2YPLD

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
199
structure length
199
Chain Sequence
EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAVSGGYQKVTFGIGTKLQVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
total genus 31
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD02
4PG9B 4NN5B 3KJ4C 3MXVL 2YZ8A 4P9HL 5CSZA 1JWUA 4FA8A 3CFDB 1OCWH 4UV7H 3MNVA 5GIRA 4A2LA 1KCUH 2O5XL 3P11L 4J3TA 2W1NA 3DV4A 4BH8A 4AEHH 4KZDH 1AHWA 1T66D 4NZRH 5KJRH 3RTQD 1HCVA 2YSSB 5E24E 2FX7H 1MCCA 1Y0LA 3BKYL 5JOFB 1H15B 4JQIL 2GITB 4BUGA 5JW4Q 25C8L 3MV9B 3THML 2NZ9D 3OX8B 1KELL 3WSQL 4I18A 4HIHA 4G43B 3SE8L 2WANA 4OFPA 4HLJA 3H42L 3Q48A 4X7TA 1ACZA 5DI8A 4LRIC 5FCUH 2EE6A 1NJ9A 3RAJL 5IQ9A 5C0BD 1AGFA 1N3NB 1ZANH 3BIAX 3RIFK 1VFOA 2ADGB 1X9QA 1XH3A 4DCQA 4RGOL 2R0ZH 1RZKH 4LKXA 5D1XD 3S98A 5KOMC 4R97C 2DL2A 3MV8E 2AGJH 1MHHA 3ZL4L 3C8DA 1JUFB 32C2A 4H0HB 2DQDL 2AK4E 5KSVA 1WSST 4MD5B 3QWRD 1WISA 4JM2A 4XNXL 1XF1A 5D7LB 3SDYH 4MZ2A 3WXWH 1FJ1B 4U7MA 1T0MB 4LLYB 1HZHL 2PYEE 4X6CE 5FHAH 1IM9B 1NGZA 3S34L 1N7MH 1W0VB 4P5TD 3UTSB 1CE6B 4I0PB 5TDNA 1RUKH 3RI5K 1J10A 3KPNB 1KG0B 2W0KA 4Z8FH 3ZHKA 4Z7NF 2D7TL 2VLRE 3BWUC 4HS8H 1DN0B 1YNLH 5T1LA 1V3MA 1AQKH 4LLUA 1I9RL 4F9LC 1JZ6A 3KLHC 2CLVA 2LAAA 3PGFH 4MQ7A 3RVVD 1ETZB 1XT5A 3QEQB 1XCQA 4NKMB 5JIHA 1I8MB 4EQ3A 4BFEA 1DQMH 1G7QB 3GI9L 3QHZL 5EOQH 5FM5M 5EU6D 4P5TC 2VR9A 5FA4B 3GMLA 2L7UA 4YLQT 1YQVH 2A6IB 1SHMA 1MIMH 1JV5A 3ZKMC 2R0KL 4NQXB 4X9HA 2R56L 2BSRB 4HEPG 2E6PA 4G7YH 1FG2A 3QEGH 4KJWD 2AJYH 1AGDA 2QV2A 2HMIC 2DKMA 4QT5B 1HSBA 3O3AB 3DX9B 4NT6B 4LARH 1QSFA 4KUCD 2MCG1 5JW4R 4YBHA 1JPSH 4DOHE 2C3VA 2VC2L 4U1LB 3WN5B 5E94A 2SEBA 1A6AA 1G9MC 4R4FL 3D3VE 3SPVB 4OZGA 4V2CB 4NWTL 3DRQA 1LVEA 4LLQA 1YMHA 3U36A 2BY0A 4M4RA 1I1AC 3SJVB 1RUPH 4G7YL 1FV1A 4EI6A 1J1XH 1DQDH 1TZHA 3EO1B 3NFNB 3B9VA 5SWSB 3RA7H 3ARFD 3VGDA 4IIQA 1AIFA 3VI3F 3KYMB 1F6AB 2YXMA 1JGDA 2HRPH 4HMCA 1JZ2A 3TBTA 2EDWA 4L4TE 4JFFE 3A67L 1F3DH 5J3HD 5CSGA 4HD9A 1UYWH 4J2XA 4F7PB 3MJ8A 1IC5L 2W0PA 4LQFL 5DVKA 3S37L 2ZCHH 2C1PB 3GIZH 4CW1B 3BDBA 4JZJA 4HZLA 2O93L 3QNYA 5ITBL 4HGWA 4L3CB 1CDGA 4L3EE 4L8CB 1HYRC 2QADB 4BSVB 4WHTA 3WFBL 1EXUB 3CH1A 1HHJA 3QA3B 2R29H 4PJIB 2NY1C 1GGIH 2X09A 3IFNL 2JJUA 4GG6F 5C71A 1F58H 5D2LE 1BD2B 3B8SA 4XMPH 3T0WA 2BZDA 1ZLSL 5LQBH 4LIQE 4Z18A 4U6TA 4DAGL 5D1XA 4BFGA 3HG1D 2LV4A 3SDXA 1MJJB 4XP5L 2DQFB 4OZ4B 2NY2D 4RAUB 4POYA 3C60A 3QFDA 4MJIA 3QDMD 4EXPX 1CG9A 1IKNA 3BAEH 3MJ6A 1OLLA 5INCB 2DM2A 2P49B 2R29L 3HE6B 5KN5A 2AV1A 2PF6A 3FTGA 3MO1B 3SDCC 3F12B 4P2OC 3CD4A 4NHUA 3O11B 4YHOH 4LF3A 3OGCA 5I8EB 5I73B 1FAKT 3U0TB 3LRSA 2HLAB 1AJ7H 4DGVL 2EZ0C 1ND0A 2B4CL 4UTAL 3TPUB 4KMTH 4BK4A 2BCKB 3U1SH 3QIBD 5EU3A 5JO5B 1NMCC 1IILE 4YC2B 3OQ3B 4FXKB 1YYLH 2VOTA 3ARXA 1RJYB 3BZ4A 4UT7H 3UBXA 4HS6B 1M71A 5C6PB 3KDMB 3QI9C 3UTTE 5IFAH 1DDHA 5D93B 4YFLF 2NY1B 5LCVL 5HHOE 1T22B 4LBEB 4CAGA 1IFHL 2FDBP 5D7JC 5ICYA 5HY9A 4FP8L 5FM5O 1UXWA 1MFBH 1NCTA 3RKPA 5EA0L 3VXPB 1A7OL 3ZO0A 3T65B 1HILB 4WFGE 1HH6B 4DEPC 4WWKD 4PLKD 3C60D 1JPFB 4LVNC 5KVFH 1ERNA 2NMSA 4PJBE 3V6BR 2R1WB 3OTTA 3QUMH 4OZ4A 1U42A 2W9EH 2BNQB 4OM0H 1ZT7B 3HTLX 2D0GA 5I1EH 1DVFC 1GHFH 1RMFH 3R4DA 1FAIL 4OD2A 1X6NA 3CFDA 2VXSL 5TPWH 1KENH 4LU5L 4JFDE 4NOFA 2A9MH 3O9WB 4OB5H 1XR9A 1R5VB 1T0NA 1YEJH 5DJCA 1NCNA 4KQ4L 3B43A 2Q76B 3TNNA 2C9AA 3IJSB 4FQPA 2EEDA 1M7IB 2NY6B 5CINL 2XQBH 4U7SA 3ARDD 4HKXB 4Q74A 1U95B 4FZ8L 1XGRB 1HXYA 1KJ2L 1R5VA 2VZUA 2H2SC 4LGPB 3NAAH 4K8RD 2B20A 4JRYB 4PB9H 4DK6A 4XRCA 1R3KA 2VAJA 4KHXH 4D0CA 3SQOH 4PRDB 2EEBA 3LKNA 2P7TB 4M02A 1FO0H 4ZOBA 3E2HB 3FB5B 5EZLA 4ALAL 4QRSB 2HT3D 4Y1AB 3MC0A 1NANH 4ODUA 5GS0D 5KANG 1CDUA 4Y19E 2XG5A 5CBEB 1F97A 2FATH 2YPLD 4BSWB 2X5PA 4LSTL 4Y5XC 4U0RB 4IM8A 1RUML 3BPOB 4F15B 5FGRA 3QCVL 4EQ2A 5KG9B 3SKNB 1FH5L 3K0WA 2FZ3A 2XICA 4WW2F 2PYED 3QO0A 1VGKB 3RWDB 4XVTH 2X70A 4IRSD 1RU9L 4PRPB 4PBWD 3BKML 4JO1L 4M93C 2DIAA 4JFHD 4OCRH 3CVHB 4JN2B 4ODVL 4L4VE 4K55A 2CK0H 5F71A 4JFFB 4OQTA 3QWQB 4RZCB 1ZLUH 4XNMA 4P4KC 4R90H 1UQSA 1AGDB 2VZTA 3NPSC 3MGOB 3B6SA 4OZHB 2J5LB 2EDEA 5E2WH 4QRRE 3KLSA 3O41A 1R5WB 1T20A 4HWUA 4PRHD 4IOIA 5KAQF 2G75B 5D7IE 4AT6A 3MRNA 3PGCA 1G7PA 1XGQB 3GJFK 1S3KL 4PTTA 4ZS7L 4PYHA 2WIMA 2WQ8A 2ESVE 4E42B 1NBYA 2BRRH 3LN4A 4PJXB 3F7PC 4Q9RH 3PJSA 1NGPL 3MSPA 1O7VA 3QEQA 1ETZA 4PREA 3RDTC 4CVWA 5BMFL 5L7XL 1LEKA 1TZGH 2GUOA 4GSDH 2BOCA 2Z31B 2F5BL 4LLUB 4KTEL 1S9XB 3RWJA 2YC1A 5TE7L 5I19L 4EN3C 2J5LC 3PWUB 3BPNB 3FT4A 5DJ6B 4KQ3H 3VGBA 5CJQH 4L8DA 4NNPL 4CNIB 1BVLA 1T7WA 3F7QA 3NIDE 4FXLA 4K3DH 4M6ML 4U6XB 3MLVL 3EOYG 1MJUL 2ADIB 3UTSA 2B0SL 3PWVB 3DBXB 2JJTA 4MA1C 2DQCL 4XCFL 4C83A 1MCKA 4LLYA 5L8LB 2F53E 2VLJE 3P73A 5E6ID 4PJXE 4G3YH 4XXDB 1NCCH 4NO0A 2K9UA 1HOCB 3H7LA 1I9RH 3LKOB 3ARDC 5B3NA 1A4JB 1I1AA 5DEFB 4HKJA 1R3IL 4K7PL 3WE6A 5CP7B 1A1NB 4LKXB 3MGTB 4WW2B 4FHBD 3MYZA 4IIQC 2XWJB 3L9RA 5TF0A 3SOBH 4HWZB 3DROA 5FYJU 4DKAA 2CD0A 4Z9KB 5HHOD 1S5IL 2B2XH 3C6LB 3UTOA 4KKCD 1Z2KA 5E1HB 3KPMA 5GGRA 4NQVB 4J1UA 4FQLH 3DI2B 