2YPKA

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ypkA01
6FABL 4X6BA 1I7ZA 5EN2A 5T5NF 1KELH 4G7VL 5E6IA 4F8TA 5CD3B 4NCC1 5E0QA 3RGHA 4LSTL 4HUMB 4EQ2A 4DKFL 3OKNA 3ULUC 1EO8L 1JF5A 2NTFA 4BK5A 5L6YH 3O6MH 4CJ0A 2QL1A 1MSPA 4JZJA 4X4YA 5IB1A 1UYWH 2IQ9H 3BUYA 3O3AB 4XXCA 4PJBA 3I3DA 3BI9X 4W70A 2FRGP 3EO9L 1OP5H 1HILA 3KPNA 1MPAH 3O4LA 3C2AL 3QXDA 4GKSB 2I27N 5C0IB 1XF2A 3G6AB 4HT1L 2FJFA 3SDXE 3PIQB 3CVIL 2VSCA 1PEWA 4O00A 4YHZL 4YHML 1T1ZB 3LV3B 4P3DB 1FGVL 3CCHB 4JRWA 3TBWA 3MCLL 2ZWLT 4WHCA 5IB2B 4WI7A 1LILA 5DT1L 5BV7B 2ITDB 3WN5C 4DN3H 1U3HB 3KLHC 2VWEC 3RQ3A 4Y89A 5K9JL 4XPTH 2XKSA 3RPIA 3BPNB 3OAYH 4XPAL 2R29L 3QDGA 3FO1B 4OCYL 5D8JH 5DD1H 3ZKSD 4D0DA 1V7NL 1RUKH 2BNUB 5E00B 3HI5H 3WCYA 1YMMA 1YPZB 4X5WA 3CX5J 1FL5B 3UTTD 5IMLB 5F96H 3D87B 1TNMA 1KLUB 4AT6B 4UV7H 5DQJA 5KN5B 1BF8A 2AAVA 1Y18B 4KK6D 5C0CB 3OPZH 4WWKC 3GSOA 4JFZL 3MBEC 4NQCD 1W0WB 3KJ4C 2LAAA 4FXKB 4UDUB 3OHXB 3SKJH 2UWEB 1MRDH 4LSRL 1M6OA 1HH6B 2DIAA 4PFEA 5D7IA 1I9EA 4Q9BA 3BJ91 3MV01 1IM3B 3PQYE 5IQ7H 4X6BB 4TTGA 1HKFA 5GIRA 2YUWA 1DBML 3O45A 4O51B 4MLIA 4F58L 1VFMA 4GKNA 4MQSB 4K94C 4DTGH 3MV9E 4XBPB 3INUL 3KR3L 4LSSL 4F9LA 1QSZA 1LO3H 4MAYC 2A9MH 2GFBB 5JORB 4L3EE 1A7OH 5DD5L 3OAZH 2AV7A 1NAMA 1RFDH 4WEBL 3CXHK 4R7DB 2HLFD 4YAQB 1P1ZB 2FX7L 1CG9A 1MFDH 1ZHKB 1ZANH 1YJDC 1EHAA 1JGVH 1KPUB 4H1LG 4Z7QF 4BFEA 2DQIL 4KTDH 4HC1A 3RWCA 2Q6WB 2CKBH 5D1XC 4QRPB 3HR5B 3L3GA 4UBDC 3QEQB 3KPQB 3QUXD 1KJ3H 4R6UA 4RGNE 1D6EB 3F12B 4EN3B 3BVNB 5E94B 5GGTL 3E0GA 4PJ9D 4YC2C 2IBZY 1MJ7H 3HA0A 4Q97A 4PGEA 4JKKA 4AT6A 2VYRE 2OXHA 3GK8L 3KS0J 4WI2A 1LEKA 5TF1H 1QSFD 3RIFK 4B7IA 4MS8D 1U42A 3RZCB 4HDIB 3QWRD 3RZWA 4F7MA 1X3DA 1MJ8H 3BWUC 5I1EL 2ARWA 3ZE1E 4JFEA 4JQIH 3QEHA 2A6JB 4OF7A 5DJ6A 2E27H 4IS6A 4QRSA 3SDAA 1MJ7L 1FZMA 5DJZB 4V3DB 1CXFA 5IR1B 3NCJH 2XTJC 2FR4A 4MJ5A 2F74A 4QHKI 3SDDD 4LOUD 1TDQA 4EKXA 4TRPH 3STLA 3G6JB 3MLRL 5ISZA 1HK6A 4JG0L 4Z7UF 1QFPA 5J3HC 1KV3A 3LKQB 3FT2B 3NFNA 3MRBB 4Y5XC 3KYKL 4BUHA 5E8NB 1XGPA 3Q5YA 3BMWA 4JFPA 4NQED 2BY3A 2C3XA 1F6AB 1RZJL 3D85A 2D7MA 2FHCA 3VFMB 5CINH 2OZ4L 3EFFB 3QP3A 4BQ8A 1VGKB 4YZFF 4WI3A 1K8DB 1M05A 4Y4FA 5FFLA 4KXZI 4WFGD 5MENB 1UB6B 1NEZB 4YGVA 2Y4SA 3O8XD 3CFIC 3IJSB 2J8UB 2NY7H 3I9GH 2V5YA 3VG9C 3WUWA 2IQAA 2CDGB 3MXVH 5LKNA 1CU4L 3TC9A 4U6TA 4LF3A 1T3FB 4ENED 4FQHB 3RWEA 1CZ8L 1HDMA 1S9YA 5ELIA 4RA0C 3TO2B 3P0YH 3UTZB 3M17A 4HJGA 1BPVA 3LQAL 2VDRL 4M7KH 2OBGA 3L3DB 4JHBA 5E1AA 1IAOA 1XGUB 5DRWB 1FVCA 1T22B 3SKJL 1VEPA 4F7PB 3GSNA 4MZ2A 1OT2A 4EI5D 4O5LL 1CDIA 3ZDZE 2DIJA 3SKMA 4OI8A 43CAA 1HHKA 2HVKA 4U3CA 3GHBH 4NKOB 1QP1A 5J9PB 2WUBL 4XCFL 3DJ9A 5D7LE 4IRSA 4HEPG 5FK9B 4M7KL 3CFEA 5CJXC 2R1YA 5E2TH 1KTLB 4GXVL 2W0KA 5F7EL 5IR1A 4YXHH 2KBGA 3JBG7 5EFIB 3TO4C 3TT1L 3QO1A 4TNWF 1RAMA 5I2IA 3BE1H 2YKLL 1HQ4B 4JZOA 4EOWL 3BT2L 3DGGB 4TPRL 3PF2A 4FFYH 4BSWB 5BV7L 2VXTH 1MHCA 3WLWD 4YNYB 1PW3A 4KMTH 2D7TL 2Z0BA 4F2MB 5JW4R 4Y1AB 1Q9LA 5D7JD 5AUMA 4P2RB 4P48A 2DQFB 2YA0A 5FYLL 5MEQA 1A6UH 5EU6E 3C2AH 1YEJL 1CWVA 1X4YA 3E3QE 1FG2B 3IETA 4OV5A 1MJUH 3O45B 1DBAL 5T3ZL 1KG0B 4M3JA 1P4LB 4XNQB 1UADC 4O2CB 3QDJD 3SDXA 5E5RB 3V0WL 1G0YR 2HJFA 2DQUL 3G5YB 4ZS7H 4KROC 3RBGA 5DJZA 1MIEH 1S8DA 3O4LE 2UZYB 4NZTH 5JO5A 4HIHA 4O2FA 2F54A 3NCJL 1MFAL 2Q7NA 6FABH 2OM5A 3C2SA 1NAKL 1TJHL 3SPVA 3RIFF 1GGCL 4I4WB 3VGBA 3O11A 4U7MA 3H42H 4XPGH 5I1EH 4FABH 2AKRA 3IKKA 3F8UB 3FFDB 1KPRB 1L9MA 1S9KC 4HWZA 5D1XA 1HHGA 2P5EA 3SGJA 3PHSA 4AY0A 3FRPA 5KTEL 2VUOA 5HGHB 2Y6SC 5SWSE 4M7ZB 4PRAA 3ZTNH 4K3DL 1MLCB 1OD9A 3S5LA 4XP5H 3GUTA 4QOKB 3FQXB 5HYFA 4Q2ZB 4WFFD 4RFEA 4NO5B 5GJSL 4FP8L 2XN9E 1J0HA 3HR5A 3L3GB 5F9AC 3VWKA 5JW4M 4M5ZL 1D5BA 2EC9U 4NHUB 3SKOB 2IJ0C 2VXVL 2X7LA 4ZYKB 2J88L 2NY4D 2SEBA 3P3YA 4L4TE 2CKBL 3T1FB 3EJZD 1XF2B 3TBTA 2BOBA 2DQTL 2V7HA 3NFPA 2NY5C 4FFWD 3KPNB 1AGBB 4P5KA 3S88H 5F7WC 2R0KL 2K7PA 4ONGL 2YD3A 2W9DH 3B5HA 2P5WD 3EGSA 3QDMA 4M3KB 4TULH 3DROA 4R4FH 4Y16A 1LD9A 1T22A 4K23H 5HI3D 2E7LA 4MNQB 3RUGA 5EU3A 4E41E 5ACZA 1HHJB 4JPVL 2EO9A 3ZLQC 5K9KA 1VERA 1JK8A 3S37L 3DRTB 1ED3A 3DURA 4LKCA 4FQIL 3NCEB 3RAJH 3AS0A 3CNKA 3GSUB 3EOBB 2O61B 5TPWH 1RIVL 2AQ3A 2YPLE 3KPSB 4RAUA 4S11A 5BXFB 3JTTB 4XHJD 3MO1A 3PHQB 4C83A 4HS6B 4NKIH 3JWOH 3MJ8B 2EIDA 4F9PA 5KS9F 4POZD 1ACYL 1UB5A 4PGDA 5F1KC 4WTXA 4U7KA 2DAVA 1FAIH 2IAMA 5A2FA 4M7LT 5INCA 5E2JA 4E0RB 4NZDA 3UTSA 3WIFB 4ELKA 1Y18A 3EFFA 3EDJA 3RHWF 4LNVA 1IT9H 2ADFL 5SWSA 3UZQA 1G9MH 5EO1B 1BZQK 5E70A 5B4MD 4Z5RB 4Z78B 1CT8B 3LCYA 4H25B 4OFDA 3QUYD 1PFCA 1ROWA 2YD9A 3RNQB 5D1XB 4DAGH 1CD8A 1K6QL 4N8CH 2HT2C 3ARGA 4F7TB 2XN9B 4X4ME 3CFDA 5MHSD 1X9QA 2X42A 3LQMA 5I18H 3S9DB 5DJYB 4KJQC 1T3FA 2BDNH 3ULVE 5CLWA 2V17L 5K9OA 2HT4C 4KKLD 4KGLA 1BJ1J 4ISVA 3P9LA 4JQVA 3MBED 4PJ7A 4TSAH 4APQB 1MLBB 4HWBL 2EYRB 4LLUA 1EAPB 3ULVD 2AQ2A 3DV6A 1SJXA 4MVBA 2NY5H 1KN4H 1N6UA 3I6LD 2OL3L 3MA9H 3SO3C 2FWOA 3VXUE 1A0QH 5DT1H 4KZEH 1ZLVH 3AY4A 2MHAA 2H9GB 3CFKA 4NIKB 4M62L 4KJPC 1DQDH 2AABH 3WS6C 3SDDB 1M7DB 2ZKHL 