2YPLD

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
199
structure length
199
Chain Sequence
EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAVSGGYQKVTFGIGTKLQVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplD02
3QNZB 3ULVC 5FXCH 3OR7A 3RWJB 2FECL 1K4DB 4KK8C 4KJYB 4FXKB 3HCVA 3NZHH 1P4LA 3VFVA 5DHYA 5I1AB 4QO1A 4FFYL 1ED3A 4I3GA 4PRHA 3T0VA 1XGTB 3FQRB 4IIQB 5HDQL 3EYOB 5IMOB 1PX4A 4MS8D 1BZ7B 1FRGH 1GOGA 2QADB 1MRDL 2Z35A 4M5ZL 2ZUTA 4OB5L 5DJDB 3PWLA 1XR8B 3VFWB 4R90H 3NCYS 3QXVA 1BZQK 4RFOH 1LNUA 6FABH 1F4WL 2EXYD 1NGXA 2YRZA 1U8IB 3DXAB 4WEBH 1IAKB 1HI6B 1L7IH 1IGCL 4IJ3B 1JYWA 3HRZB 4F57L 5C9JA 3SDXB 1AY1L 5IK3A 3IXAB 2ADGA 4I48A 5IVXF 1CFQB 1IT9L 3LV3A 2FHCA 5FO9B 1A1MB 3WNPA 2ZOKA 1DQDH 2R4RL 4M6OH 4NO2A 5D72L 4JQVA 2IAND 4X0KB 3GUTA 3PHOA 3VXUA 3VFRA 5E8PA 1ODAA 3HNSL 5E5UB 3TPUB 2BNRD 4R8WL 4Q9RL 4WJ5B 3UJJH 1MCDA 3DO7B 2Q1EA 4HPYH 2JKXA 3V52H 2L0DA 1QSFE 3CVHB 4N8CL 4S2SB 4L4VB 3QEGH 4MDIA 5L9DH 3HN3A 1TTGA 2ESVA 4ZMAT 1EEYA 2ARJB 1JZ7A 3O8XC 3UBXB 3DRTA 1DQLH 4M7KH 5ETUA 5IR1B 3BP4A 1R24A 4PJGF 4P2QA 4QRRD 1T20A 4OUOA 2HT3D 1QFWI 4G8GD 4XP6L 3KS0H 5JW4M 1HN1A 4YHNB 4IEFB 4OV5B 4M62H 2D03H 4OLWL 4D9RD 4HD9A 1KCKA 2XZAL 4X9FA 2BVYA 2FIKB 3ZKXC 4NJ9H 5B3NA 3LDBB 2R1XB 5DRZA 4MAYD 3JSSA 4F80A 4OSUH 5F88B 2XIDA 2UYLA 3ALXA 3CPLA 4F9LA 5HHQB 4FQ1L 1RJZB 3LN9A 4IMLB 5FV2A 4UI2A 3I2CL 4ZUVA 3DARA 5MENE 1OAYH 3KLAA 2BRRH 3G04A 1BPVA 4L3EA 4XVUD 1X4YA 2BSTA 1RUPL 3ALPA 5B3JF 3OKYA 1QBAA 3HI6L 4XP5H 2BJMH 3AMLA 4HAFA 3BRFA 2D3VA 3MV8D 1J5OH 2ZSVB 1XGYL 3MLPA 4JO1H 2DBLL 5DJXA 3DETD 3H3BC 3IF1B 1DE4A 2B2XH 2FBJL 1P4IH 2IAMD 3RTQC 4OD3L 5D9SB 5I1KH 1UKTA 4F7EB 3HZKB 5F6IB 5IQ9B 4OAWB 4NQSB 4KTDL 4N0UE 2APTA 1YEEH 3FB7A 1ONQA 4HT1H 1RZFH 3QPQC 2IBZX 1VSCA 1U42A 4OLYH 4KMQA 4O4YL 3GSRA 3RPIB 4R2GB 3Q48A 1OHQA 2DKMA 3KYMA 4GKOA 1JNNH 4N5ED 1TJHL 2M8XA 5EUOB 1C8PA 1HXYA 3KYOA 3RIFK 5JXEA 1YEKL 1G7LB 3VXSD 2K7PA 1LEIA 4ENEC 2BVUA 3W39B 3W5NA 1ORQB 2Q86B 5DD1H 1R0AH 3BP5A 3TIDB 1A6AA 3WEXB 4I0PC 3ULSA 2AJVH 1S7QA 4P3DB 5GRVK 1RIHL 1YMME 5I30L 3B3IB 1UACL 1CXHA 1JHTB 2AEQL 5HYIA 2IC2A 5HYJA 5IF0B 3I6GA 2V7NA 4M6NL 4YR6B 5C0BB 3KLHD 4TSCH 2F8XC 5KS9E 2L7UA 2P8MA 3SDDC 3OR7B 2OYPA 3BKYL 3B9AA 1Q9WA 2AK1L 3K0WA 3SDAA 3S88L 3HCVB 1P4LB 3VFVB 1SM3H 4GXVL 2JJSA 1ED3B 3IDXL 4L5FH 1CE1H 3DLQR 2J88H 3LRHA 4NKDA 2W1NA 1KCLA 1F00I 4YLQT 4MA7L 5KTEL 2ENSA 3PWPB 3GIZL 5E0QA 1A3RH 3PWLB 1I3RB 3WFBL 1FC1A 4PJCF 2A77H 1LNUB 5FGCE 1WFUA 4GBXC 3P77A 3ZT5A 3DHMA 2VQTA 1NKOA 1KB9K 1RZKL 3D2UD 4H5SA 2D4DA 4LLDA 5TQ2L 4NHUA 1SJXA 4HEPG 1VFOA 5AUMA 3V6FA 4WI8A 1NMCC 5C9JB 4OFIA 4PJBA 5HHVH 3WHE0 4UAOB 5IK3B 5FDYA 1CL7H 3I6KB 3MUZ1 4XCNA 4ZO9A 2ADGB 4DUXA 5BQ7A 1TETL 1N6UA 1FAIL 3LV3B 5EN2A 3B9DA 1H5BA 3H9HA 3RIFF 3TEUA 2MCPH 2ZOKB 