4X6CF 3ECBB 2WLYA 1QA9B 4L3ED 3EJJX 4NYLB 1U8QB 3QFJE 5F9OH 1Z5LB 5A3IC 3GO1H 3TN0A 2GAZA 1T5WB 3HAEH 2GITA 1T2XA 3DIFA 3SJVA 1E6OL 4MAYA 3QQ9C 5E2UL 1JHTA 2EDTA 1NGXA 4Y4HD 5C9KA 2EXWC 2FX7L 4IRZL 1F4XL 1GC1C 1KJMA 1UACH 1VFAA 4Y1AD 2OTPA 3GSOB 4NZUH 5FKAA 5EA0H 4QXTB 2AK4B 4M8QB 4KTEH 3MXWL 5C0JB 2VUOA 3P2TA 4JFPA 3DO3A 4HG4J 2CLRA 2J4WL 1CD9B 3RVTD 4R26L 4OI7A 2JELH 5HPOA 1DBAH 1AGBB 1Q1JH 4PGZA 1TETH 1IM3B 4IMKC 1F3RB 3ZKND 4YX2H 5M7QA 5FOBA 1FNGA 1HHKA 4HCRL 4X9IA 1G7IB 2WBJD 5L6YH 2ED8A 2VDLL 2DTMH 3BP7B 1L6XA 1I1CA 2HJKB 1SEQL 5CZXD 5DC9B 3FFCB 3GM8A 3OAYH 5KSAB 2FHBA 1OGTA 1ORQA 1P6FA 3UEZA 1EBAA 1Q94B 3BT2H 3IXAB 4XPHH 4PRIB 4UNVA 4WHCA 3I85A 1U8MA 4V1DE 4GKSA 1KJ2H 4KI5C 4XMKL 3EOAA 1F4WH 2WMPA 3QUMA 5C0FA 1FLRL 4PJDB 4EJ1C 1A14H 2HFEA 4HIEB 2NY1D 3T2NH 4XMPL 3VA2C 5CEYB 3Q1SL 4U49A 5HI5D 4UDTB 3SHSA 2AJXH 2ICES 4P2QE 4NDMB 4FQJL 2VXQH 5CJXC 4HWBH 2VDNL 4LSTH 3H6JA 1P2CB 3VFVA 1S5HA 2E9IA 1H3VA 1WTLA 4K3EL 4ZSOB 1VFAB 5EU4A 4IOIB 4FRWA 1LP9A 4KAQL 4X9GA 3FHAA 2VLRA 3SCMA 3VRJB 4HS3A 2DLFH 4X83A 4DCQB 1JZ5A 4QHNB 4Q2ZA 4ELKA 5I8CB 1KLFA 1HH9A 1PEWA 2KZ1B 3BJLA 5DJZA 3ARWA 4ORZC 5IMKB 1MRFH 2APFA 3ULVC 4J1UB 2XV6B 1MCJA 4WU5A 5DDHB 5LGKA 5F6HJ 1VKXB 1U58A 1EFXA 5C0CB 5HDQH 1F4HA 4MQXC 1MH5B 3QYCA 4XCEB 3QNZB 3PNWA 1A6VH 2PW2A 5I9QB 4JE4B 3C6LD 4LRIA 3K8MA 43CAA 2ITCB 1AXIB 4HUVA 1KF9B 4QRSA 5CIPB 4G80B 4NBYB 5DFVC 4H1LA 4OLVL 4PIRF 4QYOA 4N5EC 1OTSC 1WIOA 2B1AH 1BJ1J 1YEHH 3BPOC 5FAAA 2X1XR 3HZYB 1IT9H 1KGCD 3KPRA 3H7BB 4NKIH 1B2WL 2Q7NA 3ETBF 1KLGA 3OJMB 1NGYA 1X4ZA 4KKAC 4YPGA 5J6GA 3MRJA 3TYGL 3G5YA 3GB7A 4G6ML 4L1DA 4LK4A 3VXQB 1SYVB 4S2SA 5INDB 5JZ7C 4UIMA 4IRSB 4Y4KA 4DKDC 2RCSH 1MREH 4XAWL 3FN3A 1RZ8B 4WUKH 3O9WA 1J8KA 5CHNB 3QUZC 4LCWB 5IB4B 1CYGA 1CLOL 1OT2A 1WC7A 1VERA 2A73B 3UTPD 4F15C 3GSWA 4CMMA 3WLBB 2ADFL 1PG7X 5BOZG 3D6GA 5ID0A 1J7VR 1WBYA 5IF0B 1TCRB 3I2CH 4UAOB 4NQUA 1P9MA 2J2ZA 1NCWL 3O8XD 2H32B 4JDVB 5MP6L 3MLYL 1DL7H 1RIVL 3RRQA 3T2PA 2A83A 3MBXH 1G7PB 4HJ0D 3L3OB 1QUNA 1G6RH 3FFCD 5KSAD 1BQSA 1MCSA 1DBBH 15C8H 4R8WH 4B7IA 4EI5C 2OTUB 2DWEA 1TTGA 2B1HH 1S8DA 3P4MB 4Q58C 1VPOH 2HH0L 1EHAA 3OKOA 3ROLA 1CLYH 3O3DB 3HR6A 4MAUH 1OL0A 5F1KC 3VXME 5J8OA 5HXMA 4QHMA 4L1HA 5FYLH 4TNVF 5JLZB 4OQTH 2DQGH 4N5ED 5L8JB 2R0ZL 1KIPB 3P4MA 1J12A 5DMKB 5I1LA 4GBXB 1J5OH 1IJ9A 3GFUA 4L4VA 2VTFA 1IGIL 3DV6B 4NJ9H 5E5MB 4A6YH 4E5XB 1MHEA 4ZFFB 1AHWC 1ADQL 1BQUA 1PX3A 1AD9B 2NXZB 2VDKL 4I8DA 4PJCB 3ZSTA 5ALBH 5BVJA 4D0DA 1G7HB 2WUBH 2RIKA 3BPNC 4GAFB 4I77H 4PJDF 4D9LH 2H32H 1DBAL 3MZTA 4MJ6B 4BQCA 2DKUA 3D85A 3M8OL 1JYVA 4J3VA 3ULSA 1OTUD 1T7VA 3GSWB 2ZKHL 4CMMB 4YNYB 3HE6A 1OD9A 1QTYT 2KH2B 3FN9A 3GMMA 1HNGA 2Q3ZA 4TOYH 1B0GA 2I9LA 4PJFB 3ARUA 4FZEL 1XZ0A 3P9MA 4NQDE 2J8OA 3V9FA 3WIIL 4G6FB 3QWOB 5IBLC 4WNQB 1WFNA 1DN2A 3W0WB 1T1XB 3HPLA 3LRGA 1B4JH 3RVUC 1NC4A 3H3KA 1IGFH 2OJEA 2GT9A 5D5MF 1IGMH 4J3OC 1MWAA 4U05A 5DA0B 2IANE 1A6ZA 4CN4A 5GXBB 3EO9H 3O6FC 4ZXBA 3KPRB 4AK1A 2W9EL 1YEKL 3HZYA 4XPAH 2JJWA 4JHZA 1LP9F 1FIGL 1JHLL 4YK4C 5FYKD 3QRFM 2AXGB 4HC1L 2I60H 3TH2T 4ODHL 1TTUA 4HXBL 1UENA 3LS4L 4FQJH 3KPSA 4TN9A 1LHZA 1ZLUK 3BZEA 3MV8B 4G9DB 1UXSA 5MENB 4TULL 1T2QL 1GZQA 1P4LB 5ICYB 1CLCA 5CINH 4AIZA 3I3EA 4KDVA 1FVEA 2DLIA 5LG1A 5L9DL 3NIFF 1MI5A 5HPMB 3SKMB 3L3DB 3MJ7B 4HPYL 4NQDA 4OZGF 5SV4A 5HYFA 4Z77B 3NZHL 3HRZB 4LP4A 1FN4B 3L3KA 5F1OB 4MHHG 5C0DA 4ELKB 2IALA 2GSIB 3VGFA 1I1YB 4PTUA 1H8SA 1QSEB 4QWWD 4D9QE 4LAQH 3ZSSA 4XPFH 2XWBA 2HLAA 5LGHH 3DURB 3QSKB 4OCWH 5H35B 1ACYH 3BOVA 1ZWIA 2EDLA 4KPHL 4ZNCD 3G9VA 3PL6A 4ODVH 3DX9A 5C6WH 2L0DA 3RVWD 1BF8A 1DLHB 1UA6L 2A9NL 2PTTB 3MCKA 1A1MA 2YKLH 3FRPG 4JFOB 1IAIM 1ZA3B 5EO9B 4GOSA 2CKBB 3EYVB 4NCDA 3O6MH 1OHQA 4FQIH 4BZ1L 4LAQL 1C16A 1RIUL 2QQQA 3IRPX 3NOIA 4F7EA 1AR1C 3O2DL 5FA4A 5EU5B 4P46A 2A6DA 4EI5A 1KPVB 4UI2A 2VLRD 2BP3A 3WD5H 3KWWB 4AG4L 3EYSL 2V2TA 4YQXH 1I4FB 3NFPA 1HDMA 1ZHBA 3TC9A 2LTQB 7FABL 3GKZA 3JVGA 3NMEA 1Q0YL 5IHZB 3QA3A 4XNZB 1DN0A 4LGRB 1SY6A 4LPYA 3DJ9A 3O6ML 4CVUA 4F7TB 4JFOA 3BHBB 5J3HC 4XNUL 1KG0A 4KUCF 4M6NL 1P4BL 4P5MB 2HJFB 4GAYA 4FABH 1CVRA 2X7LA 4ONFL 3J7HA 4HKBA 4JB9L 3V52H 3WL9A 4P9ML 4PRBA 5L0QB 1TMCB 3HI5H 5J6GB 1ULVA 1MCPL 3OKYA 2O61B 1BGXH 4H26B 4AG4H 2ATPA 1LGVA 4HPYH 3DO7A 5IOPA 3NPSB 5DK0B 1WCBA 3FONB 5HHNA 4L8BA 5DQDL 2FWOA 4PGBA 3O4LE 4IDJL 2EO1A 2CIIA 3ESUF 4NN7B 2HH0H 4EN3D 3MUGA 3OSKA 3NBNA 3QNZA 4XP4H 3DYPA 1T5WA 3LEYH 4DJMA 4G9FA 4YFDB 3VMOA 5SWSE 5JW5B 3ECBA 1JWMA 2VZ1A 3OGOE 3U7WH 3DVIA 3MV8A 3H9HB 2AABH 5JR1H 1MAJA 1QD0A 4KFZC 4LRNL 3H0TB 1R6VA 3SDCA 1CD1A 3EJZD 3KPQA 5I0ZA 2VISA 3MA7B 3MV8D 2MCPH 3TO4B 4K7FB 4LHQB 3O2DH 4PJ9D 4HJ0C 4W81A 4BKLB 2R2BA 1K2DA 5HYQA 2WUBL 4OLWL 2APXA 4KGJA 4HS3B 1J0KA 1FSKB 5BVPL 3FRUA 2IFFL 3QRGL 3MUZ1 4CBPA 5I75C 2Q3AA 2VLLA 5F1IA 1CFQA 4JFEA 2CIKA 2EDJA 4DW2L 3RUGF 4IRSC 4NN6C 4HBCL 1D5ZB 2YXFA 2R2EA 3U6RB 4QGTA 3OB0H 2UY6A 5E70A 2A9ML 2BY2A 5A2JH 2C3HA 3DX6A 1QSED 3HE7C 2VIRB 4ZUWA 1EEZA 2R1XB 2V7NA 4P4RA 5GRVL 2DMCA 2NY3C 4P2RD 2QSVA 3CFJB 3OXRA 1BREA 4DFIA 