2YPLD

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
199
structure length
199
Chain Sequence
b'EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAVSGGYQKVTFGIGTKLQVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 31
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD02
2C3GA 1AFVH 2FSEA 2CLVA 3MACL 4L8BB 4I13B 3V4VH 3WJJA 2IFGA 1R0AL 1T22A 4OZFH 5C6WH 4BSVB 1FPTH 3DSFL 5EOCL 3SQOL 4PJ8A 4OLVL 3ZT5A 5FUCC 4XBPB 4UV4L 4NUGH 2EH8L 2ARJA 2YWZA 3CDYA 3HHRB 2NYYD 5IR1B 2X89A 5DJ0A 4R26L 1HIML 1JNJA 1VFOA 3DYOA 2R2HB 4J23A 3K46A 2BMKB 5AEAA 3MROB 3KYKL 3VG0H 4QOKD 4AIZB 3BDBA 2FL5A 4Z0BL 3QO0B 3U0PB 3HZMA 3D85B 4NZUL 1KIRB 4KHXH 4P9HL 2Q6WB 2EYSB 3RWHA 3CNKA 3JTTA 4WFGD 1XGRB 3RQ3A 4CDGC 4P9HC 2J6EA 3QXDA 3RWFB 4ZDHB 4F7MB 2IGFL 5CSZB 4L29A 4MLIA 2OJEA 4RBPK 1KCVL 1FYTB 1Z0MA 1P9MA 2VXQL 3TN0A 5B38G 5DUPL 1IFHH 4F9LA 2BJML 2DQFB 2HJFB 4BZ2H 3F5WB 2HKFL 4IOSD 4Y19A 4UT9H 5KS9A 4XCFL 3BYYA 1AJ7H 4OIIH 1Q9OA 4DFIA 3H0TB 3TC9A 2G5RA 4TSAL 1RZIB 3W82A 2ITCB 2NY4B 3P4LA 3VWKD 3EDJA 4I8DA 1OSZB 3AY4C 5EOTA 4OLWH 5J13C 1K9TA 3L3IA 4WWID 4Z6AT 2PYED 4BELD 5E03A 1T1XA 4F3FA 1JRHH 4HPYL 3UZVB 5FV2A 3UPAA 3OGCB 3DMMA 4L8SB 4QHLB 3NCJL 4JQIH 1QR1A 2J88H 2ZG1A 4EI5C 3FB5B 2FH8A 4MCYB 2WIIA 1IGIH 4JHAL 3IT8D 3P30H 2JCCF 4HQQH 4YGVA 3KG5A 1MCNA 1YEDA 3A6OA 4BQCA 3MBXL 5FOJA 4X6DA 3Q1SH 3TBSB 2XQBL 4MSWA 5CZKA 1A6UH 1F58L 2VLRA 4Y4HA 1X9QA 4YEFA 2GK0B 4PREB 1LNUB 1EFXD 1PSKL 1BJ1H 2Q8BL 1U8MA 3LV3A 3G08B 4R9HA 4MDIB 2AK4D 1LEIB 1RZJH 3RWGA 3CZFB 5JHDA 1NAML 4NO0B 3NCEB 4FXKB 4GXUM 5IW6B 3NIGF 3LPFA 3WFEH 4O4YH 4CN4A 4WFGE 2OR9L 4ACPA 4RGNB 4XXCA 3ZMRA 4N0CC 1MF2L 2VAJA 5BVPH 4M7JH 4Y89A 4Z7UB 1DN2A 4BH7A 4OGXL 5IVXA 3VCLB 1T0NB 1CL7L 4UAOB 1WBXA 1D5BB 2HFTA 4DKAA 4WW2C 4W70A 4P2RA 4YAQB 4OI8A 4K9EH 5INDA 4EI5D 3O6ML 1S7WB 1HOCB 3ZKSD 1HQ4A 4M9PA 2IPKA 4GRLB 3PP3K 1Q94B 3DXAB 4G9FD 4JFDA 2XY2A 4ZMAT 1IC5L 5IFAL 4ZUUB 5J9PA 3ULUH 2BVOA 1SBSH 4FA8A 3VGAC 4PG9A 1P7HL 5K9OB 3T8XA 2PYEE 5CP3A 4JKKA 2ICWB 4MA7H 1XCQB 4M7LT 3TIDB 2FGWH 1LO4H 2XACC 4HUKB 5HGBB 2ATKB 1AO7A 4JFZH 4TSBH 1YEIL 4LEOB 2CGRH 1F3JA 1VPOH 2L7UA 4KZEH 5KJRH 1M71A 3H3KA 4JB9L 1D5IL 4F57L 5SWZB 4LSTH 5IEHB 3FB8A 4ZOCA 5C09B 4N0CD 1AGEB 1W72A 1ZAGA 3C2AH 4YBHA 5I18H 2RR3A 3CC5A 4LF3B 5LGJB 3WJJC 2XZAH 4S1DC 5DUMH 1UZ6F 4QTIL 4LSQH 4PLJD 1EV2E 3JV4A 4BZ1L 3D39B 4NQDA 3O41A 4PJ8C 1LMKA 3BDYH 3MCKB 2AK4E 1T3FA 2XYCA 1R5VA 3CCHB 1OLLA 2CUMA 5B3JF 1RURH 5E1AB 1A4JB 4U6YA 5ENWA 3VXSB 3U48A 1QSEB 1JZ3A 2BY1A 4S2SB 4GRWF 2COQA 5HHXH 5HYJB 4Y7MA 1ZSDA 4ZPVB 3OWEA 3GMMA 3C6SA 3DV6A 2OMNA 2OTPA 1JNLL 2XQYK 2YZ1A 1VFAB 3G6DL 3D0VA 3QDJA 4G6AC 3IFPB 3BPOC 4ZUTA 4ZAKA 4K3EH 4Y4FB 4Z0XA 43CAB 1L7TL 1AI1L 5JW3L 3F7VA 4NM8L 2O5ZH 3LQAL 1Q38A 2J6EL 3SKMB 4PP1D 1RU9H 4LLQB 4L4VA 2ZCLH 4G9FE 4NKDA 2DI9A 3V4UL 3MRFA 5GGSA 4YHKL 3IDNB 2ZPKH 3QEUA 1CG9B 5ALBH 4CVZA 2XKNB 2PTVA 1P9MC 1MHPH 1MLBA 3TN0C 4S1DD 1N8ZB 3Q6FA 4F9LC 1IC4L 15C8L 1TVBA 2AJZB 5HHNB 2EO1A 4KGLA 1RZGB 5DJ2B 4R7DB 1NJ9B 4K7FA 4JN2B 3KPOB 2BNUB 3I02A 4HGWA 4HC1L 5BQ7A 4L3EB 2Z92A 5D72H 3TJEH 2QHLA 3DRQA 3WL9A 3TBVB 1G7LA 4XPFH 3KPMA 1HH6B 2PW2B 2DQDH 3MOAH 3T09A 4FFWD 4XVUC 1KELH 3QQ3B 2BVEA 1KN4H 4G6AD 3RVXC 3DMMC 2BNRD 3EOTL 1I7RB 2P5WE 4Z5RB 5GGRB 2WW8A 3V52H 4JRXB 1CGWA 2DICA 1JNHA 4Y5YA 3SDYL 4X98B 1VGKA 1QBLL 1KT2A 2YA0A 3BKYH 5F3HB 5HYQB 2I9TA 1OARL 1MPAH 4YDKH 5D7JA 4Y4HC 3CSGA 5E8OB 3TN0D 5DMKA 2P5EA 4WCYH 2H45A 1S9XB 2BC4A 5SX4H 1NFIA 1I1RA 3MRBB 4S10A 5HVGB 4JLRA 5CJXA 4Y19D 1DQQB 1P6FA 4DZ8B 2N56A 2DQCL 2A2QT 4XP1L 2IH1A 3CVHH 1OPGL 1PQZA 5FO8B 4PJXE 1IAKB 4D94A 1VFMA 2X42A 2JJUA 3REVA 4XXCC 5EULV 1KENL 4OV5B 4WY7L 4PJAE 1DLFL 4GW5A 4XVUD 1CFTA 3L3GA 4XAKD 3EJJX 3V6OA 3V5HB 2IALB 4IMLA 1HILB 1NEZG 4Z7NF 2GKIA 4GG6A 3NAAH 3DMMD 3RWDA 1NMCC 4X80L 5FHBH 4QGTA 5DT1L 3T2NH 1T5WB 4NZDA 4KTEH 5IV2B 4POYA 2VAAA 1AGCA 4LVHB 4HS6A 1KTLB 4WU7A 5B38B 2EEDA 2CKBB 1ZANH 4NNYB 4PBXA 2VLRD 4Y4HD 2HTLD 3NZHH 1ES0A 3VFGH 4JFEB 1XR8B 1RUKH 4NKIH 5EIIB 2CLZB 1TCRB 4XX1G 2EDOA 3QXTA 1M4KA 3HA0A 5IKCA 2BNRE 2XXCB 3ARGD 1W8OA 5JHDD 1F6FB 1X5KA 2BDNL 2Q76A 1J0KA 2W0PA 4EI6B 1PZUB 2FBJH 4JZJB 4MX7B 3OMZA 3O8XB 1R3LB 3GO1L 4O00A 1W72L 1F11B 5C0CB 3T2PA 1RI8A 3ET9F 4NNXB 1II4E 1RULH 3GBNH 4JO4L 2HP4A 4YFDB 5CEZL 5D7IB 4ZUSB 3RY4A 5I1IL 2EICA 5T3XH 4WGWB 5DRZA 4P2RD 1D6EA 4LSSH 1Q0YH 1G7HB 1IQWL 1RK0A 1WAAF 2QJDA 3O4LB 4L8DB 5E8EB 1NCAL 5C7XL 1FO0H 1PAMA 4JFDD 4CMHC 4C59B 4OZHB 1QVOB 2AI0H 4JJ5A 4X8XA 3GSRA 4A6YA 3P9LB 6FABH 2AJVH 4BKLB 2AV7B 4YHMH 3S5LA 1VHPA 1TTUA 5F71A 4OBSA 1JWMB 4Q9QH 2EYRA 2VH5L 4J8RA 2VXUH 5EO1A 4ZAKC 4ZFOA 4PLOB 5J56B 4LLDB 1B0WA 1A5FH 3CU1A 1SEQH 1ZOXA 3SQBA 3IFLL 3U6RB 3VXRB 1SJVA 3MUHL 1FORH 4ETQA 2WQ8A 1A6ZB 4W4OA 1A1NA 3RDTB 3MRJA 4HKZB 1FZKB 3E1F1 1JGDA 4LLWA 4OKVB 1UXWB 3KPRA 1CT8A 1BZ7B 2JCCE 3CSYA 4X7TB 1BF2A 2E7LA 1FGNH 1A6PA 2ZSVB 1FG2B 2W0LA 3BPLB 5CEZD 4PRHA 4NQDD 2VDRL 3WHXB 3E6FA 5F1IA 4LOUD 4YX2H 3V6BR 2NXZB 2BSTA 4PJHF 1NGPL 1S5HB 1Z3GL 5J4MA 3EYFB 5CSBA 3IFOB 4ZXBA 