4NO2B 2RR3A 2C4FT 2YUZA 1I9EA 1CD1A 3HB3C 3GUTB 1W0YT 2W9DH 3PHOB 4ZSOE 3VXUB 3VFRB 1T04A 5E8PB 3F58H 4I3SL 1XCTA 3L7FB 1PSKH 1P4BL 3CXHK 3F8UB 4E41D 5F1OB 3HC0A 1UA6H 4ODVH 2VZVA 4BH8A 3C5ZA 4LIQL 3MC0A 2AGJH 4MDIB 3CH8A 2CPCA 4C57C 4J4PD 3H9YA 3D87B 1VENA 2ESVB 1NL0H 1EEYB 2VLKE 3DRTB 3O6LH 1IQDA 5ETUB 2HRPL 4OI9A 1U2CA 1R24B 1LO2L 4NN7C 2PO6D 4P2QB 4N90D 1T20B 4AK1A 4KRPC 3WFEH 5C0IA 4TSAL 2UY7A 5EBGA 3B9EA 3HC3H 4PJIF 5T5NG 1J88A 4QKXB 3TN0B 3TVMA 3B9KA 3AM8A 2RHEA 1AXSA 2VSDA 4P46C 1RULL 2UYLB 3BXNA 1QG3A 3CPLB 4TUOA 4F37F 4LVEA 1H3WM 4WI4A 1NAKL 1FORL 1T7VA 4M6ML 4JN1L 3HI5H 4XPTL 4OGAD 5FYKE 3OKOA 4ZUVB 1D7FA 2CKBA 4CRPA 4ELKA 3G04B 4UIKH 4L3EB 2BSTB 5CD5D 1BF8A 4LPCA 1FFRA 3QRGH 2GTZB 4K7PX 5C0CA 3KPPA 4RNRA 1QO3A 4ZSOB 3S4SG 1MJUL 1A7OH 1QLEH 3TH3T 2ZUQB 3T2NH 3MRHA 5DK0A 4PRAA 3WFHA 3S37X 3F7PC 4OZFH 3RKPA 4KDVA 4JPKH 5DJXB 5F7YC 1IGML 4CAGA 1DE4B 4LPVA 2F5AH 4D9LH 5T1MA 3BGFC 3BZFB 2I60L 2P4AB 5HHPA 4OFYD 5A40E 1V05A 1ADQH 2YD3A 3FB7B 1ONQB 4PRDA 5LGHH 4GRLC 1WSST 4HK3N 1NUGA 2VUOA 4EXPX 5HGDA 4L9LA 2DICA 4LEXH 4NZUH 5DQDL 1EMTH 4UNUA 4OUUA 5J7CC 3GSRB 3KYMB 1PQZA 4MD5A 3E6HA 4PJDF 4NQDE 3GKZA 1HXYB 4JM4L 4XNYH 3ARUA 5E9DA 4QRPA 4U7SA 1CDIA 2NW2A 4N9OB 1MFCL 1LEIB 3MRRA 4IDLA 4LHUG 4JRXD 5D8JL 3K74B 3BP5B 1MQKH 4R3SA 4KK6D 3MJGX 2OL3B 1A6AB 1ZV5A 2F53E 3G6JA 3QJFA 1S7QB 1ACYH 5SWZE 1QKZH 4BUGA 5D1QA 4I2XE 5HYJB 2CO7B 3I6GB 4OCWH 2CDFA 2V7NB 4ETYA 1D3CA 3UAJC 3JUZA 4G6KH 1E27A 1A3QA 2AJYH 2P8MB 4WWKD 4UDUA 1DBKH 1I75A 1AE6L 4ZTPL 1Q9WB 3HNTL 2KDGA 2CUIA 2MOVA 1F58L 2IPUK 1DVFD 4LQFL 4JFYA 3VW3H 5FUCC 3SJVD 1HKLH 5C2BL 2NY0D 5I8CA 5DZOA 2BOBA 2P48B 4NKDB 2K7QA 3ZDXE 4YZFF 2HLAA 3WBDA 3UZVB 4KY1H 3EOTL 2RGSA 3BEVA 2NXZB 4K8RH 3QIUD 4PJAE 3P4OA 2WIMA 3DUSA 1T7XA 3QIBA 4O9HH 2E9BA 2IH1A 3LRGA 3STBA 4OFVA 4Z18A 3TBTA 4H5SB 4LLDB 3GMLA 1HHHA 4NHUB 1WBYB 2ZCKH 2C4FU 4CU7A 5AUMB 3V6FB 1JL8A 4NQCA 4PJBB 4XCNB 5BQ7B 3GSUA 3HZVA 4NWUH 2HWZH 3WXVH 5EN2B 4NJAH 3O4LE 5FYLE 1H5BB 4LARL 5GISH 2AXHA 4LBEA 5K9QI 3VXOA 5AD0A 5F9WC 1QSEA 3BWUC 5ESVA 1GGYA 3SGEH 3IYLW 2RCSL 1T04B 1RSFA 2F53B 4EEEA 5FUZL 1KBGH 1XCTB 2QBWA 2XTJB 4AQ1B 3VXRA 1JHKL 2NY2C 4PLOB 2EDHA 1WCBA 3RVTC 3TH4T 3QXAA 3HC0B 4BH8B 3C5ZB 3U9PL 4O51A 2XN9D 1AGFA 4U3CA 1GSMA 4G6ML 4ERSH 1MHHA 1GC1H 3GK8H 3RAJH 2AW2A 4U1SA 4U7MA 3MLVL 5D7LD 2ZOLA 1IQDB 1R3KA 3RGHA 5IB5A 1OTSD 3GMQA 2X9WA 5DMIH 25C8H 4KV5E 4AT6B 3TYGL 5C0IB 1FG9C 2OP4H 4L4JA 1JWUA 3WIHL 1G7HA 3IDGA 3HRPA 1C12B 1FDLL 2JJVA 2P46B 1EUUA 4LOUC 1YC8A 3QQ9C 3TVMB 1AJ7H 4OF8A 1RURH 3B9KB 1H0DB 1AXSB 5JIPA 1Z0MA 5AYUH 3BXNB 1G1CA 4X4ME 1NCBH 4Y19A 2OK0H 4KMTH 1MRFL 2A9NL 2IPTL 1FNLA 3OKOB 3ULUC 2CKBB 3T3MF 4ELKB 4BFGA 4K7FA 1N5YL 3WFDH 4D9QE 1E6JH 3FFCB 3KPPB 4YDKH 1QO3B 2DQEH 5L7XL 3MRHB 5DJ2A 5DK0B 1CTNA 1J86A 4ONHA 