5CJ8A 3UPCA 4U6XA 5JXEC 2JCCA 3O6LL 5IBLD 1MELA 4HUUA 2GK0B 4JZOB 4X4ME 5EPMB 1S9XA 1NAKH 4JEGB 2BHZA 2HG5B 2B39A 5J9PA 3HHRB 4U1IB 4D0BA 4ZPVB 3PQYE 3RQ3A 1ZKAA 1U8PB 2D7TH 2XN9E 4G6AD 5DJDA 1QLRB 3DV6A 4MD5A 4AEFA 4OCLC 1DTUA 2CKBL 2NXZD 5HVGB 5LGJB 3IF1B 5D1ZD 5E99L 5I1HH 5DMKA 4HIJB 3X12B 3MBED 4MHHI 3BVNB 1LQSR 2K3TA 5FO9B 4N0FA 1N0XH 3B2UC 4MVBD 3RWIA 5F7EH 2VDPH 1JYNA 1Y18A 4JO3H 3D69B 4RWHA 1MFCL 5H37G 2G9HB 5MEQA 2D7QA 2BSED 5E8NB 2ORBH 3EOTL 4U2ZA 1ZLWH 3PABB 1CFSB 1EFXD 2R0KH 3AREB 3SO3C 5CCKH 1E27B 4IOFC 1H3GA 3T0ED 5J6HB 2J8UA 2D9QB 5IGXH 2YPVH 4L4JA 1SJEA 5JPMA 3W9EB 1Q9OB 3RU8H 5I8OH 2HMID 3MJGX 1F6LL 1JHKH 4OV6F 3CFCH 2DN7A 2NLJA 3MRBB 3DIFB 5DLMH 5GISH 1UVQA 2XTJB 2OCFD 3N85H 2VH5L 4JANA 1EIBA 2BSSA 3UX9B 2ORBL 3EOTH 4KRPD 3TH4T 4R3SA 3NCEB 1KELH 4MAYC 4ZS6C 1OD7A 4U1MB 4CJ0A 4LPXA 3PV6B 3TBYB 4YDJB 4EN3B 3PWPD 5DK0A 1WLHA 2BVOB 1NCUA 3BESR 1RZJC 2BVUA 1FQ9C 1PD6A 5I1JL 4S0SD 3QPQC 2X7LB 3WL9B 5EDXA 1NBVL 3G04B 3MV01 1KLGB 4NC2B 2P43B 5JMOC 1F4XH 2QQKH 4XMLH 1YEIH 3GSNH 4UB0H 7FABH 2FR4B 1N2RA 4MDIA 4U1MA 1DQLL 1IC1A 1PFCA 3NCCB 5AWNH 2ERJC 4MXQD 5EU6A 3VRIB 4ZUUA 5ICXA 1A4KA 4XT1C 5DMGD 3NFPB 1B2WH 1E6JL 4AH2B 1Q8MA 4LSUL 2UVFA 1N26A 4K7PY 1RZJL 2P46B 4OUUA 1WT5A 3UTQA 2OR7A 5IIEA 4MXWH 3D3VD 4GKNB 3X3FH 5IV2A 3I6GA 3F7YA 5J6HA 5F8QC 3CSBA 2HKFH 3HMXL 1U2CA 3REVA 1ED3B 5F72S 1ZLWK 2EH7H 5DQDH 2AJ3A 4GRLD 4OKVA 3TBWB 4X6DE 2PTTA 4XAWH 3LRHA 1AQDB 4K94C 5MHSD 4AMKH 4CL7A 4MNHA 4HJJH 4RFNC 1PEZA 3CVHL 2X1OA 2DJSA 4NZTH 3REWA 4LASH 5EU4B 2BVPB 3K46A 3GHBH 4UBDD 4AIOA 4WEMB 3AU1A 5DGQA 1OTUC 3DNKA 2VDOL 1ND0B 3FQUB 3O3BA 3IDXL 1X6LA 4PLOB 1XIWB 4RRPG 2EH7L 3IJYB 4IOFD 5KVEH 2AJYL 2I07A 4NRZB 3TBWA 2MCPL 1DZBA 2UZYB 2IPUG 1AJ7L 1BFOA 3BUTA 5E00A 4ZFZA 1ED3A 1A1OA 5I71C 5HPMA 2D7OA 3B2VL 4NO5A 5EPMA 5B4MC 5D2LB 2FX8H 3VFWB 2GSGA 3OJ2C 1FHGA 5AAMA 3FQTB 2B8OT 5DK2B 3LKPA 4G7VH 4WV1B 3DGGB 1F4AA 2P5ED 1OGAB 4DUWA 3AUVA 2RBLA 5IHUL 1CE1L 4JFDD 5DHXB 2ZSWA 4M7KL 3R0NA 5B21A 4WY7L 4XBGA 1IGIH 3JV6B 5K33A 2ENYA 1UWXH 4BYHA 4PY7B 4UT9H 1D5ZA 5H8DA 1B0WA 1G7IA 5FUCC 1RQ5A 5FCUL 3JBG7 1KUMA 4YEEA 4RMVA 3IRZA 1FG9C 4HKXA 3EYSH 2W60A 3HPLB 1KB5B 4I2XE 3MPCA 4LIQL 3BIKA 3LSOB 4KZEL 3MRDA 1FC2D 2EDDA 2V9RA 2P8MA 4OZIA 4AQOA 2B1AL 1JK8A 5GGVH 5IW1A 3LMJL 4FQCL 4JPWH 1MF2L 3D85D 3ARBD 1YA5A 2W91A 4LLWB 3RZCB 5IW3A 5DRNA 1V3KA 3DMMB 3MRCB 2BNQA 1MFDL 3U48A 1G9ML 4NQEA 3WJJA 3CNKA 3GNMH 1RZFH 1MHCB 2WBWB 5KS9B 4KZEH 1IGCH 4MA8H 4PRPE 2NY3B 1D6EB 4BFBD 2XFXA 4WFGD 4F8QA 5CEXA 4QY8B 4PRAB 2EYTB 2PKDA 3PF2A 2EC9U 4V1DA 3CPLA 3LQMA 4Y1AE 3LS5L 3MROB 4TVPH 5DD6A 2LU7A 3QXVA 1D5BB 5TFSL 3IFLL 1FZJA 4ONHA 1M71B 3WLWD 5E08L 1KBGL 4LSSL 4RIRA 3BZ4B 4X6BB 4P4KD 3X12A 5J4MA 1OAKH 1E4JA 1BWWA 3LEXA 3QJFB 2HFGH 1HYSD 2DQIH 3A6CL 3TT1H 1AE6L 3FQRB 4HX1B 1P53A 3PQYD 4NJAL 4F3FB 1TFHA 5ERWA 5B3JF 4QRQA 5DA4A 2Y36L 2NX5B 5JW4M 5EH1A 2J8UB 1R3JA 2AV1B 3FTGB 4ZOCA 3MQIA 4LIQH 2GJ6D 3HB3D 4B50A 2FLRT 2IH1B 2R23A 3RTQB 3FT4B 5DJ6A 4DK3A 4PJ5A 3ZDZF 1RK1B 1AFVH 1FLTX 3LQAC 1MUJB 1T66C 3KJ6L 5C0EA 3QXTA 4F2MB 2H9GB 1XR8A 3QG6B 2A9NH 1GZPB 3ZTNL 1BBDL 4B7LA 2FEDD 1CE6A 5TDNB 5KVGL 3DX6B 2H2SD 4I2XA 1KTDA 5HTSA 2A74B 5JNYA 5C0RH 4POZC 3BEWA 2BRQA 4HMEA 4UINL 3RJDA 3OXSA 1Z6JT 5D5MB 1F5WA 1R0AH 3PGCB 3LH2H 5K9KB 1FVDB 4PPTA 1OGAD 3QH3B 4NNPH 5ISZE 5FK9B 4R96A 3LCYA 4O00A 1KENL 2R0WL 3OV6A 2HG5A 2NY5H 2P5EA 1MHHB 2R69L 5HYQB 3HMWH 5IVXB 1DEDA 1FL5B 4Y5VA 3ZTNH 3QG7L 1Z9OA 2XNAB 4F33A 2Y9RT 4XAKE 2AGJL 4ODSH 2NTFB 5B4MD 2Y1VA 2X4SB 1OAYH 4QHUA 3PWPB 3CFBA 1QFWL 3VI4F 2IPTL 4GRWF 2MFNA 4YHLH 1U91B 4M5ZL 1INDL 4EVNB 3GUTA 4HH9B 3QUZA 1NFDF 1GZQB 1P4LA 5DD3H 2QJDA 4I0PD 5FYLE 4BQ6A 5DEGA 2JE8A 1LK2B 3PWLA 5F21B 3N1QC 5IK3A 2X4PA 4BFIB 5F6HI 3OB8A 1ZA6A 3U46B 4NN6B 3CFBB 5DYOB 4KVNL 4CRPA 1B0RA 5EB9A 2W07A 4KY1L 1UKQA 3ZE2F 2Y06L 3GMOB 1NFDB 2R2EB 5DWUH 3EO1A 4HC1H 2YZ1A 1TQCC 1Y0LB 1RJZB 3BH9A 2DQJL 4FNLL 5GZND 3KR3L 3MRQA 2EIDA 4L8SB 4OCSL 2QADC 1A9BA 1ODAA 4YFLI 3O4LB 3TV3H 4XPHL 2BOBA 2J88H 5GISL 4PRBB 3CUPB 5GSVA 3QQ9D 3ZE1F 4GAYB 2YBRA 1JRHL 5DVOA 1YMMB 4PP2A 4DN3L 3WIIH 1JFQL 4KJYB 2YR3A 4IS6B 5DJCB 1F2QA 3K4AA 5DFWH 3B3IB 3T2NL 2XT1B 4PGJA 1YDPA 5IB2A 2VXUL 1XCTB 3EYOA 2UYLA 1RHFA 3MRKA 3KPRE 3QIUA 4NHCL 1MFEL 4NQCB 5EN2B 4PJBB 1Y6MR 4YHPA 3UYPA 4GRWH 1EEYB 3KWWA 1WBXA 5DT1H 5HHNB 4PJFE 1NUDA 4ISVB 1DUZA 3NABH 4R96B 4Q6YA 1LO3L 3UTPE 2CLVB 1PKQB 2OK0L 4NKDB 2JJVA 3VD4A 1EBPA 2Q8BH 1A64A 4P48A 3RWGB 4CMHC 5T1LD 2VXUH 3EOBB 5FECA 4PUBL 5T3XE 4HK3J 4KK6C 3VFTA 4PYGA 4C56A 3PL6B 2X4NA 1K3IA 1NGZB 5T1DL 4FFYH 1D9KD 5DUBB 5BS0A 3BSZH 4V1DB 2Y7QA 5D2NB 3V0VA 5IMLA 2Y06H 3F58H 1QP1A 4S1RL 5GGQL 5D7LA 5GRJH 6CGTA 3FRPA 3BPLC 2OMNA 5AZ2L 3NIGF 4N8CH 2OK0H 4DFHA 2BCKA 2G5BB 4G6KL 5FB8B 3TPUA 3HKFA 4OB5L 1D6EA 4NNYA 4FQHB 8FABA 4MAYD 4HT1L 2A6DB 2VYRE 1MQKL 5EU5A 2HKHL 1C12A 3KXFD 3IDGA 1EA9C 3NA9L 4NQDB 5H2BB 3MLWH 2FGWL 1ZTXL 2Q8AL 4C56E 3ARGC 5HHME 5HGDA 1YEHL 2EIZB 3AFLA 5IFHH 1L0XA 2VE6A 1YJDL 1KLUA 3MOBH 4ODTH 5ESQB 4CJ1A 4P2CG 