFSL 3ROOA 4HF5L 3QHZH 4JFHD 1AKJD 1I8LC 5E8PA 3IFLL 2GTWA 2R0LL 2D31B 3QXTA 4J3VA 2W9DH 4JFDB 2HJLA 5FKAB 4FRWA 4HKXB 1EZVX 3IETB 5GRZA 4R26L 1N4XH 4OLZH 3MV11 4J1UA 3GSQA 3TV3L 5BVJA 1CLOH 5IFAH 1Q9WA 2OBGA 4U1IB 2VITB 1IC7L 4PJ7E 1S7XA 1UKTA 4XCCH 4HIEB 4KQ4L 3IDYC 3L5WB 2QR0A 3DLQR 2AQ3A 4DKFH 1UCTA 1YYMH 4FXKB 3ZTJH 1GGIH 2ZSWA 3O4OB 4TSBH 4LRIC 2DD8L 5FUCE 3GSVB 3MV7B 3JV6B 4P2OC 4X4YB 4BH7A 1KLFA 3ZDYE 1MPAH 2XZCL 4LAQL 3S4SA 3BIKA 3QIWC 4YBHA 3MGOB 5F9JB 1RIVL 1BZ7A 4X7FC 1ZT4A 5IBTH 4LVHC 2HT2D 5IF0B 3S3SA 2P43B 4QT5A 3FN9A 2AK4B 4BUHA 2QADD 4LVNC 3DARA 2M2DA 1IGYB 1A21A 4HWNA 5T1KD 1S7UA 1PZ5A 1G7IA 1MQ8A 1OT1A 3MYZA 1FH5L 1SJEA 3FO1B 1AJ7L 2J5LC 3G04B 6FABL 5LGJB 2QQQA 3RZCD 4YDIH 4FZEL 1I7UB 2EDEA 4GUPB 4JDTH 3BP6A 5BQ7A 4JFZL 5JW4Q 1A2YB 2FSEA 1RHHA 5FUZL 1AGEB 4WW1A 1CFQA 4M9OA 4Y88A 5HYJB 1WFUA 4NO5A 1MCOH 5I8OH 1MCRA 5C0AE 5D72L 1FFOA 3V6OE 2XXCB 1EZVY 4BH8A 4O2CB 3QUZC 4LIQL 3BSZL 1MFAL 4H88L 3F12B 1MIML 5HYFA 2F8VA 4AEHH 1AGFB 1WTLA 2NTFB 3LKNA 1MOEA 3K46A 1EXUA 3QUYB 1OAUL 4UQ3A 5E03A 3GMPA 1JGLH 5DUBA 5D93C 1HK6A 2VR9A 3MJ9L 4OLYL 3H9HA 2DTSA 4L8DB 3BX7C 4FQIL 2WMPA 2X1QA 2CO7B 2VAAA 4RGNB 1B0WA 4C4KO 5EOTB 4D0BB 4MAUL 1X44A 3QWOA 1KIRB 1VCAA 2AEPL 5H2BB 4WEBH 5CZVL 5AAWA 5EBLA 4N8VA 4JO3L 2Z8VC 3VXTA 3GI8H 3WHE0 3I02B 1QFUL 1D5XB 5CFHA 1SBSH 4JO2H 3UAJD 1F6LL 1FCGA 1RD6A 2H8PB 2VC2L 3PQYA 4WJ5A 3INUL 1N59A 2GIYA 5EC1B 5EO1B 1W0WB 1CU4L 2V9QA 5TE6L 1OL0A 2F19H 3RGVA 4WI9A 3CFBA 3RHWK 4AT6A 3TBYB 4X98B 3IXAA 5E99L 2RFXA 1J8HD 1S7VA 2V17L 4LLMB 1AI1L 4X0KB 4WO4D 1CDHA 4XWOC 4O58L 1HINL 1A22B 4M6AA 1MY5A 4C59B 2NY2B 3LSOB 4QGTA 3H7BA 2DLTA 2GAZA 2R4RH 2VLRD 1CD1A 1T22B 1H3VA 3S4SG 1S7QA 5CEYB 4OCSL 3TCXA 3I3EA 1AIFB 4QTIL 1AXIB 1RZJH 1I7ZA 1QSFE 3HG1E 2OJZH 3RPIB 1TIUA 3PWNA 3QZWB 1MHPH 1N26A 1CGVA 1FFNA 3NFSH 4NZRL 4DGIH 4ENED 5DQJA 1YEDA 4M48L 3O3UN 3LQZB 4LSPL 5I1CL 1INDL 3WFHA 5A2JH 3E6HA 1JFMA 4P3CH 4X6FB 1RJYA 2X4OA 5DYOA 4GMSL 1FZJB 2OP4L 4HPYL 4Y8AA 4JREC 5D1ZA 3UTQB 1LO5B 4M7JL 1MAML 2H41A 3G6JB 4Y5YC 2DLFH 1RAMA 1LQVA 1SYSB 4XC3H 1PKQE 1NC4D 3HZYB 1WBYB 1YEFL 3PL6D 5ESVB 3WDIA 1OTSC 4S10A 1U36A 4N9OB 1BQHA 2GHWB 