3PP4L 4LEXL 5DYOB 5FB8A 4FFZL 1VDGA 1GYAA 5KW9L 2DLFL 3D2UB 3L7EA 3E6HB 3MXVH 4JO1H 3ARXA 1BX2B 4MA3B 3BRGC 3QDJD 1FZMB 2BNQB 4M4RA 3HZKB 4IM8A 4HS3B 2EXWC 4NQSB 4UT6L 2V7NA 2Y06H 1ONQB 4XHQA 5FYKH 3D3VD 4Y5YC 4DKFL 5C6TL 5AYQA 4JO3L 4L4VD 5ANMA 1JYVA 5I1KH 2VSCA 2HFFB 4N8VG 4U31A 2YS4A 3ZKXC 3TBWA 5IFJB 4MA8L 2B4CH 5FUOL 1MQKL 4PJBF 3OJ2C 2H2PC 5D7JC 5DJDA 5FEBA 4NFDA 4ZFFA 1ZE3C 2OR7A 2DQIL 1AGBB 1OTUC 4HV8A 5F96L 3JTSA 1CDJA 5CJXC 1YMMB 4RWHA 3UBXI 1XF1A 2DI8A 5DGQA 1INEL 3KYOB 1U8NB 1LDPH 4FS0A 4C55A 3VJ6B 1BOGB 3PGFL 3FQWA 5DFTA 5LGHH 1CE6A 2NY1D 4LCWD 1LEKB 5IQ7H 2B2XH 2I07B 3W2DL 5IMLB 2A83B 4NUJA 3V6OC 3U2SB 3TWCL 4QRUA 1I8IB 5HYFA 5I76A 4HLZG 1MI5E 1JWSB 1N59A 4PUBH 1CLYL 3LQZB 5C2UB 4ZOBA 2EXWD 3NTCL 5IK3A 4LVNC 2X09A 4H88L 4JGUA 1G9NH 1UENA 4J3TA 5D7SH 3TYFA 1QFOA 3MRMB 3OKKB 2BXZA 3BKCH 25C8H 3VFNA 4UOW1 3SO5A 3U4EA 2VWEC 5D7JD 4J6RH 4O2CA 3BWAB 4ZUWB 1HZHH 2Z0BA 2P5ED 4XCCH 1JZ5A 1G84A 3UPRB 1IGJA 2Y1VA 2BFVL 3GSQA 2JJWA 4GRWE 4P4KD 2VDOH 3DUSB 3CK0L 4EQ2A 1IGYB 3QWOB 3T2QA 5MERA 1BJ1J 1N0LA 4QNPE 1SBBA 2XI9A 4PS4H 1VESA 3D3VE 5SWQB 2AXGA 3NABL 5D71L 2WINA 1C12A 3IDGA 3HNSL 1INQB 3S36X 2RAMA 1EBAA 2EDWA 5EOQL 1RZJC 5GGVL 3W81A 1QPXA 3CU7A 2R8SH 2NXYB 5FCUL 1S9YB 4KRPC 2HH0L 2H9GB 7FABH 2XZCL 1EEZA 1U8IB 4TNWF 1LP9F 3QJHA 4YIQA 5I17A 2AJSL 4RISL 4XC3H 3LSOA 1DQJB 1UB5A 3ZKQD 1A6VH 1FL6A 3RL2B 2D3VA 3ULSB 4FXLA 4RSVA 4A6YL 5JDSB 3TZVB 2BOCA 5T1KA 2ID5A 2WBKA 1CXIA 3K80A 2FB4H 4OZGA 1HNGA 4LCWE 1GOFA 3IJSA 3Q3GB 5I15H 1FFNA 5EU4A 5E7BA 2P8PA 3RU8L 1Q9WB 3ARSA 3P9WB 5C0AA 3V5KA 3BXNB 3GJFH 4Y5VB 3D25A 1RJYA 1OW0A 5FYLE 5H35B 5DD3H 3O2VH 1P84K 4XP9H 2ZNWA 2BY3A 1S7UB 4Z9KB 1AXTL 4W4OC 5ITBL 1FJ1B 1HHKA 1IM9B 3MXWH 4XMKL 1U8LB 3WD5H 3UMTA 1NGZA 1NEZB 3TH4T 3ARZA 2E7LC 1EIBA 1B2WL 5B39G 4KRPD 1QFPA 1MCDA 3KDMA 5KVFL 2R29L 3KLDA 3BZFB 4LCYA 1FLRL 3IGAA 3JWOL 2AKRB 1PFCA 1XGYH 2CXGA 3ZTJH 4HUVA 2P24A 4P9ML 4WO4B 4C4KO 4K07A 3JWOC 2NY2C 5E8PB 4ZXBC 1IZJA 1ZXQA 2R0WL 3HE6B 3S35H 4CJ0A 1A6TA 1IVLA 4JRYB 1BQLL 4R97B 4J4PA 1NL0H 4QY8A 3MRPB 5L0QC 3NMEA 4Z7OF 3EDEA 5F7NC 4S1QL 3CPLB 4EXKA 2AJYH 3V6OE 3UYPA 4MNHA 3GSOA 3KVQA 4HUNB 4Z7VA 5LCVH 5TDOB 1BHGA 1FFPB 5C2BL 4GG6E 5J57B 4NKOB 4M9OA 1DBJL 4LMQE 1N7MH 1DUYB 4NO2B 4PGJA 3MV9E 4UIMB 3VXMB 3DTXA 1WWBX 5IGXH 3QCTH 1OP3H 4X0KA 1IQDB 3GKWL 1RHFA 1S7VA 4CKVX 3GSXB 3MLVL 2VWEE 5F9JA 4L5FL 1BVLB 4XNZC 5GGQH 2HFEA 3U7AA 3SKOB 3FT4A 4KVNH 4NHUB 3ZDZF 4J3VA 1I8LA 3OR6B 3UTSB 2F8OA 1ROWA 4MNGE 3GUTB 2XFXA 3EYSL 3MRDA 3G5ZA 4P5KB 5CFHA 2G75B 2VQ1A 1L7IH 1QLRA 5HHVL 2APVA 4O5LL 1T83A 3QFDB 2NY2D 4QRRB 4JZOA 4IRSB 2C9AA 5DS8B 5F9OL 2OYPA 4PJGB 1A7QH 5J1AA 3NFPA 4EN3B 1BJ8A 1OAUH 5I2IB 2G2RA 5GS0C 3DBXA 4M6NL 1YJDC 5GSRA 3I2CL 1U58A 4M6OL 4XCEB 4JQVA 2W0KA 1YY9C 5L2KB 5I73B 3DX8B 4RGOH 4FZ8H 4ODUA 2C3VA 3Q6GL 4KZDH 1RUMH 5C1MB 3H9SA 3VFRB 3TT1L 3V2AR 2KKQA 4Q6IB 2IF7A 3TIEA 2A9NL 4PJDF 3X13A 2IQ9H 3VH8G 1B0GA 4XAWH 3ARDB 4EUPH 4FQJL 3HS0B 3ARYA 2VDNL 5TE7L 4JREC 3AS3A 4G8EA 1DBMH 3EIFA 5CUSL 3MNVB 1J1PH 1SYVB 4OD1L 3QB7C 1K3ZA 5C0DA 1P7KB 1V7MH 4AIXA 1I9EA 2H6PB 4BQ8A 2OJZH 4GKSA 5EC1B 5BV7L 3FOMA 1K6QH 3RTQA 3W0WB 2VNCA 4JHWH 5BV7C 1DE4A 1JWUB 1NEUA 4YHZL 3RL1B 3GMOA 1BZQK 3OJDB 1YEGL 2VDPH 4NQEA 3GM0A 4KRLB 1I1YB 2EC8A 5GS0D 2FJFA 4PRAA 1DUZA 2A73A 1F6LL 5IB1A 3V95A 2O93L 3BMWA 3FTGA 1F4YL 1T5XA 4O2FA 5D2NE 2W9DH 1JI2A 4FMFA 1BEYH 2EDRA 1XGQA 3VGDA 3M8OL 2ADFH 3T3MF 5HJ3A 3OX8B 3FMGL 1CE1L 3GSUB 3WXWL 4KV5E 1DEDA 1GAFL 5FF6A 3PHOA 4PJHE 1IEAB 1VGEH 1WV7T 1PLGH 2WP3T 4OGYL 2ZUUA 3WNOA 2AV1A 1D5MA 1DFBL 4JFOB 1OW0C 2PO6A 1CICA 3B9VA 3HMXL 2DDQH 3F7QA 2QQQA 1NKRA 5F89A 3V6ZA 3G04B 3MRKB 2DLHA 4NWUL 2IFFL 1UJTA 1OM3L 1GZQA 4LU5H 1A7NH 1JHLL 4KDTA 1F2XK 3GHEH 4XHJC 3H3PH 2DBLH 4ZTPL 4M8QB 3QSKB 4HH9B 2C4XA 1QBMH 43C9A 3H9ZA 4MMXC 1XF5B 3IU3A 1MJ7H 3QT2A 4GOSA 3DV4A 3VXPB 1RZ8B 2EEAA 2OTUA 2VXSH 5TDPB 4JDVA 2EDHA 4Y88A 5TE4L 1SYSB 1MRFL 4CGTA 4P99A 4NN7B 1DBAL 3LB6D 5T1KD 3QUKB 4C57C 4OAWA 3I6GB 4XPHH 2CDEA 5TFSH 4L1HA 5FUZL 5K9JL 1NBYB 4J4PC 1V3KA 4YFLI 2MCPL 5DD6B 3F65A 5E2VL 4IHOA 3N9GH 1BWWA 5C0AD 3QIBD 1WZKA 4K3HA 1UC6A 1X6NA 4O9HH 5DC4B 1JGUH 1BJMA 2YOCA 4A2MA 2VDML 2DMCA 4KI5F 1QSFA 2R23A 2WUCH 4QYOA 4G42B 4H8WH 1Y6MR 4KK5C 3B8YA 4LKXB 2UZXB 3QIWB 1ITCA 3BPNB 4XHJD 5KVEH 3BPCB 3P77A 1J0YA 2GUOA 1S9WA 3DGGB 3FFCB 4LLYB 4JDTH 3X12A 1C7TA 1AQDB 4F7PB 1I8LC 1BBDH 3MLYH 3PHQA 5E5MB 5IESL 4M1CD 1QRNB 2X4NA 4MJ6B 3ZLQC 3FFDA 1F00I 2DKUA 5E0QA 4K7PH 3HUJF 5K9QG 4JDZB 1HH9A 1NPUA 1T83C 1QFUL 4ELMF 3WFHB 4YNYB 4IRJB 1H3GA 4LHJB 3MA7B 3GSNB 5DA0B 3GMNB 1F4AA 5TGBA 4PV9A 1JV5B 2PTUA 2NY6D 4J4PD 4NBXB 2VDQH 5ESAB 2ICEB 4YZFF 2DRUA 2JK5A 1BD2B 1CTNA 3QNZB 1HYRC 1KLFA 3EYQC 4JQVC 1CGYA 4XVJL 3B4NA 3MV8A 4WI6A 4DW2H 4HFWA 3T4YB 5KANG 5IOPA 5TH2B 5E70A 1A0QL 5CGMA 4PY7B 5KSUB 4WW2F 3ULVC 1RZKH 3W5NA 4GKZA 2V9TA 4KK5D 1T03H 4H20H 4I0PA 1LP9E 1GL4B 4MVBC 4X6CF 3DO3A 4YPGA 4B7LA 3NH7L 1IKFL 2OQJB 5E94B 5B39B 3CFJA 4V1DA 3RIAF 3EOAA 4OZIB 5I8EA 1D6VL 1S7XB 1MJ8H 4ZO6A 2ED8A 