1K8DA 1S7XB 4L29A 4WEBH 1YECL 2DQIL 4G6MH 3AS0A 4N0CD 1YQ2A 3MROA 2ZUQB 3KYOA 4ELMF 2F8VA 5JTWA 1RURH 2VXVL 3MV9A 1QBLL 1H0DB 5D1XB 4WO4D 5KVMC 4KV5F 2Z91A 2MKWA 4O5LH 3RHWK 4JG1L 4G8IA 2F5AL 4QY8A 4OV5B 2WBJC 1WZ1L 1IC4H 4PV9A 3IDMA 1XGUA 1UH4A 3DMMD 3FO2A 5HVHC 1XGTB 4CVXA 4I4WB 4Y2OA 4PY7A 3QDGB 4X6DF 1L9NA 3UTSE 1BEYH 4HGKC 2NX5E 2JJSC 5CLWA 2G60H 2J3SA 1CXEA 3QWOA 3P77B 1UWEH 3KYNA 4WRLA 4HH9A 4OLWH 4DGIL 4JB9H 5JZ7D 2W0FB 4XB8A 1LILA 3WO4B 4N9GB 1JMZA 5EUOE 4XPBL 3ZDYF 5GGQH 3V0WL 1T2JA 1AXTL 4QRRB 1KC5L 4YPJA 4JAMA 5E8OA 1V8HA 4Z78A 3MACH 3SDAA 2EC8A 4IIQB 1DQLH 1KB5A 1TETL 1QBML 3MODH 3ZKSD 4K71C 4KH2A 4I3GA 2RJMA 4J12A 2BDNH 1FL3B 1FSKC 4PJCA 1TZHB 2QQKL 2K7QA 4YR6B 1BPVA 1PSKH 5MEPA 4S1SL 4LOUC 1XIWA 5IESL 5AEAA 3O3BB 1EGJL 1PJ9A 4RDQG 4LMQE 4X7SL 5J7CC 2CXGA 1XGQA 2VLKD 3K80A 1N8ZB 4QKXB 3WN5A 3IU4H 3FL7A 3WHXA 3BW9A 5F96L 2CPCA 1S7XA 4L29B 3DSNA 2COQA 2UWEA 3FQTA 3P4OA 1DEEA 3GMMB 3OKKA 5BV7L 3B9EA 1AR1D 4LU5H 2AXHA 1R3HA 3S37H 3PL6D 3CAFA 3AAZA 4UOJA 3Q5YA 3D48R 4J8RA 1WEJL 4UBDC 4GAGL 5BVJB 1I1RA 4QHKJ 1N4XH 2I07B 5I17B 4YDIH 1U2HA 4QXUL 3KPRD 4AH2A 4CVZA 3FQRA 1KBGH 5D1QC 1ZMYA 4Z7NE 1U8OA 3K8LA 1QHOA 3WLBA 2L4OA 1FNSL 3LEXB 1J5OL 2Z8VC 4XPGL 3OAZK 2AI0L 3ES6B 3UAJC 5CGTA 4WI9A 1IEAA 5KZCD 2EO9A 1LEGA 3QIUD 5CEZD 4M1GH 2OTWA 1K4DA 4D0CB 1EMTL 4M1CD 4MNHB 4G5ZH 2ZPKL 3UJIH 2X4NB 5L2KB 4F57H 2F54E 2Y6SD 3ZYJA 3NVQA 1S7TB 1BECA 1U8LB 3PGDB 1JNJA 3GSXB 4PRPD 2FHFA 4P2QD 4E0RB 1QBMH 1ZHLB 5AAWA 3QUXC 1EZVX 5GZOC 4HEME 1FNSH 1IAOB 3FFCE 1ZLVH 2VL5B 5IW6A 1JNNH 1KCKA 3RBGA 1FRGH 5IVOA 3KJ6H 5D2NE 5F97E 1B3JA 2R56H 4JGMA 1G6RB 5GS0H 1TJIL 1MRDL 3BN9C 2FYYA 1QEWA 1BBDH 2BSSB 4LEXH 2AQ2A 4R90L 3HG1B 2NYYD 3R1GL 1A4KB 4KUZL 4UV4L 3F7VB 1J0HA 1LNUB 4NQCA 4PRNA 3RX7A 3ZKNC 2Y5TB 4O02H 5GGTA 4D94A 4PJHF 1FL6A 3VRLE 1NANI 1CZ8H 5ACZA 2H45A 2ICEB 1EAPB 2PCPA 4KPHH 4UB0L 2Y4SA 3T65A 5LAXB 5GSVB 5IHBA 2DJ4A 5HYSG 4MQXD 1J1XL 1DQDL 2FCBA 4ESKA 2F74B 5SWZB 2ZUXA 2NZIA 4POUB 1A6WL 2OTWB 2MHAB 1A3LH 1EO8L 4PJAE 4KWUA 3ZDXE 1U0QA 4APQB 3LKOA 3RTQC 4P23D 4XP6H 3ZDYE 5GRWA 3MRIB 1MJUH 4P46D 4G8FB 3UTTD 1OWWA 3BJ91 1MRCH 1P7QD 4Z5RA 3WJLC 3NN8B 4KK6D 1YEDB 3TO2B 3ZTJH 2NLJB 4G5ZL 3GIZL 3OF6A 1CXFA 2CRMA 4FFVC 4TPRL 5IK3B 5C09A 4PJFF 2V5RA 3O11A 3W9EA 1MVFA 4K7PX 1F3JB 2CUMA 4YHKL 2UZIL 2XZQH 4CNIA 1A3LL 1R3HB 2F8OA 3IB4A 3U79A 1I3RA 2EDFA 2VRAA 4Y0GA 1DBKL 1KXQE 4MCZB 3BPLB 1P4BH 3DETD 5IVXA 5T5FH 1CK0L 3KLAB 3EYQD 4OGAD 3P4LA 1U6AH 4GJTB 4KRMB 3G5VA 4PJDE 3H3PL 1LP9B 4K8RH 5DMYA 1MFBL 3Q3GA 4KJPD 4L3EB 5EC2B 2GJZB 4OFYD 4ORGA 4DEPB 5J1TC 2BJML 5ADOL 3UO1H 3VFVB 1PZUB 4JY5H 4IMLB 5I8KL 4OLEA 3M1BA 5D71L 4OSUH 3PHSA 2X89D 4NDMA 5ADPH 2Z4QA 4JO2L 3RNKB 2CLZA 2XTJE 4ZPVA 1HNFA 1CK0H 5C07B 1QOKA 2CRIA 1MSPA 1MUJA 4YHOL 4JDTL 2GTZB 4XH2A 4ZSOE 2CDEB 5ISZB 4JKWA 4KK9C 4RGMC 3TO4D 2Q6WA 1EVUA 3FZUD 4DTGH 3UTQB 3CVHH 4NZTL 2IFGA 2W0FA 4KMTL 4WENB 4NM8L 1IKNC 3W39A 4JM4H 1VGKA 4MSWB 4OF5A 2KZWA 3KYAA 5E0QA 3RWDA 2YD1A 5HVHB 3EO0A 2AXJA 4J3SA 1NGXB 4YXKL 5HYJB 1T6WA 3TJEH 1AO7B 2WUCL 1YEDA 3SDDD 3JV5A 3MUGB 1CL7I 2AEIT 5D4QA 1YN6A 1Y6KR 2R69H 4YDKL 3BP7A 4JFQA 3MYJB 2BY1A 1UZ6E 2VDLH 1XGUB 5IQ7L 3SQOL 4TNWF 1U3YA 5EWIH 2ESVA 2V2XB 4G8IB 5E1AB 1D5BA 2IADB 4YIQA 1R3KB 4MD0A 5H94B 5KVFL 3QUKA 3KJ4B 5IG7A 4KK8D 4I48A 4PV8B 4N1HB 1VGEH 3CVIL 3HFML 2F54D 1CTNA 4QXTA 4PGDA 5LWYH 3Q5TA 2XA8L 4QRRD 5ESQA 3HUJF 4JFXA 1WITA 1KJMB 4F7TA 4YO0A 1YY9D 2AABL 5K9OB 5JR1L 1FORL 2BSRA 2XPGA 5IBUG 2YA1A 5E5RB 1HHHA 1EX0A 5T5NG 2F19L 3EIFA 4GO6B 4KQ4H 4P2RE 1UB6A 5DRNB 3NCYS 3ULVD 5D1ZC 1C5BL 4LLWA 4JFZL 3DSFL 4C83B 3G6JE 5FYKE 2V9QA 1BZ7B 4NYLA 3ZT6A 2NY4D 4ZDHA 2IBBA 2ADIA 4LVNB 4FQHA 1G7QA 2WQRA 1J18A 4ZUTA 4P46B 5LWYL 5FB8A 3UTTB 2OL3H 3CC5A 4LLAA 2YRZA 3CK0L 3RWJB 4JRXD 4WI3A 3JV0A 4RMSA 3VXPA 1F11B 4FMKA 4QLRA 4C56D 5EO9A 1BQHB 1RI8A 3HPJA 4JCMA 3JWDC 4WCYL 4JKPH 4PB0L 3U0PA 1EERB 5ALBL 4ZD3L 1QLEH 1TPXB 4Q6IA 3LN4B 4PGCB 1T80A 1WWBX 3U30C 4O51B 3QIWA 3JV4B 5GS2D 2AK1L 4WW2C 4M6OH 1FYHB 3T4AB 4I3SH 4OGXH 3RX8A 5A1AA 1MJ8L 1QR1A 3IU3B 4FS0A 2VSDA 4RA3A 1Q0YH 1HCFX 4LDOB 3IDJA 3MMEA 3MRFA 1IQWH 5JW3H 3PP4H 1KIUA 5DFVD 1R5IA 5BV7B 3LQAH 2BY3A 5DMGC 4OZHF 5D2LA 1CDCA 3F7RA 3QIUB 3BD5A 3WBDA 3PWUA 3VXUA 5HHOB 4PJEB 4L9LA 5IEHB 2R0LH 1NMBH 1S9WB 3UC0L 3DETC 3CFJA 2GYSA 5F3HB 3NTCH 3GHEH 4HPOH 5IB3B 2E7CA 3SKNA 1P4IL 4X4XB 2DI8A 4ZUWB 4KJQD 5C0BB 1CG9B 5E56A 3FT3A 3OF6D 1QSEE 5GJTH 4C59B 4QF1B 1FO0L 3MRIA 3H3BC 2CKNA 1UT9A 5FXCH 2I60L 4PTTB 3OB0K 4Z7OF 5BV7H 4W4OA 4NCC2 2BVPA 4YWGH 5EBLA 4LNRA 5I6XB 1INQA 4KHTL 3NCMA 2ZUSA 3EYUL 1MCNA 4TSBH 5DUML 1TPXC 1A21A 3D87B 2FECI 4FQ2H 1RUQL 4YDLC 3RL1A 3U30B 2FGWH 5MENE 3BMWA 1G0DA 3C8KB 4TRPL 4ZOAA 4JDZB 4I9WE 5KW9L 2LFGA 3NZHH 2IQ9H 1IRAY 5FGSA 4WCYH 12E8H 4MA1B 1TZIA 1KULA 1C08A 1JRHI 4G9FB 3EHBD 3D3VA 3S88H 1UXSB 1CL7H 1YC8A 5SX5H 5CFHA 3SGKA 5DHVH 5T1MB 3FO0H 3IETA 3F7VA 4UILH 3FQXA 3SGDI 4HGMA 5J12C 2EH8L 3N1PC 3KYMA 2R0WH 5L88H 2DMKA 5LJYH 1A2YB 5IBTL 1AGEB 1OLZA 3IGAA 1S7SA 2GK2A 4FP8H 2OBGA 