1IEBA 1OB1B 1U58A 5CMAB 4WI8A 3Q6FB 3EDDA 3VGDA 1GCFA 3E3QA 3DROB 2HYMA 4JM2F 1LO4L 5CSZA 1OTSD 5HI4C 3K3QA 4KTEH 2I9LA 3MRDA 3T2NL 1QO3A 3EO9H 3O6FD 4ODXB 5KS9B 4UTBH 2Z93B 3W2DH 3U2SA 3IXTB 1JNJA 2FX8L 4GJTB 1NFDF 4G8IB 1JWMA 1CGVA 4JE4B 3LRHA 5SX4H 2ZOKA 1GZQB 3FOLB 3L7EA 4YIQA 5LGHH 4GXUN 4NZRL 2O93L 1MCQA 3S5LB 1HSAA 4P4RA 1RK0B 1N4XL 4H5SB 1QSEB 3MOBL 3UX9B 4JO1L 3W0WD 1SY6L 2K9UA 4OZGB 5GRZA 4IHOB 1BD2B 3KYNA 2WM0A 3QI9C 3OR6A 4AEIL 4S0UC 3ARFC 4NGHH 2NX5E 3SGKC 1FYTE 1OARL 5F7DA 3DWTA 2I07B 5GGVL 5EOCJ 5JOPE 2WV3A 5CP7A 3GBMH 1MHHA 5GGSA 5I16B 3SDCD 4N8PA 2A77H 1OQOA 1SEBA 3IXAA 2ARJQ 3ZKMC 1RD6A 4NQDB 1BX2A 1QSVA 2P5WB 4DGIH 4PJ9A 3HZYB 5HYSB 4UDTA 3QNZA 3VRIA 2W9LA 4NRXA 1IKNA 3MNVB 4KDWA 3QULA 1WISA 4EI5B 1ADQH 1MCFA 4O2CA 1CVRA 1Q94A 3G08B 5D9SA 3S4SG 2NLJA 4R4ND 2IGFH 3T8XB 2CUMA 3C09C 4R3SB 4L4VB 1KNOA 3IJHA 2VLMD 3RVVD 2JK5A 2P46B 4DGYL 1P4IH 2WW8A 2ORBH 2X2YA 3BP6A 3VW3H 4IEFB 4GBXD 4XAWL 4JQVC 5D7SL 1CGTA 3NPSC 3P4OA 3GGWA 3VFUB 4OUUB 3O4OC 5IW3A 1KCUL 2CR3A 1LWRA 5KW9L 1RZ7H 2A6IA 3TLRA 4H1LA 5IBTL 3BGAA 1W0YT 1HHGB 1A7PH 2BVQB 2VZSA 3GMMB 3DTXB 4Y8AA 5E2VL 2OK0L 2F5AH 2XWBB 3FN9A 1S7VB 3LS5H 1A7RL 2FL5B 2DMCA 5D5MF 1T03H 3HMXH 4PP1C 4P5MB 3MRCA 1H0DB 2FYYB 3TFKA 1NFDB 3BHBA 1J0IA 5EOTB 2AEPL 3QA3A 5CILL 4O4YL 3WE6B 5ID0B 1KOAA 3KPOB 3OX8B 1IC7H 3GIZH 5CEZL 3PL6C 3AU1B 4P4RB 3BGMB 3TF7C 4M61B 2LV4A 5KZCD 4ZTOH 1HHHB 1OT1A 3H7BA 1FE8L 3EYVB 2YEZA 4YO0B 3RVVC 1VHPA 5KSUA 43CAB 3ARBB 4EDWH 4N0CA 4PJHF 1CQKA 3T0ED 1HYSC 3NN8A 1KCSH 3MUZ1 4KHXH 3CH1B 5HDQH 2Q86B 5DLMH 4PGCA 5C3TA 3QZWG 4HK0B 4YWGL 4IOSD 1WBYB 2OR8A 5GZNC 1U2CA 4HQQH 3U9PH 4NJ9H 4TTDC 4F7EA 2FEDC 4V2BA 1GPOH 2X1WL 1P6FA 5HHMB 2Z31B 5LWYL 3RAJL 2H2PC 2XQBH 4LCCA 1NAMH 3NH7H 4UOJA 2B0SH 3U6RB 3VI4F 1N5YH 4KKNA 32C2A 3UDWA 3TZVC 3L7EB 2H3NA 2ZSVA 2HT3D 1G7LB 5E08H 3SDCA 1T0MA 1KJVA 1LK2A 5JW5A 3QRFM 2NW2A 2R9HC 3H9HB 1PY4A 4RNRA 1BVLB 1A64A 1IAIM 2A1WH 1V8HA 3ARGB 5SWSB 4HIEB 4PRHD 3JXAA 4U3XA 3SO5A 4MXWL 1KB5A 3BZFB 2DQEH 2C3HA 1AY1L 1VA9A 2IPUG 4KVNH 1CLZH 1JHTB 4LLDB 4I18C 3OJDA 4DQOL 4I77H 1F6LL 1A3LH 4Z7NE 3V4UL 1L0QA 3RDTC 3CFKB 1AR1C 4DGIL 5J1TC 1A5FH 3P30L 3QWOB 2YD6A 1RUMH 3ARWA 2VN4A 4R2GC 5A43C 3SCMD 1AFVH 1YECL 4P4KB 4BFBD 4X80H 1A1OB 4LSPL 2IFFH 1Q0YH 4Y2DB 4H26A 3I6KB 4XVUC 5EU6B 3BKMH 1A6ZB 4XWGH 4GLRI 3O6LL 4HKBA 5BQ7A 3C8KA 5C09D 2LTQB 3FO0L 3CSYA 3QG6B 3ZHDA 1I3RB 4BZ2L 1MFBH 1S7WA 3Q6GH 4D3CH 1E27A 3DVNB 1WAAA 2FCBA 1G7IB 3GSNL 4RSVA 4J3UA 1RK0A 5EZOH 3F5WA 1RZIB 3LZFL 3IRZA 4MAUH 5SWZA 3VXSB 5H94B 1GZQA 3FOLA 4YIQB 3QDGE 2A73A 2EC9T 5IHZB 35C8H 4N5UA 4JO4H 2UZIL 3RTQD 3JTSB 1AI1L 2XT1B 3U9UA 3U7AA 5I6XB 5DZNA 2FLRT 5ID0A 4J3SA 5GGVH 3SE3A 3U82B 2WIMA 2BJMH 3TNNB 1CL7L 3O2DH 2XQYG 4U1LA 3MBEB 2XZAH 4F7MB 4AEIH 3BIKA 1DBBL 2H8PA 4N0CC 1P1ZA 5EU3B 3C5ZC 4POUB 3VD5A 3X14A 5KSAC 4NC1E 5BVPL 1KN4L 1JK8B 4GQPH 3LQZA 4HKJB 4NP4H 1DDHB 3KAAA 4PJDF 4XPBH 5IVNA 3CVHH 4RGOL 3OG4B 4R26H 1D5XB 2FLBT 4JG1H 1DEEA 2Q1EA 2MNUA 2YA1A 4NO3A 3GBNL 2RB8A 4MA7H 3GRWH 2HFGH 4FQQA 4OUUA 5D5MA 5E8EB 2AERT 1JRHL 1A6VH 4HMEA 4PV8B 2WLZA 4X9FA 4NOFA 4G6AC 4F57H 1S7XA 2DMKA 2IANA 3HZVB 3SJVD 4LMQE 2RHEA 4K7PY 4P2YA 5JMOC 5JUEH 4JKLA 3NZHH 1X5ZA 3HC3L 4JDVA 2P7TA 2VE6B 5IVZA 2HH0H 3O3BA 1RIHL 1J11A 2R2EB 2IAMD 4Y4HD 1IARB 1FORL 3WJLC 1OY3B 3MOAH 2FEEL 2XY1A 5IESL 4FXGA 2V17H 4U2ZA 4QHKJ 1Y0LA 4PY8J 3SPVB 3VXTA 5EG6C 3RWDA 1CFQB 5I18L 3VWKD 1CK0L 3AS3A 3PL6A 1G7QB 2FBJH 1K8IA 1ORQA 5MP6H 5EULV 4GG6E 2YPLA 5FUOH 5A16B 4BQ6A 4Z7VE 1F3RB 5FIEA 4Q58C 2RFXB 4QXTB 1IT9L 2ADFH 1R24B 1QR4A 4QGYA 3VRLE 5EO0B 2X4RA 3CSGA 1I7RB 5ALBH 5ABDE 3JV4B 2J12B 2JCCE 4GBXA 1L7TH 3MCKB 1EH9A 1FH5L 1KCLA 4G8IA 3FFCA 1GC1C 5DEFB 5HJ3B 3VXME 3PL6D 4UQ2B 4Z7VA 2DQTH 4HMDA 1CD0A 3MLZH 2QR0B 1I8MB 4ZXBC 3QH3A 3TVMC 3MLRH 4LPWA 4XBEH 1RMFL 4CW1B 2R0ZL 1HEZA 2GTWB 5IMOB 1C8PA 1I3UA 2N7BA 3OXSB 4MDIB 4KDTA 3MJ6A 4HW6A 4P9MH 5ECJE 1TJGL 1DZBA 3TO2A 3DYPA 1SJHA 3C5JA 1PSKH 1HYSD 1XGYH 1MQKL 4LHUG 3K2MC 4HJJH 2OI9C 3RWIB 4I3SH 1B9ZA 3GO1H 2VH5H 5GS0L 1CFNB 5F89A 4D9LL 5AD0A 5C0BD 4LIQL 4PLNC 5HYJB 2ZUUA 4EUPG 4NNXB 1OQXA 3DX9A 4PGZA 5HGDB 5FAAA 4MHHG 3ZE2E 4Z7UA 4LLYA 1X5YA 4OCRL 3CGTA 3DRQB 1TMCB 4JPWH 4U7SA 4PP8C 2N56A 1RIUH 4M5ZH 3BGFB 5L0QB 2VL4A 2X9YA 1AD9A 3VFGL 5GZOC 4ZDHB 4XP5L 5E99H 3UJJL 3UTSB 4IMKA 1F8TH 1IAIL 1KNOB 3FFCD 3HE6D 1DBAH 5T3ZH 5DRWA 5HHVL 5C71A 5EBWB 1HH9B 4UUJA 1SBBA 2C1OA 1EEZB 2FEEI 1UVQB 1A6UL 1LEIB 4B53A 5C07A 4MD4A 4L29B 4TUJA 4XP6L 3GSRA 1O7VA 3U30B 5FV2A 5EU6A 4HZLA 5JQHC 1WCQA 3BWAB 2XKUA 1Q9LB 5AUMB 1NAKH 4KH2A 3IDGB 3KXFE 5C0AB 1KEMH 4K3JH 3BQUA 4CDHA 1QNZL 2KH2B 1P7QD 2VDKL 5F7FA 1WLHA 1T80A 1DBKH 1XIWD 5EWIH 3EYUH 5DZLA 3BH8B 3CXDL 1NCNA 4I9WE 3WDIA 3QNYB 1FFNA 3FMGL 4WO4B 3VXOA 2QJDA 1P7KB 4JZJC 1MCBA 1FN4B 5FYKU 3V9FA 3VFPB 5DD6A 3ARGD 5L2KA 4KV5F 1J18A 1JUFB 4JY6B 4NCDA 1CN4A 3OGOE 2VABA 1KJ2B 1MJUL 1W8OA 1J0JA 1MREH 1DQJA 3NGBC 5LXGL 4LDEB 2ICES 2J8UF 4XPHL 1V7ML 2NY2B 3UPAA 5TQ0H 4OFKA 5IB4A 