2WSKA 3ARBB 4NKMB 4TVSa 3ZDZF 4Y5VC 4JFXA 3RDTD 4PJ7A 5IEHA 1FORH 3QDMB 4ZUSB 4K8RL 3LVEA 1KCGC 3MLSH 1XR8A 1DBAH 1MLCB 5EBMB 3IDYB 3VCLA 5E7BA 5CSGA 1OW0C 2XTJD 1DQLH 1J05A 1E27B 3X14A 1QD0A 5TPWL 4K3DL 3VFPA 1JPGB 2VDKH 3O6ML 3QCUH 4ZUUB 4K3HA 1MRCL 4JY6B 3QIBC 1CFTA 5ETUA 4XNZC 4LVHB 4KK6D 4OCXL 4KJYA 4LVNB 1RU9L 4G43B 3H9SD 2CDEB 1QFWI 3MRRA 3DXAE 1NBYB 1QA9A 3UJTH 1LD9A 1JPFB 3LQAH 1N8ZB 2R2BB 2E7BA 5ALCL 1RUAL 3ROLB 5I1KH 5DO2D 1LK3L 3LQMA 1CFVL 3M45A 3B5TA 2YMXL 1QSEB 1IKNA 1JGUH 2BNUA 3BPNC 3TF7A 4MD0A 1AD9B 1AO7B 4XNQB 1ERNA 4H5SB 4CUCA 5JW5A 2GSIA 4LSSL 5C0AA 4S1QH 4JFEA 5F1OB 3V6OA 3I9GL 3P0GB 4O02L 3FONB 4HJ0C 4YGVB 3H2WA 2Z35A 3N1FC 2XICA 1JTPA 1FCCA 4DOHE 3ILPA 4OFDA 2I9TA 4F2MB 1GHFL 3HC0B 5AYQA 1TJGL 2GJ6B 2JCCB 1L9NA 4HDIA 3TFKC 3BZEA 4U1NA 3FFDB 2BOBA 4XC1H 5L9DL 2G2RB 2R56H 2XT1B 1NGYB 1GIGH 3S96A 1PEWA 4P4KA 1DBMH 3S7GA 3CVIH 4HG4K 4OLUL 3FQNB 3HRZB 3LN9A 3V6FA 2WBJA 3MO1B 4FQLL 4DUVA 1MNUL 2VL4A 1B3JA 1EEZB 3BJ91 2HTKC 3MCG1 3MODL 3ZDXF 4U49A 4XBEL 5JQ6H 1SM3L 2NY4D 5J11C 5SWQB 3KLDA 1F8TH 2EYTB 4IIQB 4J3WA 3MCLL 1GGYA 3MXWH 3OBAA 2LU7A 1BQHG 3GBNH 3GBML 2XKNA 4CW1A 2ZUYA 1GGBH 4ZFOB 3NN8B 2W9EH 1M6OA 5DT1L 3BWAB 3NCFB 1TFHA 2DQEH 1MFEH 4GLRH 4O9HH 2IQ9H 2WY3A 2JJSC 4PTUA 4X8JB 5EO0B 5KSVA 1VFUA 3DO3A 2FJHB 2ITCA 1SEQL 1WF5A 2I07B 4PRNA 5D7JD 3HG1A 2FATL 3QH3B 1FLRL 4HW6A 1JYWA 4FFZH 2BMKA 3IU4L 4FQXB 3IDMA 1RK1B 3D85B 3NH7L 4YHIA 2PW1B 3TIEA 3MRPA 1U0QA 1HHIA 3BPLB 1Y18B 4LSQL 3BAEL 4G5ZH 4PJEE 3NIGE 3I75B 4JQVA 5DJ0B 1HH6A 3J7HA 2UYLB 1OHQA 4NJAL 4Z7WE 2YPLD 2GQHA 4JREB 4JRYE 3KPPA 3CXDH 1PKQA 2X4NB 3DMMB 3FZUD 3V6BR 1G7MA 1YN6A 5GRUH 1KIPB 4ODHL 4HIHB 2EECA 2CLZB 2X9YA 2AJZA 1PDKA 1ZANL 3EYSL 5DHVH 1XF5B 1UWXH 5GGVH 3WJLC 2A0LD 5HJ3A 5FO7A 4AEFA 3IDXH 4X6CA 1BM3L 1CD9B 4L9DA 4UOW1 3TIDB 1A5FL 2WBKA 4PRIB 3UTSE 2GKIA 5D71H 4EXPX 1YQVH 1MHEB 2GT9B 4U2YA 4EI5B 5E2JA 4D0DA 4EVNA 5FCUL 2HFEB 5IB3A 2XWBB 3QIBB 2VLKE 3ZE0E 5FGRA 4XNZB 1KB5B 2R2EB 4KKAC 1GRWA 2ZCLL 4MD5A 3OAYK 4W4OA 5D96C 5DLML 1LO4L 2I26N 4IRSA 3VXPB 3DXAA 4QYOB 1ZXQA 4KY1L 4PREA 4C83B 4ZAKC 4XNMB 4JDZA 3TEUA 5IHLB 2F53D 1UXSB 2MJWA 1W8OA 1UWEL 3BP7A 4JZNA