4TUJA 5D8JH 3MNZB 2DOCA 1HILA 1JGLH 3OXSB 3HUJE 4E0RA 2EE2A 5GS0L 4YK4B 2AJVH 4P3CL 4XVJL 1KTDB 3DLQR 3SKJH 3WJLA 3THMH 3ARDA 2IBZX 3TVMC 3IJSA 3OMZA 3QG6A 3P30H 4WUUA 1XZ0B 1LO5B 5J12B 2YHGA 1CWVA 2N7AA 3D0VA 2EE9A 1IEAB 1UADC 3TBVA 3ES6A 4XCFH 1J87A 2H8PA 2IH1A 1W8NA 4TOYL 3U2SA 1GL4B 3T04D 4QOKA 4AM0A 3QHFH 5FF6A 2M1KA 2VAAB 3S96B 5DRZA 2XIDA 3C5ZD 3MXWH 3MFFA 4CU6A 1FO0A 4NP4H 5ESAB 2DYPA 3SDYL 3IDGB 1TVDA 5T3ZD 3VWKA 2NNAB 4X6CA 5SX4I 4JQXC 5BQ7A 3QIWD 3ARPA 1UKSA 2OJZL 1CF8L 4OLXL 3TN0D 4JG0H 1OP5H 1KT2A 2A0LD 5FF6B 2J7LA 5E5MA 5KW9H 4J4PD 4W4OC 3CDCA 2A73A 4R7NB 1ZA3A 2DIJA 3P4OB 4DUXA 3OKNA 2PYFB 2G9HA 1BQLL 2P5EE 3DHMA 3VA6A 2OX5A 3L95A 5EZJA 5IROA 3O3DA 3FO9A 4WTWA 1FFPB 3QPXH 1UM6L 1ZWIB 1I9IL 4YE4L 3VFTB 3VFRB 4IDJH 5I30L 1Q9LB 3SBWA 4PJHE 3ARBB 4HS8L 4N90D 5D9SA 5C3LD 3D2UB 4XGZA 4YGVA 3S3SA 1CF8H 3VFNB 5IB5A 4OFIA 3TWCH 3FB8A 1CFTB 3MNZA 1UH2A 5CIPH 3CX5J 5BZWA 4L9LC 4OFKA 4PJCE 4EBQH 4YBLB 3TA3A 3HRZA 2E7HA 3ALPA 2IEPA 1YECH 4M7LT 32C2B 2OXGA 5GS2H 2X1QA 4XC3L 1RIVH 4G6AC 1UM6H 4YHPB 4JM2C 2FIRT 4HBQA 1MHPH 3RIAK 2EIEA 5MENA 5INCA 3GI8L 2JIXD 2ZUYA 2BVQB 3OBAA 1IE5A 3AS1A 1KXVC 2VZOA 4PJAA 4ENED 2ID5A 1T03H 3KPSB 1WBZA 1BZQK 3BP5A 2R1XA 5K59E 2XKNB 4Q9QH 4XAKD 1DSFH 5F8RC 2YRLA 1XAUA 4J4PA 5EU7E 1V3LA 1SYVA 1VSCA 3S7GA 4WGWB 5F6IC 3UDWA 3LIZH 4GMSH 1KNOA 3HZMA 1JGEB 5KS9F 4Z7UB 3BKYH 3TVMA 3LY6A 1LK3H 3CDGA 5FYLD 4JPIA 3FO2B 4JM2D 1A9BB 5BMFH 3IT8D 3BRDA 1FYTA 2XPGB 3K81A 2VLRB 4I5BB 4N0UE 3Q6GH 2HAZA 3BH8A 5TE4H 4LHJB 5E94B 2EXYC 3R1GH 4BKLA 5MI0B 4HZLB 3KPSE 3SDAD 1N59B 3VGHA 4WEBL 3EBAA 3KPQB 3EDJA 3FAXA 3C09B 4RWYL 4O02L 3SDCB 3M8OH 4HFWB 3DECA 3QXWA 1JL8A 2R2HB 3MBEC 4JN1L 5GRUH 1CZ8L 2AJXL 5JIIA 2Z9TA 3PWLB 1ZAGA 5A16B 3FO1B 4WI2A 5L8KB 2AV7B 4GBXD 2N4IA 5HGBA 3EZ8A 4MGXA 1XEDA 1F6AA 5LKNA 4MJ6A 2GTWA 4PJEA 4JPKL 4M7ZB 2A6IA 1AH1A 4RCAA 5HHPB 4Z7WF 3UBXG 4Y19A 4HWNA 4HV8B 4FQ2L 2IWGA 4KDTC 1FC1A 4Y5VB 5FHAL 2PXYC 4ZFFA 1IGFL 2IBZY 3MMEB 1Q94A 3UJJL 4QXWA 5TQ0H 2X44D 4XP5H 4NRXB 3VFOB 2SEBB 5B39A 3WFHB 5E9DE 3RWCA 2DMBA 3KYKL 1LE5A 1AE6H 3QIWB 4RMTA 1G1YA 5GHWH 2H1PL 2ITDB 3HE7D 1OSZB 2AEQH 3ULUD 2BVYA 5HD8C 1A6TB 3FZUC 3TIEB 4UAOC 1FH5H 1U6AL 1J05A 4NUJA 3QXAB 4KJPC 4TULH 5GGUA 1JV5B 3B83A 4YGAB 1DVFD 5D8JL 3RI5F 5AZEL 3KPLA 5I16B 15C8L 4ORGB 4QO1A 4R8WL 1EJOH 2HJLB 1FFNA 5IEKA 3O9WC 1F4YH 2HFTA 4RNRA 3CMOL 4YDLB 5J0BA 2P5WD 1CICD 3ULVL 4HX1A 1YC7A 1NKRA 3QXDA 4KV5E 5C0AA 5IB2B 3L5XL 3L3JB 4TTDC 4FOMA 4HV8A 4OGXL 1Y6NR 2YA0A 5DI8B 3O6FD 5JQ6H 2GTWB 4NQVA 4PGEB 3P9LA 4PLJC 4PGDB 3C60C 3EFFA 2YBRB 4AEIH 4I18B 1JPGA 3MR9B 3VWJD 5A16A 1GGYA 3W2DL 1IM9A 1R24B 3TA3C 2XZAL 5I1DA 1FNEB 1UZ8A 1J0IA 5E7FA 1E4XH 5EO0A 3ARTA 2DDQH 1II4E 5TQ2L 3FOLB 4U1HA 2I25N 4MNGE 4EN3A 3AXLB 1JNLL 3MRQB 4QHLA 3G5ZB 3HLAA 2DKSA 3MBEA 1RIUH 5I1EL 1MAKA 3MCLL 1RVFL 2IALB 2ZKHH 4MA8L 4RBPK 4XWOC 3WDHA 1MCWW 3UTZA 4I0CC 2CDGA 4YQXL 4OQ1A 4Y19D 2ADGA 3T77A 3TVMD 3CLEL 5DHVA 1DFBL 1FVEB 3V6OC 3BP4A 1WTGT 2GAZB 3UYRL 3PUCA 4MDJA 3PWVA 4H5SA 1SJEB 1VCAA 1JWSA 5TDOA 3BE1H 1NEUA 3K4ZA 4QHUB 3O6KH 4HUXB 4UQ2B 1CICC 1NUNB 3PHQB 5IUSA 1BM3L 1S7VA 4KC3B 1FBIL 2EC9T 4OD1L 1JNNL 1FL5A 1F58L 3QEUA 5JDSA 1U8HA 3ARED 4PJ7F 1X44A 1XF2A 5EOCJ 2HVJB 2BX5A 3E3QC 5GPRA 3LV3B 4OZHE 5DQJA 1D5IL 3FN0H 3QIBA 4FQQA 4NFCA 5AZ2H 3RFZC 4XXCC 2VDQH 1FFNB 5IEKB 5DEFA 2X4OB 4E9LA 1BAFH 3RDTB 3KXFB 4U6VH 5I74B 1FVCB 3TA3B 1I7RA 4AJ0A 3GSQB 3KGRA 1DVFA 4K9EC 4NIKB 3Q3GB 2HKHH 4L3EA 5EC2A 3FB8B 4ZFOB 1ZHLA 2HT4C 4N0RA 3VWJC 1R3LB 5GS1A 3B9AA 4M1CC 4UDTA 4J6RL 4OAWB 1AKJA 3OHXA 4F37K 3AM8C 4WV1A 3T3PE 1JNHA 3VXSD 5ID1A 1OSZA 4M9OA 4M6AA 4YZFF 4MA7H 4PJ5E 2PXYA 4JFFA 3HNTL 5E8PB 5F9WC 2HFFB 2WW8A 3QDMA 3K2UL 1CLZL 1E4KA 1NAML 1JGVL 2VLME 1ZHNA 4YHIB 3TT3H 1KTKE 1JNLH 5B38G 1HINL 4MXVF 3C5SB 1KJ3L 4PRIA 2PUQT 1MFNA 1T4KB 1FFQA 2X6MA 2V7NB 4P4RB 4Z7UE 3MRPA 1J1PL 1MPAL 3IFNH 1P7QA 1S9VB 5A43C 2F8XC 1WF5A 1MCPH 4BSWA 2BERA 1CT8A 4TQEH 1IQWL 2ZOKB 3IXTA 3HCVA 3AU1B 2DYPB 3GM0A 5GRJL 2LVEA 4HMDA 4PJ9C 5FO7B 3Q6FA 2P5WB 3MOAL 3LKNB 4KROD 3VXMA 1GC1L 5F9AC 3ULUC 5DRWB 5E8PA 3NIDF 2UWEB 4XNMB 1G9NC 3BQUA 4QRPD 4OKVB 1I7TB 1BIHA 2CK2A 1CD1B 1I1FA 5T5FL 4O9HH 3CVHA 1N59A 1UM5H 4AEEA 5CEZE 1LO4L 1CR9H 3QULA 2DL9A 3GNML 4HH8A 3IFPB 5IVXF 3MUY1 5GGRY 1FLRH 4NFBA 1WJ3A 3BGAA 1G6RL 2H2PD 4MA3B 4XCNA 1XR9B 2X9WA 2Z35B 2HKFL 3HMXH 1L7TL 1FYTB 2Y5TA 1T89A 5T3XD 3B9KD 4HUWB 1ZEAH 4JR9H 4Z7UA 4CGTA 1WAAA 2X9YA 5CJXA 2FX9L 3C87A 4O5LL 5DZLA 3VRIA 1JE6A 2FWOB 2DQHL 2R39A 3O45A 3V52L 1P84J 5E8EB 4MNQE 5JQHC 3QQ4B 4LSSH 1BBJB 1B90A 3DUUA 3L5JA 4CU8A 5DJXB 5IJVA 1KPUA 5IOPB 5BS0D 4KU1A 4TRPH 1HSAB 2OS7A 4JO3L 4MJ5A 5E2TL 4XC3H 3P77A 5F93C 5IB1A 4KK9D 4KVCL 2IBGA 2IAMB 1T22A 2BVOA 3PIQB 1NMAL 3WSQH 3O3EA 1GRWA 2VR4A 3ORJA 3BXNB 3EGSA 2X4TA 4GS7C 1GGUA 3TBYA 1YEFL 2YD8A 3PWJB 4HS6A 4Y88A 4R97B 5C7XH 1G7LA 3RUGA 3TYFA 3ME0A 3IDMB 3VD7A 3LKQA 4Q6IC 2MQ0A 1EO5A 1KC5H 5EU3B 3MBEB 2XQYK 3EJZC 3R8BB 4PJBF 1INQB 3QXUA 4RX4D 2V5YA 4U6YA 3FMGH 1MVUA 4PG2A 4UQ3B 1LO2H 4XTRC 