2YPKA

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ypkA01
1KCSH 4Z7UF 3MRJA 2DI9A 2UVEA 4NRXA 3GRWA 3GJFA 1YN7A 2X1WL 2Q87A 1C12B 2BNQD 4LLMB 1W0WB 2NLJB 1R3JA 4UAOB 4LSPL 1NGWA 5IV2B 4XNZC 2J88L 1F58H 1CWVA 4WFFD 3I85A 4U49A 4Y5VC 2RBLA 3T3PF 4FQXC 4EUPG 5I74B 3KPRE 1AGFB 4TSAL 4HJ0D 5CJXC 3KPMB 1KB5A 4JFQB 5E4IA 1C16B 1OY3B 3BN9C 5BVPH 4R0LC 1CF8L 1T7YA 2HVJB 2X4UB 3V52L 1YQ2A 3IKCB 3UJTL 1T04B 5FO7A 2FR4A 5ESAA 2IPTH 4Y4KB 3UTSA 1OGTA 1MCOH 3OJVC 1B90A 4NQCA 1QD0A 1DANT 4OF7A 3FQWA 3HE7A 1CGTA 4Z18A 1D5ZA 4KDTC 4S1SL 3ARBB 4MSWA 5FYKL 5JIKA 2LU3A 1K6QL 3U79A 2P8PA 2PYEA 1REIA 5JZ7D 5FHAL 2VR4A 4YC2C 3FHQA 3BH9B 4NBYB 1PY9A 2P8LB 5DK2B 1J86A 3U46B 5IMKB 1U8JA 3DUUB 4F33B 2VH5L 1HHJA 2X4RB 1T4KB 4WUUE 4MS8A 4NYLA 1CFVH 3EZJB 3ZKMD 1DSFH 1RUKH 2JJVA 4HXAH 5EZJB 4QCIA 3CX2A 1ZA6B 5KSVB 4NRYB 4ZODA 4C56B 4M5YL 1I4FB 4X5WA 4ZFGH 1MPAL 3QDGD 4AZ8A 5C70A 3KPLB 4NQEB 4LHQB 3WSQL 2NQCA 3FN3A 2BMKA 4M1DH 1NLBH 5CEYA 3RZCC 2HVKB 5KVGL 1MI5A 4P23C 5C0NC 2YPVL 5FECA 2ZUXA 5KW9L 5I1CH 4G6KL 2IH3B 2XPGA 3VWJA 3HUJF 5KTEH 4MD4B 4ACPA 3O6LL 2R1YA 3OB0K 3RJQB 2ZG2A 2Z8RA 4QT5A 2F5AH 5JIIA 4NFCA 2RAMA 1MHPH 2E9IA 5DMGC 1GGIL 2AXHA 5GGQL 4AT6B 3RWEB 4MHHI 2MPAH 2IWGA 2H8PA 4FQQA 2YD7A 2OX5A 3C60B 4UBDC 1LD9B 1F2QA 5I1AB 1UWEH 2Y06L 4TNWK 3WNOA 2EDTA 4JKKA 5I15L 2Z31D 1M7IA 4KTEL 4XVSH 2FEDC 3FQXA 3QCTH 1KNOB 1S7XB 3RZCB 1KLUB 2CUMA 5LG1A 4HJGA 3HE7C 4FFEX 4K7FB 4DTGH 1EVUA 1K4DB 1ULVA 1YEGL 3KPNA 5I19L 2AEQL 5M7QA 1EFQA 4OZ4B 4LRIC 5DJAB 4YZFF 4LSSL 3RNQB 4HZLA 3RNKB 1GHFL 5C0DB 5HYJD 1R5IA 2WBKA 4Z5RA 2RB8A 1OW0A 3S98A 1I1YA 1TNNA 5SWQA 1TZHA 2EEDA 5F88B 2E7LA 2XZCH 5GGVL 5BZWA 4XCFL 1JRHH 1AQDA 2DI8A 5GRXG 3OF6D 2BVPB 1UVQA 3RJDA 1R3IH 4WWKB 3QUMB 1T03H 1Q0XH 3EHBC 1ZS8A 1EX0A 3GIZH 1BBDH 3BD4A 2IALB 4LNVA 3MTRA 5JZ7C 3AMLA 4EJ1C 3MMEA 3X12B 2N4IA 1RY7B 2DMCA 1ZHBB 4OM0L 1FE8H 2A9NL 5ISZA 5SV4A 2OTPA 5ISZD 4IMLA 1QQDA 4U7SA 5D1QD 4D9LH 2AXGA 1BMGA 2AAVA 4KGJA 3TBYA 4CADA 2DQFA 2ADIB 1FCCA 2RHEA 1T6VN 1YN6B 2VKWA 3CVHL 1BFVH 4LQ1A 4NCC2 1YQVH 5EUKB 2CLRA 2XQBL 2VXTL 5HI3C 4HZAA 3CPLA 4JRYB 4LKXB 4LVNB 5D2NE 3MRMA 2CLZA 4RWYL 4NQXB 1RZFL 2G60L 1UZ6E 1NSNL 3RRQA 1I7TA 1Q1JL 3TBVA 3IFOB 4XB8A 3OR6B 1HXYB 3D0VA 3MO1B 5EORH 2R0LH 3RL2B 3PDOA 4C83B 1OWWA 2FB4H 4M62L 5C1MB 1MLCB 2AGJH 3JXAA 2Q86A 1RHHB 1Q38A 2DYPD 2FECL 4PV9A 3MLTB 4OZHE 3VG9C 1SM3L 1FFOB 1ZV5A 4MA8L 1YDPA 2ORBL 4ODHH 5GS0H 2DWEA 3R1GH 3D85A 1VEPA 4UNTA 4MD0B 1IAMA 1QBLH 1KB5H 3H0TB 4KK8D 3M8OH 4QXGH 5IVOA 5FA3A 5IT2L 2GY5A 2FSEA 1AR1C 1KFAL 4I0PB 3NIDE 1FGVL 4Y4FA 1LVEA 5DK3A 5GZOD 4WWKD 2E9WA 5MERA 1F02I 8CGTA 3AAZA 4RGMB 4A6YL 4UT6L 4G9FE 3EYSL 1H3TA 3GMLB 3IU4H 3L5WA 1R0AH 4JGMA 3MNWB 5L2KB 4YH6A 2XQYK 2JKXA 2D9CA 4QRPE 1IEAB 3TP4A 1UJTA 5I76B 3D25B 1ODAA 1WLHA 4LEOB 4XNQB 5I1LA 4TQEH 3JUZA 1UZ8A 4Z9KB 1UACL 2HVKA 2M8XA 5DLMH 4G59A 3MUZ1 2F19H 4XXDB 5E8PA 3RPIA 3K8KA 3L3OA 4N9GB 2XPGB 4QRUA 5DJZA 3CVHA 3O8XA 4L8DA 3WJLA 3ULVF 3MRHA 2O26U 1MAMH 4UDUA 5JW4Q 1PFCA 2QBWA 3HG1A 3SOBL 2VUOA 3VD5A 4QHNB 1R3KA 1S9VA 1YEJH 1FRGH 3RGVD 1K8DA 1BZ9B 3WNKA 1S9WA 3GMOA 1ND0B 1SJEA 5BVPL 1CU4H 25C8L 4Q9RL 3DHJA 3TIEA 4LHUB 2HJKA 3ZKSD 4BK5A 1BF2A 5SX4H 4EDWH 2V6HA 3BP4A 4L1HA 1RUAL 3NABL 2ESVD 3TBWA 3VXNA 4C56E 2XFXB 4DUXA 1WBYA 5FO9A 1E6OH 5BZDA 4M61B 3MLPA 4WCYL 3CFKA 3MGTA 3LS5H 4NHCL 4PTUA 4ZOEA 3UCRA 1MRDH 1S7WA 5J6GA 5F7YC 3VGBA 3WE6B 1F6LL 1UEYA 3LEVH 2QSQA 1LK2B 1P5UA 3RVTD 4PRPA 2Y6SC 3BGAA 5J1TC 1JYXA 5CILL 1DVFB 1I3GL 3QUZC 5JHDE 1RQ5A 3QXDA 1DQLH 2NZ9C 4MJ6A 4MXVE 1MFDL 4G7YH 4TULH 1OTSD 2R4RH 4HW6A 1BIIA 3R06B 1MWAB 3UTTE 1WUNT 2GITB 4M5YH 3EGSB 5D7SH 5DJ2B 1N6QL 2ESVE 4WW2C 2EC9T 1FYTB 3L5XH 3O4LA 3SDYL 2J5LC 3TJHC 1QRNB 4XVUD 3RWJB 2O5XH 4TSBH 1AR1D 5T3ZD 4ZYKA 2AI0H 4QGTA 5T5FH 3RY6A 3VD7A 4JFDD 4EUPB 3PWPD 4HBCH 1CBVL 4OI7A 3O0RL 3GHEL 5MEPB 3OXSA 5EO9A 4U1GC 4ZFZB 2W65A 1ZEAH 4JM2B 4XI5D 2GJZB 5FDWA 3OGCB 4Z0XA 2WNGA 4U1GB 5DURB 4P2OD 4Z0BH 1HZHH 4IDJL 3ES6B 1K2DB 4JRYE 3ZYJA 2VZVA 4KHTH 5KS9F 3L6FB 4GRWE 1PSKH 3RL1B 3HCVA 2P8MA 2Z35B 3BX7C 4GS7C 5BS0A 3DSFL 4F57H 4DFHA 3QIWA 4PJ5A 2VMFA 4OLZL 4XMPL 4PGJA 4AEHH 3QXTA 3GHBH 2HRLA 2YHGA 4LASH 3BI9X 4MWFA 3GSVB 4U6TA 3TO2A 1I3VA 1CR9L 1N3NA 3DX7B 4ZFOL 1P2CB 2RCSH 5MP6L 3WXWL 4RX4D 3M1BB 1A6TA 2APWA 1A6WH 1HNFA 3IDXH 5IW3A 3NIGF 5D2NB 4L8SB 4ODWB 2V5YA 4PJHE 1I3UA 3OSKA 1LE9B 4JHAL 5TDNB 1ERNA 1VHPA 3REVB 1A7RH 3EJJX 4YO0B 5DDHA 5C08A 4RBPH 3VU2A 4JRXE 1QSEB 1SEBA 3IDUA 1A4JA 2PTTB 5B8CC 1Z9OA 2XN9D 5IK3A 3TH3T 1LP9A 5DZLA 3U9UA 4DWHA 1NL0H 1TVHB 4GKZB 4R0LB 2NY0D 1T3FA 1YEKL 2EICA 1K5NB 2BOBB 2IF7A 4NJ9H 4NQDA 4D8PA 3ZTJH 3L3IA 1VGEL 3BVNA 2FJHB 2IFFH 4LCWB 1HDMA 1Q0XL 2E7MA 1DR9A 4MD5B 1FIEA 3LRSB 5F7WC 2WBJD 3GMLA 3L5WB 4LBEA 5DXWA 2B4CL 1QSVA 4NKMA 5SWZB 2DYPB 2VDQL 1QR1B 4GUPA 4N0CD 2GJJA 4ZAKA 2I26N 4XBPA 1JNNL 1FCGA 1RJLA 1MJ8L 1CICB 4Y16C 4XNQA 5I1LB 3VW3H 1RJYB 1CXHA 4PP1D 1YEEL 4LU5L 4UOW0 1IC5L 1DL7L 1HSBA 5FKPB 3QUYB 3KYKH 3RTQC 4E41D 2YBRB 