3UYRH 2VKXA 1R3IH 5IB4A 1KN2L 3OXRA 2YD4A 3RTQC 2B4CC 4M1DH 5HYSA 5FKAB 3BJ91 3MRGB 5I6XC 2YMXL 3D9AH 4JFXA 4CMMA 4U1GB 1ZWIB 4ZODA 3CLFL 5ITFB 1MVUB 4RMQA 4C56E 2LFGA 2D0GA 5D2LF 3EYQD 3O3BA 3T0EB 2QSCH 1DDHA 5GGRY 3H9SD 1A7OL 4JO2L 5GHWL 4BUHA 4F8QA 4XCNB 2R2CA 4PJBB 2E9WA 1WBYA 1MJUH 4MVBD 1EJOL 1KJ2A 4J1UB 2GCYB 3PWVB 3NFNA 3GI8L 5ALCH 1BP3B 4I2XE 4GLRH 3V4PH 1G6RL 3EZJB 3LN5A 1J7VR 3GSWB 4IIQA 4WWKA 4ZFZA 4M61B 3HPJB 3MCLH 3RUGA 3FO9A 4Y16A 1EERB 4TSCH 1LO2H 1IAII 1T4KB 3SDDA 1GC1H 2KBGA 2PO6C 4Z7OE 5IHZA 1CICC 3RTQD 5M95B 1ZS8B 3V0VA 4XZUA 3DURA 4KMTH 1G7QA 3O0RH 4ODXB 1QO3B 4UDUA 1TITA 1IGFL 2OXGA 3QEGH 4TQEH 5D7KD 5C0GA 3K3QA 4KDTC 2KL6A 2IPUK 1ZK9A 2HJKA 2YD6A 3RIAK 1IAIM 3O45A 4HKJB 1NGWB 1W0VB 4KXZI 1YEEH 3C5JB 4PRBA 4W68A 1FNGB 3JWDH 1MVFA 1ZHNB 3VH8B 3ZDZE 3TBTA 1K4CA 5KS9F 4KKNA 2HWZH 5F7DA 4PJ7F 4UDTA 4YDLB 5E99H 3QQNA 1WF5A 4H1LG 4PD4J 5GSVA 4LLMB 5TQ2H 2OMBA 1B4JH 3QPXL 5A43C 1DQDH 5F1NA 1RJZA 4NP4H 2LU4A 3FCTA 4YWGL 2QHRH 3T0WA 1S5IL 4Y5XA 3NPSC 1QLFA 1CICD 3VFUA 2EKSB 4EIGB 4R7NA 2XXMB 3B9KB 1FIEA 1RY7B 5T33H 3WFDL 1EEYB 4HIHB 1CDBA 4MXQD 4XPGH 2DQHH 1E4XL 4KY1L 1KB5B 4X6EA 3L5WA 5D70H 3SE9H 1NBVH 5ADPH 3KR3L 2MCG1 5CEXA 4X6DF 4PJDE 1HHJA 5DGRA 5DLML 3S4SA 3G6JA 4MJIE 3WS3A 3WKNA 4BH8B 5I8CA 1UYWH 4X4XA 1CQYA 5IMKB 3KHQA 5CILL 3ZDYF 5FDWB 1J18A 2MQ0A 4KQ3H 1KSRA 3C8KB 1QHPA 1X5YA 4LSRL 1U3HA 3BP4A 1AD0A 3WBDA 1ND0B 2OP4H 2DIBA 3MRNA 3PWNA 3BGMB 5MEOA 4HUWA 5HYEA 2J8UE 4YK4C 1S78C 2SEBB 3VFOA 2HVKA 1MHCA 4P59H 4TUKH 1ZLWH 3ELAT 1TQCC 3C6LB 1QP1A 4ODHH 3VFPA 3SGEI 3THMH 2P44B 3W9DA 3OR7A 1EGJL 3ZE1F 5F7WC 1QSFD 4F33A 2C4FU 2XZQH 1BREA 4UILL 1OCWL 3QDME 3L95B 2YXFA 2FO4A 4I0PC 3VDCA 4LARH 3H9YA 2GT9A 1QACA 2W0FA 2CKBH 2F9BT 3GMLA 3OKEA 5C0NC 2CJUL 3S37L 5D7LA 4G8GB 1SQ2N 2X7LB 5DVNA 5KZCB 4LL9A 4U0RB 5DHVB 4PJEA 2GJ6A 2A77L 2X4SB 2ORBL 4X99B 2XZZA 3P40A 4X4ZA 3QH3B 5DJ8A 3RZCB 5JOFB 3IJHA 1JNNL 1QEWA 4AT6B 4MD5B 3KWWA 3OAZH 4LSVL 3UJTH 1RVFL 1LEGB 4FNLH 4JPWH 2JIXB 2ZOKA 3ARBB 3JV6A 1XIWB 1KXTB 1S78D 2HVJB 3OB8A 1CXKA 3PGCB 3QULA 1DSFL 3ZTNH 1B6UA 3N85H 3DROB 1FL3B 2DD8H 4U1JB 1WCBB 3MV8D 4QHUB 5KSBF 1UJ3A 2W65A 2UWEE 3PWUB 5JHLL 3K74B 2Z91A 3K1KC 2CD0A 4WNQA 1CD1B 3MFFA 4B5EA 4M5YL 1KJ2L 2LU3A 4PJ9A 5BZWB 3U46A 2XY1A 3RY5A 2NLJB 4M1GH 4I0PD 1NC4B 5BOZG 3PWPB 4DCQB 4ERSL 1D9KA 3GI9L 3OZ9H 5EO0A 1ZTXH 3MRCB 4WEUD 1X44A 4V1DD 5C0ND 2A74A 5JMRA 2H3NB 4UBDC 4IIQC 4WWKC 4X6BA 1AXSB 2DWDA 3GMQA 3LD8C 3QDAA 4Q7DA 4Y16C 4RMTA 5GJTL 5HHOE 3SDDC 1M6OA 1PG7H 1ZLSL 2EIEA 4Q9RH 5IB3B 5DMIL 2GEEA 2X1PA 5JO5B 1T21A 4H0GA 3KPPA 4NN5C 1U8HA 1FFOB 2JELH 3GK8H 4OB5L 3C5SA 1JVKA 5D1QA 3DX6B 1WTGT 1U8QB 3BIKA 3HI5H 2VDKH 4YDVB 3QZWA 4XCYB 3QAZC 3DYMA 1WISA 1PEZA 1P1ZA 2OZ4H 1JPTH 3CFBB 3OKYA 5FHAH 1AKJB 1KC5H 3R06B 2DM7A 4PRPE 5DEGA 4DK6A 2X2YA 3O2DH 4M3JA 1GGIH 4OTXL 1C7SA 4AH2A 1FIGL 1QNZH 1U91B 3DO7B 1NLDH 4DOHE 2I9LB 3U36A 1CVRA 4P2OA 1MCSA 3Q2CA 3HUJE 4LCUB 1KJ3H 5H2BB 1WEJH 4WWKD 4ODVH 5CS7A 4QOKB 3EFDL 1R3HA 3FJTA 2NY5L 4PJ5A 12E8H 2QR0B 1FRGH 2MHAB 1TFHA 2PF6A 4ZD3L 1BIIA 5GJSL 3K2UH 4Y5XC 4KRNA 2NY5C 2VZ1A 5D8JH 1AQKL 1EUUA 4AEIL 1GGUA 4JEGB 1MH5B 4M62H 1C1EH 4XWGH 2IBGA 3TH2T 5KAQF 1TJIL 1PJ9A 3HCVA 5TDNA 5DD0L 3L7FB 3QG7L 5I75B 4K71C 3IDMB 2O5YH 4NQCA 4P2QA 4V1DE 4JM4L 2JB6A 3BW9B 5DK3A 2QL1A 2GTZA 3EDFA 4X5XA 2A1WL 2EH7H 5F7YC 4X6CE 5F6IC 5T5NG 4GW1B 4YDIH 3WUWA 2V9QA 3WDJA 1BOYA 1RIHL 1J1XL 5D4QA 4LK4A 4TRPL 4YO0B 2M2DA 4Q0XL 4Y0GA 2D7TL 3TNNB 1TTGA 2O61B 2APFA 5F21B 3WNKA 2A6IA 2EDBA 3DECA 2CPCA 2ZG2A 2A6JB 4AL8L 5L9DH 4X4YA 4E0RA 3ME0A 1U3HC 4OCMC 1VKXA 4RAVB 3ECBB 1OT2A 2Z35A 3ZDXF 5DR5L 2EIZB 4R4BA 5TPWL 3H3BC 4HHAB 1AC0A 2Z4QB 4MJ5B 2D03H 3KPSE 4QEGA 5F97E 3U4BL 1YEHL 2WWKT 3IB4A 1JK8B 5AYUL 5J6HA 3QWQB 1JN6A 2M8XA 4QCIB 5E4IA 3AUVA 4OCYH 1YN6A 1H3UA 4WU5B 3RGVA 5D2LE 2DQJL 5C0FA 5D96C 4GS7C 2HRPH 4U1HA 2Q86A 1CVSC 2ITDA 4CU8A 4EDXA 3K4DA 2G9HB 4KPHH 2E7HA 4L8SC 1T1WB 5KVGH 4HKBA 4TUJA 3QHZH 1K8IB 3OHXB 1F4WH 1VADB 1ZA3A 2EDEA 4HWEL 4JPKL 3WIIH 3JV0A 4F2MA 1EFXB 3LKNA 4H8WC 4RA3A 1NAKL 3LHPH 4UNVA 3BVNB 1YYML 1JIBA 4PR5A 3O3AA 4I0CC 4U1NB 3NN8A 3HG1E 5J12C 3ZE2E 2GY7B 4NYLB 1J5OL 1JGEB 3UTTA 1JHTB 2ZJSH 1PKQE 3R4DA 1ETZA 3Q5YA 4H1LB 1QKZL 2NZ9C 5CWSA 5J13B 5DURD 3TPKA 2B1HL 1UM4L 2W07A 2CRMA 1NC2A 4XVSL 1NGXB 3L3KB 1KEML 4JAMA 1BFVL 1PEWA 3ARVA 1UJ3C 3MYJB 3D0LA 4M5ZL 5EA0L 2OK0H 4EI5B 1YEFL 4DGIH 6CGTA 2AEQH 4DAGH 3JUYA 2V7HB 1LILA 3BE1L 4PJ9C 3O6KL 1EHAA 1LHZA 4GQ9H 3U9PL 4LP5A 1ACYH 1D9KC 5E00B 2AXJA 2BCKA 3K4ZA 5CBAB 3H2WA 5C0IB 3N50A 5EWIH 2N1KA 3IDXL 3TCLB 1RZKC 4ELMB 4KHTH 1AXIB 1FLTX 2K7QA 1NANI 1SJHB 4IJ3C 5I1HH 2XWTB 1NGYB 1KCLA 2FATL 1P53A 2ICWJ 2VXVL 3PDOA 3ZO0A 1GGBH 5IROA 2DMBA 2QQLH 4XPTL 2ZUYA 1NUFA 4ONGL 4WFHD 3RNQB 5GGUB 1RJCA 2YD9A 5D1QC 1NCCL 2CIIA 1X5AA 4BQ6A 2NZ9D 4HJ0C 1KTRL 1DVFA 1JP5A 4UQ3A 4N68A 3MLUL 3VFVA 2JKXA 4XTRC 1KCKA 3BESR 3WE6A 1CF8H 1JBJA 1CLCA 1FGVH 1DJSA 1JF5A 4Y1AE 1G9MC 3PQYE 4MB5A 4WW2B 5J8OA 4L4JA 3C09C 4MS8C 4LASH 1CXLA 1WZ1L 2DIAA 5MP6L 