1UACL 2ATKA 1BVLB 3ARZA 3EW3B 3GKWL 1K6QH 3S36X 1MIML 4M7ZC 3BZDA 1JTPA 4JFYA 1G0XA 1MLBB 2GFBA 5C0CA 3OAUL 5T3ZL 1NAMA 1EFXB 5F44A 5I1AB 1YEEL 5D7SH 5F3BA 5C0BA 2CKBH 1T21B 2QR0A 1UM5L 3OKNB 3RVXC 3T0EE 5TDPA 3KLDA 4XXCA 1A1OB 2GUOB 4F57L 5F3HA 4PREB 2E6QA 3L3JA 2V5MA 1VACB 3O8XC 4KHXL 4PJXA 4L9LB 1I8IB 3RY4A 2C26A 4NC0B 4RAVB 5BQ7B 1JJUA 5CMAA 2BRRL 3X13B 4Z76B 5TGBB 3V8CA 1OM3L 1R5IB 4OM1L 2FO4B 4WFHD 4NN5C 5DD0L 1SJHA 4ZSOA 4FXKA 5DRZB 8FABB 1NEZG 3MLWL 4UMGA 2I9TB 3TN0C 5E5UB 1SM3H 5LGJA 3O41B 3IDJB 4NSKA 4FG6C 1YEEH 5D7SL 4OF8A 3FT2A 2W9DH 3PWPE 1W0WA 4LEXL 4LNVA 3T4AA 4TNWK 2ZP0T 3X17A 1AQDA 3GJEB 4JHBA 3V0VB 1RU9H 5IMLB 4M93B 1FBIH 3TIEA 2X4TB 1IAKA 4P2YA 4BSJA 1NCWH 4NHUB 4JY6A 2OR9H 4RISH 3MTRA 3DRTA 3MZGB 2OLDA 3QNYB 4HF5L 3HE7A 4PJDA 5IMOB 4GKZB 1ZT1A 3CSYB 4X7FC 2FZ3B 4Q7DA 4YHMH 1TJGH 3IDYC 2PYEA 2EKSA 1I3VA 4G6JL 4R0LC 2OI9B 4QXGH 4JQVA 5B39B 1D5XA 1KOAA 3QDAA 3KYNB 2FD6L 2VXQL 4W70A 1WBXB 2I5YH 1CFNB 4P57B 3QQNA 5HVWA 5EC1B 1BZ7A 5DJ0B 1JRHH 1FYTD 3O8XB 4QTHA 3FQXB 2H6PA 3WFCH 3D1MC 3PQYB 2F53B 1YMME 2VLJB 2CIKB 2AKRA 3T0VA 3ZDXF 5C0IA 1C5CH 3A6CH 4NQTA 2ZCLL 2OJEB 1YDPB 1HXYB 5KJRL 1GVIA 2VXTH 3FO1A 2A1WH 4R0LB 4FFVD 2ZJSL 4TYUA 2A6JB 5FA3B 2C3VB 2XYCA 4QRUB 2ICWI 4NO3A 4CN1A 1IAII 5T33H 3MLVH 3T0XA 4JRXA 2EECA 4MD4A 3C9NB 2ZWLT 1M05A 3HZKA 3L5XH 1EFQA 5A2LH 1OB1A 4OT1L 3TGXA 4U3XA 2D03H 3GMQB 4YIQB 2NW3A 2JTDA 1UYWL 2LU4A 5EBWA 1TVHB 5DXWA 1UVQB 1MJ7H 2DQDH 2P5WA 4HKZA 5I71B 4TSAH 1KYOJ 2EIZA 2DD8L 3BX7C 5TE4L 3RDTD 4ERSL 4M6NH 1IC7H 3UPRA 4EI6B 3AROA 4JFHE 1JPFA 4YZFE 4PJIF 4UT9L 1S9VA 1PY9A 3TLRA 2AVGA 1YMHB 4MS8C 4OJFL 3U36B 1RZGB 1TJHL 5JHDA 3KPMB 3DRQB 1ZHKA 3C6LA 4HSQA 3WNLA 3QAZB 2RCSL 3E6FA 3W39B 2BFVH 1KSRA 1S5IH 2B2XL 4LVHC 2XRAL 2EKSB 4LBEA 3RWFB 5D70L 3ULUH 1P5VA 3QHFL 2D2OA 3X14B 1S7QA 3QO1A 4AYFA 3U4AA 4HJGA 2ARJQ 4AQ1B 1I85C 2E8ZA 1KN4H 4LPVA 3RNQA 1NSNL 5GRVK 1OAYL 3VW3H 1KEMH 3MLXH 1SY6H 3B2VH 1TNMA 3KS0J 1G7MA 5IBTH 3GJEA 2X05A 3MFGB 1CXIA 1MF2H 1DL7L 2FSEA 4NKDA 1PKQA 3OKLB 4UOW1 2AJSL 4GUPA 5E6IA 1DBJH 3MRLB 5C07E 3MA9H 4I2XB 4XCYA 5JW4N 4DGYL 5EORL 1SYSA 1DANU 1GH7A 5IHUH 4PBVC 3RPIA 1GGBH 1H9VA 4L4TA 5GS0C 1M6OB 4KGLA 1NMAH 3RP1A 3B9KC 1H8OA 1OP3H 3IAPA 1FGNL 4LCWA 1BX2A 1GOFA 1VACA 3TESA 1MAML 2CKBA 2FH8A 2OZ4L 3B3IA 5F7MC 4QRPB 1WT5C 4QRPE 4U1JB 4K3EH 1U3HC 3OR6B 5TDPB 1MJJA 1G6VK 2BK8A 3QUYB 1U8IA 4P0DA 3PL6C 3DX7B 2NX5A 2VDOH 4ZDHB 3VXQA 1NBYB 3D25A 4ZAKB 3VD5A 3DYMA 4PB9L 1DE4B 3E6HA 3KPOA 4X5WB 1UWGH 5I1KL 3ULUF 2EEAA 5HHXH 1CS6A 3UTZB 3TT3L 1MRFL 4OTXH 5KSVB 3B9KB 1QVOA 3D9AH 4NO2A 5BRZD 4G80A 3RNQB 5FV1L 4RFNB 1NLDL 3G5ZA 3GRWA 3HLAB 3TJEL 2WUCH 4MD4B 3C08L 3CJJA 3QO1B 3BXNA 3QZWB 3X14A 3SDAC 4KKLC 1RZ7H 1RMFL 4RGOH 1AGFB 4PRPA 5ITBH 1CXLA 4S1SH 2FBJH 2V2XA 1XIWC 4KTDL 1U58B 4QCIA 3ZDZE 4PGEA 1A9EA 1AIFB 1MCWM 2AKRB 4H1LG 4CDHA 4NWUL 4GG8A 3C5JB 3HNVL 2XZAH 2CIIB 1XMWA 4F33B 1JF1A 5EUOA 4U3CA 1H3XA 1NEZB 1QBAA 4PR5A 5DJ0A 2VN7A 4EBQL 2JJTC 4XP6L 5B8CA 1LO4H 2ZNWA 4WFFE 1MJ8H 4ODHH 1DUYA 3HNSH 2GJ6E 3D18A 1S3KH 2C4FU 4DWHA 1ZLSH 1FIGH 3BZFB 5HGHB 2CDFA 5DD1L 4XX1G 2EZ0D 3AB0C 2O5ZH 4PG2C 2ICWA 3OKEB 1UB5B 3QXAA 3O2VH 4KKBD 3WHE1 4TTGA 4Q9QL 2FATL 1RV6X 1AGCB 4BUHA 3VCLA 1FG2B 3FFDB 1L7IL 4XNQA 1IAKB 1XR8B 2Y72A 1A6TA 4RGNC 2HWZH 2I9LB 5F7DB 4K2UH 3H9SA 3G08A 3VXUD 2P45B 5D1QA 5IM7B 1Z0MA 3PWNB 1KFAH 5HJ3A 4U6HA 5EIIB 3GSVA 3BKMH 4JO1H 1MQ8A 2H6PB 1HHIA 3A0OA 5E4IA 2E9WA 1H5BA 5F7WC 4DN4H 4OGAC 3UCRA 4EUPB 1GOGA 4OGZA 4GKSB 2MOVA 1KPVA 1KB9J 4G8GA 4DZ8B 1OGTB 1I9JH 5CILH 2EDOA 1CU4L 1Z3GL 1UCBL 1K4CA 3GSRA 5C0ND 2J12B 2NCMA 2NY2B 1I8IA 3QNXA 2MPAH 2OXHA 3QDGD 5HI3D 5FO8B 1U8KB 2IAND 4GBXA 4K7PH 3DXAD 3VXNB 3S35L 3CXHJ 3FQWB 4BZ2L 1X5FA 5F3BB 4LEOB 4XBPB 1INEH 4B5EA 3T1FB 4DN3H 4W6XB 1DEEB 4MNQD 4KRPC 2DQTL 1IC7L 1S8DB 4U6YB 2RGSA 5JXEA 2GY5A 5JHDD 5GGSB 5C0JA 4F80A 4YHNB 1MWAH 4OCXH 5KTEH 3I6KA 2VZSA 4LHUD 1PVHA 4FXGB 3GSQA 3OG4B 1PQZA 3X3FL 3G6JA 3X3GH 3O4LD 2ZUUA 1NAKL 2HN7A 3IFOA 3REWB 1A7QL 4M1DL 5DSCB 3SKMA 3PIQA 1TCRA 4M3KB 1FNFA 1E28A 1VB9A 4FQQB 2VLKB 3OKMA 4N9OB 1WC7B 4MB5A 4OI9A 3P0YL 3DGCR 3NZ8B 5C0BE 5DJXA 5DC0A 4QEGA 5KTEL 4WWKB 3C60B 4O2FA 1R0AL 5IIEB 1L0YA 1VFBB 3QDHA 3CVIH 2XWJA 3T2OA 1N7ML 1D5MA 2RHEA 1BGXL 1AHWB 4DAGH 1CGSL 5EOCH 1E28B 5JXAL 2DTML 4XP9L 4PLKC 3QUXD 4XTRD 5DTFB 1YNLL 1MWAB 2HYMA 4N0YL 3AY4A 4XCNB 2Y25A 3O3EB 3V7MA 2VNCA 1HKLH 2QL1A 1E0OB 3QULB 3BT2L 5JQ6L 4DKFH 3G04A 5GS3A 4PLJD 4PRIE 1D5MB 3FOMA 1X5GA 4KY1H 2DF3A 5DO2D 4WHYH 2D3VA 3T4YB 3UJTH 1MH5A 3T3ME 4NZUL 3ULSB 3CLFL 5GZNC 1VKXA 4JY5L 4N0YH 2MQCA 4I3RL 4ZNEE 5C86A 1A6UH 3IS1X 1KLUB 1U93B 2I27N 4JFQB 3LQZB 2VLKA 3ARFA 3V4VL 4OCWL 1U8OB 4NQSB 1JZ3A 4UIKH 5H37H 4IRJD 1MCDA 5DFTA 5BVPH 4FFYL 2H3NA 1NBVH 3LKSB 1K4CB 4E5XA 5M94B 3G6JB 5ESAA 1FFOA 2JCCF 2EXWD 1WFUA 1B6DA 5D5ME 2MKLC 1T1YB 4S0TD 2P8LB 2ZG1A 1PG7H 4UNUA 1T5XA 1FDLH 4P99A 4KI5E 3B6SB 4OZHA 4GG6E 3OJDB 1NUFA 3CFEB 4NUGL 4XCCL 5ISZA 1ZOXA 4Y8DC 3PP3K 1J05B 1SJXA 2CRZA 1B6UA 3GI8H 4WO4B 4OAWA 4OLXH 3SGKC 1RZJH 