4X6BB 1A7QL 4GJTB 3CFBB 4PY7A 1SEQH 4U31A 1IAOB 1MCJA 4LCCB 1UFUA 5I8EB 4YHNB 5C6TH 1RZFH 2G60H 2O5ZH 2VQ1A 1ZT7B 1QR4A 1JPGB 1NFIB 4MQSB 1G6VK 3MGOB 1XR9B 5DS8A 3R0NA 4PY8I 1FVEA 5IW1A 4F2MA 5E99H 2FB4L 1I9RH 4JVUA 2DQTH 3G08B 4H1LH 3SQBA 2Z0BA 1CLZL 2QJDA 2YK1L 4GBXD 4PLJC 4F7MB 3V0WL 1D5ZB 2BNQA 1OAXL 1P9MC 4QXUH 4XGZB 2X4PB 3HNTH 4I3RH 1JPTH 3I9GH 4GW5A 1N64H 5LGHH 3HI6H 5BMFH 2R1XB 2Q76B 4D0BB 3MOAL 4PTUB 3SHSA 2BRRL 1P4LA 2ZSWB 1I9JL 4MLSA 1ZHKB 1MUJA 2FLRT 3O6ML 4UIMA 3RAJH 4M6OL 4Z77A 1Z5LA 2ICES 1OGAA 4KH2A 3TF7C 2F74A 2HKFH 2OYPA 1WIOA 1FORH 3V6ZA 3KLAA 4HKBA 3W82A 3G6JE 5CUSH 5HYJB 3TIDB 4RIRB 5BOZG 3Q5TA 2BHUA 3VRIB 1OM3H 5EN2B 1H3PH 2YZ1A 2OSLA 1EK3A 1FLRH 4JKPH 2WW8A 5IG7A 3U4BH 2M2DA 2IPUG 2VC2L 3GB7B 5I17B 3NPSB 5KANI 5DJCB 5JW4M 4GLRI 5IMOB 3BSZH 3Q5OA 5C0AE 1UZ6F 3QI9A 3E1F1 3WIHH 3MLZL 5J12B 2FBOJ 5DLML 4NNPL 3VXRD 4YIQB 2DKUA 5JHLH 4ONFH 4QRQA 4Z7VB 3LMJH 4Y7MA 3VRLF 3TO4A 2NY7H 3MNZA 4EI5A 1E4JA 1QACA 3U36B 2LU4A 2QKIA 5AUMA 5E00A 5EUOF 1W72A 3F12B 3F7VB 3HFML 3SOBH 1ZHLA 3I6GA 4F9LA 1JE6A 5CCKH 2IAMD 4ELMA 1LHZA 4EI5D 3FQXB 1V3MA 3SDDD 5ADOH 5JHDB 4U3XA 4MNQD 3KYOB 4FXKB 4JDTH 1OSPH 1FZJB 2C7UB 5KOMC 3CDFA 3WDHA 5DD3L 4YPGA 3C87A 3SGDI 4U6HB 4DW2H 2J6EL 5A2JH 4NM8L 3VRJB 5B3NA 2PTUA 1EO8H 5CSBA 1C5DB 4OQ1A 1H8OA 2LABA 4XHQA 4EIGB 4ETQA 4G6MH 5CKAA 4KY1H 1JWMA 1CGWA 5C0BD 5I1GL 1T0NA 1HWGB 1I8LC 5HHOB 3CCHB 4GOSA 1J10A 4TUJA 3ZTNH 3ULVL 2VISA 2GCYA 2BK8A 3NIGE 5C2BH 5IW6A 1FDLL 3VFMA 2HN7A 5IQ9B 2I07A 1KYOK 5CD3A 3KJ4C 4OB5H 4NM4H 2YC1B 1O0VA 2IH1B 4G7YL 4TULL 4Y5XA 3F7RA 3MRNB 4G9DA 1B6DA 3RTQB 1Y0LA 1TQBB 4WWKA 3TYFA 1CQYA 5SWSD 2H41A 4P59H 4PJAE 3T2NL 1ACZA 5KSBA 4IJ3C 2AKRB 1HKLH 4XVJL 3L5XL 2PR4H 5C7XL 5F7EH 1CDHA 3DX6A 4KC3B 4D2NA 1YNKL 4M02A 4PGZA 4HQQH 5HJ3A 3D39E 4GAGH 3W5MA 4XNMA 5F1NA 2WBJA 4PJXF 2R9HD 5ITFA 4V1DA 2H9GA 1P4IH 3LEYH 4LSTH 3FO2B 4BSWA 3FO0H 1GGTA 5E9DA 5AYUL 5ILTL 1N5YL 3WS6A 3K1KC 4X7TB 4XB7A 1U8MA 1SY6L 5IBUB 2P8PB 4KJWC 5E0QA 1I8MB 5A16B 4K7PX 5E6IB 1IL1B 5J9PA 1RZKH 4UDTA 4NZTL 4FFVD 3SPVB 5C0IA 3IDNB 1R3LA 4RCAA 3FFDA 5ESVA 1KGCE 1GPOL 4XNUL 5DFVC 2R2HA 1JF6A 5ANMA 5J1AA 4Y4KA 3HUJA 4LVNC 3FMGH 5HGGS 3P9LA 4XP6H 4KV5E 4P4KB 4LASL 2BOCB 1HYSC 5CEZD 1FO0A 2A6KB 3L5JA 5FUOL 4X99A 3WXWH 2E27H 3CFJB 4JFPB 4AEIL 2XZQH 5IUSA 3FRUA 3CXHK 4NKDB 2OTWA 4OCYL 8FABB 4BSVB 2ZOLA 5EZLA 4U33A 2V9TA 1DLFH 2NXZD 3O45A 4XBGA 3T0EE 4ZTPL 1JNJA 2XG4A 2PXYB 3PGDB 3BGMB 4WUKL 5C86A 3MJ7A 4G6KH 4U0RB 2LQRA 3U4EA 3S7GA 1WVZA 4XVTL 12E8L 3JWOC 4NO0D 4JR9L 1U93A 2QADC 3LKRB 3TVMB 4PB9H 5LJYH 2JLLA 3EJZC 4WWKC 1KN4H 4X5WB 3BO8A 1BWWA 5FM5O 3GMPB 1KT2B 4RFEB 3BD5A 4H0IA 5CMAA 5D7JB 4NJ9L 4GKNA 2CH8A 1R24A 4KK5D 3SE3A 1RMFL 4QNPE 2Y06H 3MRBB 5I1AA 4I3SL 2ZWLT 1TVDA 4KTEH 4XVSL 1WTLA 5B38G 2A1WH 4Z7OE 1RULH 2ITDA 4OLUH 1F3DJ 3KLDA 3EOBA 4FRWA 1CK0H 5K9JH 3CZFA 2FL5A 2YD5A 4OLYH 3EOAB 3OB0H 3FQUB 2FX7H 3LSOA 4WW1A 4K7PY 2BSSB 1T1ZB 1UG9A 3S96B 5CAYB 3GMRA 1G9MH 2OXGA 3V9FA 1JHKL 3CU7A 2UWEF 3BISA 1AY1H 2MKLC 2J8UA 3P4MA 5IFHL 4G8FA 1A7QH 1PG7L 5EC1B 4MNGE 1G7JA 4OV6F 4BQ9A 3MRGA 4V3EB 3BWAA 2HRPL 1HHGB 1QVOA 3DARA 4PJHF 3ULUH 1QBBA 1S7UB 1LEKB 2XZCL 1V05A 5K9KA 1FNFA 5M95B 3OHXB 1YYMH 5I16A 3IJHB 4KDVA 2XNAB 4QNPF 3D3VA 1JWSB 2XWJA 3NZ8B 4U1MA 3NFPA 3ALXA 1J11A 1IGFL 3TT1L 1P6FA 3MCLH 5BV7C 1HQ4A 2IQ9L 4K94H 1K8IA 3P3YA 4NSKB 5T1KA 3SGKC 4ZOBA 4L3EE 1N8ZB 5DHYB 1NMCB 1RK1B 5H8DA 4QXUL 4U6HA 3C5JB 4ONGH 3RGVA 3KPPA 5KVFH 1H8SA 4JO2H 2O61A 2NXYD 5ADPL 2GIYA 1UWXK 5HHMD 3G5XB 1MCDA 1RZ7H 3IDJB 3HC3H 1KTKE 4PJBF 1IM3B 3GBNL 4Z7WF 1XGUA 3QA3B 2NY1C 4FFWC 4J4PA 4FABH 2R29H 2GT9A 2ZUVA 1J1OL 1UEMA 3GSXB 5EO0B 2OBGA 3N06B 5IJKC 3A67H 5D7IB 2DBJA 1AGDB 4F8QA 3NBNA 1OCWL 1IGCH 2P49B 1NMBL 4CJ1A 1S7TA 5DJDB 2WQRA 5D9SA 2VDNH 3P30L 5LGJA 3LQAL 1OAKL 3VFRA 3BEVB 3UTSD 4OQTH 2JELL 5F7DB 5DVMA 4KDWA 1U8IB 3KHOA 4O2EB 5MEQB 3DURB 1T6WA 3L9RA 4PBWD 4RFNB 4RZCB 5CEXA 1JIBA 3M8OL 1L9MA 4QXGL 3LMJL 4P2OC 4AENB 3RA7H 2X2YA 5ESQB 1UA6L 3MRRA 2CMRH 3SE9H 3CUPA 3V4UL 2WAHA 5HGHA 2PNDA 3ZLQC 5C09B 1DQDL 1IC4H 4OKVB 3CSPA 3GSVA 3VFOA 2OTUB 2L7JA 3EYSH 1P2CA 1QFWH 2DLFH 2XKSA 4Y5VA 4MJIE 3Q0HA 3X14B 1ZAGA 5EPMA 1AD0A 5CSZB 1I8IA 3WIFA 2I60H 4LNRB 1AGCB 4Q2ZA 5CJXA 2WZPD 3QO1A 4X6CA 3LRGA 1J0HA 4I0PA 3ZDZE 2NX5E 5FB8A 1OAZH 3SDAD 4KQ4L 4PLKC 1YY8B 5ESAB 1EO8L 1NBVH 2DJ4A 2Q8BL 3U2SA 4EQ3A 1OGTB 3RU8H 3GSWA 2MHAA 3D48R 2CXKA 2UZIL 3V7AE 3MFGB 4UUJA 1XF1A 3LHPH 5JW4N 2PYEE 1I1AA 3PGCA 5E5MB 4OFDA 1N2RB 4PJ9A 4MVBC 3T09A 2CJUH 3BQUD 1JF1B 3TA3C 1LQVA 1B88A 4U7KA 4X6DE 1VACB 5BS0D 3QCVH 1WQVT 1W8OA 3PP3K 3S36L 1KJVB 2WINB 2KKQA 3PABA 1KPUB 3C09B 2W0KA 4NM4L 4WUUA 5GJSL 5MEND 3BHBB 43C9A 2DAVA 2L4OA 4WEBH 2CKBH 4HUMB 1T1YB 4N5ED 1IKNC 2IQAA 3L3HB 4PD4K 4G8EA 4PRIA 2YA2A 1W0WA 4XVJH 1CU4L 5I8OL 2H1PH 3WSQH 2CKNA 3MV9A 5KSAA 3D9AL 1MCQA 3NFNA 1EHLH 5EUOB 4C56D 4Z7UE 4NC0B 3RHWF 3NAAL 3I50H 3V7MA 3RUGA 1QLEL 3FTGB 2XFXA 4FTVD 3MBED 3MRKB 1E6OL 5AYUH 1MRCH 2CKBB 1Q9LA 2OI9B 3O3AB 