2EDQA 4HCRA 5KOMC 4DKDC 1BBJB 2C4FT 4PJ9D 5D5MF 3HRPA 3TBYA 2NNAA 5EC2A 4NT6B 3N1GC 3U30C 1D9KD 4RCAA 1KCSL 5C07A 4BJLA 4P2OC 1G7IA 3E3QC 2CK0L 5JLZA 3VGAB 3MRHA 1MSPA 3ZDYE 5FOBB 3V6FB 5ID0B 4QXUL 3D87B 5J0BA 5E9DA 4WUKH 3REWA 1I4FA 1KXQE 1QFWH 3K0WA 4ODBD 5C8JA 4QRTA 3U7YH 3O3DB 3CX5J 5GRVL 5KAQG 4NGHL 4HEPG 5A40E 4HJ0D 4XMPH 2VXTL 1GGCL 3F7YA 1GIGH 2FSEB 2CLVB 2PR4H 5C0JA 4XTRD 1YYLH 1OAZL 1NUNB 1T22B 3QIUA 4YC2C 5TF0A 4G6ML 4D3CH 3STZA 4PJ8B 4N8PA 3HFML 5DMGD 3VFWA 3I6LE 5I8OH 3T65A 4LRNL 2ARJB 2FYYA 2FBOJ 5DJ0B 5I0ZA 3U7WH 1K4DA 5HI5D 3G5VA 4QRPB 4P2OD 2EDNA 4TVPH 3HI6L 5DJYA 2NW3A 4JFHE 2EECA 4WFED 3TO4A 3DUHA 3V7AG 4P46A 4PJ5D 2FL5B 4XPAL 1SVCP 4YQXL 3BPOB 5MENE 1P2CA 3VRIA 1Z5LA 4OCWL 2NQCA 3O3UN 1E27A 3HZMB 4NCDA 1AJ7L 4JR9L 2G5BA 4XNMA 3RGVC 3RWHB 3HE7A 3NA9L 3JTTB 1INDL 5KSBE 4G7VH 3QXDB 4CUCA 4L29B 2OJEB 4NQCD 4P2QD 3MLPA 3RVUC 4NQUA 3L3DA 4I18A 3TN0B 1PW3A 2ZUQC 5HVWA 1VERA 2MPAL 4DVBA 4HUMB 8CGTA 4PRIA 4I77H 5KS9B 4Y19B 4MAUL 3P4MA 4NDMA 4P3CH 4LLUA 1Q9OB 1KYOK 3AC0A 3MNWA 4HULB 1MQ8A 4FMKA 1HHGA 4U1KA 5FXCH 1I85A 5L8KB 1W8NA 5EOTB 3L3IB 4JY6A 5FM8A 1T1XB 4JY4A 4F3FB 1JHKL 1IAIL 2GYSA 4JRWA 3W9EA 3DMMB 2C1PA 1QR1B 5C0BA 5AUMA 2WIIB 3ES6A 3RGVD 4YGVB 1YEDB 3GMRA 4OLZL 5BXFB 4UIKH 5I1GL 4X6DB 2ZNXA 2DAVA 5E8DH 1BZ9A 2VN7A 4MSWB 4JJHA 3VD4A 2VLRB 4Y4HB 3EYUL 4NZJA 5BVPL 2AEIT 4WFEE 2FHBA 2DM2A 4E5XA 1WK0A 3S5LG 2AEPH 1CGTA 4OZGF 4OFYD 4H0IA 1T0MA 3QHFH 1U8MB 4QHKI 1N26A 1OQOA 3HC4H 3LV3B 1BMGA 3RWGB 3EOYG 5JHDB 4GH7B 5IROC 4MXVF 4GXVH 3ZL4H 1OF2A 3UTTD 5DC0A 1WJ3A 4A2LA 3DIFA 3S98A 4N0FA 3MR9A 5ADOH 5AZEL 4FABL 3HNVH 4KQ4H 1DVFC 1UT9A 1U92A 4YHOH 5LWYH 5EN2A 1NC2D 2C1OA 2D7OA 3BQUA 3MMEA 4ETYA 4Y4KA 4BH7B 3TFKC 5IVXB 4RGMC 3L3JA 1JYNA 3RHWF 3CXHK 1C5DA 1XGPA 4NSKA 1WBXB 1T04A 1WSST 4GBXA 1NMCB 4P2RB 4HCRL 2IANE 2H32A 3L1OH 3O8XC 5INDB 1AGDA 4U3HA 2DMKA 1HQ4B 3K7UA 4JFZL 4V2CB 2E6QA 4JFDB 2E9BA 4M6ML 4B41A 3B5HA 5J9PB 1BLNA 2BVOB 4PG9B 3B2VH 1UFUA 2XN9E 5ISZA 3T8XB 3RPIA 5F88B 3WMSA 4N0YL 3DVIA 5K33A 4Q6YA 4LSQL 3HR5A 1G1YA 1AO7B 5JQHC 3ZDXE 4Z7VF 3AS0A 1F3JB 1GHFL 1M71B 1W72B 1NGQH 3GIZH 1FBIH 1MFEH 3CC5B 3TFKD 3QIUC 3G9VA 3JV4B 4M93C 5EU6A 2YPLE 4NQDB 2AEWA 3O41B 2DJ4A 3L3HA 3QRFM 2FD6L 4AEFA 4F37K 1T3FB 3FAWA 1KV3A 1R5VB 1PGRB 1LK2A 4CMHB 1OGAE 3JWNC 4U6YB 5C08E 2I60L 5E2WL 5ENWB 3GSNH 5C07D 1MCJA 4NO5A 1JCKA 2YN5A 1ZSDB 2ZPKL 4HJJH 4XMLL 3WO4C 4YR6A 3GMMB 4ODTH 3C6SB 3DV6B 3TO4C 3MC0A 1LDSA 1A7PH 4P46C 4FZEL 4UTBH 5GRXG 4FFVC 4O2EA 3RHWK 3D0VB 3QDJB 1A9EA 4ZUTB 4ZAKB 1CGSL 2YEZA 4H26A 5E9DD 4Z0XB 3X3GH 3OG4B 2ESVE 3VG9C 3F7VB 5GIRA 4TULL 3TH3T 3AVEA 1REIA 3LS5H 4APQA 4JFPA 4G3YH 3HE7C 3I6KA 3CMOH 4L4VB 4U1SA 3WFBL 4NKDB 4PJCF 9CGTA 1LO3H 5GGSB 1K2DA 3RIFK 2M26A 2BVTA 4HWZA 3GHBH 4PP2A 3QEUB 3ULVF 5IG7A 3Q5OA 4CVZB 1MLBB 4Y2DA 4I18C 5CGYC 4E41B 3Q6FB 4FN0A 1N6UA 1TVBB 4UI2A 4NNPH 3LH2H 5KTEL 1T7VA 4K7FB 4R90H 2Y4SA 3R1GH 1AH1A 5EZIH 3I02B 5T1DL 2YSSA 4WUUA 4HGWB 1XFPA 5BQ7B 4NHCL 2FNBA 4LQ1A 5E8NA 2Z92B 3WIFA 1I85C 3DRQB 4R6UA 3U1SL 3WL9B 4YHNA 4CADA 2CDFA 1G7LB 5L6YH 3KPMB 1Y6KR 1I9JL 2YUWA 3PJSA 2AABH 3RBSA 1T7ZA 1BQSA 1GJIA 3TO4D 3ULUE 4HZAA 2VDLL 4P46D 5TF1L 1TZGL 4FFVD 3SDXA 3CFIC 3U0WL 3BAEH 1YPZA 3T3PF 1A3RL 4X8JA 5M7QA 1F97A 1MCOH 1UA6L 1JNHB 2KQNA 4K8RH 2H1PH 4Y5YB 4HSQA 3HE7D 5T5FL 2DTSA 1VGKB 2BVUA 5GZOC 2DM4A 1KT2B 3FQNA 3ZKXB 3SJVA 3PF2A 2OSLA 2I9TB 4FQCH 5D7JB 2PUQT 5F1OB 4OUUA 4P5MA 5CGYD 5DMKB 5D5ME 3VD7A 2P5EB 2BC4B 5INCA 4PRID 4G6FD 4JLRB 1SEBA 2HT2C 1HE7A 2AS5M 2X4OA 5FAAA 1I9IL 4F8TA 2IH1B 4Z7QE 1PQZB 3LN4A 2FO1A 2B0SH 3REVB 2GK2A 1K3IA 1WCQA 5HDBF 1JTTA 4RFEB 4GW5B 5BMFL 1CFTB 1AIFA 3L3GB 1I8MA 3BQUC 5I1AA 1LD9A 4Y4KC 5FGCE 4IMLB 3MRRA 3VFGL 4QF1A 5LXGH 4W6YB 4GG6B 4LAQH 3RVTC 3RWDB 4GBXC 1MRCL 3GBMH 5C0BD 5TQ0H 1KJVA 4QO1A 1FAKT 1PY4A 4LVNB 4JVPA 4LPYA 1JGVH 4KTDH 4IOFC 4RDQF 2VAAB 1AGCB 3HR6A 4HS6B 5EZOH 2WSKA 4KDVA 1YA5A 3O11A 4WU7B 4FHBD 3SE3A 1ES0B 1OAYH 3GBNL 1J8KA 3FOLA 1T20A 2HT2D 4OD3L 1LWRA 3I50H 5IKCB 3W39A 4LSSL 1CR9H 2H8PA 2Q76B 5J11C 3MJGX 2F53D 1X6LA 5HD8C 3UJJH 2P43B 4OF3A 5JUEL 1KB5H 3DVGA 2FCBA 5IFHH 2VLKA 1SM3L 1ZHKA 5FV1L 6FABL 1B88A 2AJVL 5CJBA 4WI4A 4EBQL 3BQUD 2XTLA 4Y4KD 5L7XH 2CLRA 3SO3C 4KRPB 5DRZB 4GBXD 2P45B 4U6HA 5E4EC 3IDIA 1D6EB 1F3RB 4QXWA 3ZT6A 1PY9A 3ARQA 1ORQA 2PW1A 1WQVT 1RK0B 1N4XH 1C16A 2FH6A 3WUZA 1A5FL 5IVNA 4N1EA 3C9NA 3VDAA 3EJYC 2NX5E 4IOFD 5EUKA 1AC6A 4JJ5B 3GSRB 4WGVB 4A6YB 2X4PA 3I9GH 5FYJH 1DQMH 1UB6A 4WRLA 1B4RA 5BRZA 2GHWB 5CLTA 5ISZD 3S5LB 1NCBH 1MUJA 2YD8A 5DK2A 2IG2L 2EYRB 1DBBH 1E4WH 4J8RB 2VISA 4FQ1L 5EO1B 3DI2B 4Z7WE 3BHBA 4ZFOB 2AK1H 2WBJC 3G6AA 3LZFH 3JZ7A 4DGVL 4APQC 3SOBH 5HD8D 4MLSA 1G0XA 2IMMA 3UPCA 4ETQB 3CFDA 4FG6C 1A1NB 3VMNA 2B5IC 3MRJB 2IPTH 1OAKH 4MD4A 4FFYH 1JGDB 3FL7A 4LLWB 4OCXH 2BHZA 3KPRB 3OPZL 1CT8B 4QHMB 3CSYB 1W0WA 4Y2DC 1UWEH 2KDGA 3DUUA 1KLUA 5EU6D 1JF1A 4PRHB 1OD9A 4MNQE 4XP5H 5DHVH 3S97C 5F1IB 5AZ2H 1QLEL 4N5EC 4RMVA 2BSTB 3AB0C 3H7BA 3KPNA 1RMFH 1MAMH 3BI9X 3EJYD 2NY2B 3EUUA 2GAZA 