4XCNB 5FDWA 4W6WB 2EE9A 1KBGH 2X70A 4TPRH 3H7LA 2I9TA 4TSCH 3GDBA 1R6VA 3Q5OA 3T4AB 1I1FB 3H8NA 4M48H 3LQAH 1QKZH 2P1YA 3LN4B 4Y4KB 1HXMB 2X89A 1UACH 4Q0XL 5DJCB 4WJ5A 5F7EH 1XEDA 2IAMC 4HIXH 3WO4C 4AIZA 5HHMA 2LU7A 1FV1A 2OSLA 5DJAA 5ICZB 3G6DL 4DN3L 1ZEAL 4CMMA 2Z8VC 3RJQB 2NY7L 5IVXB 5JNYB 3UYRH 1KBGL 1UKQA 4YHMH 1MOEA 2AK4A 2XNAA 1MHPL 2I25N 2D2OA 4Q9RL 3KG5A 1JPSL 5IW6B 3L3KA 3V52H 3S3SA 3PWVA 4PJAA 4YBQD 1F2XK 2MPAL 5GRWA 3TCLB 3LOWA 4ZYKA 4MS8A 1MLCA 3TZVB 4I48B 3BO8A 3ULVF 4QKXB 3IVKB 2BSRB 3EJYD 4DOHB 2MSPA 2W9EL 5C0GA 5JHDB 5ILTH 5KVEL 2HKFL 1K8IB 2AEQH 3FMGH 1YC8A 3ULSA 3HE7C 3T3PF 2CK0L 4MXQD 4OD3L 3OSKA 4ZUUB 4JREC 2R39A 4R90H 2KZWA 2V7NB 2DD8L 4G6KH 2C3VA 4RFOH 1A6ZA 2X4OB 1FZOB 3GKZA 2ZOLA 3L3OA 3S36X 3LSOA 2R0LH 3HAEA 1UWXK 2C3WA 3MUGA 4M03A 3H3PL 1MY7A 3TIDB 4MXVF 5IM7B 2ITCA 2YRZA 3DVIA 4WW2F 1P7QA 3Q1SH 4E42B 4YDLC 3I84A 4ZTPL 2QQQA 3DMMB 5K9KB 3VFVB 4XHQA 1N6VA 3WNNA 1F97A 4LU5H 3UJJH 1QLFA 1EVUA 4PTUA 3DIFA 4JO2L 2DLFH 3EBAA 2C7UB 5T1MA 5HHQB 2MFNA 1EA9C 3FAWA 1N0XL 3QEGL 4S1RL 5C0IA 4WUUB 3BKYL 4ONHB 1KJ3L 5FA4A 2A9NH 1TNNA 4PRDB 3QQ4B 5D1ZB 1A14H 4LRNH 2XRAL 2IADA 3AS2A 3TH4T 4KPHH 3QIWD 4OCMC 3QDGB 4LCYA 3VXSE 2AXFB 5H35A 3DYMA 2IAMB 1QRNE 1T89A 3CH8A 1BJMA 1DR9A 1MHEB 2PR4H 1FLRH 1IGIL 4UBDD 4Y1AA 4G9FD 1CYGA 1P84K 3L6FB 1MFDL 1HQRB 1YNTA 5JR1H 1EPFA 1S9XA 1IE5A 2EXYC 4N5ED 4OLWH 4RWHA 4BH7B 5F88B 1NUGA 2F19L 5IHBA 2NY2D 2VWEE 5T3ZD 2AI0L 3ES6A 4R90L 5GGTH 2Y72A 4OZIA 4LAQL 2ZNWA 1K3IA 1YY9D 1JIBA 3KDMB 4ACPA 2BXZA 3CU1A 1U8IB 4X6EB 2PW1B 2XTJB 3IAGC 1D5MA 4LLQB 4YHKL 1BVLA 3GKWL 1JHLL 1U95B 5CSZB 4LSRH 2CH8A 4RDQF 3UBXB 4HFUH 5FYLD 1HINH 1DSFL 1WZ1H 4XCEA 3KPMB 4MNQE 4P5TA 3BQUB 1EMTL 5HI5D 4C59B 1FO0H 2R4RL 1FL3B 2D4FA 4XXDA 1LDPL 4JN1L 5D71H 3RU8L 3T0BA 4KC3B 4YHNB 4ESKA 2OL3B 5GGSY 5DD1L 1ES0B 1T2QL 2AP2A 2FB4L 4X99A 2LTQC 3ECBA 4HIXL 1Q8MA 2OTUB 5ESVA 4JANA 3KPPA 4BH8A 2GITB 1DL7L 5E8DH 1ZVSA 1F45A 1TCRB 3MMEA 5IHUL 3P0VL 4ORZC 4PJEA 2G75B 2PXYD 1FZJA 5DJ0B 5TQ2L 4HH9A 2DOCA 4JFZH 3T08A 5AYUH 3OPZL 2C1PB 3HUJB 3JV4A 1QRND 1KXTB 2WWMD 4MNGB 2EE2A 4ZODA 3U1SH 5E9DB 4FFWC 3FN0H 3MJ8A 2ZSWB 3GRWL 2VUYA 3CPLA 3RWFA 2VDQL 2QSQA 4XVTL 5CEZD 1T2XA 1X6LA 1UA6H 3ISWA 3QUYA 5K9JH 3UZEA 1E4KA 1UH2A 4PJ7E 3RKDC 1DBKL 4QHNA 4YUEH 1UJ3B 4F15C 5ANMB 3VH8A 1GAFL 1TITA 1KEML 3MCLH 4XRCA 4I0CC 2UWEF 5CZXC 2AS5M 3QEQD 4U0QB 4H0GA 5GGUB 4TUOA 2X4TA 4IM8A 2EXWD 2PO6A 3X12A 3SGJC 1BGXL 1JNHB 5K9OB 1MPAL 4A6YA 5JOEA 5F7HA 4F80A 2Y06H 5DSCA 4CVZB 2EEAA 4L8BA 1IAIH 3QQ3A 2IQ9L 2WQ8A 3DI2B 3Q3GA 1NGPH 1HHIB 5HGBA 4M1DH 1NQBA 1BQSA 1ZE3C 3O6ML 4RMVA 3H6JA 5DD3L 3LMJL 3O6FA 1VKXA 4ORGB 1S7TA 4OZIB 4HWZB 3UROR 3H0TA 3L3DA 5GS2H 1GRWA 2P8LB 3V8CA 1IAKB 1XCTA 1OAYH 1UC6A 3B9KC 3RTQA 4KKLC 3ULUH 1A2YA 1XF3A 3T1WA 5D2NC 5EBLB 3RWJB 3MLSL 4XMPL 5AAMA 4NBYB 1YECH 5ESAB 1QLEL 3RL1B 2VISB 3RDTB 4GRWH 3VI4E 4X6DB 4PLJD 5E8OB 5TF0A 2YBRA 1MQKH 1DFBH 2J8UA 4N0YH 4OLVH 4XC1H 2FIKA 1HSBA 4S10A 1C5CL 2F8VA 4HUNB 5FHBH 5F9JB 1MVUB 1H3XA 4M93B 5L8JB 2YWZA 5FA4B 2F58L 4WDIA 3RJDA 5KN5A 2PYED 5F1IA 1FIEA 5C0CE 1RUPL 5DMGD 1QOKA 4BKLB 4DEPC 3QPQD 3C60B 1I1CA 2EDTA 4AK1A 5E1AB 2IALB 3IFPB 2P5EE 3QXAB 1DCLA 5GGSB 4FTVD 3PWJB 4PGJA 4MDJB 1A4JA 4GW1B 4MS8C 3B9KA 3RTQC 2Q8AL 3MLXL 4PB9H 5DA0B 1NDGA 3TCXA 2N7AA 4YHOL 2ZPKL 4Z7WB 5KVGH 1CBVH 2CIIB 1HQ4A 1EDQA 2H41A 4JZOB 3HE7B 4QY8B 4E5XA 2F54E 2XXMB 4LASL 3SOBL 1D9KC 3D3VD 3QWOA 1CK0H 3KYMB 4ZPVA 3FN3A 1NKOA 5TJWK 5E9DD 4KI5F 1F4XL 2ENSA 2H2SC 4OIAA 3W5NA 2NZ9C 1CXLA 2X44D 2DM4A 4UIKH 3UPRA 5TE4H 4GRMA 5HDQL 1J8HA 1R3JB 2CDFB 1WT5C 1IKNC 3KJ6H 2DM7A 4G7YL 3VXRA 3I50L 1H3UA 2X89D 3IDJA 2XA8L 5DO2D 3BP7A 4XI5D 1X5AA 5J1SC 2VKWA 4K3EL 4EQ3A 4L8CB 4RIRB 4WU5A 5C6TL 3ALPA 5A3ID 4Z6AT 1JNNH 4QHMB 2VOTA 4OLYH 5KVDH 4YEFA 4PJBB 1RURL 2Q6WA 4OI9A 3A67H 3TNMA 3FO2B 2ESVA 1A6VL 1I9JL 3LY6A 1QFWI 1MCRA 3IDNB 1IAII 3CUPB 4U6YB 1P7HL 2ZCHL 3OKEB 1KPVA 4KKAD 3FQXA 3UYPA 4EUPB 4P59L 4Y16C 3HC4L 3BW9A 4JHWL 5B4MC 3QA3B 1FNHA 4HJGB 1RZKC 2L0DA 3M17B 1MCPL 1NGQH 2X4UB 1NSNH 1NPUA 3S96A 1N0LA 4CGTA 4AQ1B 3JWDL 5DHVB 3BESR 5ITFB 4N68A 1UCBH 4QEGA 3PDDA 3BXNB 2XPGB 4KV5E 3IFNL 4ODUA 2NR6D 5T3XE 4HEME 3VFMA 3ZKND 4FQ2H 5D7LD 3DNKA 4FN0A 4HUWB 3MZGB 1IC4L 1QHOA 3MRBA 4KRPB 5F9OL 1EUUA 1BFVH 2E6PA 4YHIA 3RRQA 4H8WL 1QRKA 1IEAB 3G5VB 1PKQE 3CC5B 3H3KA 1XH3A 2EH7H 1YEHL 3MA7A 1IM9D 1VGEL 5FGCB 3TFKD 3FT3A 2R8SH 1X44A 2Z91A 4FQQB 4HPOH 4J8RB 4YX2H 1Z5LB 2NY4C 4D3CL 4OLXL 2X4SB 4Z95H 4LCWE 4TUOB 4XP4L 3WFDH 4ZUWA 2KKQA 5MEND 2VLKA 2ZJSH 2WZPD 1A7BA 5DS8A 2IH1A 3GBML 3S34L 5LBSL 4HS8H 1BF2A 4BSVB 3B4NA 1K4CB 1XT5A 4P23C 4KRNA 4JFEB 4NZJA 5ISZD 4OZFA 3X3FH 2AV1A 2WY3A 4Q6IB 2DJ4A 4XP4H 3WFDL 3T09A 5LQBL 1HDMB 4WW1A 2K3TA 4EUPA 4JB9L 3W39B 3KWWB 4Y5VB 3VWJA 5HYEA 3T0EA 4HWNA 1FBIL 4ZQKA 4HCRH 1AIFB 1JWUB 5K33A 3V4UH 1A3LL 3I2CH 2HJFB 3HG1D 3ULUD 3MV9D 1KPVB 1VFBB 5I0DA 5L7XH 3QFDA 3W2DL 4OLUL 5I66A 1JVKA 3QPXH 2BRRH 5D1QD 3ZHKA 1EGJA 5TH2A 3T2NH 4TSBL 1EUTA 4ZNEA 