4KVNH 4ELMB 4ZFOA 4YDKH 3DXAA 4HIEA 1LO3H 1ORSA 4PRHB 3DVFA 3IF1A 2A83B 2RR3A 4E41A 1JZ7A 1I7RB 2CO7B 2DI9A 1NFIA 5MEOA 3K74B 1A7RL 4OLUH 5BW7C 1U8MB 1PZ5A 3DVGA 5EBMA 4NUGH 4XCCH 3CU7A 3LEVL 3V4UL 5DD0H 1RUQH 4LQ1A 4ONGH 4G8GB 4DZ8A 1NC2A 3WO3B 3HZVB 1BFVH 4L4VD 2Z93B 4JO4H 3LD8C 3SDAB 1RK0A 3U4BL 1KCRL 1FE8L 1IC4L 1N2RB 3FKUS 4XNXH 3F58L 3V5HA 1JFQH 1NGWA 1Q38A 1RZ8A 2WIIB 1JYWA 1M7DA 1XCTA 1NBQA 3W9DA 4KZDL 1QRNB 4R4BA 5C08E 1W72H 1ROWA 3RKDC 3WS6A 2AQ3A 3FFDA 3P4NA 4P5TA 4OLUL 5KVEL 3IDIB 1KYOK 1YYMH 2D31B 1X5AA 3GO1L 4ZODA 4D3CH 2ICWB 3OKEA 2FX9H 1MPAH 2VQUA 3H7BA 4YHYB 3QDGA 3WD5L 3SCMC 5L88L 5HGHA 2AK4A 2PW1B 3QJHA 4LFHD 4M8QA 4WHDA 1MAMH 1FE8H 3MLPA 2YK1H 5CEZL 3U83A 4KRLB 2AXFA 4YFEA 1OVZA 2X4QB 4OUOA 1DSFL 4JHWL 4Y4HA 3U7WL 2Q87A 4Y16B 2FL5B 4PD4J 1O0VA 1U8HB 2R2BB 3S8WA 3OR7B 5DF0A 3TCLA 3I02B 5C2BL 2IGFL 2H26B 1ITBB 1U8QA 2QSQA 4UQ2A 2V7HA 4R6UA 4WWKA 3WKML 1JGLL 4NKOB 4X7TB 5IR1A 4P5KB 4YHZH 3QIWC 5C8JB 2GHWB 3S36L 5C07D 3RIAF 1EHLH 5C09E 3NACL 3QUZB 2OR8A 3I02A 5HYSA 3F62A 2E7LA 2NY6C 4P3DB 1WUNT 3VXRD 3VXUB 5J13B 3JWNC 5E03A 1RUKL 2IAMC 3VRJA 2HN7B 3UPAA 3ARBC 3DV4B 4BH8B 4Y4HB 1A3RL 5D6DA 3I6KB 4U1KB 3UZVB 3WDIA 3MRFB 1QVOB 3KPLB 2B4CC 1IL1A 2QKIA 4R4NC 4KTYA 3U4BH 5K59F 2XWTB 3NFSH 4P2OA 5ENWA 4OBSA 5GGSA 2YPKB 3MCG1 4TSCL 1U9KA 1IAOA 1EHLL 1U8PA 2EE3A 4YXKH 1MNUH 2IPKA 4BQ8A 4U1IA 3P4NB 4P5TB 3UTSD 5SV3A 3RBSA 1IQDB 1D9KA 1JPGB 4QNPF 5HHQA 5CEYA 2X9XA 1QQDB 2HJFA 1FGVL 1JCKA 1G9NL 1V5JA 4L8DB 4HJGB 4J4PC 5T3XH 1S7QB 3DYOA 1T1WB 1WIUA 5FGBA 1W0YT 1MIEL 2BOCB 1JTOA 2NTSP 3QEQD 3ARVA 3H9ZA 1UH3A 2DICA 5JHDB 1XGPA 4MWFB 2X89A 3QWRA 3RPIB 3TIDA 5EBMB 1TIUA 5TFSH 2W92A 3UPRB 4QRQB 1EO8H 3U6RA 1KV3A 4HIXL 4K3GA 4F7EB 5EIIA 4U6HB 3MFFB 3GHBL 2YWZA 1Q9WB 2WBKA 2G75A 4AT6B 2VLLB 4A6YL 4ZO8A 3I9GL 3MJ9L 4ZFGL 5CCKL 1I3GL 3EYVA 5F7DA 2G2RA 2XN9D 1FGNH 3U2SB 4YO0B 1MIEH 2ZNXA 1AGCA 3S36H 3RU8L 5I8OL 4MYWB 2PR4L 1TITA 4HAFA 3EFDL 2IJ0C 4WFFD 2D9CA 4ONOA 3CFEA 3DI3B 2XTLA 1LO5A 2WV3A 3MACL 4MJID 2JB5L 3IKCA 3QHZH 5CJBA 5EOQL 4XPTL 1QO3A 3ARSA 1NUGA 3IYLW 4LLMB 2A6JA 4FTVD 4YAQA 2GJ6A 1BM3H 4H8WH 5L9DH 3BO8B 1OOAA 1KB5L 4Z7VF 4L5FH 4YBQD 2QSCH 3ZE0E 1TENA 3VXTA 3NFSL 4F7MA 4M43L 2ZPKH 3TA3D 5C0DB 5JORB 3IGAB 2ZUWA 3ARFB 2DDQL 3HE6C 5FYJD 1ZGLB 1X5JA 5I8KH 4L8BB 5FKPA 6FABH 4PRDA 4Q0XL 2X4PB 4BFIA 1LK2A 2NYYC 2DJUA 1GIGH 2Q86B 3VXSB 5FYKH 3G5XB 3K7UA 2GJ6B 5AYQA 1ACYL 5C9JB 1UJ3C 1YEIL 5D72L 5CZXC 4UDUB 3L9RB 4X9FA 4DVBA 1C1EL 5CSBA 3QZWA 3MGTA 4Y5XA 1A1NA 4LSRL 2EYSB 2WP3T 5L2KE 5TE6H 1PYWB 3ZKMD 1M7IA 3IKKA 3F5WA 1S78D 1ZT4B 3QFJD 5K9QG 3BH8B 4KTDH 3FQNB 1KJ2A 2NY2C 4M5ZH 3RL1B 2HRPL 1RZFL 5F88B 1GIGL 4NZDA 3M17A 4X5WA 4GRWE 1P4IH 3QUXA 2D7MA 2GT9B 4K94H 4LCYA 4GMTL 4ACPA 1FP5A 1PLGH 3RGHA 3S4SB 4KROB 3V95A 3QR2A 3W0WA 2Y6SC 2KDGA 4F58L 5FUOL 2EDYA 5E6IC 4XWGH 2FLBT 4UU9A 3AS3A 4HQQH 5CMAB 1S7UB 3PE9A 2JCCE 3U1SL 3BYYA 4FQ1L 2FEDC 5C08B 1QZ1A 1BIIB 2XZCL 4RGNE 2NY4C 2VC2H 3VFWA 3OKMB 2XKSA 4XMLL 4P2RA 5TF1L 3C09C 5J1AA 1LDPH 4EXKA 4F8TA 4LP5A 5HYJD 3IDNB 1ZSDB 3C2SA 3EDDA 4OQTL 3S5LG 3K1KC 1M1SA 3L7EA 1F3DJ 3SE4A 3NN8A 3S96A 4EDWH 5ESVB 5IBUB 1NDMA 5IB5B 3MJ9A 3L5WA 2VO5A 1EJOL 3B2UD 3BAEL 4XNYL 2QKIB 1YPZE 1P84K 1AXSA 1T03L 5FIEA 3N1FC 5HDQL 4MXWL 1Q9LA 4JPVL 3NACH 1FN4A 3L3KB 1SEBA 1Z9MA 4P4KA 1OP9A 5EG6C 3LN9A 2O5YL 4M61B 1S7WB 5DD6B 3VFGH 4JN2A 1ZSDA 5B3JE 1FZKB 3OJVC 3ULUE 3ALXA 2P4AB 3FQWA 1FAIH 3SDDC 1A6PA 4LSRH 4LPUA 4PJ7B 5IJKC 4XC1L 3MLTB 3ET9F 1A3RH 1GOHA 4TUKL 5IFJB 5HHXL 4X9BA 2C7UB 5KG9A 1A6WH 5LBSL 5IV2B 4MJIB 3RY6C 1QRKA 4ETQA 3WEXB 4UU9B 2AJZA 2BVTA 1NGQL 3IS0X 1YPZB 3OKDB 4NQCD 3L7FB 1AGEA 4ISVA 1FO0B 3S97C 4P9MH 3FB5A 5EZLB 4NQEB 1ONQA 2ENSA 2NY4B 3CDFA 4UINH 4EUPA 3RZCA 4GAJL 4HCRH 5I74C 1G9NH 4LFHG 5F9JB 5D7LE 2UYLB 4Y16D 3GEWB 3TBVB 1OB1B 3KAAA 5IW1B 2BVEA 1P1ZA 3CH1B 2C3WA 1NC4B 4KKAD 3TM6A 1CLOH 3IJHB 3H9SD 1UB5A 1MCRA 4Y5XB 5K9JL 3S5LA 1I1FB 1F90L 3C8KA 2CDFB 4EIZC 2E8YA 1YJDH 5C09D 4LLVB 4WEUD 3GHEL 4HPOL 5C0GA 1DBMH 3NH7L 1IMHC 4MJIE 3VFMB 4WTXA 3WNOA 4XHQA 2PETA 2UVEA 4X6EA 1A3QA 5DURB 1CFNA 4HWEL 3D2UD 3MX0A 1YNKL 2GKIA 1KGCE 1T7YA 1JF1B 5EUOB 4IMKA 5GHWL 3DGGA 1CT8B 4NQDD 1I7UB 2RFXB 3HFMH 4Y4KC 3EYFB 2PYEB 4LCCA 5KSBB 5HDLA 3L1OH 4MA3A 4PJGB 2DAVA 4XNZC 4I3SL 2YN3A 4ODBD 5IMOA 3HI1B 2WWKO 3AB0B 1PKOA 2ZCKL 5IEHA 5CBAA 5F7EL 4OZFH 3BMVA 3TT1L 4JFFD 3MNWB 3BDYH 1EPFA 5DJ8B 2JF1A 3PABA 5FHBH 4HF5H 3BQUB 2HT3C 3GKWH 3ZYIA 2CUIA 3BKCL 1LEIB 4XH2B 1RJYA 4C4KT 3IJYA 3LKRA 4Q2ZB 4X98A 3D69A 3N9GH 2GY7B 2P8PB 3IDYB 4U31A 1R3LA 5TE7H 4FN0A 1T5XB 3FO0L 1QR1B 2Y23A 4YDVA 1CI5A 3NTCL 2YUXA 4RAHA 3Q2CA 5I18H 3GMLB 3JV4A 5K9QI 1WAAE 3IXTB 3S35H 4OLYH 1CGTA 3X13A 4Z76A 4OCRL 1SVCP 1NBZA 5DVMA 4IRZH 3NIFE 3QUYA 3W2DH 2C3XA 3CFKB 1XGPB 1OAXH 2WP3O 1J86A 5IB3A 4MLSA 1BLNA 5DQJB 5J9PB 1T4KA 1BQHA 4OZGE 1SM3L 1S9WA 5C0AE 5IMMB 1EGJH 1GC1H 2HT2C 3WN5C 3SDCD 1R3IH 2Q1EA 2A77L 3VGGA 1G84A 1IAMA 2WZPD 4ZUTB 4WTZG 4Y4KB 4GQ9L 5IT2L 1HQRB 3GIVA 3G5YB 1NGYB 1ORQB 4K07A 1YNKH 1IEBB 4Z8FL 