4PRAB 3WFHB 5E1HB 5GRJH 1P6FA 3UP1A 4XCFH 3IDJA 4U1MA 1WGOA 4IRZH 4M1GH 1HINL 5T1MB 3TFKC 3HUJA 1QBLH 3CC5A 1L9MA 4Z7VE 5L6YL 1BFVL 5HHPB 3EYQD 4LDLB 2EKSB 4KUZL 1IKFL 1DN0A 4PRDB 4OZ4A 1WAAF 5DD0L 1DQMH 3WNKA 1KJ3L 2HVJA 5HGDB 3O8XA 4L9LB 4N1EA 3LRSA 2P44B 4OUUB 2GK0A 3MBEC 1M7DB 3WNMA 1EZVY 3I02A 1PQZB 4MD5B 3E6HB 4OZIE 1FNEA 4MAUH 2A83A 3MZTA 1TVBA 1JNJA 2IADA 5E9DB 4UOW1 4QRPB 5L0QB 2NW2B 5DVOA 3MRRB 4NKIL 4Y1AE 1ORSA 5ITBH 1KGCE 4LSRL 5JUEH 1SYVA 4U2ZA 4PUBH 3LS5H 4R3SB 1A7NH 1OF2A 1V3LA 3ZLQC 2I25N 5DSCA 3G6JB 4JPIA 1XH3A 1DTUA 3L5IA 4KVCL 5GZNC 1QRKA 3EYSL 4TSBH 3EJZD 1RMFL 5D1QB 1RIUL 2O93L 2CDFB 4LDOB 4NDMA 1U6AL 2YUVA 2C3WA 2EDBA 4WU5A 1N4XH 1E27B 2DAVA 4GRWB 3ES6A 4YK4B 1WWBX 4UDUB 4NFBA 5FECA 2MKLC 4Z8FL 5JW4N 3SE3A 3WDIA 4JG0H 2D7NA 1A5FH 4U1GB 4RFEA 5GGSY 4MXVE 3S98A 3UTSE 2OZ4L 4PBWD 5I8CB 5KSAB 1NKRA 4AMKL 1FBIL 4PRPE 2HLAB 2Q76A 2W65B 1NCAL 4Z7WF 1NSNL 3RTQA 3BEVB 2JB5H 1VGKA 4XX1E 3P4OB 3DUSB 3QIBB 3H42L 3ARRA 2ADFL 3WV0A 1VEOA 3DGCR 3GHBH 2IH1B 4YBLC 1FNFA 1FYTA 1J87A 1BBDL 1YQ2A 3TNNA 3TBTB 2FJFB 3GMLB 1HHHB 1LO0H 4P5TD 1BEYH 4Q97A 1E4JA 5FGSA 1MCEA 3GJFH 2OS7A 3U30B 2RIKA 3KYNA 3LS4H 4NQCB 1BJ8A 4C54A 2Z4QA 3U0PA 5ADOH 3X3GH 3GSUB 2HMID 2KQNA 1UH3A 4Y16C 1KG0A 5E2WH 2Q6WA 2X7LA 1QLFA 1SQ2N 4LBEB 4AL8H 3P30H 5AD0B 1QSEB 1KELL 5ESVB 1JMZA 5BO1H 5CLTA 5AZEH 3GJFK 1XCQA 2DYPD 1WWAX 1PG7W 4PV8A 3G5VA 3GSQA 4CVUA 4MNQE 2CR3A 4I0PA 4KROB 1C5CH 5CEZL 3D3VD 3VXRB 3HPJA 1CIDA 4LSVH 3GBLA 1WCBB 3QULA 4G6JL 3UDWA 3QXAB 2YPLD 3U0TA 1U0QA 3QO0B 5H2BA 1GGBH 5DD3H 1S9KC 3EKCA 4O51B 3CK0L 1AGFB 3VMNA 1QA9A 4R0LC 3IS1X 3SDDA 4N68A 4U1SB 3MRGA 4NC0B 4KKAC 5C08D 3MOBH 4S1QL 1RD6A 4ZAKA 4TULL 2A74A 3V5DA 4FQPA 1FZOA 1R3KB 5DDHA 4YHZH 5IB5B 3GMQB 1TJIH 1JPST 3X3FL 2ZCLL 4JFDE 4MB5A 4RMVA 2FJHA 5HGAA 1JWUB 1DANT 1G7HB 3W9DA 2DQCH 3IDGB 2ADJA 3HAEG 1AGDA 2W92A 3BKCL 4IDJL 5HGBB 4LSTL 1KCUH 5TQ0H 4GBXA 5FUOH 3WFCH 5J1SC 5DVLA 3D0VA 2VLME 3LD8C 3TJHD 5I2IA 3T0ED 5F8RC 3QB7C 4Y19B 2VXTH 3U7WL 1ZSDA 3GRWH 5SX4I 1A9EA 3TO4D 3IKKA 3AB0C 4LSSH 3PDOA 2DTMH 4PS4L 4P9HC 1LK3H 2AEPH 4X6DA 2VDLH 2MTPA 3BGMA 4NBZB 2HT2C 4IRSD 2I9LA 3U0WH 2B0SH 1CDUA 5DHVA 4LCIL 4UV4L 3TH2T 1LO3H 3QDGA 2Q3AA 5JQ6L 1MF2L 1MAMH 3CVHL 4LPUA 4R97B 3IDJB 4U1MB 2FD6L 4JDZB 2FRGP 1LGVA 5IHUH 3RUGA 3HUJB 3CC5B 3QG6A 2AKRB 1TENA 15C8H 3D1MC 3ZT7A 1QHOA 4KDTC 1DN0B 3NPZB 4OZ4B 4YHLL 4PTTA 5I8OH 1OAKH 3QUZD 2Z8WC 5KVGL 4BKLA 3O8XB 3LEXA 2ITDA 1MWAA 1VFMA 4Z0XA 5A3IC 2GK0B 3RKDD 1EFXD 4LMQE 1DL7L 2VXUL 1IEAA 4HGKC 2VN7A 3HG1E 4HULB 5J1TC 1FNEB 2A83B 1YNLH 4Q58C 1TVBB 4JB9H 1MPAL 2IADB 3R4DA 4NRYB 4F58L 5I8KH 4WHDA 5JOPE 2JF1A 4JE4B 4UZGA 4X98A 3VWKD 2IF7A 2LU4A 1SYVB 5FCSH 2CIKA 1OF2B 3GSWA 4DJMA 3L5XL 3ZTJH 4P46A 4JPIB 1XH3B 2X4PB 4JR9H 4OQTA 5GJSL 4ZFFA 3QHFL 5IFAH 