1BBJA 4U1JA 1SVCP 1MCWW 3BAEL 4AMKH 4WUKH 4RX4D 4Z7OF 3L5IA 1R5WB 3FCTB 4ODUB 3VD4A 5GGVY 3DVNA 4JFEE 4O58H 1U41A 1KXQE 2VDNH 3FQRB 2E7LC 1WK0A 1QUNA 1UCBL 4HD9A 1U8QA 2O5ZL 5AD0B 4JKMA 2OL3H 1G6RL 2KZ1B 4IIQB 5C2BL 5IB3B 5CKAA 3S3PA 4G8FB 1QEWA 4NBZB 3DO7B 2HT2D 1NAML 1RJLA 4WO4C 1M71B 1MWAH 2QKIA 1BOYA 3HC4H 1HE7A 2BDNL 4KKBD 4NDMA 4UILL 4ZUVB 5EU4B 4JFDD 4HUVB 2BNRE 4YWGH 3SDYH 3RGVC 3U4BL 1RURH 3ARFB 1AGBA 3QXDB 3K2UL 5CP3A 3PWJA 3BEWA 4PJFA 4ZAKD 4EDWL 1HZHH 2IPTL 2NNAA 3VGEA 4KQ3H 3IFPA 3RFZC 4APQD 4UU9B 3VE0A 2GK0A 4K9EL 5HHQA 3R06B 5CMAA 1FAIL 2Z8WC 1FHGA 1U0QA 2JTDA 3K2UH 1YEGH 4LLYB 3W11D 4L3EA 5TE4L 3SDYL 1GC1H 3DVGB 3VFTA 4OGXH 2VITB 4GG6B 3UO1H 1DQLL 1S7RB 2H26A 4CKVX 3PHQA 5IW1B 1ZT7A 1JPFB 2ZUWA 3QAZC 4EI5C 3QR2A 4NM4L 5DK3A 5F6HI 1PYWB 2GCYA 3WKML 5FGBC 2DKSA 3PQYA 3MRJB 1Q72H 1NAMB 1OGAD 1T1YA 1K4DA 3R1GL 1H3PH 5J6GA 3UJTH 4CNIB 2O5ZH 3FQRA 3MNZB 3HRZB 2VL5B 1PQZB 1AGFA 2I24N 4NUGH 4FXGB 2X4SA 1E6OH 1CT8A 1I1YB 2CDEA 1YMMD 1BD2E 4XWOD 4HXAH 1XR9B 4L4VA 4MA8H 1FG9C 3MRRB 4MJIE 1XGUA 1LO2L 3NFPB 1YMME 1BD2D 4JFED 3KPQA 2FX9H 2R15A 3L3HB 4FP8H 1IGML 2PO6D 4MA1C 5I76A 4QXTA 4RGMC 3BDYH 4NSKB 4RAVB 3ZYIA 1C16B 5D9SB 4N0YL 4ZD3L 1BEYL 1KB9J 4HCRL 4TNVF 1T83C 5T1DH 2RFXA 4QHLA 3HG1B 5C86A 1FCCA 4JM2B 4LKCB 1I3GH 1OW0A 4YBLC 3ZDYE 5CS7A 4N0UB 5CJ5A 1JGDB 2DQGH 3BP4A 4G8EA 4XMPH 5AZEL 1UJTA 4JPKL 4NKDA 5T1KA 1TQBB 3CFJB 4GAFB 1DVFA 4HF5H 4HS8L 1TJHH 5LGJA 4G8GE 2J8HA 5GS0C 3ULUF 5FYKH 3F6IA 3GI8H 5E8PA 4P23D 5DI8A 3BZEB 1B0GB 4NFDA 3LPGA 1FL6B 5CSGA 4PD4K 4BZYA 1IGJA 1CDHA 3MYJB 4GRWF 5FCSH 3WEXB 3BO8B 1YEHH 4U3HA 3LIZL 5MI0B 2SEBB 1JZ7A 1OSPL 3ARYA 5HVGB 5CBAA 3BYTA 3LKRA 3SDAC 1I1AB 5EIVA 1VFAA 2JJTC 1RHHA 3GIVB 2DYPD 4LSUH 4U6XB 4WU7B 1NGWB 4N0RA 4OZHF 4X6DF 1XGRA 1SM3H 3SHSA 3I3EA 3KPRE 5AAWA 3OGCA 4HWEL 4X9BA 2XNAB 3KNBA 4PJIA 5D1XD 4M9PA 1I1YA 3ALWA 5IHLB 5F97E 3UTQB 4X5LA 1NCCL 4OLZL 1X5LA 4FOMA 3GHEL 4EXPX 4M93C 4NM8L 4UAOB 1QSFB 4X7TA 4CVUA 3IFNH 4G6MH 1GH7A 3VGFA 2Z35B 3OAYK 1JGUH 1MLBA 2BFVL 4UQ3A 3B9EA 3LB6D 4JFFB 1SBSH 4YXHL 5HGAB 1T5XA 1SJEB 2L4OA 2KDGA 2HJLA 5DFVC 4HIJB 1I8KB 3IJYB 4OCSL 2VR5A 3WIHA 4ZFZB 4A6YL 3DSFH 4KY1H 4LQFL 4YPJA 3SJVE 3OAUH 5IB5A 1RI8A 3HNSH 1PLGH 3EHBC 3A67L 1F6AA 3WSQH 1A22B 3QUZC 1I9RH 4P2OD 1MCWM 3MV7A 4MNHA 4PJIE 1JYXA 1YA5A 4NQUA 5C0FB 2PXYA 2P4AB 1PBYA 5CZXD 3I50H 1FFOA 1S7VA 4O9HH 4M43H 1F6FB 5E5UB 3AROA 4LLWA 5EZIL 4ODSH 3W0WB 5ICYB 4JFYB 1JCKA 3P9MA 4GUPB 5SWZD 3GJFK 1EO7A 3P40A 1T2QH 1CF8L 1FJ1A 1AP2B 3QWRA 3PDOA 3GJEB 4PJGA 4FQIH 4KUZH 4PRHB 1BREA 3IRPX 5D71L 4P99A 3T77B 1M4KA 5F7YC 1OAXL 4FQJH 2WNGA 2XY2A 2BNQE 3IU4H 3KNBB 4G42B 3QH3B 5HHXL 3QJFB 4NKOA 1X6NA 4L8DB 2J5LB 1FQ9C 1S7UB 1S9WB 3REWA 4IMLB 1J5OL 4HV8A 3OB0K 3E2HC 3NIGF 5C0AE 1I85C 5DFWH 1YNLH 5EU6D 4Q6YA 2EDJA 2LAGB 3VU2A 5FO8B 4UIMA 3D9AH 3LRSB 2HN7B 4APQC 1A9EB 3S98A 1NCWH 3IDXL 1ZS8B 1YYMH 1N8ZA 5I2IB 2ZUYA 3RVUC 4NRZB 1BD2A 2H3NB 3KYNB 3T0VA 4ELMA 3HN3A 5HI5C 1MJ8L 1FC1A 4WI6A 2DQHH 3G6JF 4P5MA 3VA2C 1UB6A 1PZUB 4NQSB 4R97C 2DYPB 4NFCA 4W6XB 3TP4A 1J12A 3WJJA 1CE1H 1RUQH 2AJXL 3ULUL 1GGCH 4GBXC 3T0DA 1KC5H 1ZXQA 4G80B 4WHTA 5JHDA 1ES0A 5IT2H 4OQTH 4TQEH 4LRNL 4GKNB 2M1KA 4LGRB 4GG6F 5DD3H 5FYKE 3HZVA 1UVQA 2GKIA 1YEEL 3EYVA 5HYJE 4Q9QH 2AJZB 5LGKA 3QEUA 4NKMA 1U9KA 3SKNA 1CFBA 4Y19B 5DQJB 4PGBA 2Y06L 3QDJB 4WFFE 1FRGL 5DD0H 3WXVH 2VZ3A 3BJLA 3CLEH 4PG2C 5KS9E 3WJLA 4K7FA 2FZ3A 3PWUB 3LKOB 4KUCD 1KPRA 4OKDA 5ITBL 5IB3A 1GGYA 5I1LB 5EBLA 2D7TH 3F7YA 4HHAB 4U6HA 4EI6A 5IF0A 2OYPA 5ESAA 3V0VA 3OMZA 2GI7A 4LFHD 1OGAB 1E4XI 2R2BB 1OF2A 4DTGL 4KKCC 1AH1A 5I74B 2J1KA 5HY9A 2XKNA 3NIFE 4U1NA 3QO1B 2HKFH 3R0MA 4V1DB 2VLJD 3D6GA 3IFLL 1KFAH 3C08H 2MQ0A 4GXVH 3EFDL 4UIMB 5IB4B 3U4AA 2NMSA 3WL9A 4D0CB 5D6DA 1BAFL 2ATPB 3FONB 3G6AA 4YDKH 4XVTH 1WEJL 3NIDF 1N8ZB 4QRUA 4QOKD 2R1YB 1WBZB 1KJ2H 3FQWA 4WGVB 5L2KD 4WW2B 3MNVA 5FA3A 4M6ML 2IPKB 2APWA 1CGSL 5D72L 4MB5A 2PO6B 2FHBA 4M1CD 1CGSH 4KJWD 5DYOB 4Z8FL 5CIPB 5CWSB 3EYQC 4X0KB 1UZ8A 4AENB 5IUSA 1JJUA 5DC0A 2Y23A 3P0VH 3MCKA 1V7NH 3QG6A 4OQ1A 5IHUH 1Q0XL 4KDTC 4ELMF 3QQ9C 3G6DH 1H15A 1FAKT 2HP4A 4GOSA 3MNWA 4LSQH 3IU3A 4MNQD 4Y2DA 4QO1A 4N9OB 3NACH 1UCTA 4KRPC 5DMKB 5KSBE 4OFVA 1H3WM 1X4XA 1RSFA 2FWOB 1QTYT 1Q0XH 4WTZA 2HAZA 3TGXA 3IAQA 4JQXC 3HS0B 4JN1H 2R0WL 3RL1A 3RU8H 3QIBD 3T65A 3CFDB 3DXAA 2Z4QA 5DDHB 1JMZA 3KPSD 5FYKD 4QOKE 5JZ7C 3RY4A 5A2IH 4PJBF 5D72H 3QUXA 3OJMB 2VAJA 4MJ6A 1JGLH 3F5WB 4PJDE 4Z78A 3UAJD 2VXUH 4LVHC 5B3NA 3WXVL 3QXAA 3GJFH 3HFML 5GS0D 4CADB 5IVXF 5K59F 2ATKB 2E3VA 2FIRT 2EYTA 4POZC 5J89A 3VXSD 4XB7A 2EEDA 4RMRA 1WFTA 4KJWC 2UY6A 2WBWB 1OF2B 1FNEB 2G75A 1HHIA 5A3IC 3EYUL 1BQHB 4LAQH 4M6AA 3A0OA 2XZQL 4OCXH 4GG8B 3TA3A 2XZCL 5DURD 2F74B 3NAAH 1UXWB 3D39A 4V1DE 4YEEA 1KC5L 2E7HA 5IKCA 1X7QB 1LQSR 1KIQA 3UCRA 3N1GC 2E6QA 1J1XH 3P77B 2VLJE 5EZLB 4XP6H 1SYSB 1M05B 3K8MA 5HD8D 4MZ3A 1IKFH 4L29A 4TUJB 1AR2A 4Y19D 1FRGH 4DGVH 3DRTA 4S2SB 4QXUH 1ZT1B 5DVNA 4HGWA 1U8KA 3HRPA 3M1BA 2PR4L 2X5PA 