4GMSH 3P9WB 3VXMA 1OF2B 5EIIA 1XGPA 4P3DA 4O02H 3VWKD 3GK8H 4NZTH 4JFHD 4UU9B 3IDMB 5JNYB 2YN3A 4NNYB 4U1LB 1UXWA 3CH1B 3BP4B 1BEYH 2PETA 1MFDH 1P7QD 4X7SL 3RVVC 4NQCE 1NUDA 4KKLD 3RVWD 4XPFH 3MGOA 4XP6L 3BPLC 4NKIH 3L3KB 2ZUWA 4NZUL 4FQHA 1MCPH 1NDMB 2E9BA 5EO1B 1QG3A 3DBXB 2CSPA 5MEOA 1VFAB 4PRIE 2PW2A 4LGSB 4GRLB 5DK2A 4G43A 2NY4D 1X5KA 2VLKB 3HNVH 4OT1H 1G7QA 1E6JH 1JJUA 4TRPL 3WIIL 2P43B 1ZK9A 3QXDB 5FYJU 4EDXA 5EBMB 1AGEA 1FNLA 1KCVL 1N59B 4OFPA 2CD0A 4GG8B 4PJAF 3FQNA 4M7LL 4YR6B 3K8LA 4ELME 4JN1L 5E5UB 2VR5A 5E94B 1BQHG 1IGYB 6FABL 1YPZF 1LEGB 4LARH 2X9XA 1ORQB 4BZ2H 1WBZA 5AD0A 2K9UA 4M7KH 3SQOL 1KN4L 2D0FA 1YUHB 2LU7A 1PSKL 5F1IA 4Z5RB 2KQMA 3OAUL 4XCFH 3LS4L 5IBLC 4P5MA 2CRIA 4PJ5B 5L88H 4QOKA 4HAFA 1TZGL 3O3EA 1PJ9A 1KPVB 4MXQD 1BJ1J 2AJZA 2VLJA 3C5SA 3T4AA 1KJ3H 2D7TL 2ADJB 2RCSL 2EYRA 1QEWA 2BSTA 3TEUA 3U9PL 2VWEC 1XF4B 1HCFX 3GNMH 4PG9A 5LGKA 1N6VA 4NP4H 1CD1B 5GRYA 1LO5A 1F90H 2C3VB 5F3BA 3LPFA 3U0PB 4NC1C 4F9PC 5I6XC 4XPTL 4M6NL 4KFZC 1FZMB 3NPZB 3FCTB 1MCBA 1SVZA 1AY1L 2EDDA 4OAWB 3CDGB 4RA3A 4GG6E 3DURA 4WEMB 2Q6WB 1YJDC 4BQBA 2MWCA 2ESVB 5EFIB 2HRPH 1ETZB 3OJDA 1GGCH 1OTUC 5HY9B 5T3XL 2BZDA 4JGUA 3KPQA 2X70A 4KMLB 1YNTB 2OQJB 5JO5A 3QUXA 3L7FA 4LHJB 5K33A 5F89A 2V5RA 1G7MB 1EA9C 4P2YA 2J8HA 2YXFA 5DMKB 2R2CA 5IKCB 4H0HB 3OV6A 3S8WA 4N0UE 5IVZA 4TVSa 2X4NA 3O81A 2P46B 4TUKL 1X4ZA 5D7IE 2IBZY 4Y4HD 3F7PC 4M7JL 4HHAA 2UUDH 3VW3L 2JCCF 2Z8VC 1OPGH 3LKQA 3CCHA 3PUCA 1KB5L 5L0QB 5ADPH 1WBXA 2W1NA 3HA0A 3STZA 1KFAH 3TBSA 1D5IH 2DWEB 4FQJH 4WTWA 1J18A 4MD5A 1VKXB 2Y5TA 2J3SA 4JDZB 5ISZB 2VAJA 2E6PA 3QFDB 4P4RB 1P4BH 1XIWB 1O7SA 3HZYB 2KPNA 3RZCD 4ZUTA 3OKDB 4OM1H 4WNQA 4UIKH 5DQ9B 3ARBA 4NFBA 2CIKA 1V5JA 1U0QA 3ULUE 5DJ8A 1Z9SA 4OLVH 5DS8B 4MDIB 3WFEL 2V9RA 5HYIA 2H2SC 3C08L 5T1MB 5F1NB 3KPRA 4MJ5B 3LKSB 3IGAB 1GXEA 1A4KA 5DRZA 5C2UB 3CSBA 4DVRL 3D18B 3SJVA 5DMGD 4U6VL 4PJ8B 5FGBA 4YQXH 1M4KA 3KG5A 3GI8H 2JELH 5CKGA 2HT4D 5ELIA 1ZLUH 3ARPA 4M8QA 1CXLA 3DTXA 2NNAB 1DBKH 2EIZB 1EJOL 3VFSA 1CDBA 1YY9D 3TBVB 2CUHA 4K55A 4NRYA 3KYMB 5CP3A 3QDME 1D6EA 3FONB 2DQEL 4GLRH 1AQKH 5GGRA 3NGBC 3IXTA 4DJMA 3UAJD 4N1HB 4NGHH 2AJUH 1IC4L 2EDBA 4KTYA 4YGAB 3MLTA 5GRVK 3JV0A 3GSQA 3ZL4H 5HYJA 2AV1B 4PJEB 5AZEL 1OAUH 1HHHB 1HXMA 3VRIA 5DR5L 3D85B 4PV8B 3W2DL 1IT9L 3EYOB 4FZEL 1VFBB 3T2PA 5EO1A 3U4BL 1KEGH 4J3TA 3BMVA 1NFDE 4NUGL 4FG6C 2ZUSA 3C8KB 3HPJA 3QNYB 4MCYA 2BRQA 3QQ4B 3EKCA 1ZGLA 2VQTA 4MCZA 3P4OA 4DCQB 3T1FA 3MXWL 3ME0A 3TNNA 3O3DA 5D5MA 1XH3B 2F54E 1MCIA 4YIQA 2WIIB 4IBLT 3U0WH 1BHGA 4CVXA 4ONFL 1WZMA 3TESA 4DGYL 4ODBD 4P2RB 2AABH 4AIZB 4QRPA 1I75A 2MFNA 3TT3L 4YBHA 3I02A 4PLKD 1DEDA 3LQZA 4HUUA 1AO7A 3QUYC 1NH6A 4S1DD 2NZ9D 4ZPVA 4DN3L 3OKMA 3CD4A 1NC4B 4MJ6B 5KSVA 4F3FB 3O6FA 5GGRY 5TF0A 4O58H 4UB0H 4LKCA 5DWUH 1UYWH 5FGBC 4LSVL 4ODVH 3D9AH 3LH2H 4H25B 3BXNA 1T7WA 4FQXD 5MI0B 2ADGB 5T5FL 3PWLA 1S7QA 4HJ0C 4CRPA 5SWSA 3VRJA 1CBVH 2CLVA 2A77H 3WE6A 5TPWH 5IBTH 2MQ3A 4IS6A 1J1XH 4DQOL 1MY5A 3BPCB 1B0RB 4KZEH 3MOQA 5TE7L 4UILL 5CBEB 2R1YB 4PRPB 3TIEB 1ZLVH 1KYOJ 1FL3B 1WCBB 4O02L 5T1LA 1FQ9C 3KYOA 4FXKA 2VLRB 4KRPB 5KVDL 5JMOC 4GMTL 3BAEL 5DYOA 1WAAF 3IJYA 3MLYH 5C0BA 1X5GA 1LO4H 1KCUH 1GGBL 4LCCC 1RUPH 4RNRA 2FH8A 4BH8B 5TH2B 3RKDC 2J12B 2UY6A 4TVPD 3BUTA 5IGXH 2YKLH 4G6JH 2Z35A 1E0OB 3HG1E 2WK2A 5E8NB 3U7WH 3HE6A 4WI5A 3QXWA 2EYTA 3PG2A 5MP6H 1A6AA 1CGVA 3OF6A 2YRLA 1EFXD 2LAGB 3G5ZA 3MLUL 1NDGB 5JR1H 5JPNB 4Y16B 4ZFGL 2EDEA 1RFDH 2OMNA 4K3GA 5IOPB 5HHOA 5B39B 1JGDA 1VEMA 4M1DL 1F4HA 3OXSB 4PRBA 3V5KB 5SWSE 4YDJA 3ZKMC 3R0MA 1CFTB 4S10A 4OI8A 3K1DA 4F80A 1MFEL 2JB6A 1RPQA 1KIQA 3FO0L 4LSUL 5F70A 3JTCA 1HQRB 1X3DA 3BH8A 1JFQL 3EW3B 4KI1A 1G7LA 2B1AL 1YN7B 3PXHA 4MAYC 2H26B 5DEGA 4LLMA 5H2BA 4R26H 5BRZE 5SX5H 3RWGB 1MH5A 4OLXL 4WI8A 3S35X 3K4DA 1GPOH 1FFPB 1S7VA 1XMWA 3X13A 1XR8A 3MV8B 4HGWB 1GZQB 3QQ9C 1UJ3C 3GSXA 3QI9D 4GRLC 4R4BB 4ZFFA 4RAVB 3V6FB 5DD0L 4JO1H 4EOWL 2GJZA 1IEBB 2XYCA 3THML 4UI2A 1RAMA 3NFSH 4YX2H 3NIDF 1H5BA 3AY4A 1ZT4B 4XP1L 3I3EA 3QRGH 2UUDK 3T2QA 4EI6B 4WHYH 3N1FC 5TGBB 1INQB 1MRFH 4HMEA 2FATH 2FJFB 4Y5YC 4NKMB 1CG9B 4BJLA 2NW3A 4CW1A 1GVIA 1FP5A 1U91A 4N0CC 3L9RB 2F53B 4MXQC 3MREA 2QQKL 1DL7H 3AREA 1EHAA 2P48B 3E3QE 3RZCA 5J6HA 1MCHA 4PP1C 3O11B 1GHFH 2LVEA 3QDMD 1EZVY 5CINL 5D7LB 1E4XI 1DVFC 5E1HB 3BT2H 4F37K 5C07E 4KKBC 4DZ8A 5C6TL 1KBGH 3GFUA 1A7BA 1HHKB 2ENYA 3GSNH 5CMAB 4ZO7A 5BXFA 4HG4J 2ICWJ 4KI5C 5DD1L 1C12A 1B2WH 2XI9A 5F8QC 5C08B 1MHCA 1JPST 2JCCB 5EC2A 1I9RL 2A1WL 4WRLA 3UPRB 4I77L 3ZE2E 4LCUA 5TFSL 3ULUD 1EH9A 2EDYA 3WKML 5J7CC 5IVXB 1MI5E 1CK0L 3TZVD 1FE8L 1S5HA 1TQCB 1U2CA 1T21B 3QUYA 4I3RL 3HMWH 3K7UA 1T1ZA 4R2GC 3RDTC 3RKDD 4OF6A 4JHWL 3H3PH 3ARFC 1D6VH 3TNNB 4XNXL 4FQCL 3SDDB 3ZYIA 4Q9QL 2ENSA 2V2TB 3GI9H 1VDGA 1CGYA 2MQCA 2WSKA 4HIIB 3BQUC 3VWKC 2E7HA 2HVJA 2X4UA 3IU3A 4HCRA 2HJKB 4PJCB 1Y6KR 1FNEA 3LEXA 1FBIH 2YA0A 3PXJA 5D1XC 4RGNC 4PJDF 5C07D 4XZUB 1X6LA 2R0ZH 2OP4L 5I16B 1MJUL 1SJVA 2JJUA 3VA6A 5HYSG 4OF8A 1SMAA 