5JDJA 4LSUH 3TNMA 1ZVHA 3CMOH 1HQRA 1BGXH 4NDMB 5FM5O 5T3XH 3VXNB 4WU5B 1BD2D 3ES6B 3MYZA 3OAYH 3FO2A 4PIRF 1SEQH 4HF5H 4F33B 5FECB 3GSNH 4R7NB 4HMCA 2G5RA 3B43A 2V17L 4F7TA 4Y4FD 5C2UB 4GG6F 2R9HC 3VRLF 4RFEB 4JCMA 2I5YH 2CRIA 1U3HC 1HYSC 3OAYK 3LKNA 5ESAB 2Q76B 3RVXC 3DMMC 4EZMA 1DN2A 4X6FA 1C7SA 4WGWB 3RTQB 2LV4A 3EDEA 3VRJA 1VGKB 4O5LL 3MRDB 4NO0D 3L3HA 4NCDA 1HXMA 2DQIH 3K3QA 4B0MM 5C7XH 2VZSA 1T66C 1FYTB 4OJFL 4GRLA 3RI5F 2UVEA 3TNNB 5IQ7H 1MAKA 5E2VL 4I18A 4JO4L 5D7IF 1CQYA 4XPGH 3QDME 1Z3GH 3MXVH 3V5KA 1TVHA 3T4YA 2Z4QB 1J9CT 5ANME 4I13B 3BAEH 1FE8L 4OB5H 3ZKMC 4UIMB 2G5BA 3B8SA 2Q6WB 3O9WD 1QLFB 5E4EC 4NO5B 4U33A 1EUTA 4QTIL 3PP3H 3KXFA 1XCQB 3VG0L 3QCTH 5I19L 4PV8B 3OJMB 3G5VB 4PLKD 3QUKA 2YA2A 3GSQB 1ETZA 4I0PB 4FQXD 3A6BL 3MJ9H 3X14A 2ZKHH 1JYVA 3WE6A 4P2RE 3HPJB 3P11L 5I66A 4F57H 4LSQH 1MREL 2JE8A 4AJ0A 3U0TB 1RV6X 3IFLH 3K2MC 4R96A 1N3NA 1EGJA 2A73A 3PP3K 1LD9A 1UM5H 4V1DA 43CAA 5E1AA 3BKML 1LEGA 3B2UC 2K1MA 2R4RH 1OQOA 5KVFH 1NCTA 3MRGB 4GMTH 4PJEA 2P5WD 4ZAKB 3WS6C 5GS0L 5KJRH 3ILQC 2A74B 3V5DB 4R8WH 5T3ZE 1FZOB 5DDHB 4U1JA 1EH9A 5I1DB 3SPVA 4NM4L 1UEYA 1WBZB 4M03A 2FJHB 3MR9A 4M7JH 2VZOA 4N8CH 3W9DB 1ERNA 3O2DH 1AGDB 3R0MA 2WWKT 4GBXB 1E6OH 2AVGA 3EFFA 3D0VB 3BH9A 5TJWK 2XYCA 3VJ6B 4E0RA 5I2IB 3EJJX 3IDNA 2ZSWA 5A2JH 1WWWX 5CP7B 5I9QB 1NMCB 4O2CB 1A9EB 1X5IA 4NKMA 2DMBA 4P5KA 2D7PA 1Q0XH 3GMPA 5FKAA 1GYAA 5IT2L 3IU4H 3PDOB 4QEGA 3ARED 1T4KA 4X6DB 3BGMB 3NVQA 2I9LB 4K94C 1DBAH 3AROA 5DHVB 1CLYH 3MXWL 3QDGB 5HD8C 3QXUA 1KACB 5JORA 4PJGE 2YOCA 4R26H 4BQCA 3W82A 2R15A 1OD7A 3BSZH 5TGBA 5CJBA 2F54E 3L3IA 4PJFA 3N85H 3RUGB 2H45A 3QG6B 5CBEA 1KN2L 1G7MA 3ARDD 4KRLB 3CX2A 4RISL 1UVQA 1SVZA 1E4XL 1WC7A 5HBBA 4BKLB 3T3PF 3KPTA 4HZLA 2BY3A 1UXSA 3LEXB 1IJ9A 3UC0L 2ITDB 1VDGA 1MWAB 1I8KA 4Z0XB 3VMPA 1X5XA 4NN7B 3O45A 5JW4R 1I1YA 1J1XL 3O3DA 3UTPD 3LQAL 2FBJH 2NXYD 3WSQL 5B3JE 1IGIH 3FZUC 5D7JD 1RVFH 2GEEA 1ZEAL 4X98B 1U8KA 5TF1H 2CIKB 4OCXL 3GSWB 4P46B 1JPFA 5KANG 1PVHA 3AUVA 2VC2L 4O4YH 4ZFFB 1FIGL 1QRNE 4YDJA 4NN6C 1F6LL 3QWRD 3TNMB 4GH7B 5IOPA 2H1PL 4OLUH 1HQRB 5CHNA 3E6FA 3S3PA 4LHUD 1JWMA 1X5YA 2ICWJ 3QEHA 5DWUL 3Q6FA 3UROR 1A3LH 5FO8A 3FO2B 4WFFD 1Z9SA 3DYOA 5MHSD 2AJZA 2NPLX 1TNNA 4L4TE 1CGSH 1AXTL 3F5WA 1JUFA 3MX0A 5KSBA 4UBDC 4O02L 4Z7OF 4F7TB 1CU4L 2DOCA 3OL2A 1UACH 3PGFL 2NY3D 2HT4C 4D0BA 1UCTA 3QDJE 5JOFA 4A2LA 1MHEA 3ZDZF 1TZHA 5CGYD 3LKNB 1AI1L 3MA9H 4X6FB 3PQYA 3W0WA 1AR1C 4PPTA 3QIWD 2VLJD 3VRJB 4DVRL 3L3HB 1HXMB 2G75A 5JZ7D 5L2KE 2HJFA 2BSSA 4GRLB 1CDBA 2AK1H 3FMGL 2XA3A 1OGAA 1JI2A 3JXAA 4I18B 4N9GA 3G6DH 4UNTA 3V5KB 1TVHB 3MBEA 2WZPD 2P47B 3JWOC 4K55A 1OAXL 1UWGL 1P6AB 4G6AC 1S78D 4CUCA 1BLNA 3N1GC 4UT9L 5I1CL 1T5WA 3SY0A 4Q6IC 1LQSR 5KTEH 2V9TA 1B6DA 2FB4H 2G5BB 3CCHB 3QUXD 1KTKE 1CICD 1CD0A 4EDXA 