4X8JB 5GS2D 5BRZA 3JSSA 1B6UA 2QV2A 1HYRC 1TZGH 3DETC 1U8NB 2GTWA 2DLEA 1NCWL 1XF4B 3V6ZB 5B3JE 1RHHB 3GIVA 2AXGB 2ICEA 3MRGA 4S1RH 3OR7B 2DWEA 2CUHA 1YPZA 4JR9H 4OCRH 5F9JA 4TQEL 1LHZA 2BOBB 1YYLL 5IMMB 5F1SA 1T20B 1CICA 1BFOA 4U1HA 3V8OA 2ICWI 5JW4Q 5BJTA 2VLJB 5CGMA 4QWWD 2XWJB 7CGTA 1NCDL 5CEZE 4KK8C 3X12B 4D9LH 3QJHA 3D3VA 2Z35A 3ZZ1A 1NBYB 3U0PA 1BOGB 3D0VA 1J1XL 4UQ3B 2AV1B 1FLTX 5DD5H 3CFEB 1OOAA 1D7FA 1MFEL 1UM5H 3BN9D 3RWDB 3F7RA 2JB6B 2MTPA 4XVJH 2VO5A 4H26B 5ADPH 3FO9A 2VC2L 5F1NB 5GRYA 3QDJA 5FKAA 3MLZL 5F9WC 4U05A 2DLGA 2YA2A 3U36B 1WVZA 2JJVA 1NANH 2DTSA 1I7RA 2QSTA 1U93B 3H7BB 3N1FC 1MRDL 3O0RH 2DQDL 1AGDA 5C09E 4PJ7F 1IEAA 3IDJB 5F7LB 5CSBA 5EOTA 3ME0A 2YOCA 1BHGA 4WGWB 1JFMA 1C1EL 4RMWA 3CU7A 1UM6H 3ARPA 3DMMA 5M95B 3GUTB 5C0CA 4YQXL 5FCUL 4OGAD 4NKQB 5HHOD 2V7NA 4Z7UB 3NFSL 3WFEH 4P2RA 3EO1A 4L5FH 1K85A 3LPFA 1UACL 1AC0A 4XPTL 1BLNA 3PGDA 2CQVA 5IESH 1U3HA 3PABA 3GMLB 5BOZG 1JGDA 2BFVH 2JF1A 4NJAL 5SWQB 4YE4H 2X4UA 5DK0A 1F5WA 5DMIH 2YK1L 2XWJA 1FNAA 2ZNXA 3TZVD 5CFHA 4NN6C 4YZFE 1CICB 5I0ZA 1PJ9A 5TH2B 4NM8H 1EEZA 1BBDH 3B9KB 3SJVA 5DJ2B 1Q9WA 5DURB 4R7NA 5DJXB 2QLVB 3MBXL 2CLZB 1MREL 3VCLB 4ALAH 1KEGH 2ENYA 1SEQL 4J1UA 1WC7A 3O3DB 5DQ9A 4U49A 3VFRB 4JN2A 2PYEE 1MJJA 1U3ZA 1DQQB 1NLDL 1F3DJ 2APBA 3FT4B 2RIKA 2R4SL 1OP3H 3B5TA 2FGWL 3IXAB 1CGWA 2PW2A 4I5BB 4S1QH 1Y6NR 4N90D 1OTTD 4UT6H 3KYAA 3QEQE 4RGNB 3PG2A 4HPYH 1CFNA 5DRNB 5HHMD 4JFFE 1NCCH 4OLZH 3QFJE 4AH2B 1CL7H 3O2DL 3RWHA 4X9GA 5GGRB 3OKEA 2I26N 2XV6B 4WNQA 4F7TA 3FRUB 1A1MB 5JPMB 3AS1A 4XTRD 4N8VG 2Y25A 3T3MF 3BPCB 3W82A 4PJFF 4ORGA 4JO4L 1JE6A 5CGTA 5EUOA 4LP4A 4OJFH 1KENH 4MJ4A 1NCUA 4LLQA 3H0TB 4JGMA 1OSPH 3QXWA 1INQB 5E99L 3TFKC 3VGAC 4F9LC 5L2KB 4UAOC 4Q9QL 5H94A 1CLYH 5GGQH 1NFIB 3MREB 3QFDB 3KDMA 3IB4A 4F7PA 2X1XR 3FTGA 2XPGA 3ARFA 3C5SA 3FO0H 1IEBB 2BC4B 3I6GB 1R0AL 4R0LC 4M6OL 2YPKA 4GT7A 1CTNA 2P8PB 3ZL4H 3EHBD 4PD4J 5T3XL 3RX7A 2VLRA 5EORH 1ND0B 5C9JB 2Q3ZA 4X7EC 4G8GB 1Z3GL 4I3SL 2MMXA 2XTJD 3QIUA 3WIIL 4CMMB 3TV3H 1BZ9B 4YK4B 1XGYL 2OS7A 1CGYA 4GRWE 3HCVA 3MRKA 1TTFA 2J2ZA 3ARRA 2J3SA 4M1GH 4ZFFA 3O2WH 1T4KA 3I02A 4H25A 4I5BA 5T5FH 1QG3A 5JIPA 1XMWA 3AXLA 1T04B 1FVEB 1B90A 3WNOA 4F3FB 3QNXA 1D5ZA 5JIKA 3RX8A 2NX5B 3STLB 1FH5H 4B41A 3SGDH 1B0RB 1CCZA 4JRXB 2DBLH 5D96C 1E6OL 4XVSH 3FRUA 5FA3B 1U6AL 5HDOA 5D2NA 2NYYC 4Z7VF 3BPCA 3SDAB 1HZHL 2IPTH 4FQJL 4DOHE 4NNPH 2DICA 4RX4A 2O61A 4MJ5B 4OT1L 2AJUH 3SE9L 2B0SL 4RFNB 3ET9F 2V2WA 3GSVB 5FUOL 3I85A 4XC3H 5FXCH 3OKMA 1F4HA 1YPZF 5KZCB 1C5BH 1UZ6F 3VFTB 4XAKD 5EOQL 1J05A 3GSXB 1QYGL 1VEOA 3L5XL 3KLAA 1HOCA 4D0BB 2BNQB 2PYFB 3EJYC 1FIGL 4E41B 4P9HL 4JRYE 4J3XA 3VWKC 5B38B 1HXYA 1FDLL 3NCBB 1WIUA 2MWCA 43C9B 3DECA 4UOW0 4PJFE 5E95B 1XR8A 1BM3L 1Z0NA 2GYSA 2JKXA 2CK2A 3D2UA 3VI3F 4PJDB 1U8PA 1OP9A 5TDOB 4FQCL 2OMNA 3VG0L 4GRLA 5C0ND 4M8QB 4AG4L 3HNSL 5E8PB 3BZEA 5I8OH 3BZFA 1JTPA 4RISH 4UILH 4OZ4B 3V7AG 5CD5C 2QKIB 1JYWA 1YEIH 3KLDA 1LP9E 4OLUH 5T5FL 3IETB 4Y4KC 1E4KC 3E2HA 3HMXL 1FO0B 5J6HB 5JORA 3A6CH 2AGJL 3RWJA 2DQJL 4XI5C 1OPGH 2EDDA 4U6VL 3GSWA 3LRGA 4M7LH 3GMLA 1B4JL 1F90L 1G7PA 5CBEA 2QBWA 3BSZH 2CXKA 4M7ZC 3T4AA 3ES6B 2YD7A 1G7JA 3THMH 1RZ7L 3FJTA 2XQYK 4LDOB 3F7YB 2F54B 3MODH 4IRZH 5DR5H 5GSRA 1NCBH 3B8YA 4QXGL 3OKYA 1J88A 1LO5B 4PJ8A 5IFJB 4H20H 5J4MA 1A4JB 4U1KA 1TPXB 1I9IH 2OP4L 5D2NB 1S7RA 3SDXB 3O3UN 1SJHB 3C5JB 1SM3L 2X1OA 1ZAGA 4LK4A 2CGRL 3V5DA 4CRPA 3TH2T 1IGFH 3WFBH 5DRZA 4HAGA 4JY5H 3ZKMD 1HEZB 1CLYL 2IALA 3IS0X 1GVIA 2VR4A 4YDJB 5C0RL 2HFEA 1F4WH 1P2CB 5FOBB 1RJYB 4MX7B 2HRPH 2CGRH 4D0BA 3SCMA 4QTHB 5I1GL 2VZ1A 4W6YB 2W59A 2AJVH 3P11H 2HWZH 5FM8A 5HHOB 4BSJA 5D6CB 3X3FL 5BZDA 4E5XB 4DFHA 3O6LH 3TJHD 5IEHB 4PIRF 4XWGL 1NDMB 4GO6B 4LCWA 3GSQA 4U1LB 3OF6A 4WY7H 4UTAL 5AZEH 2GT9B 3C6LC 4HPYL 1DN0B 4PBWD 3NVQA 1UXSB 4Z95L 4OZFG 3QXTA 3P9MB 4GUPA 4PRPE 1F3JB 4OM0H 2GUOB 4FFZH 3UPCA 4KKBC 1FZOA 2ZSWA 4U1MA 2HFTA 2KPNA 3FFDA 3OJDB 3P9LB 3IFOB 1XIWC 4ZD3H 2NPLX 5FYJE 5BS0E 4I77L 3GSWB 4UTBL 4EDXA 1IGMH 3K1KC 2Z31C 3MV7D 4ZG1A 4QRTA 5DJ0A 3PJSB 4H8WH 4M02A 4EVNB 5KS9A 1DUYB 4XP9H 4KVCL 5E56A 4N0FB 3PWNA 2H1PH 3K1DA 5J12B 12E8H 2M2DA 1XCQA 3QIWA 3STBA 1JPTL 4R0LA 1XGQA 1S7UA 1S9WA 4D9RD 5GS1A 5I1AA 3TT3L 1UG9A 2VDML 2YZ8A 3BN9C 6CGTA 7FABH 3B9DA 1MF2L 2RR3A 4PJCB 3EO0A 5C6TH 3QJFA 4OTXH 4NWUL 2YD5A 3DGCR 2AEWA 2VZVA 1H3TA 4C4KT 1FNSL 5I17B 5I1IH 3FQNB 1CFTA 1XR8B 3UJTL 3MA9L 4ZUVA 1H3PL 4UZGA 2NY5L 3AAZB 3KPRD 2GW5A 3R1GH 4NJAH 5L2KE 4OF5A 3WS3A 5FB8A 1BZ9A 1E6JH 1NGQL 4RGND 5E7BA 2X4PA 4HWBH 1YY8B 2W0FB 5DJCA 5EC2A 2VSDA 4PJEF 4GG8A 4YC2B 2NXYB 2P45B 5I8EB 4MQXD 4WHDA 3VH8B 5ACZB 1CFQA 3NIGE 4XNUH 1MWAB 4XRCB 3PV6B 3UJIH 2GJZB 2PETA 2EZ0C 5MEOA 1T66D 2I9TB 4MSWA 2HLAA 4L1DA 1A1NB 4CU7A 5E6ID 4OT1H 4WW2C 1T6WA 4QCIB 1G9ML 3KVQA 4WV1B 4X6CF 4ERSH 3WFHA 1CXIA 3QQNA 3F58L 3L3IB 1T7XA 3MA7B 4WFEE 3PWLA 4OQTA 2ILLA 4YR6A 2B1HH 3NZ8B 4P46B 3IFOA 5HD8C 1GSMA 2F54D 2RCSL 5EZJB 4YK4C 2DWEB 1IZKA 2E7CA 2ED8A 4ODBD 3RNKA 1IFHL 3Q0HA 