4XP4H 4ZXBB 4PD4K 5T3ZL 3ROLA 4HAGA 2F53E 4KKBC 5FB8B 2J3SA 3O2WH 1T1YA 3Q0HA 3QFJA 5L0QB 1XCTA 3L7EB 4HXAH 3EYVA 1Z9MA 3M1BA 3MV7E 1P69B 4LGPB 2V5RA 3GJFK 3AMKA 3ZKNC 4Z95H 2FR4A 4QRQA 4AMKH 2V7NB 4OLXH 1S9VA 35C8L 1F45A 3RPKA 4JFFA 1LVEA 5ANMB 4UV7L 4FG6D 2HN7A 4RAUA 4XC1H 1OTTC 4UUJA 3TBWB 2B39A 1FQ9C 4XNZB 5DJDB 4Y2DD 1S3KL 5IQ7L 2W60A 4ZFFB 3X3FH 5ISZE 3FQRA 1CLOL 4Q6IC 5E6IA 4HV8B 4ZSOA 3JTSB 1HKLL 2IQAA 5IW1A 1I1FA 2K7PA 4P23D 4OM0H 1FVEA 4J3XA 4WUUD 3WFCH 3RUGF 1Y0LA 1UVQA 3NZ8A 3FO1A 1MWAA 1G9NL 3K2MC 4PFEA 4GO6B 1DL7L 3GRWA 4KVCH 1T7YA 4KKBD 3FQWB 3FN0L 4FTVA 5IT2H 1CE6B 5T3ZD 1IAOA 2PTTA 2VLJE 1G1CA 3EHBC 4PRDA 4J6RL 4NUJB 3DX7A 2VERN 1MHHA 4ODSH 4QRUB 4N0UA 3SPVA 3MODH 5I76B 1IGML 2F54A 1N59B 4NM4L 2OLDA 1Q1JH 3RWEA 1TLKA 3ZKND 1UH3A 3CVIH 2K3TA 3TESA 5BZDA 1FH5H 5IK3B 4UT7L 3QDGA 1TENA 4RDQG 5EU3A 3VD5A 5BJTA 1OP3K 3TYFB 3VFNB 1OTTD 1W0YT 3SJVD 2X1XR 3HZYA 4JREB 3U4EB 1VCAA 4O2CB 5EBMA 3B9AA 1NSNH 3SE3C 3MJ9A 5F1SA 5ACZA 2FIRT 1IGJB 2BRRH 3QI9A 5DQJA 3EYOA 3GSQB 2JJTC 5FGBA 2DQEL 1T89A 3MO1A 5MERB 1F13A 1YQ2A 2HFGL 2X40A 1BFTA 2YK1L 2P4AB 4XC3L 3D69A 3QXUA 5BV7B 2AXGB 2BSED 3WIHA 3WFZA 4OBRA 2WINB 1C12B 1I7ZA 2Q87A 2WZPD 1UZ8A 2YUVA 2D7PA 3EW3B 4X7CC 4PJCE 3V79C 5FGSA 1EEZB 3MACH 4PJFA 4L4TE 3NCMA 3QJHB 1R0AH 5I74C 4YUEL 4YIQB 5I17B 5A2KH 3LSOB 3O3EA 3DSFH 5EOCH 5MHSD 1UB5B 3SQOH 3G6JF 3U79A 1RSFA 3O2VL 4OLVH 3S7GA 4UV4H 5HDQL 2EH8H 3OAUH 4Q58C 2BOCB 5T1KB 3JXAA 5FYKE 4R26H 1HIMH 4U1MA 4OZGB 3IJSB 4FQXA 1FFNB 4LGRB 5EU4B 1WZMA 3BN3B 4XWOC 2P8PB 3ZSTA 2JE8A 3KYKH 3WNMA 5C0AB 4P48A 3V5KB 3D25B 1NFDE 1RJYB 1VFUA 2D0FA 5FKPA 5H37H 5DDHA 4Z0BH 2LAGB 1CDUA 4K2UH 2Y36L 4NZRH 5D6CA 1YZZA 4NZUH 4P9HH 3LDBC 5I71C 1HHKB 5HVFB 3L5IA 5DVMA 3CD4A 1I1AA 2VLKD 4ZOEA 5DK0A 1NGZB 4BSWA 3QEHA 4U6XA 4X9BA 1J0IA 3KLAA 2IGFH 4Z18A 3N0PB 4ODWA 2X4RA 4DZBA 1KCVH 2A6KA 3KDMB 1XR9A 3R0MA 2VXQH 4YXKH 5DUPH 2BJMH 4CVXA 4JM2A 4LCYB 1J05A 3IGAB 2HKFH 2YC1A 2MKLC 4HUVB 2P24B 1QPPA 4XCFH 4MXWH 1Q9KA 3WS6A 4ELKA 5IGXL 4ZNEE 5HYSG 3P73A 1A6TB 4TSAH 4KJQC 4H1LH 2NY6B 5DEZA 3VE0A 4QY8B 3PWLA 1CD0A 5BRZD 4LSPL 2YHGA 1BAFL 4MNHB 3GSOB 3FB7A 1E0OB 4Z7VB 5FA3A 5JDJA 1OGTA 3B5TA 2JJVA 4HPYH 1QA9A 3BKML 4YHLL 5CINL 2MMXA 3T4AA 2ZKHH 3K1DA 3NCJH 3DTXB 4NC1C 1VA9A 5KVDL 4RIRB 5EU7C 5JIIA 3KPTA 4JHAH 4X0KB 1FNEA 4FRWA 1S7VB 2OL3A 3MBXH 3TEUA 2YRZA 4K3DH 1U93A 2F8VA 5F9JB 5BS0E 2HFEB 3FT4B 2B8OT 2XQBH 5GRJL 5JIKA 1V05A 3M07A 2A0LD 1F58H 3KLSA 4HKXA 5E6IC 1BM3H 2O26U 3BZEA 2AJXL 1CBVL 3MLSL 2HKHH 2XFXB 3TO2A 3MRDB 3G5ZB 3SGDI 1MWAL 1PSKH 4FZ8L 2Q8BH 2VQ1B 1QLRB 4EUPG 1NCTA 3GRWL 5I8KH 3CFCL 1TJGH 3UTPD 1DN0A 1NAMH 4JZOB 3QUZA 3KXFE 1U41A 1UACH 4KJQD 4GMSL 1FNLA 4XNXL 1PX4A 5LG1A 2D7NA 3QFJD 5J1AB 1PVHA 2OR9H 3NFPB 5I66A 2G2RB 2EDKA 1QHOA 3DBXB 1MF2H 5GSRB 1U58B 4GG8A 4YFLF 1RK1A 4OGXH 1V7ML 4ODUB 3WHE1 2C3VB 3NIDE 3DRTA 3OKOA 1AP2A 3L3OA 3H9SB 1CL7H 1IAMA 1BGXH 4YHPA 2FECI 4JY5L 4JFFD 3O6MH 3X13B 4LLAA 1B0GB 2P42B 4LEOA 3MJ9L 1NCDL 4G8EB 1IC5H 1HWGB 1FNSL 2DWEA 4NZTL 3CLEH 1JUFA 2ATPA 3QI9C 5C0DB 4M43H 1LGVA 4XNYH 4GKSB 4U2ZA 5FGBC 2W38A 1T89C 2W9DL 3FOMB 3RTQB 4U1IA 3WIHL 5HSFA 1DE4B 2IJ0C 5I6XB 3MLRL 1YEIH 1IZKA 3AXLA 2ADFL 5FIEA 3GMOB 3DETC 5F7EL 3ARED 4NQEB 3W11D 1D5IH 1ZLVH 4F57H 2FJFB 4PRAB 1HEZA 1DUZB 1PLGL 2A73B 5IB1B 1XGUA 3ORJA 4YDJA 4UINL 5HBBA 3FTGB 4O2FB 1T5XB 3S4SG 3RWJA 1A8JH 2PYFA 4WW1A 2PXYD 4HK3J 3QDGD 2XG5A 4O51A 4URTB 1XGQB 3FRPA 1KCUH 4U2YA 3K4AA 5HJ3B 1KJMA 2DQTH 2ERJC 2R1YA 5GGTA 5E08L 5FF6B 1KG0A 3PHOB 5SWSE 1N0XH 1EMTL 3VXTA 4PPTA 4FQXC 1ADQA 1X5IA 3S3SA 3IDNA 1QBML 4LAJH 1Q8MA 4S1RH 1JPFA 3QI9D 5DJXA 1HI6A 1G0DA 4ONFL 2AV1B 2W59A 1JNLH 1D5MB 1NDGA 3OKNA 2PO6B 3G6DH 4XI5C 1CICB 5IIEA 5F89B 3V6ZB 1I8KA 1TIUA 1L7TH 3BD4A 4KK9C 1AI1H 5JW3H 1IC1A 4NM8H 2BNUA 4UZGA 4R8WL 5F9WC 2J6EH 1GZQB 1Y18A 1MCWM 1I1AC 2JTDA 3V4UH 1A1OA 1UWGH 1SY6A 1IGCL 43C9B 3QO1A 5DEFA 2YRLA 4G80A 4AM0A 3IU3B 1CQKA 3DV4B 1IGTA 4KK8C 2OTUB 2DLTA 2Q7NA 1IC4H 4JDVB 15C8H 4JM2C 4D0DA 3N1QC 1QBAA 2GSIA 2XTJC 4X7SL 3LAFA 3WS6C 4KJWC 3BEVA 2E9IA 5JW4Q 2CXKA 3D85D 4OAWB 2CDEB 4PTTA 4NRYA 3T04D 3LKSA 3MRQA 3AFLA 4FQXD 3G9AB 4TN9A 1JZ7A 4IHOB 1M1SA 5DUBA 4PYGA 4JDTL 1XEDA 4M6AA 3VXNA 1GPOL 5IB5A 1FYTD 4XPBH 3MLYL 3VWKA 1CU4H 3B2UC 4XI5D 3WDIA 3LPWA 1QSFB 2R23B 4HFUL 3EOTH 4KK9D 2EC9U 4QYOB 2PYEA 3SKJH 3NBNA 2OL3L 3SDYH 1ZGLA 5IMMA 4R4ND 1I1AD 5D1ZA 2DKMA 3P77B 4AEEA 2GUOB 2VDQL 1X5FA 4TPRL 5DJ6A 7CGTA 3X12B 2R0LH 3KYMA 1F6AA 1OARH 4LCCA 5E6ZA 3PHQB 4KK8D 2FX9L 3ZE0F 4XNQA 1LO5A 3U0TA 2FEDC 3WDHA 2X4NB 3WCYA 3V5HA 1EBPA 2W9EL 3FFDB 2YPVL 5DSCA 1SMAA 1HH9B 4PGDA 4POZD 1YECL 1FFQA 4KJWD 4XP1H 5TGBB 2FIKA 1OPGH 4PV9B 4H20L 5EPMA 1U6AL 1G7JA 3O6LL 4FQIL 2JK5B 5A2FA 4GRMA 1KENH 4YK4B 1DLFH 1KIUA 3QZWG 3MV8B 1TQCB 4HFWB 4N90D 4DUWA 5IOPB 4EDWL 2R0KL 2RBLA 3IF1A 1MNUL 2E7BA 2IADA 1F5WA 1J8HA 4GKZB 5DT1H 4I0PB 4NO0D 3IDJA 3VW3L 3D9AL 4YPGB 2NY7L 1F4HA 1MRDL 3CFJB 4V1DB 1R3KA 3EOAB 5D7IF 2FX8H 1XGTA 5I8EB 5CP3H 2WLYA 4ZQKA 1GOHA 4G9FA 2R2EA 3MA9L 1FYTE 