3RHWF 2OL3L 4ONGL 1VFBA 2BNRE 3KXFB 1N59A 3BKJH 4QXGH 5ESQA 1VEPA 4HUVA 3QUKB 1ETZB 4GOSA 1GGIH 4PV9A 3X14B 5FYKL 3WE6B 2AABL 2LU7A 5I66B 1JGEA 3N06B 1I7ZB 2IBBA 1MIEH 2E9JA 4R96B 4G8FA 2A73B 2WQ8A 1FAIH 1LD9B 2BC4A 4PJCE 2OR9H 2VZ1A 4V1DB 43CAB 3QISA 3FQNA 5E1AB 1LEGB 5GS1C 3P4LA 3RA7L 3FQUA 5SWQA 5EU6E 4PJEB 3DNKA 4M3KB 2H9GA 5DA4A 1RU9L 2K9UA 2VO5A 1KF9B 3DHJA 4LGPB 4U1JB 2H2SC 4ZUUA 1P4BH 3QNYA 1P9MC 3K1KC 2LVCA 3OKMA 2DWDA 3ARBC 4NNPH 3BN9C 5JQHC 3SO3C 1OPGL 4D9RE 5JDSA 4P23C 5ECJE 4MQSB 4YBQC 2B5IC 3EOAA 2OJZH 3EFFB 2X05A 1TQCB 3BH9B 4YWGL 4E0RB 4XWGH 3BW9B 4JDTL 4TVPH 5FOBA 3IDNB 4PBVC 2ZSWB 4GAGL 1VEMA 4YJZL 4CJ0A 1LO2H 2XG4A 3QDAA 4H1LG 4GQ9L 1T2XA 1MCKA 1WFNA 4PYGA 4NKMB 4I4WA 3CX5J 3K8LA 3GMOB 1UB5A 5FKAB 3DBXA 5EZJB 5LWYL 4Q0XH 3AS2A 4OI7A 4Y16A 1T4KB 3JBG7 4PTUA 2ATKA 3QNXA 5F9WB 1FNSL 4Z0BH 4C56A 2OQJA 3SKJH 1D9KC 1IKNA 1K5NA 3PL6D 3EO0A 3GI9L 5JORB 3AXLA 3BPOC 3JWDL 1ZHNA 2YC1A 2NY2B 4KHTH 1FORH 5TGBB 5C1MB 4JN1H 3L3IB 1B4JL 4MA1C 4MA8L 3IETA 3PWVA 4DAGL 5CBEB 4C4KT 4PJIE 1IGTA 5DA0B 1G7MB 4S1RL 1I1CA 3WFZA 3STZA 2D7MA 2VISA 4H26A 4RRPA 1ZK9A 5EU6B 1UVQB 4Z77A 3NCYP 3SE9H 1WC7B 3D25A 4P2OC 1UXSB 1NGZB 4XVJL 3U2SA 1I8KB 5FV1L 1PEWA 5EO0A 1CT8A 4TUJA 2OTWA 2RQ8A 1G9NH 1SY6A 4PJHA 4FNLL 4R9HA 2NY1C 5FYJU 5IESL 3O3DB 2J8UF 1F97A 1G0YR 1BX2A 5FHAL 3NA9H 4LCUA 5CS7A 2QQKL 3U4BH 3CFDA 1T80A 3MLWH 5LGJA 4YDIL 5ADPL 1JGVH 4EIZC 1U8KB 3LMJH 4Q7DA 4WUUD 1X5JA 2VKXA 4JGUA 3REWA 2B1HH 1JWSA 5CZVL 3VFGH 3CFIC 3BZEA 1JPFB 5DVMA 2V2TB 3MCLL 2VDNL 1F3RB 3TT1L 3DVIA 2VLRA 5FYLL 3KR3L 5IOPB 5CHNB 2DTSA 2EH8L 3QEHB 3Q6FB 5EWIL 1TTUA 1NFDA 1T83C 2YPVL 2AJZB 4OZHA 1BAFH 5E99L 4KC3B 4PGZA 4WHTA 3BGAA 3F5WB 3I3BA 5TH2B 3T77A 4ZNEA 1JUFB 5E6ID 4PJ8C 5KSBB 5TPWL 1AD9A 2R0LL 3AC0A 3ZL4L 1AC6A 3R0NA 3UYRL 3FN9A 4KKCC 4PJDE 4D0BB 1MHEB 1TZHB 4X5WB 5CP3A 1HEZA 2GY5A 1WISA 3MRJA 4FG6C 3PQYB 4I0CC 1TDQA 4D3CL 2X4SA 3I6LE 3W0WB 1MI5A 1U3YA 1F90H 5EBWA 2IJ0C 2CUMA 2G75B 2WBWB 5IGXL 4KDTA 3QP3A 2HJFB 2BSSB 1AE6H 5DC9B 3SCMC 5D1ZC 5JW3L 3HNTH 1VACA 4BZ2H 5EU7E 1OGAB 4KHXL 4F2MA 4N9GB 4OD1H 4DUVA 1ZTXH 3J7HA 3MBEB 5C2BH 1WZ1L 2EC9T 3LPFA 1BLNB 1T5WB 3EIFA 3SY0B 3INUH 3S35H 4I3RH 3EOTH 4HIXL 4Z78A 4M4RA 3BRGC 2H6PB 3NCMA 4EDXB 4U3XA 3LB6C 4HIEA 1K85A 2F58H 5MERA 4JFFA 5ESQB 1N59B 4QRUA 5HHOD 4HUVB 3O6FC 4LAQH 2WINA 4PV9B 4APQB 2F19L 3NH7L 4HKXA 4AYFA 2XQBL 3OMZA 5DFTA 2Y6SD 3ZYOA 4DTGL 1KJ2L 4YZFE 1JGEB 4L1DA 4U05A 1B9ZA 3MRPA 5JLZA 3NPSC 2IQ9H 3V4UL 4G8FB 5I0DA 1T7YA 4QXUL 5J56B 2BC4B 5LCVH 3FQNB 1FO0H 4R4NC 5T1LA 3WMSA 3FQUB 1JHLH 1EEZB 4F8TA 5SWQB 3QWOA 4LLYA 5KOVC 4P5MB 5AZ2L 4DZ8A 5EZOL 2H9GB 4FABL 2VL5A 2YMXH 2AK4A 4JO2L 5FUZH 3QPQD 3QNYB 3RY6C 1JHKH 2VDOL 4QGTA 3OKMB 1U3HA 2DWDB 2IFGA 1NJ9A 3G5YA 4RA0C 3QXWA 4ZTOL 3DMMA 5JDSB 1I9IH 4MZ3A 