3SBWA 4O4YH 3QT2A 4Y5XB 4JM4L 1GGIL 3BISA 1NGXB 5ENWA 4JEGB 5D7LB 1NC2D 1MI5B 2CLRA 5TPWL 3L95A 3D69A 2XOTA 1MWAL 1UM5L 1VADB 4M1GL 5F93C 2EDOA 1T1XB 5A2KH 2BNQA 1A7RH 2WMPA 3PP4L 5CUSL 5FUCE 3MUJA 1S9VB 4Y4KD 1X4ZA 3MRQA 3LB6C 3RDTD 1BZ7A 1DE4B 1ZHNB 2M8XA 5IBTH 5DHYB 4W68A 1IGCL 3FB7A 4HULB 3ULSB 3ALXA 3ECBB 2VLKB 3MBEA 1NKRA 1UGNA 3JWDC 4P3CL 3MRNA 5FKPA 4DEPB 4K55A 3S88L 1R3KA 4O58L 1AO7B 4HUXB 3T2OA 4Z7WE 3TNMB 4JKPH 3HNTH 4P57B 4KI5E 5FOJA 1S78D 1YYLH 2ORBL 2C1OB 4JRYB 4MHHI 1KCVL 4PLKC 1JZ5A 5DWUH 3G5YA 1S5HB 4UNUA 2ATPA 2BRRL 3GJFA 4TOYH 3OWEA 2OZ4A 5IEKA 3WV0A 5FHBL 2VKXA 3CSBA 3KPOA 1C5CH 3BFOA 1FZKA 2ITCB 3OZ9L 3C60D 1ADQL 3MRDB 1GZPB 2VABB 3AU1A 2P5WA 3CDFA 4AIXA 5C6PB 3QFJA 3DV4B 3BKJL 4U1SB 1N2RB 2VR9A 2OMBA 1H3VA 3VXMA 4QCIA 1DVFB 2GSGB 4C56A 4OZHE 2JCCA 1EHLL 1F58H 2DTMH 3K4ZA 1W2KT 3MLSH 3Q48A 5J1AB 1ODAA 2VXQH 4IOIB 4P49A 4U33A 1OARH 4NN7B 4K7FB 2OTWA 3CVHA 5CJQH 2Y5TB 4NBXB 4RAUB 3SDCC 5BXFA 2PYEA 1OP5K 1BQUA 4I18B 2G5BA 2XZCH 1ZGLM 3V5KB 2H32A 5DJDB 2NY2C 4OFPA 5FV1L 5DFVD 3DVGA 2UYLB 4NZTL 2XZQH 2JIXB 4K8RC 4NPYB 4NRZA 3IJHB 4TNWK 1HHJA 3IKCB 1IM3A 4MD0B 4JFQB 1ZS8A 2BSSA 5TDPA 1JWSA 4HJ0C 3AB0C 1NLDH 2GK0B 1UA6L 3D1MC 5IWLA 1KJ2A 1WV7T 5I71C 1AC6A 4LHQB 1QFWM 2EECA 4DWHA 1YEKL 2YS4A 3U1SL 4GKOA 2EIBA 3WIHH 1JGLL 4A2MA 3JTCA 5EC1A 4CN6A 4MSWB 1DE4A 3WFZA 3ABZA 3MC0A 2OSLB 5DJAB 2P42B 3TO4D 4WO4D 2IH3A 4ODHL 1MCKA 4LVHB 4P2RE 1U8OB 4UT7H 1A1OA 2CIIA 1WZLA 2FATH 4YUEL 3PQYB 4OM1H 3O8XA 4ZAKB 4LARL 1RVFH 1L7IH 5FYLE 3OAZK 3OV6A 4MA1B 3BKCL 2GJ6A 5CHNA 4OFYD 4P46D 3GMPA 3PIQA 4PB0L 3OKLA 5EBWA 2C3VB 2BHZA 3FOMA 2F9BT 1T1ZA 4HIIB 1KIPA 4Z7WF 1WJ3A 3OR7A 3FAXA 4JM2A 3CMGA 5IMOA 2R4RH 5EO1A 4Z5RA 1V3LA 3I75B 4Z8FH 4KJQD 1UM6L 3D48R 5AWNH 4ZFGH 5DEGA 5AYUL 2XG4A 4M6MH 1WWCA 1MVUA 4OV6F 1OCWL 1LO0H 3CSPA 2WK2A 1GGUA 1XZ0A 1XF4A 1YN7A 2YHGA 3O0RL 4OSUL 3V6ZA 3U48A 3BD4A 4YFEA 2JIXA 1M6OB 1PAMA 4XNYH 3X13B 4CVXA 2QQLH 5DUML 1OB1A 1U58B 2QADC 5E8DL 1SVZA 4ZQKB 2APTA 1AO7D 1E28B 3DV6B 2G60H 1YY8A 2EDYA 1F4XH 5JA9A 1BWWA 3HLAB 4DKEH 5ADPL 1CU4H 1JZ4A 1Q9OB 4WENB 2R2HA 5BW7A 1UWXH 4D9QE 3PGDB 1Q9KB 5FF6A 5MERA 1I1RA 4KK8D 2ZPKH 4AEHL 2PN5A 1K2DB 4KMLB 1ZSDA 2EDLA 4LEXL 2G2RB 3DX7A 5EH1A 1EVTC 4PJAF 2HTLD 1NC2A 5IK3A 3X11B 2W9DL 1BECA 2BK8A 3GKWH 3H9SA 3STZB 1RK1B 4KK9C 3VMPA 4Y4HA 1ZOXA 1NMAH 3KYKH 1ZA6A 3O6KL 4BFGA 4IRSB 2YUZA 1QFUL 1PZ5B 2K7QA 1A14L 5I9QC 1WSST 3R4DA 4QRPA 1KN2L 4WWID 5BOPA 1E27B 4G5ZL 1ZHKA 4A2LA 1VSCA 4P0DA 5GZOD 2O5YL 2JIXD 5IMKA 1EHXA 3K0WA 3AMKA 4K3DH 2A6KB 1QPXA 4WIQA 3OTTA 4LU5L 3D39E 5DFTA 5GRVK 4D9QD 5BQ7B 3KJ4B 8FABB 3Q1SL 1F2QA 5I16A 4GMSL 1ZHNA 3JVGC 5BZDB 5DGQA 4HDIA 4YNYA 1MRCL 3NPSB 2AV7B 1JP5A 5IROC 5FM5O 2P8MA 3UTTE 1T5WA 3MLWH 1OAYL 2VTFA 4HBCL 4O51A 5D1ZD 4NQDE 3QDGD 3OG6B 4FFVD 1B2WH 3IDXH 1MCEA 5E4IA 3TESA 5EPMA 1D9KA 5I76B 5C0DB 2DQUH 3J7HA 4ZS7L 1IJ9A 1I75A 5FHAL 3L3JA 4MCZA 3SGKA 2EIEA 5ILTL 2NY6B 1NEUA 4HUUB 4KTDL 1CIDA 5SV3A 1UWGH 2CRIA 5DMJB 4QRTB 4EVNA 3ARVA 2B7DT 3X11A 4QTIL 4DK6A 2N1KA 3VXUB 2YC1B 1BGXH 3W9DB 3HUJF 3EAKA 3CDGB 1I7UB 1OLLA 2DWDB 4QF1B 1NC2B 5IK3B 3L5JA 3MV8D 5C92A 1LDSA 5LGJB 3HMWL 3IYLW 4KMTL 3L5WB 4DZBA 1T7YA 4D0DB 2R0WH 5JXEA 1EJ6A 1AD0B 2OL3A 2J5LC 4Q7DA 1BJ8A 2OJEB 3INUH 4LSSH 3AVEA 4WNQB 2LU3A 5AZ2H 5GHWH 1JPFA 4OD3H 2ITDA 5HI3C 2UV3A 1E4XL 2W0FA 4LF3B 5D2LE 2CIKB 1IILE 5JIIA 4LLVB 5EO9A 4HK0A 3FB6A 3U0TA 5I1HL 2D31B 4IRJD 2QSVA 1HH6A 3QG7H 1CGUA 4DUVA 1OWRM 1EV2E 4Y19E 3LV3A 2MPAH 4MVBC 4IBLT 4TSCL 3MRRA 4TUKH 2VLKE 2F5BH 1TIUA 3S97C 3I6LE 5D7KE 5FYJL 2YUXA 4XCCH 5EOCL 2AXHA 2BXYA 1LP9B 2VAAB 4HS3B 4RA3A 1HCVA 1LE9B 1R3IL 3O41A 1LNUA 1MCHA 2IC2A 4MA3B 1J8HB 2CDFA 1M7DA 5JTWA 1RU9H 1M1SA 2VMFA 5EUOB 4WHTB 2NW2B 3H9HA 4A6YH 4S1SH 1WZMA 5E00A 2H6PB 4FTVB 1TZHA 3FQTB 5CEXB 5A16A 1BJ1H 1DL7H 1SBSL 3IJYA 2FSEB 3MFFA 5I15H 32C2B 2QSCH 4M48L 3KPLA 1L7IL 3CXDH 3KPSA 1WTGT 4OM1L 2FB4H 1CZ8H 1K5NA 5IFHL 3MLVH 1A9BB 5KSAD 1BFTA 1QNZH 4RGMB 4K3JL 2A6IB 3OXSA 1LK3H 4G8FA 1T0NA 4PUBH 3VXTB 2DS4A 2EH8H 3CVIH 4YHZH 4RQQB 3JV0A 4LNRB 4BYHA 4HK3N 3OKKB 3RVTC 2NX5A 1VKXB 3UTQA 1A8JH 3UXFA 5H35B 3IVKA 2JE8A 4QTIH 1ZGLP 3MRIB 1MUJA 5HHVH 3IS1X 1HILB 3P4LA 1T21A 4LPCA 1FFNB 4WO4A 3VXOB 3MRLB 5I8CA 5KSAA 3SBWC 1I1AA 5B3JF 1F11A 5KSBB 3ZYOA 3BDXA 3WFCH 1TETL 2BNRD 2BRQA 2UUDK 2H2PD 4XH2B 1Q1JL 4PRIA 3LSOB 3QO0B 4Y1AD 3IDIB 1HKLL 1G6RA 3HI6L 3K7UA 1JPGA 5L8KB 1G7HA 4PRHE 4QHUA 2NY3D 4HBCH 3T0AA 3OKDB 1CFTB 4NHUE 1NFKA 3ARDA 3EDFA 5GS3A 1ETZB 1J8HE 2YSSB 4LBEB 5JIHA 3CMOL 1GHFH 5GSVA 5IG7B 3U4EA 2JLLA 1A6AB 3T4YA 3VXUA 1FFOB 4M7JL 4HJJL 5TF1L 5B22A 1URLA 1BEYH 1MJJB 4QF1A 1B3JA 5IBUG 2B4CC 3QFJD 1A6TB 5GGRY 3MFFB 1R5VB 4XBGB 4NQXB 1W0VB 3OZ9H 3BDYL 5C8JB 4ODTL 1JNLL 3GMQB 3FQTA 5CEXA 4W4OC 4TOYL 5IB5B 4NN5B 3TCLA 4X4MA 3F7QA 3P9WB 1OM3L 3PWPB 1LO2H 4JAMB 1YDPB 5CP3H 1XAUA 1BVKA 1FVEA 4LSDA 1PG7H 4QRSB 4PJGE 1L7TL 4NQCA 1TVHA 4CMHB 4EZMA 1JNHA 5D93C 4NC0B 1U92B 1AXSB 1TVBA 1TENA 1ZVSB 3MJ9H 2CMRL 2X4QB 2YMXH 