4R96A 2FEDD 3QUYA 5IB4B 1NMAL 3OXRB 1P5UA 1VEMA 5EUOF 5HYSB 2UVEA 3ABZA 3QUZD 3FB6A 3GNML 2BDNH 4JFXB 4GRLD 4CMMB 5JA8B 4AYFA 2R2BA 1A64A 3GO1H 3PL6A 1W72H 3I75A 4U1LA 4XBEL 2DLGA 5ALCL 3S35X 1ZLWK 1XH3A 2ZUVA 3O3BB 2ADJA 2F8XC 2Y7QA 1DDHB 1V8HA 5CEZH 1A6AA 4TSCL 1LO2L 1SJEA 1KEGH 3MZTA 4G6JL 3WUWG 4AG4L 4KUZL 1MCPH 1IQWH 1WBYB 3SHSA 1N5AA 3KYAA 2JF1A 4EQ3A 1NCAH 1KJ2B 5C7XH 5JW5A 4TQEL 2YD7A 3NFNB 2P5WA 2QSQA 3LN5B 4IIQB 4LPXA 4WWKB 2F19L 4ZFZB 5SWZD 5I16A 3LD8B 3RUGB 3FO9B 4HKZA 4Y16B 2NYYC 1MIML 3SDDB 4L9DA 2GITA 2BOBA 3UXFA 3MOBL 5IHZB 5LBSL 1AR2A 3V0VB 4XZUB 3DURB 5CCKL 1G7QB 3SEPA 2EEBA 4UDUB 5K59F 4NN5B 2LQRA 5FGRA 2LVCA 4JANA 5C0GB 1P4IL 1SY6L 4EXPX 5E99L 5FM5O 2HJKB 3HNTL 5JOPE 3LN9A 1A4KA 3O45B 3QAZB 4RGNE 2XICA 3IDYC 5HYJD 1RIUL 4I1NB 4PJXA 5FDYA 2YD1A 5IHLB 3D2UA 4PRBB 4Z7UE 4PJAA 2VDRH 5DRNA 4Q97A 3TBTB 1K4CB 2E9JA 3VFSA 4U05A 2AQ3A 1GXEA 5EOCJ 3QCUL 5F7DB 1NGPH 1Z3GH 2FJGA 2DQHL 4UDTB 4OQTA 5SX5H 1K5NA 3DXAE 4HDIA 5GSVB 2UVFA 5ACMA 3PP4H 4LEXH 1NBVL 2A9ML 4FFZH 5F1NB 1CGUA 1RJZB 2WWMC 1WLHA 2DLFH 3FCTB 2YBRA 4RMWA 4I5BA 4Y5XB 3VWKC 3A67H 4M00A 1QLFB 1P5VA 2BVPA 1PDKA 3VFUB 2ADIA 2QEJA 4K23H 2VZOA 4HT1L 2B7DT 1CFVL 4FQPA 1Z0NA 3PABA 4UT6H 4DKFH 2YKLH 1A3QA 5C6TH 4KQ3L 4JO3H 4X6EB 3L5WB 3M45A 4K71B 5IVOA 2NW2A 2VC2H 3CUPA 3LKRA 5D1ZC 3TYGL 3WNNA 2BNRA 5CEXB 1KCRH 1HHJB 3B3IA 4MA8H 4OIAA 5FUOH 5SWZE 1MQKH 4P57A 3S4SB 5C09E 3G6JB 4LCCC 5F6IB 3WS3B 5GGVY 5I8CB 4HJGA 4X4XB 2NTFA 1YDPA 2DQIH 3BUYA 5F96H 2X9XA 3D39E 1Q72L 2MJWA 3J7HA 1INEH 1A47A 1U3HB 3BP4B 3PGFH 1AD0B 5DURB 3RRQA 3PWNB 5MEOB 3MRNB 4HUWB 3OKKA 3RKPA 3C8HA 3VFOB 2HVKB 1MHCB 3VXSE 3AGVA 2WWMD 4JPIA 1QSEE 3MNZA 5HYJE 3BZDA 1WUNT 3TWCH 4HC1A 3RY6A 3VFPB 1J9CT 2QTEA 3W9DB 3OR7B 1O5DT 4F33B 1CLYH 1X4XA 3QWRA 4OFPA 5GRUL 5D96B 4GS7B 3DVNA 1A14L 4H88H 2FO4B 5CJQL 4U6TA 5FA4A 4X5WA 2ZUTA 2GT9B 5D1ZD 2W0FB 4JPWL 5IUSA 3UJIL 3OKEB 3GMLB 1D5ZA 5D7LB 1KXVC 3UTOA 4YE4L 4OD2A 1T80A 4PJEB 2GJ6B 2R1WA 5HGHA 3QUYC 2Z31A 5DJ8B 5J12B 3IJHB 2IC2A 3ZKMD 2XA3A 4LBEA 2JCCA 3CK0H 3FONA 4OFVA 1QEWB 1UM5L 3ARPA 2EIBA 4KMLB 3KWWB 3PXJA 4M1GL 5JR1L 1H0DA 2ZOKB 3JV6B 3NABH 4FQ2L 4P4RA 5D71H 3PL6C 4L3EE 3MGTA 5T1MA 3ARGA 1I3UA 3HNSH 3QA3A 1JI1A 3QULB 4OKDA 3TT3L 1U95A 1BVKA 1ZA6A 5EOQH 2J2ZA 5GGVH 1UJ3B 2W65B 4U3CA 3HZVA 5FCUH 2AJ3A 2HH0H 2Z91B 2XZCH 3QEQA 4WNQB 3MFFB 5TJWK 1IEBA 4D0CA 2AJSH 5B3NA 2EC9T 4PJ9B 3U46B 1J8HD 4KUCF 2VITA 1FSKC 3QYCA 4K94L 2YD2A 1D9KB 3CFKA 4PLJC 2JELL 4JRXE 1DBKL 5EO0B 4A6YH 2HT4D 2R56H 2A74B 4S11A 2VDKL 1O7SA 4X6BB 5C0CD 2XRAH 1IM3A 2DWDB 3GMQB 5TE6H 5I1JL 3EDKA 3H6JA 5EBWA 4JKPL 2O5XL 3QUYD 1FFRA 4J12A 4IJ3B 1M6OB 2VB5A 3RU8H 1QSVA 3LKPA 2Y72A 5KSVA 1T21B 5GZNC 3KPPB 1P4LA 1U8HB 1QNZL 2Y5EA 3VXUA 3C5SB 5D1QB 4K7PX 3BIKB 5F8RC 3PL6D 5ITBH 1PG7W 4U4BA 3QZWB 5DQDH 4J2XA 1KJ3L 3UYOD 1WEJL 3PWJA 1P1ZB 4PP1C 4FP8L 4U3XA 1B2WH 3LMJL 3MRLB 1FRGL 3C09B 4GSDL 3K2UL 1H8NA 2Z8RA 5DEGB 4PY8J 4YHIA 3LS4L 1FLRH 3EBAA 4LSUL 4AH2B 1OLZA 3JWOH 2X1WL 4OQTL 3KLHC 1C1EL 3U30B 4P9MH 1MI5A 4P2OB 3S96A 2BSSA 1A7RL 2P5WD 5F6HJ 1BQLH 1WICA 1R3HB 4PJ5B 3GSXA 2I25N 4MD0A 2VZ3A 1BIIB 4GKNA 1IJ9A 3CSBA 3VI3F 4YDIL 4JFEE 4KDWA 5C2BH 2EKJA 4ZPTA 3SDXF 1NCUA 3SKNA 1DBJH 2CK2A 4FFWC 3RWIA 1YPZF 5GZND 1XF4A 1J8HE 1MCHA 3OTTA 4RWYL 3HCVB 5TDNB 1LO0L 4PJGF 3KPQA 3U4AA 5L9DL 4NQCB 4P2QB 3GKWH 5HDLA 3BISA 5HXMA 2JB6B 3C5ZA 2GTZB 4YC2B 4X5XB 5C0CE 1NDMA 3D3VA 4L5FH 4D9LH 3S36L 3INUL 3LQAC 3D2UD 4HLJA 1WVZA 1NCWL 1U8OA 2PN5A 2EE3A 3WUWB 2FECL 5D7IE 4DQOH 2YUXA 3GMPA 3HC0B 3EYSH 3KLHD 2YRPA 2A6IB 5HHVH 3MLXL 4O5LH 3O4LE 4X4YB 4E0RB 4CN1A 1VKXB 5T1LA 5F9OH 2Z35B 3O9WA 4OZHE 4GAYA 1CTOA 4R4BB 5GS0H 1YJDH 1U8KA 4NKQB 1QUNA 2ARJQ 5J7CC 4M6NH 3LHPL 3RY6C 5J6HB 1JN6B 4M6OH 4PB0H 3MNVA 3AM8A 1YN6B 5DVOA 3RGVB 4LCWA 3Q6GH 5C0FB 3NPZB 3LEXA 1S7QA 2XOTA 4B53A 3ZYJA 5IBTL 3TT1H 5IEKA 4U1HB 2ZJSL 4WVRA 4ESKA 2Q86B 2VQUA 2ITDB 4KU1A 2A9NH 4EDXB 2OTWA 5A3IC 5IWLA 2PNDA 1BQHA 4CBPA 4HKBB 4WV1A 4TUJB 3VXRE 4FQJH 5TE7H 2VDNH 3RAJL 2ZUQB 1ZA3B 2C26A 4F2MB 2WUBH 1MCIA 3LKNB 5CUSH 1ED3A 4LQFL 1HINL 4JE4B 3TP4A 3OKMA 2Z31C 4OD1H 4X6FA 1JPSH 1T6WA 4PR5B 3O3AB 3NN8B 4DGIL 2HTLC 3UTTB 5BV7H 3S8WA 3ZYOA 1G7PA 3R8BB 1ETZB 1HXMA 4GQ9L 4OJFL 5CWSB 4YHZH 4OV6F 4P4KA 3E2HC 4N8VA 5D1XA 5EBLA 1YEGH 3LEVL 1NC2B 3ARGC 2F5AL 5EWIL 4OT1H 4JAMB 2IWGA 1OSPH 4Y2OA 3WYRA 1DQLL 4NKMA 5HHMB 3D0LB 1R3JB 1TXKA 3VGFA 1N5YL 5E5RB 3QWRD 2BNQE 2F5BL 1G9EA 1NLBL 3M8OH 2BCKB 5A3ID 5AD0A 4EKXA 1S7RA 4JN1L 3FMGH 4P2YA 3WXWH 3MV9A 1GAFH 3FAXA 5C6PB 1SHMA 2Z31D 3MLTA 2NXYD 1MCWW 3PDOB 1XF5A 2BRQA 3SDAA 3HMWH 4LASL 1DFBH 4DTGL 5K9QI 4CNIA 2VE6A 1YMME 3KHOA 4HIXH 3TVMA 3G5YA 2CIIB 2ZCHL 1DVFB 2AXFA 4NWUH 4UQ3B 4MNGA 1OM3H 4EOWH 3VFVB 4ONHA 1I3RA 2FZ3A 3WE6B 4RGMB 4ZTPH 3IKCA 2LE9A 1TZHA 3FHAA 1HSBA 5DD6A 1R6VA 2MWCA 1MIEL 3QEQD 4WUKL 5DZOA 5HDOA 4G9DA 5JIHA 1PX3A 2DM3A 3T1WA 4C54A 5TE4H 3E8UL 3TBYB 5ICYA 2NNAB 1MRFH 5EC2B 3T1FA 3KPLA 4MZ3A 5C07B 1T2JA 4WJ5A 1G7IB 2R69L 5A1AA 3CJJA 4TOYL 5JLZB 3MRHB 1CD9B 1ORSA 5FUZH 2QQNL 