4D0CB 1TJIH 1I8KA 4WTXA 5IMKA 3U46A 2E7LC 2KBGA 3T0DA 4I18A 3UTZB 4WTZA 3TT1H 2I5YH 3MV11 2X4TA 5EN2A 4YHZL 3D25A 4CKVX 1A6VH 2CLZB 3MRMB 4WV1A 2VWEE 5A2IH 3TV3L 1E4XH 1N0LA 1QVOB 3DVFA 1J5OH 4B50A 1EUTA 1OAYH 1P7QB 4ONGL 1TJGH 1IC1A 1Z3GH 3DHMA 3L3OB 5DJAA 4NN7C 3B9DA 4ZTOL 3LKOA 1RK0B 4JM4L 3AS0A 1ORSB 3UO1H 5F21B 1XF3B 2KH2B 1RU9L 4QRQB 1T83C 4Z7VA 5BO1L 4PJ7E 5FIEA 4L3EB 5D2LB 4N0YH 3LD8B 2XKUA 5EU3B 5CCKL 3ZL4L 1ED3A 3H0TA 4C55A 1NAKH 3ZT7A 4QHKJ 3IU4L 1R0AL 2BNRE 1U8PB 3KPPB 4C54A 1U8HB 1AHWC 2R69L 4LPXA 5F6HJ 3VXUD 3EOYG 2AEPH 4OZGA 3ZTJG 3WN5B 5HHNA 2O93L 3H2WA 4OCMC 4RIRA 3FFCD 4PJ5D 3T0AA 3WFZA 4PRBB 1P5VA 3FJTA 2W9DL 1BX2B 1BQHA 4ZUVA 4OZIF 5FM4A 5LBSH 3HMXA 4HKBB 3H3BC 3LV3A 5E08H 2FBJH 4P4KD 43CAB 3F5WB 4NBZB 4ERSL 4E42B 2YPLD 3ARGC 2FDBP 2HFFA 1WCQA 1JGUL 4TVPH 1GJIA 1FZKB 3SE8L 3JUYA 3O4LD 4H0GA 1KGCD 3RWEA 2HN7B 1TJHL 5IQ9A 4EIZC 5E5RB 5EBLB 4YAQA 2EDRA 1DQDH 2EXWC 1YEJL 2Y7QB 3IFNH 1JUFB 4RMTA 4AH2A 2GITA 4OCSH 2R15A 4QXTA 3T2NH 5A2KH 4G9DB 2BNRA 1I1YB 1IGIL 3D0VB 3U36A 2PR4L 4G8GB 5C0DA 4LLVB 4RZCA 4OZGE 2QSCL 2Q7YA 3VXUE 2C3HA 3HC4H 3SKJH 3QNZA 5CJOL 3PWPB 1P4IL 5D1XD 2Q8BH 2GTWA 3DMMB 4QHMB 1FZJA 4GO6B 4UILH 4Q58C 2MCPH 4S1QH 2I25N 4Z0XB 1YDPB 2VJXA 2Q8AH 4U0RC 1L6XA 2X9YA 4RAUB 1LE5A 1OT2A 1QOKA 1XIWC 4PJCE 3TBWB 2PXYC 5JORA 4K3JL 5A16A 3QFJA 1I7RB 1WFUA 3GIVA 5SWQB 1C5DA 1A8JH 5IB1B 5JOFB 5DRNB 3IS0X 1LO3H 4PRHD 4CNIB 4JKLA 3LRHA 2C4XA 4YHPB 5GRZA 3NOIA 5HHOD 2QTEA 5I6XB 1J0YA 4XCYA 1NBZB 4JRYD 5BRZB 3OX8A 3S9DB 3L3DA 2DS4A 1JPFA 3W0WD 2DIAA 3UBXG 2R0KH 4LGPB 4XVUC 2D7PA 1NGXA 4PR5B 1X5HA 3TNMB 3BP5A 3HE6D 4P4KA 1I1AB 3PGCB 3MFFB 3NN8A 3CSYB 3IRZA 3QULB 3SKOA 2AI0L 1RIVH 5IW6B 2GK2A 2VXQL 4V1DD 3BP7B 5FDYA 4LEOA 5H94A 3S37L 2ILLA 1GGUA 5J13B 5E9DD 5E6IA 3OR6A 3CFEB 2B1AH 2V2XA 12E8H 3T65B 3MO1A 3KPOA 4WI6A 4WHDA 1OP5H 1HEZB 1JYWA 3WNPA 3QWOB 4LCWD 2DQFB 1X5ZA 4WFFE 4R26L 4M7LT 4Z78A 1NQBA 2DD8L 3KS0H 3CLFL 3IU3B 5E2TL 3HRPA 2W0LA 5EUKA 1NGYB 3SKUD 3MRJB 1QFHA 4JQIH 4JANA 3T1WA 1RZKC 4P3WA 3B9VA 4QF1A 2ATKB 2ZNXA 1OP3K 1Q9KB 4JB9H 3THMH 4LVOB 4I8DA 4TUOA 3WV0A 4IIQA 4BZYA 2VDMH 5FUZH 4MJ5A 3O6FD 3JVGC 1I1FA 1PKOA 4EZMA 4HX1A 5KSBE 2FRGP 5LKNA 1WFTA 5HYQB 5AG8A 1B4RA 3IDGB 4PJDE 4WV1B 3G04B 4N9OB 3V6ZB 3CZFB 3EO0B 3GMNA 3W9EB 4MB5A 5BZDB 1BP3B 1S8DA 1FFOA 1HHIB 2AK4B 3DMMC 2CDGB 3WXVH 5IFHH 5D2LE 1EAPB 4NQEE 5T1DL 4D3CH 3G5VA 2N1KA 4I1NB 4FOMA 5LXGH 3ULUL 2Z31B 4AEEA 5I66A 3PGDA 1KJ2L 2WBWB 1NGPH 2FHBA 1KXTB 1TMCB 2J6EA 5BOPA 3QUYD 1T22A 4S1DC 1JPGA 2BJML 5I2IA 3QJFA 2ZCLL 3QIUB 3KNBA 3CVHB 1YMHA 4PJGE 4HWBA 4IJ3B 2VDKH 2P5WB 4XPHL 3RPIB 3ZHDA 4UV7H 1ZTXL 5H35B 5KZCD 3CAFA 4ONHB 4A2LA 2IQ9H 3HZKB 5D7LD 5TDOB 2H32B 3LSOB 4ORGB 5JA8B 5HXMA 3BFOA 3MNVB 4XX1E 4NYLB 1NFDA 3P4OB 5GISL 4DCQA 4OCRH 1R3HB 2NX5B 5I1JH 4NRXB 1LEIB 1JNNH 4OKDA 5I76A 5E24E 1QRND 3MLSH 2OR7A 4M9PA 4LU5H 4ELMF 2BY0A 1P4LB 3QUMH 4EEEA 4P57B 4IMKA 3P0GB 4P2RA 2DOCA 4QY8A 2DQUH 3UBXI 3H42L 2ZNWA 2EYRB 3KLHD 4ODSL 5C09E 1Q8MA 1KPRA 4UQ2A 2DM4A 3FT2B 3TA3B 3UJIL 1L0YA 3CFDB 1FG2B 2HFEB 4PJDA 3KPQB 3IDJA 1IGTA 1I85A 1OVZA 2EDKA 4HJJL 3GMQB 3MZGB 4YEEA 2R9HC 3IB4A 3FB6B 1FO0L 4M43H 2GTZB 4QXTB 4YXKH 1QBAA 3GBMH 1T7XA 2RGSA 4L8BA 2DQTL 5I8EA 4YHZH 3DO7A 4O5LH 5I8KL 3GKZA 4RGND 2ZCKH 3MRFB 4Y4KC 4JQVA 4L8SA 4HIHA 4J3XA 2VSDA 2IH1A 3CNKA 3EGSA 3GSUB 2DWDA 3MV7A 3HR6A 5IHZB 3B4NA 1IJ9A 1MWAA 3BEWA 1IGMH 1CFQA 3B2VL 3C5ZD 1J1PH 5HBBA 4MJ2A 4RMQA 1DBMH 1UA6H 4FQJL 4N5EA 4Q6IC 3G6AA 3SE9L 1T4KA 4KRNA 1UQSA 3RBSA 5HHPA 1ZVHA 5IFAL 3F12A 3F7VA 4RDQG 5K93A 4N0YL 2Q7NA 4XMKL 1DN0A 4JG0H 4MA7H 1CIDA 3VGGA 4OFVA 1BQLH 5JDSA 3FB8A 4KUCD 5ACLA 4JFXA 4N68A 2VL5A 1FLRL 4GXVL 2H8PB 4FQQB 4AM0B 3QEQE 1IL1A 4JG1H 4JPVL 3TNMA 3P4NB 2BP3A 1MCEA 2R0WL 1OOAA 4D9QE 4R96B 4FQLL 1U92B 3QULA 4YQXL 3WIHL 4WU7B 5GS1C 1G7LB 1QRKA 1JWMB 4QTHA 1DBKL 3OKYA 3I75A 1UM6L 2YD9A 5DJDA 3MBEB 1F58L 5FDWB 5GIRB 3C8HA 3QCVL 2DQEH 5T3ZH 1DVFD 3HZVA 3SE8H 4N90D 4KKBD 5EZLB 1ZLSL 2I9LA 1NCCH 3RHWK 4M1GH 5D9SB 1SEBB 4L4VB 4JAMA 3REVA 4OCSL 4MS8C 3HB3D 2ID5A 5AZEH 1H15B 5FGCB 2KUTA 4KZDH 4M1CC 4NN5C 3ZO0A 5TQ0L 5GXBB 4YNYA 1CDUA 2QSCH 1A64A 3QT2A 4ZXBD 4NUGH 2IPTL 1CG9A 4YHIA 2J6EH 3FONA 1U8JB 4X6FA 4O9HH 1TZIB 4UUJB 5HYQA 4PRHA 5LCVH 1DFBH 1U3JA 4MD0A 4D94A 3T1FB 1MRCL 2IAMC 4XGZA 2AQ1A 3KWWA 1AD0B 2C7UA 3PV7A 5SWZA 4XCCH 3ZSSA 2X4OB 4J3VA 1Q94B 1DUYB 1P69B 5FHAH 5J9PB 1ADQA 1NCBL 3VFPB 1E28A 5SV3A 3D5OF 2AABL 4PV8A 1KF9B 1UENA 1YC8A 2C4FT 3IDIA 4K94C 2VXSL 1QSFB 2AP2A 1UVQB 5BV7H 2OCFD 3WNLA 4PJFB 3KPSD 3ARQA 3HLAA 4NWTL 2HKHL 1UXWB 1L6ZA 2Z93A 3QJFB 3E3QA 4OF0A 1FNSL 2X4QB 4QRRE 2BVQA 5FKPA 3OAYK 4IMKC 1BGXL 5F71A 2W9EL 4J12A 1NMCC 3RQ3A 4CVZB 3ULUC 5H35A 3CXHJ 4LCIL 5HHMA 3DNKA 2NY3C 5KVGH 2BSED 4UIMB 32C2A 4I5BA 2VXQH 3DPBA 2Q3ZA 3BGMA 4FZ8H 1D5XB 3AU1A 2LVCA 4CADB 5EB9A 1CD0A 1PKQA 1G9MC 5JUEH 1FV1A 2ICWA 5F9OH 4LARL 5KS9B 3V8OA 5HJ3B 1HSBB 2Z4QA 1A3LL 5HD8C 1H3XA 4WW2A 1F4XL 3STBA 1LO4L 5DA0B 3W5NA 4EXPX 2JJSA 3GGWB 4L8SC 