4YXLL 3RA7L 5CZVL 5DMKA 5GGTA 1KIUA 2VDLL 4ZPTA 2EKSA 5IBLC 5K93A 5L0QC 1RFDL 4WEBH 5JPNA 3HPJA 3RUGB 5F7UA 3P4MA 2DD8H 4RFOL 3RIAF 1MI5A 2CLRB 2A9ML 4NM4H 1LO3L 2KQNA 4KUZL 4UI2A 4PJXA 1FFQA 2FBJL 3GFUA 1T1XA 4P5KB 2HVJB 4NHCH 2R0ZH 2QQKL 3EYSL 1GOGA 3DX8B 3WO4B 3DPBA 1GC1L 1U8HA 1UFUA 4BM7A 2VIRB 3EOTL 2NTSP 4XCNA 4BUGA 4L9DA 3ILQD 1PKQB 1RIHH 3RL2A 3MLTB 2EYTB 2PTTA 1IL1A 1IGJB 3FCTA 2HTLC 4HUWA 4OIBA 5GS1B 5I1AB 3OXRB 2ZG2A 4YHIB 5BS0D 4FQXC 5IROA 3DUHA 5H37G 1ORSB 3OQ3B 2GAZA 4GH7B 4KUCF 1EBAA 1R5VA 1OSZB 3OKKA 1A6AA 4IRSC 3T4YB 1T04A 3HCVB 4GSDH 1CVSC 5BRZB 3QIBB 4KY1L 2GITA 1Y0LB 4LQFH 3DSFL 4XCYA 1MHCB 1MEXL 3GMMA 3TBVB 1EHNA 2R29H 4WI4A 3MYZA 4XPAH 3LN5A 1DANU 4JG1L 1JPST 3WBDA 5I8EA 2HTKC 4PJGB 2JJSA 2C3GA 4RMQA 1RVFL 4KWUA 4NP4L 4X9HA 2Z92B 4I0PC 5DJ6B 2FJGA 3MJGX 4FQXB 4RRPG 3KPRA 3V6BR 4RMUA 2IFGA 2HH0L 1CDYA 5J3HD 1V3MA 1KLGA 4NO2A 4P2CG 2A2QT 3NZHL 2JK5B 1DBBH 3CH1A 4NWUH 4PRIB 5E9DE 4ONFL 1LMKA 1NDGB 5JMRA 5JPNB 4JFDB 5I71B 1DQQA 7FABL 2BJML 3LVEA 3GMOB 2Q7YA 5TQ0L 4DN4H 5CIPA 3PV7A 1V7MH 4IIQC 3WNLA 3E6FB 3ARFD 5E4EB 4CW1A 4KVCH 2BERA 2FNBA 3DUSB 5CCKH 1JWSB 1NL0H 3PJSA 1MNUH 4I3RH 4Z77A 1O5DT 2CRYA 3R0NA 5HHPA 2F53A 3MRHB 4RGOH 3G6JA 3RPIB 1QBMH 2AJ3B 1RZGB 1EO8H 2BVPA 3O3EA 4DKFH 3ARXA 3VG9B 4OCWL 1UM4H 3FO1A 3MV8B 1AJ7H 3D0VB 3Q6GL 3U7WL 1B6DA 1NFDE 3MACL 3ZTJH 2B5IC 4GQ9H 4IHOA 1ACZA 1OGTB 5IVXE 5C0BA 1KJMA 3DTXA 5CJQL 5AG9A 4JFYA 1JFQL 4U6HB 4KXZH 3U83A 3RX5A 2WSKA 3UYOD 1RZ8B 2ZOKB 4MMXC 5IWLC 2AQ1A 3RHWK 2DTML 3QIBA 4JY4A 4WRLA 1C12B 1F58L 4P3DA 1I3GL 3BYYA 4KK5C 4GKZA 4IRJB 5HPOA 2HRPL 5KSUB 2GAZB 2IEPA 3LKPA 5JQ6L 4J3WA 2DDQL 3CFCH 5LCVL 2YD2A 2YRPA 3NN8B 4JFPB 1ZHBB 5E2UH 5EBMB 2NXZB 3V0AC 4XMLL 1R3HB 4DQOH 1BQLH 4ODWB 1CLZL 3CD4A 4M61A 3GJFB 2EH7L 1FNGA 4QWWC 4YLQT 4X98B 3TN0D 5ISZB 3BQUC 2IG2L 3SDDA 3V95A 3SKNB 4BZ2H 1N7MH 5E5MA 1P4BH 2I60L 4PJFB 1BFVL 2H45A 4OBRA 1O7SA 3C8KB 3EDKA 4NO3B 1I9IL 3MZTA 4RIRA 4WU5B 4KQ4L 4LPXA 1PD6A 4JFHD 3EJJX 4WV1C 1Q0YL 1SYVA 2YBRB 4JZNB 3WXWH 3N1QC 2NQCA 4BFIA 1AFVL 2R56L 1KCRL 4P3WA 3PABB 3V6OA 4MCYB 5D1QB 4XB8A 1Q72L 3PP4H 3NABL 1AD0A 4HKXB 3RZCA 3ULVL 2AGJH 1TJGH 4PJ9C 2R2EA 4P9ML 4IDJL 4N1EA 4TVPL 4N1HB 2ZCHH 4JDZA 5DJ8A 4OZGE 1NBZA 1D5IL 2DQEL 1IFHH 5BRZD 4Q9CA 4OGXL 3L1OL 5GJTL 1CD1A 3WD5H 1E4JA 5IEKB 2GQHA 5L88H 2V9TA 1XF1A 4U6XA 4WU7A 2XI9A 4U6YA 4YHYC 2A73B 1HN1A 1GGBL 3FQWB 3MRPB 4Y1AE 2BNRA 1UB5B 5FK9A 5KVFH 1QRNA 4G9DA 5K9QG 4U1GB 4DVBB 3RKPA 2CLVB 4MD5B 3ROOA 4EN3D 4PJ9B 1FE8H 1I1AD 4V3EB 3QCTH 3R06A 3U46B 3W39A 4P2OC 4PJEB 2X9WA 4HLZH 2V5TA 2CKBA 1YUHA 4XZUB 4X83A 3PP3H 3MJ7A 4G59A 1MCOL 1IBGL 4PRID 3S5LG 3U0WL 3U4BH 1G0DA 3NH7L 4WJ5B 4XWOC 1RQ5A 1KACB 3R8BB 5ISZE 5L2JA 3L5XH 4HMCA 1QFOA 1DUZB 4PJXB 1GPOL 4OF3A 3TVMA 4ZXBA 4P5TD 1C5BL 1ZHLA 2DKUA 4GLRH 2G9HB 3FL7A 3GMNA 5CAYB 1PYWA 2GCYB 3HG1A 4ISVB 4PJ7B 3GSRB 3IJSA 4PS4H 1ZK9A 3VGHA 4YHOH 2MCPL 4X99B 4HGKC 3RWGB 4ZUWB 1J1PH 1MCOH 5DA4A 2OTWB 3CVHB 5E2VH 5I17A 4ZNEE 4ZO6A 1YN6A 4FA8A 5J0BA 2AK1H 2NY1D 3EO0B 3NA9L 4FMKA 1T7VA 4XVSL 2CD0A 3QIUC 2DBLL 3FKUS 4JVUA 2WIIA 1T21B 4ZTOL 3ZT5A 2GJJA 4L3ED 3WL9B 4XAWH 5D7SH 1AXTL 3PWPD 1FL6A 4OFIA 3T0EE 1DLFH 1P4IL 2C1PA 4XMKL 5IOPA 1G7MA 1JTOA 4Y5YB 2MHAB 5I1KL 2DL2A 3CFJA 3PGCA 4X6CB 1TCRA 3QQ3B 3UBXG 2GIYA 3BEVA 4Z0XB 3SE4A 4XPBL 3LS5L 3OKDA 5C7XL 4W4NA 4FFZL 3MLUL 5IKCB 4WWKA 5D93B 1JPGB 3LEYL 1IM9A 5EZLA 3B6SB 5KW9H 4WTWA 3NA4A 3IU3B 4X7TB 2OJEA 15C8H 4ZAKA 2X40A 1A7QH 2EE3A 1MHEA 4P2QE 1U3YA 4U1GC 1LEIA 2EE6A 5MENA 1ZA3B 3LPWA 4FZEL 3BPLB 3L6FA 1VESA 3V6OE 1XGTB 5F3BA 2VDOH 4Z77B 2I60H 5I1GH 4G43A 1N7ML 1WBXB 4MGXA 3HZKB 1KSRA 35C8L 2FEDD 3QIUD 1S7TB 4YHLH 4E0RA 4UDTB 4M1DL 3BVNA 5E94A 4YFLF 2HJKA 2DLIA 3WLWC 1LK2B 5DEGB 5JLZB 4HIIA 3T2PA 3SE3C 1OP3K 1HSBB 3T1FA 5DF0A 3P73A 1PDKA 1LO4H 1NBZB 1F3JA 5C09B 2PCPB 4UT9H 1NH6A 1N59B 5F8QC 4NDMB 4AH2A 1MAKA 2YXFA 4WCYH 4YAQA 1GOHA 2R9HD 3GSUA 1NBYA 1PVHA 1U91B 2ED7A 3KWWA 4XNXL 4ZOBA 5J8OA 4IRZL 5DR5L 4M62H 4Y7MA 5DGRA 4LHUA 4GW4B 5SWQA 1GAFH 1XF3B 2ZCLH 4JO1H 4H1LB 3MOBH 4NQEA 3ESVF 3P30H 1AHWC 1CDCA 5FGRA 4M7LL 3ZYJA 1F02I 4ODVL 4CMHC 4JRXD 4C57C 1Q9KA 1NCAH 1QR1B 1IAMA 5FO7B 1ZWIA 1DEDA 4WEMB 3GGWB 3PWPE 4I0PA 5T33H 1S8DB 1NL0L 1U3HC 4JPIA 5HHNA 5CCKL 3CIQA 2XTLA 2GSGA 1TCMA 4WUUE 4XMKH 3IDUA 4TYUA 5C07E 3RPKA 5JOFB 4L3AA 1K6QH 1I9JH 4J1UB 3KPMA 4P5TB 3VG0H 1HNFA 2C4FT 1MCSA 5KVDL 1QA9B 4Q2ZA 4DN4L 4WDIB 4NNYB 2A1WL 3BP5A 3HKFA 3MGAA 2XFXB 2UYLA 2X7LB 3TO4A 2LQRA 5TQ2H 3DHMA 4D0CA 1FZJB 3GNML 4OV5B 3BGFC 4I13B 3HRZA 4NWTH 5D7KD 1OGAA 4GAGL 1J1PL 5DUBA 4ZO7A 1N5YL 2MCPH 4ZMAT 4X6DE 4PS4L 4P9HH 1J0KA 3BD3A 4ZOCA 1UQSA 4NKIL 1G7JB 1A6PA 3WHE1 4L9LB 2ADJA 4P2OB 3HC0A 5EOQH 2ADGA 2OQJA 1MHHB 3NFSH 3WFEL 4LOUC 4DZ8A 5FCUH 3OB0H 4DUXA 3S37H 2P5ED 3U79A 5HPMA 4YXKH 1IBGH 1IEHA 3TF7A 1EMTH 4MJID 5CKGA 4V1DD 3SE8H 2VLLA 1INEH 4TVPD 2WWKT 4NCC2 5JZ7D 1U6AH 3W0WE 4XNMA 1M7IA 5C0DA 1CFSB 2BP3A 2GSIB 1ZKAA 4HUKB 4MVBD 3EOTH 3ETBF 1ACYH 4GRLD 1RK1A 1KIRB 3DXAB 