4LOUC 5K9JH 3B83A 1JL8A 4I3RL 1H9VA 2MCPH 4Y8AA 3L5XL 3FO0L 5IW3A 5EUOB 5E2VH 1GRWA 1BVZA 3ESVF 5E9DB 3VI4F 3REWB 4PV8A 1I4FB 3EO0A 2EDFA 5C8JB 4HK0A 1N6QL 3ZHLA 4QRTB 3G5XA 5SV4A 1TETL 1OAXL 3OL2A 4NJ9H 2VDMH 3VXUD 1UG9A 4PBWD 4I9WE 4I48A 3H42L 4G5ZL 2KPNA 2W1NA 4MWFA 3F7YB 3NCYP 3ETBF 2APWA 4LLVA 5C0JB 3C5ZC 4JVUA 3QIUB 4OCSL 2NTSP 3STZB 4M93B 3ARRA 4U7MA 2C3XA 1VB9A 3VFWB 3T65B 4HH8A 5IESH 2FYYB 2E6JA 2VUYA 3BJLA 5BVJA 1U3YA 1WBZA 2I24N 1FC2D 1K4DB 1S7TA 3NACH 1MI5D 4JZNA 3G5VB 1QFUH 2XNAA 5D2NA 2EE6A 4OZIF 3WO4B 5DJYB 4PTUA 2NW3B 3RJQB 5I9QC 3TO4B 3O9WC 3MUY1 4X9FA 1PYWA 5EIQA 2Q20A 4K3GA 4P46B 5L88H 1IBGH 2APBA 3NCFB 1P2CB 3VRIB 1FAIL 3F62A 1Z5LB 3PV6A 1WIUA 4I77L 3VG9B 1E27B 1YY8A 5AG9A 4LHUA 3AM8C 1EXUA 4XVJH 3QEQE 4P3CL 2G5BB 4PJHA 4XNMB 5A16A 2NY1C 3HE7B 3NIGE 3ULVH 1WWWX 1PG7X 1A0QH 4HF5L 1G7MA 5FYLL 5F7UA 2RQ8A 5IWLC 1T7XA 1MEXL 4WV1C 3L3DB 4I18B 2HTKD 3NH7H 3C5ZD 1MREL 1IKFH 4G6KL 1A1MA 2VTFA 1V7NL 4DVBB 4OCNC 4PRIB 5I19L 1D6VH 3FT2A 3P4MB 4NDMB 2QKIA 4Q74A 4LLUB 2CMRH 5L2KD 5FYKU 4KJPD 3MNWB 1ERNA 2RB8A 4DGYL 2C7UA 3BRDA 1KN2H 1HHGB 4U1KB 4TTDD 3VXUE 1R24B 2GFBA 4HIIA 2YMXH 4P4KC 2P48B 3OAYK 5T1LD 3O9WD 3ARDD 4JY6B 3ARFA 4JY4B 4PG2A 2F58L 3CLFH 4JRYE 3W9EB 3BO8A 5CIPA 2C1PB 1M05A 1QYGL 1E4JA 5C0BB 3HC4L 1CFNA 5GS2D 5AUMB 1E4XI 4XX1E 1AE6L 3ES6B 4PJFF 2AJUH 4GXVL 3GMRB 1A7OH 2Y23A 2FWOA 5GHWH 3BSZL 5C0RH 3BH9A 1BZ9B 3UTZA 3VXME 4KROC 3BKJL 3NFSL 5FYLD 1EJOH 1TZIA 2V9RA 4D9RD 4E5XB 3GI8H 1UZ6E 2D7QA 1G6RH 5HVHC 1B90A 1T0MB 2Z93A 4R3SA 4ZS6C 2OM5A 1W0VA 3SDAC 2DQUL 1OF2B 3UTSE 4F7CA 5B3JE 2L4OA 1HN1A 2R1XA 3DIFB 5E7FA 4R4FH 4N0FB 3MR9B 3TVMC 1IT9H 1L6XA 2ZCKL 3MJ7A 2AQ2A 3A6BL 4X5LA 1IGFH 4X4ME 1H15A 2Q3ZA 2Q3AA 1U92B 5D1XD 4FQHA 2C1OB 3MMEB 4PJIF 3BQUB 5EN2B 4ZFGL 4Y4KB 2V6HA 1WIOA 4XVTL 3L3JB 1C5DB 4PJGE 3DARA 4TVPE 1XGPB 3P9MA 4NSKB 1T04B 4GBXB 1RIVH 2H32B 4Z77B 4NJAL 1AGDB 2HG5A 3DHMA 5L2KE 3FT3A 2Z9TA 4JM2F 4YPJA 2YWYA 3STBA 4MB3A 4HWUA 1BLNB 4KROD 5ICZA 1QQDA 2X1OA 5ETUA 1NGQL 3GIZL 3MV9D 5ISZB 1MFEL 5F70A 1CK0L 3EGSA 3RPIB 3KYNA 1EH9A 4R0LA 3F58L 1ACZA 3HR5B 1O7VA 1LP9A 1H8OA 4ZS6D 4YWGH 3SDAD 1S5IH 5J11B 5IMOA 4KH2A 5F9DC 5C9KA 4QXGL 1FDLH 3TVMD 1JPST 3W0WE 3WFDH 1FNFA 1CDIA 2PKDA 3QIBA 5CD5C 4KY1H 2I5YL 3CSPA 4NQTA 2W91A 4YXHL 4D9RE 3SO3B 2DL9A 4L3CA 3H9HA 5KN5A 3IU4L 3EO9L 3KR3H 5EU6B 3HMXA 4M48L 4UTBL 2QADC 2OR8A 5E4EB 3VGEA 5DLMH 1JTOA 3L3HB 1GVIA 1EDQA 1RUAL 3BH8B 1LK2B 1E28A 4ZOAA 2H41A 3CH1A 4C56A 1B3JA 5CILH 2OI9C 4GAJL 2CDGA 4NO5B 5D2NC 4HXBL 3TLRA 4YR6B 4JKWA 4LSRH 5DO2D 5DZLA 5LVEA 4O2EB 1A9EB 3GSVA 5JPNA 2YEZB 2IBBA 4H26B 1XF2A 2WBJB 1KYOJ 1EJ6A 3IAPA 5GIRB 4I2XA 4APQB 4JFPB 4JCLA 3I6KB 1RAMA 4CU7A 4U1SB 1ZHLA 2Y07L 3FHQA 1K2DB 5I1DA 4QGYA 4UILH 1OCWH 4HWZB 4PP2B 2B5IB 5CD5D 5IG7B 2VR4A 4TNWK 2HYMA 2HJLA 2AABL 1WWAX 4Y2DB 2F15A 3OKDA 2YPKA 1ZT7A 4Z7NE 3WKMH 4XT1C 2APXA 2QADD 4CW1A 3QRGL 3EAKA 5FO7A 3S37H 5EZJA 4EIZC 1M7DA 4I0KA 2YSSB 4WUUB 3LIZL 3RA7L 3AB0B 3DROA 2A77H 2ORBH 4AQ1B 5E8NB 1X5JA 2JB5L 3WIFB 1JNNH 4YHNB 4CADB 2CDFB 3PJSB 1N64L 4LSVH 1RVFH 5AWNH 2B1AL 1U8JA 1RUPL 3ARFC 4PG2C 3PV7A 2BHYA 3SDXB 5AAWA 5IM7A 1DSFH 1YPZB 2EZ0C 1KTKE 5FCSH 4LHUD 1BFSA 4X8JB 5EB9A 2NY0C 3MREA 1IC7H 5JHLH 1TJHL 2X4UA 5H94A 1OTSD 5F1KC 3UAJD 3FKUS 1PZ5A 1ZHBA 2B0SL 1CDCA 3FQNB 1KJ2H 3SJVB 4X83A 4H0HB 2OSLB 4G43A 1A6WL 1Q9LA 4OUUB 4P5MB 4ERSH 2VL5A 3CXHJ 4PLKC 4F58H 2ZOLA 1F2QA 5INCB 3K8LA 4I3SL 3MUJA 3RFZC 1SEBB 1YUHA 1RZFL 4K3JL 3MV11 1JE6A 2X4OB 3GBML 4DN4L 3T0ED 1WAAE 2VOTA 3LN4B 4PJDA 3FO2A 4ONOA 3P0GB 5ILTL 3ARWA 5DMIH 5CZVL 1EVTC 3ZHKA 3CGTA 3PE9A 4QXTA 4MJIA 3T0BA 5JPMA 1AIFB 1I8MB 5I1AB 3ARFD 4Q2ZA 3MRRB 4QF1B 2YD5A 3VWJA 2XA8L 2XG4A 2EZ0D 1BD2E 1KJVB 5A2JH 2NY0D 3QP3A 2QR0A 2FX7L 1X4YA 4ORGA 2J8UA 3LKOA 4GUPA 2FJHA 4OTXH 3UEZA 1FIGH 3O11B 1KOAA 3FRUA 1JZ6A 3BN9D 1J88A 4PLKD 4N1HB 3FOLB 3QDMA 5L7XL 4JG0L 1T20B 3LB6C 4HGMA 2VLME 4AJ0A 4OZIE 2NY5H 2V5TA 2VZUA 5CD3A 3W39B 1P7QA 4ZD3H 5GJSH 2H8PB 1N4XL 2UY7A 3SGJA 4HIEA 4RRPA 4O58L 4UTAL 4AEIH 3QUMA 3QXAA 4WENB 4PB9L 1G6RA 3DVGB 3QIBC 2VLKB 3AS1A 1TJIH 4LGSB 1ZHKB 1EHLL 5DD0H 4NRXA 3K8MA 2F74A 4HS8L 4K7PY 2CLRB 3JSSA 3DGCR 1NCBL 4LSDA 1HCFX 1JZ8A 4DKEL 4U6HB 3IDIB 5I74B 1U3ZA 3ZHDA 1ORQB 2PW1B 1HDMA 1C16B 1H3PH 2DJSA 3T0EE 3C9NB 5D6DA 4M03A 1RIHH 5EUKB 1J1XH 4TRPH 1BPVA 3T0AA 4Q0XH 3SOBL 1KPRA 2X4PB 3ZYZA 4D2NA 1UB6B 2UWEA 2ICCA 3MBEA 5LQBL 4OLUL 4PJBE 4M1CC 1OAKL 4AL8H 4OZ4A 4B50A 3VFMA 5BRZB 3TF7C 3WO3B 1MUJB 1CFSA 1KFAH 4JCMA 4X7FC 5DK2B 1HWHB 2VLLA 4GW4A 3RX7A 1LK3L 2G60H 2VISB 5DR5H 5TPWH 5KG9A 4DVRH 4HBCL 3BHBB 3U4BH 3MLZL 3G6AB 1JGLL 4LKCA 2NY6C 4KFZC 1L0XA 4GKOA 1RMFL 4M7ZC 1C08A 3LDBB 2ENSA 3CFDB 5I71B 2DQJH 2AW2A 5DHXB 4ZNCD 1F42A 4MD4B 5HHOA 3SY0A 5J6GA 1CN4A 1W0WB 3UBXA 2BERA 4DFHA 1KBGL 2RFXA 2J4WL 3DUUB 1KLUB 1JF1B 3I3EA 2R9HC 3PIQA 4P49A 4KAQL 2UUDH 5JNYA 1ZKAA 3DHJA 4ISVA 3H7BB 3KPNB 2GAZB 4JGJA 4C56D 1YYMH 4HPOH 1HNFA 3ROLB 1J5OH 5EFIA 4XC1L 1T1YB 3QFJB 1XCTB 4PRPA 3S3PA 1QKZH 3EYVB 4E9LA 3M1BB 5JTWA 2B1HH 