1NGPH 3FFCA 5KSAA 3LEVH 4GXVH 1Q0XL 3BDXA 3LVEA 1UCBH 5E4EC 4C54A 3STZB 2DQHH 3L3HB 4OKDA 4NGHL 1FVCA 4NQED 1V7ML 2CJUL 5HD8D 2OQJA 2P1YA 1MEXH 2E6JA 2NY0C 1B9ZA 3R0MA 4NZJA 1E6JH 3AY4C 1AFVL 2C1PA 2DBLH 1BD2E 4W4NA 1XF2B 2XI9A 4I48B 2PW2B 3CPLB 3KVQA 4P3DA 1YQVL 1HK6A 3B4NA 3TO4A 3SE9L 4FQXC 1NJ9B 3VXSA 5D2NC 2DQJH 3TBTB 4YDJA 2VWEC 1BBJA 3EFFB 2F58L 5ETUB 1A0QH 3MLZH 5SWQA 5BV7C 1RHHA 5CEZH 1EUTA 3QFJB 1HXMB 2WK2A 4MDJB 2Z31C 3INUH 3BN3B 5FUZH 3JSSA 2CDGB 1NDGB 5LCVH 1LNUA 4PRNB 2Z35A 5C7XL 5JW3L 3TN0B 3OL2A 4KKCC 1KCSH 5F7LB 1RUAL 1IFHH 4JFXB 2AXFB 2VDRH 3G6AB 3WFZA 3DHJA 4M7LH 4DQOH 5C6TH 5IROC 4DGIH 5CUSH 3GJFA 3C6SB 3U7AA 1A5FH 5D7LD 3MLUH 3MLSL 3F6IA 7CGTA 3MRDB 3QUML 4W6WB 5H94A 1MCIA 5JOPD 1YN7A 2W60B 4R0LA 2OJZH 5F7FA 1HHGA 4POZD 5FV2A 5E1AA 3R06A 5ACMA 1FYTE 4IHOA 4ZUSA 1N5YH 3OZ9L 3VWJB 1U3HD 1X5IA 3V7AE 1U8KA 1YPZF 2WBJB 5EUOF 3RWGA 1WZMA 1OP3K 3RWCB 2ZCHL 1NCDL 2VJXA 1N6QH 4X8JA 3MLUL 3S3JA 1LO0H 3A6BH 2E9BA 2PNDA 4RNRB 1KEML 3MLXL 4PFEA 3UP1A 5IHLB 3T0BA 2PO6B 3Q6GL 2DQEL 2Q6WB 4Y19B 2HA1A 3KPPA 5BO1H 2HFFA 12E8L 2X40A 3PWNA 4U1SB 1OPGH 1QYGH 2N56A 1W72A 4G6KH 4MB3A 3U9PH 4MVBC 1OQOA 1BJ8A 1W0VA 5F96H 3I50L 4LVEA 1AP2A 4QRTA 5T3XL 4UILL 2ITDA 3RX5A 4O2EB 1VEOA 4YC2C 4JFPB 1W0WB 4L4TD 3WHXB 3WV0A 4O2CB 1E6OH 5J11C 2E27L 4APQA 3RDTA 5BCAA 1NLBL 4L8SA 1T83A 4NRXA 4YDVB 5EFIA 2J8HA 2FO4A 3PG2A 4APQD 1IGYB 3WFDL 3LV3A 4P23B 1HKFA 1RZIA 3MJ9H 3X11A 4ZFGH 1I9EA 4DVRL 4AY0A 2CH8A 2L7JA 4A2MA 3FN0L 4HXAH 3SKJL 1FL3A 4M3JA 3STLA 5KS9E 5JOEA 3L3IA 4GLRH 2ADJB 3H0TA 4HWBL 4P3WA 1T21A 3EYQC 4QCIB 4XNYH 5KSAC 3L5HA 3H9SE 5D71H 3TWCL 1J1OH 4GLRI 5F1NB 3T8XB 3GMPB 2KKQA 2E9JA 2VLKE 4EDXA 4PJGA 2NY0D 3KLHD 3UXFA 3U4EA 3P11H 1I7UA 2FHCA 3U0WL 1C8PA 4DVRH 4R7DA 3ZT5A 1BEYL 3BP6A 1N6QL 4OT1H 4UZGA 4M43H 2V2WB 3TFKC 1KFAL 3K3QA 2AS5M 1BOGA 1NAMH 1MFAH 5AZEH 2PW1A 3QJHB 3TO4C 4NM8H 4AENB 2DD8H 5L2JA 2OL3B 4LLVA 3LHPH 4OGYH 1FNEA 1UZ8B 3V0WH 3HR5B 4EZMA 2WAHA 2X4UB 4BM7A 4Z7OE 3U0WH 3RGVC 1WWWX 4OJFH 2GW5A 5I9QC 2B7DT 4ZUVA 1KPUB 4GW1B 5L2KA 3MBXL 1FFPA 1YYML 2NXYD 1QSFD 5D72H 4MZ3A 1D9KC 2H9GA 1WBZB 3O6FA 4RQQA 4ZXBC 3VRLF 3VD3A 3GSUA 3QXDB 1KIRA 5C0AB 1SVZA 2R4RL 4X80H 1YEJL 4NPYB 5GJSL 5IMMA 5F9JA 1DCLA 4H20L 1NLBH 3HG1A 4NNXB 4NC1C 4LHUB 1R3JB 3DVGB 3W11D 5K93A 3PXHA 4CVZB 5IWLC 5C0RL 4F9LA 4W6YB 4XBEL 5H2BA 2NW2A 1G7HA 3MCLH 1RFDH 2AJUH 4ZXBD 5DR5H 1A7NL 3I84A 2JB6B 1PQZB 3T1WA 3CZJA 3M07A 4H0IA 5GRZA 3IAGC 3EDFA 2APWA 1NL0L 2ZSVB 1P7KA 2G5BA 3TZVA 3AMKA 4ZTOH 2X4RA 1UJ3B 3GK8H 2D0HA 4QXGL 4Z95H 1T04A 3HI6L 1A1MB 1X7QA 4O4YH 4NFDA 3VDBA 3MRRA 5ANMA 3BW9B 5F89B 5BJTB 3VFUA 1K4DB 3MNWA 1S9YB 4N0FB 3LZFH 5M95B 3L1OL 1RFDL 2F54B 3UJJH 3CX5K 1RUAH 1J8HE 4BZ2H 2FB4L 1QSEA 2IAMD 2XFXB 3QIUC 5ESVA 1WVZA 1HIML 5CUSL 3V4PH 3V6OA 2Z8WC 5FHBL 2VXTL 4JKPL 4K9EH 1XF3B 3U0TA 3BWAB 4BZYA 4XP9H 4D0BB 4EKXA 2CR3A 4OD3L 1GGTA 4WWID 3C08H 4OZFG 2VAAA 4Z78B 4KDWA 5C0NC 3VXUE 3NIGE 3LDBB 4AIZB 3BI9X 2DQGL 5E9DD 5A3ID 4N9GA 2PXYB 4UT7L 3F6LA 5L6YL 3BEVA 2N7BA 3O9WD 3UZQA 4NCC1 2R2HA 1KIRB 5HGGS 2CXKA 4JRXB 1EUUA 1AKJB 1U95A 1SEQH 5I6XC 3HC0A 4X80L 5GJSH 2YPLE 1F4YL 1QFWM 1QKZL 1M4KA 3TZVD 3H9YA 5F7KC 3ARDB 1N8ZA 3C2AH 4Z0XA 4WFED 4YDIL 3HC3L 1EEUA 2NY0B 2FBOJ 3P40A 3W0WD 3MRJB 1WQVT 2BSTB 1GAFL 1IGJB 3QDGE 3F65A 1DQQB 3O4LA 4NWUH 3UC0H 1P6AB 5C0IB 1JI1A 4TUJB 3PQYA 1SBBA 4YR6A 2QQNL 2BNUA 4KMLB 5T1KB 5I15L 3ULVE 1KJ2B 4P59H 1QYGL 5AD0A 1KEGH 2R4SH 5DT1L 5F7UA 3DUHA 3ULUL 4XI5C 1F02I 4PP1C 4FZEH 1RJZA 1UC6A 3BH9B 2P5WE 4GBXC 1L4IA 4JZNB 1OARL 4Y2DA 1E4KC 3DTXA 1D6VL 5FGCB 5JXAH 2VISB 5HYIA 4CW1A 4Z7VA 2QQLH 4ODXB 1TXKA 3L5IA 4KRNA 4M7JL 5D7IF 3TPKA 4WUUD 4F37F 1HQ4B 2BVQA 5DD1H 1IGML 2XA8H 1ZT1B 2Q86A 1XF4B 5F1NA 3T8XA 3AVEA 3D0LB 2ILLA 5FKPB 4FZ8H 3EZJB 3BUYA 1FZMB 1JHLH 2NTFA 2YPLA 4HZAA 1UFUA 4OI8A 4ALAH 3UBXB 2IQAB 4MX7A 3DPBA 1FV1B 2DYPD 4IJ3B 5CILL 1OTTC 3RGVA 4NNYB 1FORH 1MCOL 3VXRE 4G8GD 3B9KA 2PO6C 4L4VB 3IU3A 1KIPA 3L7EB 1CFBA 1AD0A 4C55A 1JHKL 3KPOB 2K7PA 3A67H 4H26A 2CMRL 3JZ7A 2PO6D 2IG2H 2A74A 1B88A 3WIHA 3JTTB 3N06B 1KPRA 5ANMB 4GH7B 2P44B 3O2WH 1KCSL 1K8DB 1GZPA 1NH6A 2YMXL 2FGZA 4U1JA 1WWCA 2Z31D 3EOBA 4MMXC 1PG7L 5E8DH 1BIIA 1T89C 4B41A 2BJMH 5ADOH 5MHSE 1W72B 3HRPA 1INEL 1S9KC 3F7YB 4QTIH 4HK3N 5I1AA 3MLSH 4R2GC 3BKCH 1M7XA 4L4TB 1YYLL 4ZD3H 3EO9L 2C4XA 1Z9LA 4TVPE 1Q1JL 4XCYB 2HTKC 2NY5L 5BXFA 3GBMH 1CR9L 5TH2A 1TNNA 4I1NB 4GUPB 5E6IB 2CQVA 1UB6B 4MQ7B 3QEQE 4XP1H 1C16B 3SQBA 4L8SC 1A7OH 2ED7A 3ARYA 2UZIH 4E41D 1F00I 2J6EH 5BS0E 3VXOB 2DQUH 4XNQB 5I19H 3LMJH 4NP4L 1UG9A 4DKEH 3V5DA 2XXCB 2IGFH 3LQAL 1F13A 1T2QH 4JQXA 4ONGL 4R2GB 4GQPH 4X5XB 4ZUVB 1TZGL 3CZFB 3SGJC 1UEMA 3EJYC 3QUZD 4K8RC 1VENA 3KG5A 4LAJH 5B8CC 1S78C 1F4WL 3QUKB 1AKJD 4X99A 1A7NH 4XB7A 3O81A 3WFHA 3MLRH 3DUUB 5CJQL 1AXTH 1DUYB 2NY5C 2VKWA 2R2CA 4LHUG 1LWRA 1ZHKB 2XRAH 3CU1A 3GJFB 2HTLD 4GQ9H 2DIBA 3PV6A 3DUSA 2B0SH 2A6KB 5JOPE 3G6AA 4OLZH 4PJHB 1SMAA 5EOCL 1SQ2N 4ZAKC 3O0RH 2ICCA 4JKMA 3SBWC 2V2WA 1NQBA 3NFNA 4RFEA 3VW3L 4JO2H 3BGMB 3VG0L