4XBEH 3BGFC 4OIAA 4YHNA 1HYSD 4EUPH 1B3JA 5GGSB 5CJQH 4P3DB 2ICWI 1QFWI 4XPAL 5JXAH 1J05A 5MERB 4Q9BA 5DVLA 4AY0A 4OCYH 3IDYB 4PRPD 2ADJA 1BD2E 1WISA 1WZLA 4HS6B 1GAFL 4EI5B 1TCMA 4OLEA 3JWOH 3CH1A 1OHQA 1TETH 4EXKA 2CO6B 4XPTH 4PJ9D 2GJ6D 4JRXB 4S0TD 3GB7A 4NHUB 2BVEA 4OFYD 4G8FB 3EJZD 4BFIA 4F58H 4JR9H 4L3CA 4U1SB 3QDJE 3VG0H 1T20B 5J56B 5D93C 1FSKB 1JCKA 3B3IA 5LXGL 1WAAE 3I6KB 4CU8A 1OGAE 4PGDB 2NY3B 1KB9K 4R97B 4K8RL 4I0PD 3E3QC 4NWUH 3C5SB 5DT1H 4R4BA 4J2XA 5GRUH 1AR2A 1XCTB 4EOWH 3TIDA 3C6SB 3QP3A 1T89A 3CFKB 3GIZL 1LO2H 3MGTB 3TBYB 2IFGA 3DECA 1S7WB 5J6GB 4OLUL 3FFCE 4HJGB 1TFHA 1MRFL 2WLZA 1YN6A 1WBZB 1YECL 5AD0B 2GCYB 5I1JL 4K71B 3C5JA 4ZO6A 2NR6C 3VE0A 2NW3B 3LV3B 2HAZA 1SJEB 1U8QB 1IAIH 2MOVA 3QIBC 4PGCB 4PDCE 4P46C 1AE6L 3QUML 4P4KC 2UV3A 3AM8C 2DMBA 4IHOA 3I75B 4NOBA 3QSKB 1C7TA 3PQYE 2WV3A 3QDJD 4ODSH 3TO4B 3QDJA 2XQBH 5F9WC 4EI6A 3MC0A 3WFBH 4DZ8B 4NT6B 3BRGC 3S35L 2I9LB 2DQIH 4OM1L 2AJVH 2Z8WC 3HS0B 2UWEA 3OL2A 3QCUH 2CIIA 3FO2A 4WNQB 1ROWA 1MEXH 2Q7YB 5C9JB 1ETZA 4Y4FC 2IJ0C 3REWB 4FNLH 3RL1A 3HZMB 3FFCA 2H2SD 5I9QC 5D6CA 4NZRL 2VYRE 3QUXB 3DRTA 2BDNL 3MRQB 1QPPA 4LLYB 1MLBA 1Q9OA 5FYJH 3TBSB 4JHWH 2VDPH 3BMWA 5D8JH 1DBML 5IWLA 4N8CL 3SE4A 4PP2B 4WWID 1I7RA 2PXYD 4F7EB 2D7QA 5EOQL 4JM2D 4MA1B 4HLZG 4TOYH 4M7ZC 3VCLA 5GZOC 3NZHL 1NC4D 4YHYC 3NA9L 1NGQH 5CEZE 3TFKA 2NCMA 5D70H 5DUML 5EOCJ 2OK0L 1U58B 5J12C 3J7HA 2AV1A 4PJEA 3W2DH 3E6HA 5L7XH 1UM5H 1WICA 1QFPA 4KI5F 3HHRB 3VXSD 5F88A 3V0VA 1RJLB 1Y6MR 4YDKL 5DMIL 5KVMC 3WFCL 1YY8A 4X5XA 1HNGA 1KC5H 4PV9B 4QHLA 5E1AB 1TJGL 2EE2A 4MCZB 2HT3D 4J4PD 1RURL 5E9DE 1IILE 4KXZI 2OTWB 3LRSA 2NY6C 1IQWH 5EBWA 1EMTL 4FQHB 2NY5H 2DLHA 5J11B 4HC1L 1CDCA 3MYJB 4HWBL 2WIIA 1ORSA 4JQXA 1L7IH 3OAZK 3V4UH 2A6DB 5EG6C 6CGTA 2X4TB 1WGOA 3LKSA 3OB8A 5DD6A 5F7DA 1XR9A 4I0CC 1JPSL 2HLFC 1CICA 4FQPA 3O41A 4LRNL 3ARTA 1A6TB 2ERJC 1MAKA 1QNZH 1UYWL 4ODVL 1LK2A 3QDGE 2P8LA 1MFCH 3NABH 4WGVB 1YMME 3PWUB 3RUGF 1TPXB 4HWEL 3GMPA 1VFOA 4KQ4H 4L4VD 4R90L 4ODTH 3BXNB 3TJHA 3O3UN 1V8HA 4M6AA 2OI9A 3SKNB 5EZIH 5EU3A 1VFBA 2YD1A 5LWYH 1U36A 2WANA 4M6ML 5JW5B 5HHOE 1VGKA 3U7AA 1NCBH 5J8OA 1I4FA 4JQVC 2PYEB 3QQ4A 5J57B 3Q6FB 4BYHA 3UPAA 3LPGA 3BRFA 3B3IB 1LDSA 4PG2A 1JHTB 5IGXL 3Q5YA 5JOPE 1RJZB 2DMKA 3HI5L 4G6FD 2Q76A 4UZGA 1YJDH 4LAQH 2GT9B 1T04A 5F9JB 4JM2A 1XH3A 4OAWA 5HI3D 2PW2B 4M48H 2EEBA 3N9GL 4HDIA 4TSBL 2BNUB 1G7QB 4X5LA 5L9DL 1QLEH 1JGDB 2QQNL 4HBCL 2K3TA 1T5XA 2EDQA 3D3VB 1MQKL 3P0YH 5D1ZA 3BH9A 4KJYB 5B21A 3ZE0E 1FL6A 4HSQA 3BUYB 1C08B 1HHJB 2BNRB 3T4YB 1CIUA 2Q1EA 2X10A 2XG5A 4MAYD 3SDXF 3MSPA 5IKCA 5FM8A 2OL3B 4ISVB 5DI8B 3W11C 3VXRE 4K3JH 5F9WB 3RUGB 3SBWA 3EYQD 4MX7B 1Z6JT 1J0ZA 1FJ1B 1KG0A 5C6WH 4AL8L 4M3KB 1LO3L 3INUH 1ZHNB 3ZKXB 3ZDYE 2IG2H 1VA9A 3QDAA 4YHLL 3T4AB 1WCBA 3NFSL 3CU1A 4YX2L 1MCPL 4H8WL 4XPAH 1JPFB 5T3XE 3O8XB 1OGAB 5CBEA 3KXFE 1WBXB 4RISL 3IJYB 5EPMB 5LAXA 3TN0B 1MI5B 1A6WL 3G5XA 2J7LA 5E00B 1ZT4A 5C0ND 2D4FA 2J8UE 5GRJH 9CGTA 1UC6A 1NLBL 2H3NB 3C6LB 3BIKA 4TRPH 3F7YB 3U9UB 3WIIH 1QA9B 5IHZA 5BZWB 4FP8L 2H26A 1TETL 4KVNH 3U1SL 3JTSB 4MQ7B 2JJTA 4JHZA 4NQDB 1U41A 4D8PB 1WC7A 1MH5B 5IOPA 3D85D 2F53A 3QWRA 4OF3A 5DHVB 2XRAH 3MUJA 2XXMB 5CINH 4M7KL 4U1IB 2A73B 3NACH 1I3RB 3RTQA 3KLAB 5B39A 4S2SA 4KVCL 2EKSA 1HQRA 3SGJA 2X1XR 5E8EA 4YHML 1SJHB 3FHAA 4F7TB 5DT1L 4JANB 3QNXA 5FYLD 1VGEH 3UROR 3ZYZA 1CGSL 4G6FB 4XCNB 1KLUA 1RJYA 4GKOA 5I15H 2BVPA 4Y89A 4AM0A 1EIBA 1CTNA 4IOSD 1N4XL 5J06A 3MV9E 5GGTA 2N7AA 2F8VA 3QWOA 1L7TH 4NBXB 4X6BA 5HGHB 2AJ3A 1BOYA 3TM6A 4P5MB 3TPUA 1KENL 2YR3A 5L8LB 5C08D 4X5XB 3BDXA 4H1LB 4APQB 1KJ2B 3KYNA 4NQVB 4YE4H 2X42A 3LQMA 3LY6A 1Q9LB 1AKJA 2R4SH 3DV4B 3VXOA 2AKRA 1U3HA 2NMSA 3G5VB 1GGCL 3G08A 4GKZA 2Y5EA 5FKAA 3QUMA 2DQIL 3N1PC 2BJMH 1T22B 2BOBA 4Q0XL 4UNUA 2I07B 4YFEA 1N2RA 1E27A 2KQNA 2Y36L 2LV4A 4BZ1L 4X9FA 1T21A 5DEZA 4XPBL 2G2RA 3TV3H 3V0WH 1AGCA 2BVOA 2IBBA 4Q2ZB 3PJSB 4WHTB 4UT9L 1MLCA 3FQRA 3MLSL 3QZWB 1T2QL 5EC2B 3FQNB 5E6ZA 2VDPL 4ZOCA 3NFNB 3VFMB 3D39B 4CMHC 3CXDL 4X99B 4N0FB 2E5EA 5FA3B 3P73B 3X17A 3O2DL 2BVTA 3B83A 1VFAA 1P4BL 1OARL 5ISZE 4RWYH 5EIIB 1LEIA 2CDFA 1LO0H 2OK0H 3QG7L 3O9WB 3PHSA 4YDLB 5IV2A 3STZB 1JWUB 1BF8A 1A4JB 2EH7H 2PTTA 2C26A 2X09A 2ITDB 3D39D 5EA0L 2R0LL 3U7YH 5A40E 1RHHA 1XGPB 4UDUB 4G8EB 5C9KA 3Q6GL 4XNMB 3BO8B 4O5LL 3D3VE 3KGRA 5DTFA 1WAAA 2ZCKL 3BSZL 4HGKC 1C8PA 1KCSL 5D6DC 4HPOH 1CD1A 1NEZB 4FA8A 1F4YH 1MHEB 4DVBB 4PS4H 2YPKB 1IGTB 2VABA 1D5MA 1TIUA 5E8NA 1FH5H 4J23A 1PZ5A 1IQWL 3VXRB 4BH7A 4ERSH 4OD1L 3WNMA 2WMPA 1JGUH 3O45B 3CDGA 1A4KB 4PJBE 5DRZB 3CZJA 4M03A 5T3ZE 3AB0C 3ZHKA 4HS3B 3GGWA 4XBPB 4M61A 4ZAKD 4N0CA 2WUCH 4M8QB 4OD3L 4NGHL 4E5XA 2VIRA 3GMRB 1CT8B 1FYTD 3ARGA 3RPKA 2JIXB 1MFNA 2RJMA 3FQUA 1B4JH 5JDSB 1OSPL 3FRUB 1VPOH 2A6IA 3OPZL 1DVFA 5DQJA 1T2JA 1KEGL 5IG7B 1N8ZA 3QFJE 4CAGA 1MCOL 1HH9B 1YA5A 4QOKB 3S4SG 2WWKO 1K3ZA 2VQ1B 3MRBA 5GGTH 4E41B 2QR0A 4YGVB 4M5ZL 3LKPA 1HHHA 2O5YH 4KY1L 2P5WE 5CZXC 4H88L 5EU5A 1T66D 4M6MH 4YWGH 1NCDL 