3OKDA 4X6BA 2FGWH 3K4DA 2BVPA 1JFQL 2IPKA 3EOAB 3DYMA 1M7XA 4M8QA 1C16A 1BQHA 4YBLB 3MV9E 5EU3A 4X80L 4JFEA 4BELD 3L6FA 2R0ZH 3FB6A 4ENED 4WI9A 5FOBB 1VHPA 2JCCF 2EDDA 3BD3A 4EBQH 1MIML 3E1F1 3TZVD 4I4WB 1UB5B 4RGNB 3DBXB 3WIHH 3PWUA 5KG9A 4PTUB 2W9LA 2WP3T 5CMAA 1UKQA 3QAZC 1MFAL 4WI3A 2ATKB 3QNXB 4WV1C 3CUPA 2OQJB 4QNPF 1P84J 5DQ9A 1UM4L 1IMHC 1K5NB 1P2CB 4LRIC 1XGQA 3EO0B 4JQXC 4FQQA 3MJ8A 3EBAA 3AXLB 3I9GL 5FHBL 1IZKA 4X5LA 1ZHNB 2AJXH 5C07E 4RMQA 1HILA 1MRFH 3PWVB 4M9OA 1PBYA 1IGTB 3M17A 1QTYT 1HZHL 4FTVA 1GAFL 5DMJB 3STZB 3OSKA 2VISB 4J3XA 4H26B 3EYFB 3ARVA 5FGRA 5GGUA 4Z77B 1YNTA 4HC1L 2BRQA 2E5EA 1NUDA 3D25B 3K4ZA 2NCMA 4CVXA 5L7XH 3WS6A 1U8QA 3FO9A 3U2SB 1UT9A 2FX9L 2H32H 5EO0B 4DKDC 4PGCA 4IMKC 4Q2ZA 1CT8B 2Z31D 5IB2A 2OTWB 4PJHB 5GRYA 3TWCL 3MRQA 2VOTA 5I1JL 2OI9C 1DLHA 1BX2B 4P3WA 4DW2H 4LCUB 3BH8A 4YEEA 5L6YH 1EO8H 1BFVH 2VXSH 2YWZA 4JQIH 1YYML 2X2YA 3CFDB 4AEHL 4H20L 2EEDA 5LGJB 3CVIH 4V2BA 2NY6C 4K3EH 4LCWE 4HWZA 4PY8I 3REWB 3VH8G 5J6GA 3KLSA 1JWSB 4JHBA 3BZEB 5IW1A 2MHAA 1PKQE 4WI2A 3CFCL 2P8PA 2C5DC 3BYYA 2VLRB 5IIEA 5IEKA 3AB0B 4P59H 3JZ7A 4MS8C 4PJ5A 5B39B 2BNQA 1NFDB 5I74C 1WAAE 4OZHB 3LH2H 1CDJA 4FFWD 3T77B 3M8OL 2H8PA 5TFSL 1AD9B 1MHPH 3KJ4C 5IB4A 5C09E 2EXYC 5HDBF 1G9MH 4JGMA 5GGTA 1KB5L 1GHFL 1RMFH 1HEZB 2Q8AL 3MRJB 4KRPD 1MI5B 1U6AH 2DM4A 2WWMD 5EBWB 1KXQE 1IZJA 4NBYB 3ARSA 5D1XD 2EZ0D 1CGWA 2W0LA 2NX5A 1GGCL 3IFOA 4NZRH 1VACB 3NZ8A 4XP9H 5E8DL 3RL1A 4F2MB 1KCRL 3OTTA 5DEZA 3FONB 3PABA 5CEZD 5ITFA 3HKFA 4F15C 1W0WA 3KPRE 1FBIH 5I6XC 3QEQD 5GGRB 1CDHA 4HCRA 3TV3H 4Z78B 5D6CA 1NSNH 1F42A 3DV4B 2A9ML 2W0KA 3H42H 9CGTA 4HIEB 3UCRA 2DLFH 4JFFB 2F9BT 2WAHA 1AQKL 5MERB 4KH2A 4QRUB 5K59F 4KK9D 3SDCD 5FAAA 2CLZA 5K9KA 1Z0NA 2WINB 3QQ4A 4JKPL 4UMGA 1KN4L 4HKXB 5KZCD 4FQCH 3MRPB 4JY6B 4Z7WE 5JLZB 4ZOCA 3IT8D 4P9ML 1CF8L 1CN4A 1YNKH 1IFHL 1SJEA 4LFHG 2HT3C 3VFMB 1ES0A 5A2KH 3DXAD 4RAHA 1PLGL 2B39A 1K8IA 3QWOB 4LLYB 4LPYA 4DEPC 4DZ8B 2CMRL 2VL5B 2AK4B 1CR9H 5DF0A 3L9RA 1OGTA 2Y36H 4MAYC 4TNWK 1U3HB 1NJ9B 3G5YB 4MNGA 5LVEA 3HI1B 5ICXA 3DMMB 1P69B 4WIQA 2RBLA 3OKDB 1X5GA 4X6BB 2BVPB 3UEZA 2IPKB 3HNVL 4KJPD 1DBML 4M8QB 1NAMA 1RJYB 1C16B 3VI4F 1BQHB 5EU3B 3MSPA 1AKJD 4JFEB 4DK6A 4PJ7F 4LAJH 4HIJA 5HHXH 2HKHL 3FB6B 4NKOB 5JIHA 4JG1L 3VXQA 1DCLA 4L4VD 5L2JA 1S7TB 1YJDC 1RAMA 2ZPKL 5CKAA 4Q6IA 3X3FH 3T0BA 3DETC 3PWUB 5KG9B 4LGRB 2Z8SA 4XX1G 2PXYC 3RRQA 3BKCH 1H8SA 2DJUA 2IAMC 3CUPB 5IMKA 5DQ9B 3U7AA 1FL3A 2G60L 3GRWA 4DGVH 1A22B 3D39E 4F7MA 3RFZC 4D94A 1XGQB 4FQQB 1L7TH 1OAQL 1KEML 3OF6A 1FCGA 2P5EA 4PLJC 3D9AL 1CGXA 3F65A 1FVDA 4JAMA 4HWUA 5EIIA 3GBNL 3M17B 1F5WA 4PGJA 4DGIL 4M4PA 4FTVB 4N5EC 2VZTA 4PS4H 3V4PL 3L7EA 2EDQA 1BVZA 3CX5K 5GS1A 4YXHH 2E7HA 4UTBH 3VD3A 3WO4C 3V4VL 1GH7A 2YKLH 4CVXB 1INEH 1U8QB 3FO9B 4OLEA 