1WUNT 4UINL 5DDHA 3SQOL 1C08A 3K8KA 2EDFA 3DUSA 1D9KB 3IT8D 4NRXB 4A6YB 1U8MB 5E6YA 2VC2H 4JPIB 3C09B 2G5RA 1YNKL 1RIVH 4MNGE 2CJUL 3CK0L 4LLMA 1ZV5A 4OD2B 4E41A 4K9EC 4C55A 1DTUA 1OL0A 2DM3A 3MNZA 3N50A 3LEVL 3QIUB 3VI3E 3FB5B 3BRGC 5ETUA 1PX3A 3P77A 2X4QA 4OLWL 2FO4A 3QDME 2CDGA 2A6KA 2WUCH 2YMXL 3MJ9L 2CXGA 2FGZA 3CFBB 1WTLA 4P4KA 4F7CA 4H88H 1NMCB 3EIFA 3CUPA 4IIQA 3NPZB 1TQBC 1MI5E 4M6OH 1R0AH 3L3HA 3W0WA 4ONOA 3QI9B 4AM0B 1MFAH 3QUKB 3TYGH 1D5ZB 4RWYL 2XN9A 2XRAH 1P4BL 1Q38A 3ZYZA 4PJ5A 2HFFA 5B39B 1G7MB 3N1MC 4MXQC 5C0GB 2NX5D 4KKCD 4RRPA 1ZLWH 3V0WH 1AKJA 2YWYA 4P23A 3M1BB 5MEOB 3C5ZB 3BEWB 3IF1A 2IANE 4ZTPH 4D2NA 1ZLSL 2YD1A 1YEJH 4NC2B 2W92A 4DW2H 2ARJA 5I1LA 3KS0H 5JA8B 2C5DC 2W07A 1CL7I 5E1HB 3D39D 2VXTL 1HKLH 4RCAA 1NJ9B 2B4CH 4FFYL 2VITA 2BOCA 3HAEG 3U7WH 4UT6L 5CJOH 2OX5A 5ICYA 3X14B 1U8QB 2ID5A 1EFXD 1WIPA 1I8LA 1U3JA 4Y4FB 4NZRH 1Z5LA 2AEQL 5KVMC 4EIZC 2ADIA 1RJYA 2P49B 3L95B 3MR9A 5DXWA 4WUUA 1FPTH 3W81A 2J4WH 4PJEE 1KB9K 2C4XA 3PWPA 3GRWA 1TJIH 3LH2H 3MRPA 5FYLH 5H8DA 1HNGA 1RULL 4I2XB 5E24E 4JJHA 3DRQA 1AHWB 3C87A 1G84A 1KYOJ 3UTTB 3MV11 2EH8L 3OJVC 5SWZE 4L8SA 3EJZC 2W38A 1VENA 3EOAA 2DJUA 1AIFA 1JWUA 4EOWH 4LCCB 3OKLB 2Z4QB 3RVUD 2YK1H 3CZJA 2Q8BH 4LVOB 1FYHB 5F88A 4NKDB 4DCQA 3MV8A 3O2DA 4MNQA 2DJSA 5JDJA 1MCNA 2VB5A 3QCVH 2Q8BL 5JDSA 1I7UA 1KF9B 1VADA 4N0UA 4QT5A 4R96A 3B2VH 4PRDA 5EU7E 5J11C 4UQ2A 5JHLH 4YQXH 1FO0L 3GHBL 4NQDD 4J4PD 5T5NG 5C0JB 1FFPA 1WZ1L 2C7UA 4O5LH 2PTTB 1HINL 2UWEA 3SKOA 2E7BA 1X5FA 1CFVL 4OZIE 5HDLA 4UV4L 3K46A 4R8WL 3OX8A 1JHLH 1RZJH 4P2QA 1GIGH 4M1CC 1WEJH 4GBXB 5F7MC 3DBXB 3FB6B 4X98A 3NCMA 1NUDA 1J87A 4XPFH 4LVNC 4JY6A 5C8JA 1ZLVK 3JWOL 1IMHC 3QULB 1MFCH 2K1MA 3VXNA 3BHBB 1E4XH 5F3HB 4CNIA 3ARGC 4XVJL 3VXPA 2EDHA 3TPKA 4S0SD 1OAUL 1A2YB 3I9GL 1OTUC 1CICC 2R1WA 2ZZUT 3VXQA 4HG4K 1SYVB 1B4RA 1UWEH 4G9FE 4Z9KB 4JCMA 1J9CT 4O02H 3JWNC 3BZDA 5JO5B 4HG4J 4QY8A 4FTVA 4MAYB 5H2BB 5EFIA 3L9RB 2R0KH 3BZ4A 1KB5H 5EUKB 1CIUA 4M00A 4OCNC 1FLRL 3PXHA 4RAVA 2H6PA 4NQVB 4K3HA 4RZCA 4LHJB 2AXJA 2W60B 3VFGH 2J88H 2AXGA 2ICEB 2A9NL 4NRYA 1JHKL 1DEEB 3T0EB 1JNLH 4QT5B 3EUUA 4JPWL 4RWYH 4WHYG 1TZGL 2I9LB 3IGAB 5F72S 1AGCA 1OD7A 3ZTNL 4JRXE 5I9QB 5CLTA 4Y4FD 3RY5A 3A6OA 4RMSA 1BQHG 1CGXA 1RJZB 1V3JA 2DBJA 2Z31D 4H88L 3DMMD 4ZFOB 1BIHA 2EEBA 3KPRB 5HVHC 1T7ZA 1H5BC 2O5XH 4NQEB 3DO7A 1KLGB 4NO2B 2VH5L 2WUCL 3ZDXF 4LLUB 5FB8B 3TIDA 4FTVE 2BMKB 4EN3C 1PSKL 3KXFB 3LEVH 4FQHA 3WHXA 1IGTB 5K9QI 3FQUB 3HI6H 1NGYB 3UTTA 3LKSA 4B50A 4G5ZH 3LN5B 4TN9A 3EZJB 3N9GL 2MQ3A 1QFUH 1KTRL 4F3FA 3C6SB 2DWDA 2GJ6D 2W9EH 2DQIH 3O6KH 4N0FA 3UAJC 1NMAL 4JJ5B 3CLFH 3QQ4A 4MQTB 5D1ZA 3FHAA 2OXGA 1J5OH 4JQXA 3L5HA 5D2LB 5TDNB 3QUMA 1GIGL 4YFDB 3VD3A 1D6VL 4BZ1H 5ALBL 4QRPE 5IBUB 1IL1B 5IJKA 4K2UL 3S3JA 3HMXA 4LRIA 4H0HB 2BOCB 1CXHA 3EKCA 3TJHA 3HS0A 1UWEL 3CSYB 2BSTA 1A7OL 1KTDA 1RJLB 1SJEA 5F96L 4PUBL 3U0TB 3U6RA 3RVWC 3GB7A 5F7NC 5L8LB 1MI5D 4X9IA 3EOBA 1OAUH 3HR6A 1RUKL 3RWIA 2NR6C 1IVLA 3MCG1 4QGTA 4NOBA 2D03L 1CF8H 5T3ZE 4OZHB 5IFHH 1KT2A 4F58H 2X09A 5IEHA 3NOIA 2A6JA 2BHUA 1MFCL 2PYFA 5DS8B 1N26A 4LLDA 5D7IE 3MRQB 3QIWC 4LSQL 4XPFL 4AIZB 5IQ7L 4JLRB 2ICWB 1OAQH 5FGCE 3JZ7A 4PRNB 4QRQB 4LMQI 5BVJA 3QUXC 4ZPTB 4UV4H 5FYJU 1AKJD 4QNPE 4Z7VB 2WUBH 4N0CD 1R3IH 3FT2A 3EOAB 4KK5D 1XIWA 4PP2B 1PZ5A 3TBYB 5AWNL 1FZKB 3ARBA 3VXRD 3S35L 1C08B 4M8QA 4XPHH 3HUJA 5LXGH 2F15A 4GKZB 3OAUL 5CJBA 3DX8A 2HFGL 4PV8A 2R23A 4LRIC 3G5XA 4NN7C 3BZ4B 3BD5A 3KXFA 4XP1H 3WHXB 2VIRA 1ZA6B 3TN0C 3EFDH 5I1HH 1P69B 4ZFZA 3HE7A 3SE4C 5L6YL 5EB9A 3BKCH 1L0YA 3WE6A 4ODVH 1EIBA 5F9WB 1BVZA 3QUZA 1ONQB 4D8PA 3O4OB 3SCMC 3N1PC 2P8MB 3MXVL 5HY9B 2H9GA 3MRMA 2B4CL 1FGVH 2IBGA 2NW3A 3EYFA 4N90E 3D0LA 4FHBD 4XNXH 5F71A 5GRJH 4LCWD 4X6FB 1EFXB 3TBSB 2GJ6E 3ARTA 3C60A 1EFQA 1NC4B 4JDVB 3CZFA 4XNZC 3VFOB 4PJBE 1WQVT 5KJRL 1YEKH 1EEUA 1JF1B 1AI1H 3UEZA 4XH2A 1F3DH 4Z7UE 3U46A 4XNQA 4NT6B 3W9EB 5E9DA 5CEYA 3IAPA 4JDZB 5DJ8B 5FHAH 5F1OB 5F9DC 5DVOA 3BMVA 3GSNH 5FYJD 4YHLL 3QNXB 1RIUL 4HH9B 4O2EA 1BX2B 1MIML 3MX0A 3TIEB 3MGOB 5I1DA 5IT2L 3SGEI 4PJ5E 1YEFH 5I1CL 2HKHL 1T4KB 3UC0H 4DK3A 4QXWA 1KJVB 3GZKA 1YZZA 2GJ6B 2A6DB 4WFED 2IFFL 4X4XB 4X80L 4CAGA 1CLOH 2DN7A 4NYLB 5F8RC 1KXVC 3T65B 1TTUA 5GZND 2CSPA 1YC7A 3O3BB 3BWAA 3MLUH 4HX1B 4NUJB 5C7XH 4ZFOL 3PNWA 1EXUB 1NBVH 1VACB 2O5YH 3FFCE 2V2XA 2B5IB 2YPLD 2R23B 3VXUD 5C08A 5I30L 2W0PA 4GS7C 3O9WB 4PGBB 4UB0L 3BIBX 3P0GB 4I0KA 4AL8L 1RMFH 2E7LE 1X5JA 3LDBC 1KCVH 3BPLC 4C56E 4MA8L 4Z76A 1J8KA 4I2XA 3HNTL 5JLZA 5GRXG 1P9MA 4HC1L 5IB1B 1L4IA 2P5WE 4IRJA 2E8YA 1KTKE 3SKMB 3IDMB 5KOVC 4RQQA 1E0OB 4PJXE 2GSIA 4P3CH 3CZFB 4Z7OE 2FIKB 4EDXB 5DJXA 5HHXH 5E08L 4L4TA 4E9LA 1INEL 4KZDH 3BGMA 1Y6KR 5ERWA 3OKNB 4JGJA 2R1XB 5F7KC 4G6JH 4IMKC 2XQBL 4Z7WA 2DQCL 3H9ZA 4H1LH 5E8OA 3T77A 2PXYC 4DCQB 3MUGB 4OGAC 3UO1L 1JV5A 5A2LH 4DKEL 3MUY1 4OKVA 4N9GA 4OB5H 3PP3K 3BEVB 4U4BA 1J10A 1A21A 3C6LD 3UDWC 3EW3B 3MOAL 3G5ZB 1FORH 1P5VA 3C8HA 5C0NC 4TTDD 4R0LB 5ACLA 2A0LD 3WFHB 3