1SY6A 4PG9B 4UOW1 1DJSA 1E4WL 5DJ2A 4ZFOA 5DMKA 3QPXL 1DSFL 2A2QT 2FJFA 4M1GL 5EZJA 2QQLH 2JK5A 4I0PC 4LVOC 5GSVB 4QWWD 5ITFB 5ID1A 1ZHLB 2VZ1A 1V7ML 1F42A 3IAQA 1XGTB 5EFIA 1ZHKA 4DKEL 3DVIA 1W8NA 3N1MC 4YXHL 3L3GB 2XY2A 5FYKD 2B1HH 5KN5A 1DN2A 1YNKH 1YYLL 2A9MH 3ZSTA 5FO9B 4OI9A 1D9KC 3G9AB 3IDNA 3ELAT 2Z9TA 3IFPB 3HCVB 3LEYL 2OZ4H 2VXVH 3KXFB 3CLEH 1MQKH 1CLYL 4YEFA 5KTEL 4ENED 1A14H 3NCMA 3QDMA 3RI5F 4MYWB 1XT5A 1KOAA 2P45B 2W65B 1IKNA 2DM2A 1U8KA 4HUWB 2FD6L 3E2HC 3PWLB 2Q6WA 1I3GH 5ITBH 2ICEB 5IR1B 2HT2C 5D1QB 3VD4A 4BELD 3R06A 2X4NB 4DAGL 1GZQA 5KSAC 2WUBH 3BZDA 3IXTB 4AL8H 4Z78B 1JWSA 2XWJB 3INUL 1GYAA 2R4RL 1LE9A 3TYGL 3HTLX 1C7SA 1PLGL 4IRSD 4X4XB 3S6CA 1Q9WA 1M05B 4KKNA 2UWEE 1FNSH 2DDQH 3O3BB 5JR1L 3IETB 3SKOB 5MEQA 2AJXL 5F7KC 4Z7UB 1J0KA 3TO2B 5J3HD 1E27B 3O6FC 2O5XL 4AENA 4PJCA 4EUPA 4G9FD 5BW7C 5JW4R 3EUUA 3VFGH 1F4WL 5FCUH 3PQYA 1EEZB 5CGYD 4K71C 3BVNB 3BGFB 2NXZC 1XIWA 1ZA3B 3QQ3A 4KTDH 3AGVA 4FZ8L 2BVOB 3IDGA 1D5XA 3AU1B 1K5NA 2LAAA 5GS2H 1JYNA 3DETD 3GJFB 3X3FL 4UT7H 3QPQD 4XHJD 3IGAA 4LPVA 1KEMH 3MYZA 4Y0GA 1AGBA 1NGWB 4K3HA 5T1DH 1HXMB 3UP1A 3X14A 3WJJC 3FN9A 1X9QA 3QQ9D 4Y2OA 2QADD 1Z0NA 1LK3L 1QQDB 5MENE 1L0QA 3TGXA 1HHKA 2EE6A 1PY4A 3MJ9L 5J1AB 4CU7A 2FHFA 2ZKHH 4UTBL 1TVHA 4I48B 3BYYA 5DD0H 1RMFH 1S9YB 1L8JA 3MV8E 1FVCA 4M4RA 3O8XC 2BOCA 4XPHH 4WY7L 3O9WA 1CR9H 5FV1L 1RIUH 5KS9E 1G7HA 4O00A 1VACA 4YUEL 3KS0J 4JCMA 3GMMB 3FB7A 3KJ4B 4RGNE 4XXCA 1GAFH 5TDOA 5INCB 1IEBA 1S7QB 5ANME 5EBGA 3PF2A 2ARJQ 3K3QA 5D7IF 4YXLL 3LKNA 4U3HA 3P11L 2QQKH 5HSFA 2XV6B 4HUVA 3MYJA 3MRRB 3NFPB 3IDMA 1XGQB 2VUYA 3JV4A 1AFVH 3RWDB 4HD9A 1T3FB 3NCYP 1BD2D 4PRIB 1WZ1L 2DB8A 3AUVA 5EUOA 3EDDA 4WFHE 1OD9A 2P1YA 1YYML 4KQ3H 2FJHA 5D1ZC 1FNGB 5IB5B 2EZ0C 4WJ5A 3V2AR 4Z7WE 4NFDA 4B41A 2XT1B 1BX2A 1I8KB 1S5IL 4HLZH 1H3UA 2PYFB 4U6XA 1MCWW 2X9WA 2GY7B 4PUBH 3VGHA 3EO0A 43CAA 4P5TC 3MNVA 3R8BB 4CVXB 1KPUA 4WUUB 4PJ7A 2RR3A 1IM9D 1KELL 1RVFL 3KPLA 4NQEA 2AK1L 4BUGA 3ZHLA 4XC1H 4OBRA 4UT9H 3KNBB 1INDL 3V5KA 2BC4A 4DK6A 1JFMA 2BSSA 4KMTL 4Y19E 5KVFL 4HMCA 3R1GL 4BH8A 5CWSA 5IMMA 1FPTL 3LKPB 1YEFL 3EFDL 1BAFL 5HYJE 1TQBC 2R1XA 1JZ3A 1OAQH 1WWWX 4DKAA 3PQYD 4WEUD 2IC2A 2NW2B 3V6OE 3ZDZF 5D2LA 4ZS6C 4A2MA 4EDXB 1Z5LB 5DEFB 1BREA 3Q1SH 3IJHA 1OF2A 1UADC 3S5LG 1FVEB 1J1OH 1AO7B 3GKWL 5EULV 3RKPA 2UWEB 5I0DA 4GH7B 4TPRL 4QY8B 4O4YL 4Z7QF 3MRHB 1MEXL 4HPYH 2I5YL 1AXIB 2FGZA 4GBXC 4PLJD 4YLQT 4RAUA 1AI1H 2AERT 3QO0B 2DICA 1LEGA 1BVZA 1GIGL 2QKIB 5AUMB 3BEWB 2Z92A 4K3DL 1K8DB 1K4DA 1MCCA 2EYTB 1X5YA 4G5ZL 3ERYA 1U91B 4KUCF 4I18B 4XCYB 1UM6H 3BKJL 5INDB 3B8SA 1QEWB 2VLME 3A6BH 5E4EC 1MJJB 3HPLA 1I9EA 1ZLWH 3BPNB 4L8DB 3QDMB 3O11A 3S88L 2CMRL 2VLJB 4EN3C 1QSFE 3ARXA 4NQSA 3MR9B 5GS1A 1PEZA 1GRWA 2VR9A 3QIWD 4OGZA 1ZMYA 1FORL 4QRTA 3MODH 3QA3A 1JUFA 4JFXB 1IZJA 2FJGB 3RBGA 2DBLL 2OSLB 1G9NL 5AWNL 2XTJD 3BZFB 4HUXB 3T3ME 4G8GA 1U3HC 1BZ7A 2WWMC 3UJJH 2A6JA 3BWAB 1AGDA 2C1OA 4Z7VF 1MFAL 4WUUD 5L6YL 2YUVA 4WDIA 3QXUA 2W07A 4YPGB 2CDEB 5IVXA 3CFIC 1KC5L 1DN0B 4Q97A 1CICD 3MLZH 3LS5L 4QHLB 1HILA 2UZIH 1MRDL 3C5ZB 4XCCL 1CDJA 2FX9L 2BFVH 3MRLA 1JHLH 5M94B 5C0CD 1Q72H 3DV6A 5E2WH 5AZ2H 3H9YA 1N7ML 1E4WH 2J88H 1PVHA 3NIFE 1NPUA 5E2VL 3E6HB 2E7BA 3CUPB 5C0CE 3TLRA 4L4TD 5GJSH 5BV7L 1UCBH 3ARSA 3AREB 4OZIA 2OJEA 4OTXL 3M45A 2IPUK 1P53A 1X44A 2ZUQB 3MRNA 4XC3L 5L2KE 4MJ4A 4GG6B 1EXUA 4D0CA 2AK4A 4ETYA 3O3AA 3IXAA 5I8OH 3V52H 2K1MA 1W72L 5IQ7H 1EAPA 2R56L 3ALPA 4PRHB 5D7LA 2IGFL 4X6CB 3SKJL 4DN4L 4UU9A 5FB8B 3CC5A 1INQA 2P47B 3T77A 1N26A 1BFTA 1H15A 1YEHL 5JUEL 3JSSA 5EZIL 4GMSL 3OGCA 1PX4A 5I1GH 2MSPA 1TCRB 1VESA 2P24B 1MHHA 3F7QA 3IF1A 3UTQB 2JCCA 1A5FH 2VZ3A 4PB0L 4I4WA 2APFA 2FD6H 1JGLH 2Y23A 4NKOB 4YNYB 5TDPB 2H32A 2NY4C 4TTGA 1UB5A 1NGYA 5HD8D 3PABB 4GFTB 3FFDB 1OD7A 3MCKA 4QF1B 5CGMA 1NCWH 3ZKXC 3SDXA 4N8VA 1AP2A 4K9EL 2DQCH 1P7QA 1HKLL 2IADB 1MPAH 1YC7A 3V5DA 3GUTA 4W81A 3DI3B 4JY6A 5F7EL 4PJBA 2AK4E 1A02N 1PGRB 2HT2D 2X89A 4NN6C 1ZGLM 3C6LD 5EU6D 3S3JA 4HHAB 3VFGL 5ETUB 3WN5A 3QFJD 4CVWA 1U8MB 2YD8A 2YPVH 3EFFA 3QIWC 4XZUA 4JFDB 4YHOL 2NY2B 5I1CL 4M7LH 1R5VB 1SY6H 2E9JA 2YD3A 4YK4C 3VXMB 3K4AA 3FO9A 5IIEA 3LN5A 3HE6C 3MUGA 3GM0A 4LVEA 3SCMC 2Y72A 3C8KA 3QNYA 4MCYB 3HE7D 3EOAA 1AO7E 2MPAL 5ID0B 3SGKA 5TE6L 4NWUL 3RIAK 3EDFA 2AQ2A 2ZKHL 2OR9L 1KACB 3WKNA 4LCYB 1A2YA 5CP7B 2NZIA 4LLQA 1UWEL 2WIMA 2JB5H 1F8TL 4NQUA 2P5WA 4U1JA 2FECI 2D7TH 4IRZH 1DQQB 1BZ9A 2AJSL 3D3VD 2XKNA 2VITA 2PKDA 1EJ6A 3FT3A 5JXED 1A6UH 1A7NH 3ARWA 4H20L 3GSQB 4GS7B 1X4YA 2B20A 3DX9A 3PE9A 4XMLL 3B9KC 1SBSL 1KN2H 2EIZA 3MJGX 3OHXA 5D71L 4GAJL 2QSVA 4YXLH 1IC5H 1AE6H 4M6NH 4F2MB 4ZNCD 2DKMA 4P46D 2IANB 2P5EA 3HB3C 4NIKB 1SMOA 5EOTB 1SEQL 4QHUA 1RZIB 1J05B 3FT2A 3UTTB 3QIBA 3P4NA 4ZAKC 2W91A 4E5XB 3S35H 3AM8A 3QYCA 1S8DB 3LB6C 2ZCLH 2HFFB 2R2BA 3ILPA 2PF6A 1T20A 1YPZE 4MGXA 3C2SA 1ZTXH 5F7LB 4RFOH 4R7NB 5F6IC 3BZFA 2M1KA 3TJHD 1QHOA 4Y5XC 1FGNL 1VKXA 3IS1X 1LE5B 1OAXH 5GHWL 3ULVC 4WDIB 5DVOA 2BDNH 1K8IB 4NSKA 1I7UA 