3S34H 1TNMA 5K93A 3C6SB 4GT7A 3CVHH 4PGCB 4Q2ZB 2G2RA 4TNVF 5D96C 3U1SL 5IB2B 3ARBA 3KPMA 4YHPA 2BP3A 3MRQB 4ELME 4NOFA 2FD6H 2YD7A 4FQ2L 1DLHB 4P23A 4GAFB 4W81A 1FAKT 4XI5D 5SWSB 4LF3A 5MEPB 2GI7A 2BCKA 4QOKA 3AFLA 4HWZB 3KLHC 1JGUH 1QSFD 5D6DC 2MHAB 5IW1B 4HKBA 4L8SA 2P8PB 1HOCA 1DL7H 2WUCH 5EOQH 2BVTA 5IEKB 5EZIH 1K4CA 4FQHA 4HW6A 4P48A 4QYOA 2H26A 1MPAH 3KPSA 4PJ5B 2BNQB 4XPAH 2DQTL 4LMQI 2OBGA 1IC4L 5JO5A 3WIFA 5J11C 2H8PB 4N5UA 3B83A 1KCVH 5IB4B 4FQJH 3L5XH 2AQ1A 1TLKA 5F89A 4OCNC 3QHFH 4OT1H 3VDBA 4HFUL 2YZ1A 1FNAA 3FN0L 4KK5D 4S0TD 2Z91A 1MWAL 3BD5A 2NX5B 1NCDH 3V8CA 3NZ8B 3IDYB 2AEWA 3SDXF 4P2OA 1JRHH 2FHBA 3PABB 5GRUL 2V17H 5BRZE 5ITFB 5MEND 5EUKB 5CBAB 1Y18A 1W0WB 3C8DA 4ZQKA 5JIKA 4YEFA 1WJ3A 3KNBA 1MCBA 4MDJA 3S3JA 3B6SA 5BS0A 2N56A 5D6CB 5CSZA 4LPWA 5JR1L 2CD0A 4O5LH 5BVPH 3NFSL 3BPCA 4HHAA 4HWEL 5GS0D 2CLZB 4J4PC 4ZXBD 4GG6E 3VRLE 5E2VH 3JVGC 3QQ4B 3O4OC 4HUXA 4W70A 2YPLE 1YMHA 1JZ5A 2R69L 3PWPD 3N9GL 4EN3D 2IBGA 1W72L 2XRAL 3S5LA 3P73A 4OTXL 3C8KA 2AAVA 1CYGA 3HE7D 1CBVH 1FE8H 2PO6C 1SJEB 3FOLA 1GIGL 3CLFL 1ES0B 3QT2A 3GBML 3PJSA 2VH5L 5IBLC 4XC1H 1T83A 1YEHL 1K8IB 4QTIH 4OI8A 5TE4L 3LPGA 5D7IE 3PP4L 3DI3B 2EE2A 3VG0H 3I85A 1AXIB 3L9RB 3LKRA 4X5XB 1OGTB 5B8CB 4OLZH 4WO4D 2ID5A 4MNGB 3CMGA 4KUCD 1D5MA 3NZHL 2DQJH 5HTSA 4OF0A 4GXUM 2A0LD 1AO7E 1EVTC 4OGAC 3QPXL 1NAMB 3DSNA 5EBLA 1DEEA 4MMXC 3S5LG 1FRGL 1YMMD 4GRMA 3SCMA 5CD5C 4HIJB 1A6VH 1NANH 5HYSA 5GS0H 3VXQB 1UJ3C 4RAUA 4R90L 3ROOA 1RJCA 2HN7A 3BISA 3N1PC 4RFOL 3BI9X 4IHOA 6FABL 5L2JB 1NLDH 3RX7A 5JW4Q 1SVCP 2YHGA 4NO3A 4WEBL 4Q6IB 1L7IL 3PUCA 1T22A 1KOAA 4AENA 3T0WA 2W9EH 4QY8A 3GKWL 2RB8A 2FX7H 5D2NA 3N50A 4H8WC 5IMKB 3IFNH 5CIPA 1FL3B 3FO0H 4HV8A 4F7MB 2DQHL 3VA6A 3O6FA 2LU3A 2J4WH 3G5ZA 4M6OL 1J1OH 5T3XE 2P5EB 2Z8VC 5C71A 2I07A 1FVDB 3TN0D 3QCVL 1PDKA 1WICA 5EIIB 2EDKA 2VN4A 1EVUA 3UJJL 2GW5A 1YQVH 2BVOA 2K3TA 3L7EB 1UEMA 4HPYL 1KENH 3V52L 5F1KC 5GS1B 5DURD 3BT2L 3WHE1 2QJDA 4U6VH 1FHGA 5IVXA 2NW3A 5IBUG 4AG4H 4NQXA 1MVFA 1P84K 5EUOF 5L9DL 5JMOC 2R4SL 4KK6C 4GO6B 3RY6A 2Q3ZA 5B38A 3ARBB 3KPMB 3AS3A 4M7LH 1U41A 4YHPB 4HK3J 3SO3B 3V6OE 2MPAH 1DQLL 1Q72L 4GS7B 4P23B 2DN7A 2LAAA 2BOCA 3QH3A 4M7KL 4GG8A 1A7QH 1CK0H 1EO7A 4LF3B 2B5IB 1T7WA 2BCKB 2N1KA 4QOKB 4X6CA 2R56H 4RX4A 4TPRL 1NUFA 3P4MA 5CAYB 4QCIA 5TDPA 4JJHA 4WWKC 4L8SB 4M62L 2D03L 2RFXA 1HOCB 1UJTA 2EYRA 3BE1H 1DVFC 5GJTH 2J2ZA 1J0HA 1K4CB 2XQYG 2NY0C 4HIHB 4OSUL 2XV6B 1N8ZA 4QYOB 2H26B 2DL9A 3KPSB 2VLKD 4FS0A 5HPMB 3BIKB 4WV1A 2GJ6A 1BOYA 5B38G 1ZEAH 5JO5B 3T3PE 3WIFB 1KIPA 3QIUC 1CDYA 1OAYL 1TMCB 4PG2A 4OCXH 4LRIA 4JQXA 2ED8A 3GMNA 5C0AE 1QFWH 3BPOB 5B22A 3HHRB 4N8VB 4XP5L 5F89B 2BJML 3VFUA 5LGKA 3UTQA 2AJ3A 4MA1B 1J5OL 3H7BA 1JPGA 3C6LA 3G6AA 4JO1L 4PRIE 1CFNA 4R4FH 4JM2B 2Z91B 1AXTH 1EFQA 4JREB 4XPFH 