1A21A 1UM4H 1KTDA 4XVSH 2HT3C 2FR4B 5DWUL 1KEMH 4G8GD 4QRQB 1BFVH 3RVVD 3HUJA 4OGZA 5IHBA 1S9VB 4JQXA 1OY3B 5EA0H 4NPYA 1SVZA 1YEFH 4JFFB 4NC0B 5C0EA 3FRPG 2HN7B 4RAUB 3BE1H 3M17A 3O6KH 4UUJB 5EDXA 4LVEA 5IT2L 2HLAA 4UQ2A 2W60B 5DJCA 3OF6D 3FQRB 2KH2B 4L9LA 5E6IB 4ZSOB 1AHWA 1XT5A 1I9RL 1EGJA 2R9HD 2IQAB 3B6SA 1I1FB 5IW1B 1CXFA 3IDXH 1FVEB 3GB7A 4NQXA 3CVIL 1Y0LB 1UVQB 3NZ8B 4AENA 3FO1B 1MWAB 2FATH 4NO3A 5K93A 4HUUA 4U0QB 2FRGP 4X6CA 4YXLL 4GAGL 4ONGH 4FTVB 2XV6B 1IAOB 4IDJL 1M7XA 2PTTB 1NC4D 1NCCH 4PRDB 3PWPD 5F7LB 3DX7B 1VACB 1MHHB 4N0UB 3SPVB 5DZNA 5FYJE 3VWJC 2F54B 1G9MH 2HT3D 3RWEB 2VKWA 3EO1A 3F12A 5BZDB 5HHPA 5B8CA 4PJXF 3RNKA 3QDGB 4OGAD 2CR6A 3NIFF 1JFQL 5EU3B 5BJTB 1WZ1H 1FVDA 5MP6H 3KPSA 4OFKA 4PJAF 5CJ8A 2GJZA 3ALWA 2X70A 4NN6C 3HZYB 4P5TA 3FN3A 5H8DA 1IRAY 2P7TA 4JKLA 3S88H 5EBMB 1KCSH 3J8F7 5L8JB 1JRHI 4DN3L 5ACZB 1I3GH 2CK0H 5E6YA 5D2LA 3PUCA 3QI9B 2LVEA 5DQJB 3EYOB 3UTQA 1T2QL 3MO1B 4P0DA 4G8GE 1MCQA 4QXUH 2P8MA 3QUML 3D69B 1NMBL 3SGJC 1AKJD 3O6FA 4GMTL 1DTUA 5EIVA 4XP6H 1AGFA 3B9DA 2BVQA 3OAUL 4MJID 4NGHH 1I7ZB 2Z8WC 1KUMA 5IJVA 2V2TA 5GS1A 4OLYL 5DRXA 5D9SA 1UZ8B 1E6OL 1BWMA 2VXTH 3HG1A 4QRPA 1GGCH 3F7PC 3BIAX 3VWJD 5JW4R 4PJFB 5H37G 2E27L 1PKQA 1OAZH 1MFCL 4MXQC 1OVZA 4ZO7A 1XAUA 4G6MH 1HYSC 3O3EB 2R0ZH 4NIKB 3HFMH 1MLCA 5D6DC 3TNMA 5EORL 3T0VA 4K2UL 4LRNH 3CX2A 4NZRL 5I1EL 3QNYA 3FQXA 4ZTOL 2ERJB 4U1MB 2C3WA 1T1ZA 3MBEC 2UZIL 5J3HD 4FQXB 1V3MA 3PWPE 4NBZB 1MCLA 3HI6H 3QDMD 4BK4A 4NRZB 2VL4A 4HMEA 4LPTA 2IAMA 2Q8AH 4JFYA 4YXKL 2N7AA 1GZPA 2UV3A 3WN5A 4XPAH 1P7QD 4YQXH 5FKPB 3MGOA 5DDHB 2FLRT 4OCWH 2J7LA 4X9IA 5D6CB 1WFOA 4MXWL 1Z9SA 4JR9H 5F9WB 4PJIB 4PJ7A 5C71A 1FE8L 3NA9H 1INDH 1I1AB 1ZLVK 5DK0B 2EDJA 4BSWB 2HA1A 1Q0XH 3QEHB 3BOVA 4U6XB 5A2IH 3KLAB 4ODWB 2X4RB 4DZBB 2A6KB 1XR9B 2EYTA 4CVXB 5F72S 4JM2B 4MAYA 3DX9A 1J05B 4Z78A 2V17H 1HYSD 2MPAH 3X14A 2XTJB 2YC1B 4KI5C 5ID1A 4MAUH 2AGJL 1Q9KB 2ZKHL 4ZYKA 4ELKB 4E42A 3X11A 3P73B 4MA1C 4Y1AA 2QV2A 3PQYA 3VE0B 3MBED 3PWLB 3UO1L 5BXFA 4U49A 3BDXA 5T5NF 4K3DL 2H26A 3FB7B 4QHNA 4HD9A 5FA3B 5L2JA 3C08H 1OGTB 1XZ0A 1BM3L 3QQ4A 4C58B 3FQTA 1JHKH 1IAIH 4HMCA 4HZLA 4LPWA 4QOKE 1QA9B 2HKHL 4RFNC 3T4AB 4LPUA 4OF7A 4JQXC 3QCVL 5I8KL 3RI5F 5MEQA 1NH6A 1AD9A 1TJGL 4O02L 3SE8L 1J1OL 1FNEB 4XH2A 1ZT1A 4NC2B 4WEBL 4GQPH 1UACL 4N0RA 4OLZH 5F44A 5HHOD 2OL3B 3BP7A 1U93B 5I1GH 2DQGL 1PBYA 5IVXF 3ROOA 2NZIA 3X17A 1CI5A 1VEOA 4HKXB 4L9LC 5E2TH 3EYUH 3BZEB 1AHWC 1KPUA 4KXZH 5KOVC 3TO2B 2XPGA 2PCPA 3C60A 1UH2A 4KI5D 5F9AC 1BGXL 1DN0B 5FUCE 3T3ME 3QUZB 3KGRA 2ZSWA 4PGCA 1MFDL 1T2XA 3P2TA 3WSQL 5AZEH 4PRPD 5I66B 4FABH 1M7IA 3QG6A 3MTRA 1HSAA 5DD1L 3CLEL 3HAEA 2Y25A 2FGZA 4GG8B 1RK1B 5DRWA 5E95B 4YHYC 4M43L 4HG4J 3DRTB 3OKOB 5F88A 1AP2B 3L3OB 4XNYL 3SGKA 5B8CC 4UNUA 5HGDA 4HCRH 4YHPB 3P4NA 4FXGA 2MKWA 5JQ6L 2L0DA 4TVSa 4L8CA 3UZQA 3WJLA 4G7YH 4M6MH 4P5TC 5MENA 1F8TL 2DWEB 4UB0L 1JUFB 3R0NA 4P3WA 2ATPB 3I84A 3V9FA 1WT5A 5KSBA 2EDYA 4N0YH 4OIBA 4F7EA 4LNVA 4JG1L 4U1IB 3O6FC 3AXLB 3RI5K 4WI5A 2X4TA 1UQSA 1KCUL 1GHFH 4HWBA 1OP5H 5KBNC 2DQTL 1ODAA 5GS1C 2NR6C 1N0XL 1N2RA 1RZ7L 5SX4I 1HEZB 4PGZA 1XGUB 3BT2L 4FQLL 1RUQL 4YDJB 4S1RL 1MFBL 3RWJB 1K8DA 2PYFB 4QNPF 4N1CA 4N9OB 4WW1B 3SGEH 1X7QA 4KI5E 4O51B 5EU5A 2FD6H 2UY6A 3IXTA 2XWJA 1NBQA 1QOKA 2FLBT 1KJMB 3KPSD 2KZWA 4P5TD 2R1YB 4WHCA 1KG0B 3EFFA 5FECA 2I60H 3VXTB 4UOJA 5E2WH 1S8DA 3GGWA 3MX0A 1CLZH 1UWGL 1MAKA 1JPFB 4XMLH 5DJXB 1HI6B 1O0VA 2IAMC 1YNLL 4E41A 1NDGB 3GBLA 4FZEH 3P0YL 3OKNB 5KSAA 5E2UL 1J86A 3WN5C 4ORZC 3ZSSA 4OM1L 5IIEB 2AVGA 1CGSH 1I8KB 4PJ8D 3O6FD 4ELME 1QFHA 3UCRA 4WI2A 4TULH 5ERWA 1Y18B 2X89D 3WFBH 5CMAA 5CKAA 1A1OB 2NR6D 3C87A 4YZFE 4H25A 4CJ1A 4OZFA 3HG1D 1FZJA 4QRPD 1F4XL 3QO1B 3IDYB 1KPVA 5DEFB 4G80B 4MCZA 4AM0B 4IBLT 1IGTB 3CIQA 4MAYC 4XPBL 4D0DB 5DHYA 1LE9A 1RJLA 2EDXA 2BSRA 1CU4L 2GSIB 5KTEH 1U8PA 4BFIA 3UC0L 1D5XA 3PDDA 4ZG1A 4ALAL 5T1DH 3BEVB 3SKJL 4NHCH 4PTTB 4NRYB 4GFTB 1FN4A 4MHHI 2IANA 3LKSB 3MRQB 3U1SH 4PRNA 1L0YA 3TA3A 1I9JH 5DUBB 2R0LL 1OD7A 3VXNB 5IB5B 2CQVA 2IAMD 1BF8A 4HWNA 2VDLH 2C3HA 3VWKB 5TF1H 1TZGH 5IJKA 5LAXA 3U0WH 4M7LL 5SV3A 2RCSH 1OL0A 1WC7A 2XN9A 2DS4A 1A3RH 4Z8FL 2PYEB 2VIRA 2BZDA 3CH8A 3NCYS 1UA6H 1ZGLB 3GJEA 1HHHA 5T5FH 2LU7A 3FQUA 5IMMB 1VENA 5D1ZB 3NIFE 3SCMA 5DJ6B 4N8CL 2D0HA 3KYMB 1F6AB 1FVCA 2J1KA 4GG6F 1P4BL 4LCCB 2MQCA 2XQYG 4RFEA 4XNQB 1LO5B 4MAYD 4WDIA 3U0TB 4ZO8A 2V2WA 4EVNA 3C60C 3L5JA 5DSCB 1YEJL 3RVXD 4PGDB 2P46B 2HAZA 2D31A 3OSKA 1I9IH 2FIKB 2K9UA 4IMKA 4Y1AD 1RPQA 3PQYD 5EPMB 8FABA 3VXQA 3HC3L 5IHUL 5SX5K 1G7JB 1TTFA 2YPLA 3CXDL 4OFYA 3AROA 2PETA 1WIPA 5IB2A 4GRMB 2AK4B 1KIPA 4Z76A 2FX8L 4QRPE 1MCKA 5BMFH 1OGAA 5C08A 1PKOA 2QBWA 2H32H 1N6VA 3SGKC 3OG6B 4JPVL 2GSGA 1MRCH 2GTWA 2GY5A 3IF1B 2ED9A 2IADB 1J8HB 1KNOA 1KIQA 1CFQA 3RP1A 3WJLC 3IDJB 2IH3A 3LVEA 2ESVA 5DD5H 1R3KB 5F3BA 3UROR 1YNTA 1XGTB 5JXAL 4ZQKB 3UZEA 4EJ1C 4G9FB 1WT5C 2R2EB 4RQQA 4R96B 3QUYB 1W2KT 1ZVSA 3F7RA 1C5CL 1R5WA 2VZVA 3C60D 1KEGL 4OD3H 4HWBL 1MCPL 4Y19E 5KS9E 4XXDA 1FZOA 3FB6B