1NAMH 1F5WA 4R8WH 4ZQKA 4X8JA 5IB1A 1FL5A 5JOFA 1VADB 1FPTH 1JHKH 1ZXQA 2X7LB 4PJ8C 3JZ7A 3BD3A 5GGVY 1BAFH 1D5IL 2R4SL 4ORGA 3PWPA 5C0FA 3BZEB 1BFVL 4WENB 5ACZB 5F9AC 3BEVA 5ALBH 4PP2A 3RX7A 2GTWB 3DMMA 1S7SB 5DQDH 5KG9B 1HWHB 1JZ4A 3BDYL 5I18H 1Q1JH 4UIKL 1XGTA 5B4MC 3L7FB 4HF5L 2PTVA 4UQ3B 4Q0XH 1A0QH 4M43L 2Y7QA 5ESQA 5HPMA 4O4YH 5C0BB 3KYNB 4NQVA 5TGBA 5I30H 2GAZA 3VFPA 2DLEA 3TA3A 2FLBT 4RGMC 5EU7E 5HVWA 5MI0C 5DMIH 4DVRH 2C3GA 2XA3A 4ODWA 4XAKD 2G5BA 3V0VB 3PJSA 3RNQA 4RAVA 3V6FA 3WUWB 1BQSA 2CIIB 2NXYC 2X40A 4ODHL 5EH1A 3MV8A 4HEPG 4HGWA 4TSCH 4JZOA 3ARUA 4DZBB 3WYRA 4HC1H 1Q9KA 1W0VB 2P7TA 5J11C 4NQED 1AQKL 5CSZA 1L7IL 2ZG3A 4NN7B 5BVJA 4FG6D 4BFBD 3HFMH 5JDJA 5JXEC 3MODL 2XZAL 1FFNB 4A6YH 4FABL 1FC1A 1ZS8B 2VDLH 1MCWM 4WU5A 2GSIB 3I84A 1HIMH 5C0RL 3QIUA 1N0XH 1JF1A 3UYRL 4CUCA 1DCLA 3DROA 2V9QA 5GS0C 4GRWF 4QRRD 3X12A 5E5MA 3VWJD 1PW3A 2WINA 4HS8H 2V7NB 3ESVF 4ZPTB 4DW2L 3HG1D 3MV8D 3VI4F 1CFTA 5E1AA 2G5RA 4ALAH 4XP4H 4R90H 3EO1B 1T83A 4PJ8A 1MNUH 1UACH 3RGHA 3BP7A 2CR6A 2F19L 5H94B 2YPKA 1W0YT 1WIUA 2BFVL 5IHLB 3U0WL 4OJFH 1DQJB 2VISB 3RTQD 3OXRB 2GYSA 1KB9J 1Z2KA 4HWUA 4L9LA 4DGYH 5FA4A 4XP5L 2XWTB 1GL4B 1IBGL 5F7MC 3MLRH 5T3ZL 3G6DH 4HH9A 2PYED 2YC1A 3LD8C 5EOCL 2BNQE 1MREL 4FXGB 4KJPC 4DN3H 4LPUA 4OTXH 2XA8H 3K4ZA 3T08A 4M1CD 3RL2A 2DLFL 4QTIL 2ATKA 4UDTB 3MBEA 4X9GA 3EYVA 1U8OB 2YWZA 3P0VL 4KZDL 5JOPD 4X4ZA 3VJ6A 1DEEA 4LRIA 2ATPA 1UCTA 4LSVH 2R2HB 3DGGA 2EYSA 2H9GB 3PNWB 5DGRA 5ENWB 2D7NA 4NQCD 1R5WB 5DJ0A 2IAND 4Y2DA 2XIDA 4GW4B 2AXJA 3B2UD 4YZFE 1GZPB 3TZVA 4GW1A 4JDVA 4MVBD 2ICCA 3FTGA 2R1WA 4H88H 4D0BA 4OSUL 3ZZ1A 3I6LD 3MV7D 5GS3A 3P77A 4PB0H 2W0FA 3UYOD 1A6AB 3WL9B 4GMTH 2F5BH 4U1HB 4G3YH 3WFDL 4JZNB 2DQHL 5E6YA 4CL7A 2YUXA 3QIBB 3TJEL 3MNWA 1N59A 1IGYA 3WS6C 3QXAA 4K9EH 1U93B 3LKRA 3MV9B 1U6AH 5KSAB 1CE6B 1M71A 2V2WB 5IROC 1XGYL 1BGXH 2ZUYA 3DIFA 2GW5A 4PRNA 3SY0A 3VFNB 5H2BB 2EDFA 4LCIH 4OFYA 4JZJA 2XZZA 4IOFC 5MEOB 3H9SB 1FHGA 1X5LA 2PXYA 3LPWA 3HLAB 1A3RH 3F6IA 4GRLA 2VXVL 1NEZG 3GMQA 3T2OA 4TYUA 1JFQH 1ONQB 1JP5A 2FHCA 1HINL 1BOGB 4XCEB 2V2TA 3X11B 1U8HA 1AGEB 1BVLB 2BSTB 4X8XA 4PJCF 5F9OL 4PG2C 1VADA 5HDBF 1HZHL 1XGRA 5F9JA 3S4SA 3ZE2F 3NIFF 2BY1A 1C5CL 4TVPE 3BJLA 2VL5B 2NY3D 5E8OB 3FN0H 4BKLB 1Z9LA 4ZG1A 4D9RD 3LVEA 1BEYL 4CVUA 3QISA 2VRAA 1W72B 35C8H 3LKOB 2EDOA 1QLRB 1F8TH 3WIHA 4Y8DC 5C6PB 5EC1A 1SJHA 4Q7DA 2MKWA 2XTJC 2ZPKH 1IRAY 3UTPE 4XP1H 4F7TA 2R8SH 4HEME 3O3EB 2OL3A 5DI8A 1ZT1B 3OG4B 4J8RA 1S7UA 2GHWB 4PJIE 4OGAD 1DUZA 5AYQA 3QEUA 4HCRH 1BWMA 1F00I 1H8NA 4HAGA 3PQYB 3AMKA 3LZFH 1KCVH 4P9HH 4C4KT 4K3EL 4X4MA 3NMEA 3RP1A 3SBWC 2WLYA 1K4CA 1TITA 3Q3GA 5F8RC 5BXFB 4JKMA 5FYJD 3MJ9A 3ORJA 3AS3A 1I3RA 4UT7L 5L2KD 1PG7H 3SCMB 1IVLA 1RZGB 4LLDB 1JN6A 1FAIL 3VG0L 1UT9A 1U8LA 4U4BA 2H3NA 3C6LA 3LOWA 3KJ6L 4OF5A 1WT5A 1JTPA 5KSUB 3V4PL 1LK3H 5BVJB 2COQA 4LQFL 1S9XA 2FO1A 3PV6B 3BJ91 4X7CC 2VKXA 4G9FB 1P1ZB 5IF0B 3V6BR 3EDJA 3K74B 4WVRA 4PJ9C 2ADFH 5I1HL 3NCYS 1KJ3L 3QEQD 4WY7H 4PJGB 5ALCH 2JJSC 2FWOA 4BZ1H 1IM3A 4JREB 3U9PH 3P9MB 4XPBH 1ZSDB 1QFWM 2C3VA 4HMDA 1E28B 2EDXA 4HIEB 3MROB 5F3HB 4P5KB 5HHQA 1KIRA 5IVZB 1Q9OB 2GQHA 3IVKB 3ARDA 3C6SA 4LP4A 3TCXA 4CDHA 4YDVB 3VXTA 1LQSR 1OSZA 4G8GE 3KYKL 4NC2B 1PYWA 4DGVH 5IB4B 3VXUB 4X83A 4P9MH 2Q3AA 4PJIF 3GJEB 5IM7B 3JV5A 5B39G 1FZOB 3HZVB 3MPCA 1BM3H 4YC2B 1NMAL 3T0ED 4HFUL 3QEGH 4IHOB 4JAMB 4PJEF 3M1BA 3WBDA 1QHPA 3TN0D 5I75B 2OM5A 1XF2A 2BERA 1U3HB 3WO4B 4WI9A 1OGAD 1I9IH 4ESKA 3BZ4A 2VB5A 3DV4A 3P30H 5FKAB 3LQAH 2PO6C 4IRJA 3UTOA 1CN4A 3IDIB 3LCYA 3KLSA 4XP9H 3OX8B 3VI4E 1J5OL 3GMNB 3W9EA 5MENB 3I9GL 1JPTL 1EPFA 5LGHL 2Z8SA 1OPGL 4OZIE 4KJWD 1IGJA 1LILA 1V3KA 4Q6IB 3NCEB 5EU6B 3RA7L 4X7DC 2LFGA 1JTTA 3O6MH 4G8GD 1ZGLB 4XWOD 3FQRB 3T3PE 1UKSA 5CD5D 2SEBB 4FQ2H 4NO0A 1FFQA 2XZAH 4CGTA 4LDLB 4U1NA 5IB2B 5D70L 3B6SA 5D7JA 1PKQB 1N0XL 3B5TA 1ZGLP 2D0HA 3FB5B 4UTAL 2GK0B 5GS2D 3OPZH 2P5EE 3BUYA 1U42A 2I9TB 5JIHA 1BBJA 4PRPE 4KHXH 1FNHA 2FX8H 1J8HD 2X4QA 2ZJSH 2F58L 3T0XA 2W0PA 3QJHB 4BFIB 2N56A 5IESH 3EOTL 5D72H 3S5LB 3SGJC 4CVZA 2VO5A 1WJ3A 4K3DH 5EU4A 4MXWH 3DYPA 5LBSL 4OZHA 5FECB 2ARJA 2FBJL 1YEIL 2L0DA 4LSPH 4Z7QE 4YWGL 1MFBH 4R4ND 3MOBL 3H7LA 2EECA 3HC0A 1QFUH 3EHBD 2NY7L 2E6JA 1NBYA 4NJAL 3RWHA 3TN0A 5HDQL 1MCRA 3CFDA 1AC6A 2HFEA 4PJDB 4WIQA 4WO4A 1DP0A 2YPLA 2WP3T 2Z91A 2VLKD 4QO1A 4LCYA 4AEFA 2HFTA 3P40A 4G42B 2QHRL 4WEBL 1CL7I 5GGUA 1MJ7H 2QHLA 1V7MH 3HR5B 1FL3A 1G9NH 2ZSVA 5GSVA 3BPCA 1IQDA 3E6FB 2E6QA 4JEGB 4WTZG 2DTSA 3WO4C 1R6VA 2AJYL 3B8YA 5IB3B 3HC4L 4LIQH 5CLTA 1CDYA 4B0MM 5HVHC 4YBLB 5HYSA 5CJ5A 3B9KD 1IAIM 4RGNB 4H25A 2EKSB 1XCQB 1EO7A 1EHXA 5D1ZB 3H9SD 4LMQE 5FYKH 3DRQA 2P5WD 4MZ3A 3VWKB 4S1QL 1JHLL 3PL6B 5TE4H 1RHFA 3AXLB 4G3YL 2JJWA 1DBJL 2YN5A 1CFVL 2DQHH 1RUKL 1RZ8B 4XPFL 4YDJB 2AXFA 3ULSB 4NO3B 2K7QA 1YJDL 5KJRH 1FC2D 4F15B 1U6AL 5DZNA 2X05A 2R0KL 4X98A 4KV5F 5DRXB 3VXPB 3VFTA 2K7PA 2WP3O 3ZYOA 1EUUA 1ZWIA 1C1EH 1MIEH 2R56H 3QHFH 1BIHA 3HI1A 1RIVL 2BCKB 5DFVD 3SE3C 2GI7A 3EJYD 2EO9A 2VOTA 4PREA 4U2ZA 2A77L 4PJGF 4X7FC 4Y19B 4H8WC 4JN1H 4PJ8D 1I7ZB 3F65A 1KLGA 1T5WB 3HKFA 5CGTA 3DXAD 5FM5M 3L5HA 2P24A 1H5BB 1CFNA 1A5FL 3GSRA 1JYVA 2VZUA 3WMSA 4XWGH 1CQKA 1C5CH 3IXAB 4PRHE 5CFHA 4NQDE 5E2TH 1RUPL 3BW9B 1T5XB 4IRJC 4Y19D 2JF1A 5JQ6H 4DGIL 1G6RH 1X6NA 4KKAD 2AJZB 2A83A 1EEUA 3S97C 3ARFA 3VXQA 4YBQD 1P9MA 5FUOH 3FZUD 3OKKB 2VAAA 3BOVA 4ZXBA 1TCRA 4NN6B 3QDHA 3PGFH 3QQ3B 1ZA3A 2FNBA 2PUQT 2X70B 1LMKA 2JB6B 3REWA 4HCRL 4NP4L 1YEGH 4LF3A 1WF5A 3KR3L 2AV7B 5KAQF 4YAQB 2D03H 4JPWL 4JPIA 4JZOB 4QRPD 3PL6C 3P11H 4KGLA 3UPRA 3U0TA 1TPXC 4QRRB 4X4XA 3QBTB 1KTLA 2VZSA 5FOJA 1LWRA 3EIFA 4NO2A 4PB9L 4W4OC 1CD8A 4KU1A 3KJ6H 5JW3H 3WUWG 1AH1A 5T3XH 4OLXH 4K23H 2G9HB 4Z7UA 3QI9C 4GRLD 3SO5A 5HVHB 3OKNA 3NH7L 3ESUF 1KJVA 1HCVA 5FEBA 1CFSA 1L9NA 1X5JA 1R3IL 2OJZL 4FFYH 1JMZA 4LLQB 5D93B 3G9VA 4JLRA 5KANG 4HIJA 3CMOH 5B3JE 1U58A 3VWJC 1F13A 4LHUD 1KJMB 4HIIA 4HKJB 3V6OA 1BBJB 5EDXA 3N1GC 3VA2C 5GISH 2AK1H 1A6UL 1A7NL 2Y6SD 4TUKH 4XMLH 5JTWA 3WO3B 4CN1A 1A9BA 1KENH 4EI5C 1SBSH 5J6HB 4KMTH 1FV1B 3D0LA 5KVEH 1ADQL 2P42B 3QRFM 1N5AB 1OLZA 5CP7A 1QP1A 1P6AB 1OAQL 2CDGA 3NPSC 4DUVA 2P44B 2X6MA 1T89C 3SJVB 5L8KB 4OUOA 3BT2L 1KIPA 3B5GA 3G6JA 4FXGA 3WD5H 4X6CF 4KJQC 3J8F7 1KB5B 1T0PB 4ODUB 3A6CL 1H9VA 1G6RA 4KJPD 3RY6C 1CI5A 1D5BB 3MBXH 5D1QC 1C16A 4RMRA 1F11B 3SDCB 1DLHB 3MLWH 5EORL 2F15A 2YXMA 3AVEA 4KKCD 3RWCA 4P46A 2DTMH 4MA1C 4I2XE 4PJXA 2FYYB 4ENEC 3K0WA 1QSFA 4M93C 2AGJL 1C08A 2UY7A 3D18A 4IOFD 5FYLE 1EERB 1OW0C 3RVXC 4Q9CA 3I6LE 4Y4KD 3GI8L 4IRJD 5J0BA 2ORBH 2J4WL 3QHZL 3GSNA 4WI3A 1T2QH 3BRDA 1X4XA 2W60A 4NQDD 1ZVYA 2X7LA 4U6XB 1M6OA 4IRSC 5FYLH 4P2OB 1G7IA 5IFAH 4Z7OF 5ACZA 4Y4HA 1MY7A 5FYKU 2BC4B 5F1IB 2DL9A 1XF3A 1M1SA 2ICWB 4F37F 1WEJL 5JPMB 1OAUL 2Z4QB 4LSDA 1AXSA 1MVUA 5BQ7A 5FF6B 3ZDXF 3DETC 3OZ9L 5I30L 5FYKE 4QXWA 1EEQA 2Y4SA 3LN4B 3I6KA 5GIRA 1JK8B 4FQLH 3ABZA 4XNYH 1FZKA 5CD5C 3HI1B 4U1IA 4F3FA 2IH3A 2BCKA 4HT1L 5HHNB 2EDHA 4PS4L 1JNHA 4IOIB 5EWIL 1F3JA 4LKCB 2BXZA 3MOBH 4NN5B 2HG5B 3IKKA 1J0IA 2YUWA 3UO1L 5L2JA 2ED7A 4S11A 5E2VH 4ZUSB 3FOMB 1QA9A 4XXCC 3H3KA 4D9RE 4NT6A 4JFEB 2XNAA 2HFGL 1SBBA 2GJ6B 4JRXD 4FFZL 1GC1C 3QAZB 4ZPVB 1QLRA 2UZYB 2IAMA 3BW9A 3QWRD 1MJ7L 1FRGL 3V79C 4PJAA 1NAKL 2VERN 4JY4B 1NCUA 2DQGL 4I9WD 1NGZA 2ZZUT 3VXMD 4Q9RH 2AJYH 3DX7A 3RIFK 2FIRT 1AGBB 3LH2L 4DEPC 4P2QE 2IEPA 1AKJB 4FQIH 3UX9B 2RFXA 4MJID 4ALAL 1OAZL 3HAEB 3HMXL 3ET9F 3OKOA 1ZANL 3DUSB 4H5SB 3F6LA 1J1XL 1CDGA 5C0AA 2O61B 2B4CC 2NTSP 4LLUA 1NGXB 4PR5A 3GBLA 3QZWA 3LHPL 5I8CB 5DJXA 4S1RL 4DOHB 5DRWB 4JPKH 2ZCHL 3U0TB 5K9OA 3IDYC 1A1OA 3JVGA 4ZDHA 3BP5B 3MRFA 4K8RC 4KK9D 1QYGL 3G6DL 4WFED 5GZND 1DQLL 2OJEB 2EXWD 4OUUB 1KIQB 3RDTA 4AQ1B 3TH2T 3O4OB 4JGJA 1EXUB 3OKNB 4DKFL 4Z6AT 5EU5B 3HZYA 2VDRH 1V7NH 2OL3L 3VFUB 3ZDYF 1XAUA 2DQCL 3JV6A 1N6QH 3MLUH 1IGIH 3C8DA 1TTFA 5JLZA 1CXFA 4DK3A 3SDXB 1U8OA 3SDYH 3KPOB 1CF8H 5DGQA 3FO1B 5LGJB 2H1PL 3KPRD 4J3SA 3N85H 5F1OB 2XWTA 5DUPL 3V5DB 3GUTB 3NAAH 4XPGL 1OTSC 4DFIA 4QHMA 4HUKB 3ROLA 4MDJB 2AXGB 1UJ3B 5D7JC 3T8XA 3CLEL 4RMSA 4LSUH 1A6ZA 5A3IC 3C60D 2NTFB 5IB4A 1A14L 5J89A 5DUBA 4ELKA 2DN7A 4LPWA 4R7DB 2EO1A 3CMGA 2F5BL 3MRCA 4O2CA 1FYHB 2YPLE 3X13B 1XR8B 2MQ0A 4YHPA 5FO7B 3GM8A 4F9PA 4APQC 2HJLB 3DSFH 4F57L 4X7SH 5E56A 1MF2L 4R6UA 2LTQB 4GW4A 2CK0H 5IFJA 2F54A 2IPKA 3RWIA 4F7EA 4JY6B 1OP9A 2DJSA 5CWSB 5IMMB 1MHEA 1OQXA 4DVBA 3TN0C 4EN3A 3F8UB 4H26A 3QUZB 4NHUA 5I66B 3EFFB 1D7FA 1TTGA 1SYVA 1L4IA 3JTTB 4OT1L 4LAJH 4F7CB 3KR3H 4JHAH 2BNRD 3DI2B 4Y2DD 2D03L 4JPWH 2XOTA 1A3RL 3VFVB 4G6AD 5FV2A 5CEZH 3DVNA 3FT4B 1TMCA 1Z0MA 4M3JA 1EFXA 4PGEB 5ICXA 2N7BA 3PHOB 1HH6B 3VD3A 4O51A 2YMXH 4MNGA 4XWOC 4LDOB 2PW1A 1GGIH 5GGQH 3QWQB 4NUJA 15C8L 3EBAA 2DD8H 4HWZB 1WFOA 3L3JB 3D39A 1VFMA 3FN0L 3PWNA 3NH7H 1ZOXA 2C1PB 4ZSOB 5HVGB 5DD5H 3LS4H 5DSCB 1X5FA 3HNSH 4TUOB 4NC1E 4HXBL 5DD1H 3W39A 2EKJA 3AREC 1Q94A 1UKQA 5FUCE 1IEAA 2Q20A 1RIHL 2R8SL 4P57A 2VDML 5FUZL 5TFSH 1T1XA 5ERWA 3WKMH 1A1NB 2XN9A 3EO9L 3GRWL 1JGEA 2B39A 4PFEA 3S4SB 3QIUD 3ARYA 4HFWA 5DTFB 3VDAA 4Z7NE 1F90L 4KK6D 4OZFG 1NFDB 4FHBD 1FL6B 3C9NB 4K3EH 4QRSA 4QOKD 2HH0L 3KXFA 1YEEH 1D6VL 5ICYB 4KAQL 4N1CA 2WBJC 2BXYA 2CQVA 1NFDF 2H2PC 2A6IB 4KRPC 2CRYA 4PJFF 2VLMD 3VXRA 2VQUA 1FAIH 4BH7B 4LLDA 2I27N 5A1AA 2BNUA 2AK4D 4HIHB 1TZHB 3DUHA 1NKOA 5I2IB 5TF1L 5E95B 3V4PH 3WFBL 4HK0B 4KQ3L 2R0ZL 4LPYA 2D0GA 1JV5B 4PGDA 2AJVL 5F7NC 4HF5H 5JW5A 1VGKB 1A0QL 4X4YA 1T03L 1IAKB 1B0GA 2EXYC 4OLWL 3RWDA 4PBXA 1SQ2N 5E99L 2CRMA 1R5IB 4J1UB 2UYLB 2YK1H 4JM2F 4QHUB 4MX7A 4Y4FD 3WLWD 5KAQG 3GJFK 1U8KB 4OCWL 4FQXB 3MROA 5F3HA 2V7HB 1O7VA 3GO1H 2DJUA 4OCXH 1TTUA 2QR0B 4GG6F 1MCLA 2X4SB 4MMZC 4ETQB 3VG9B 4N8CH 3SKMA 5DEGB 3AB0B 3IFLH 3S3SA 2WM0A 5A43C 1HOCA 2GFBA 4OZFB 4BQ6A 2P7TB 2AEIT 4HG4K 3H9HA 1JBJA 5DVKA 4RMWA 3U30B 3Q1SL 4YJZL 5CJBA 1H3GA 5C08E 5D7KD 3GKWH 1OP5K 1QLFB 5C0GA 1OM3L 4NO5B 4FTVA 4L8BB 3QDGB 3QG6A 4WFEE 3OAZH 4HS8L 4KPHH 4M62H 5D2LF 3W0WB 3HZMA 1QSEE 4G8IB 1FFRA 3UAJC 1UGNA 4