3ZO0A 4P2OB 1LEKA 4BSVA 5FYKD 4OLVH 5CGMA 5EULV 1CU4H 1Y18B 2HFGH 3K1DA 2J5LB 1JPSL 1MCWM 1W0VB 2Y06L 4HT1L 4IMKA 3PGFH 3KNBB 4K3JH 5C9KA 4MDJB 2NY1B 2NMSA 3ET9F 3B6SB 5BS0B 4OF7A 4OLYL 5CSZB 4DVRH 1QYGH 2DQGH 3BPCB 4HHAB 1G7IA 1L0XA 5GRVL 4Z7OE 3KLDA 4JO3H 3WN5A 4DKFH 1MEXL 4H0HB 5E8EA 3DX7A 3LCYA 1YMHB 4NGHH 1NCWH 3ZDZE 1UWGH 4RZCA 3CH1A 5DD1L 1R0AL 3P73B 1AGBA 4HXBH 2EDNA 2FH8A 4UT9H 5I1CH 5H94A 4GLRI 4YDLB 1OTSC 1T0PB 2AJVL 4JZJA 4JVPA 3FOLB 3N1QC 4XAKE 3PJSB 4IOSD 5I71C 3S96A 1UG9A 4LRNH 4LK4A 3V6ZA 4E5XA 3E3QE 4NQDD 4TSCL 3LKRB 2ZJSH 1OLLA 3WKNA 2YD9A 4NN5C 2V9QA 2I9TA 3KDMA 1RZJH 2QKIA 3D48R 4G3YH 4ZFOA 1SM3L 4TTGA 4QT5A 3OGCA 2Y7QA 1S9VA 5DFWH 4L5FL 1CE1L 2F53D 5EBLB 5BZWA 1DEEB 3DX8A 4GRMB 3SCMB 2CXGA 1T6VN 5SWZD 3U48A 2BXZA 5HYSB 2I27N 1PG7L 4N0YH 1ZHKA 4RAUB 1OSZA 3QFDA 3MLRH 1V7NH 2IANA 4ISVA 2YRPA 2HN7B 3ROOB 4KU1A 2A77L 2FX8H 1KT2A 4IHOB 1XIWC 3C5ZD 1I8LC 1ZANH 3NFNB 2BNRA 1NBZB 4DOHE 1OPGH 1D6EA 1T22B 2XTLA 4X7TB 4AENB 4QY8B 4WWID 2M1KA 4OD2A 3MNVA 3V9FA 5D2NB 4D0CA 4GUPA 3QEUA 5HHVL 1P1ZA 4KKNA 3EYQC 1G0XA 1CL7L 4HV8B 2GITA 5F9AC 4LPXA 3O6FB 3G5ZB 4YAQA 2V5SA 4AZ8A 2MCPL 1UFUA 5A43C 4L8CA 4GAGH 2FBOJ 2FEEI 2OR7A 1FV1A 1CS6A 2R9HD 2W9DL 1WCQA 2VE6A 2I07B 2ZG2A 3F58L 3RVXD 4QRRA 1PSKL 2BVOB 4G8GA 1L6XA 4FMKA 1U8LB 1FNSH 1EAPA 5F8QC 5HYQA 5IVXB 2NW3B 1PZ5A 3PGDB 3QFJE 1T66D 3RWHA 2AGJL 4NQXB 3AY4C 4ZUTA 3BRDA 2EDXA 3ZMRA 3ZTNH 3RY5A 5DMKA 1JF5A 4RMSA 4MAYA 3O4LD 5FYLD 4YC2B 5B38B 1NUNB 1XZ0A 5E8OA 3OX8A 1JP5A 4WI7A 2DM7A 2X4TA 5FKPB 1B4JH 3PHQA 4DAGH 2BOCB 3QH3B 3NCFB 3FFCD 3OV6A 3EJZC 4GG8B 1PKOA 4P57A 5DEFA 1F11A 4X6CB 3WFEL 3P4MB 4QCIB 3HC3L 5TDPB 1RJLA 2NY5L 1WVZA 3NFPA 3JV6B 4I9WD 2EYRB 3MV8A 1MCSA 2BMKA 1CVSC 4XXCC 4FNLH 3WKMH 1N8ZB 4J23A 5FHAH 4OF5A 2QQKH 4HPOH 5IKCA 4HJJL 4WV1B 2GJ6B 5ADPH 3HI5L 2Z8RA 2IAMA 4M5YH 2VL4A 2L4OA 2KZWA 4ZOBA 2APWA 3B2UD 4UIKL 1SEBA 3GMNB 1U91A 1I85C 4GW5A 4BSWA 2CK2A 1OTTC 5E6ZA 1CFTB 3QRGL 3AAZA 1KTLA 3VFUB 4E9LA 2CKBH 1MAJA 2WIIA 1A7OL 2AJ3B 2J8UE 3KR3H 3UTQB 2BK8A 3T2NL 5GGVY 1JPGB 3C6LB 4ZUSA 1QEWB 4HBCL 2ZUXA 3G6AB 4JPKL 1VPOH 5HJ3A 2HLFD 4EJ1C 1CFNB 4QHLA 4X7SL 2HMIC 2YPVH 4AIZA 1FN4A 4D9LL 4UQ3A 3EDKA 3VXSA 3W9EA 1ADQL 3QUYD 2ATPB 1I4FA 4NNYA 3UYRH 1ZWIB 5JHDE 2Y1VA 4LEXL 3GDBA 1EMTL 4D3CH 1II4E 5KAQF 4PGDA 5FGBC 1KXTB 1G7IB 3U46A 2NY6B 4TVPE 3BVNB 1ZLVH 5DK3A 4X9GA 1M6OA 5JW3H 3WN5B 3WHXA 4XNYL 5KSAD 5F9OL 5D6DA 2VKWA 1B90A 5E8EB 3DX7B 2A6DA 1JTPA 4NC1E 4FHBD 4P2YA 5HD8D 1IGYA 4RZCB 3CH1B 1QBBA 4U31A 2NTFA 2XXMB 1Z5LA 4JEGB 4XNUL 1JYXA 5E08L 1ACYL 1PJ9A 4JZJB 3CIQA 4JHZA 32C2A 5FA4A 1QKZL 1DBJH 4PJDA 3CFBA 3S96B 4G9FE 2P43B 4OCWL 1EXUB 3V6ZB 4E5XB 4V2CB 5I1LA 4G6KL 3KJ4B 35C8H 4Z7NE 5ILTH 3IGAA 4HEME 2AJYL 4AEFA 1NC2B 2F19H 1DR9A 1DBKL 2AJSH 1T89C 4LFHD 3U7YH 3EO9H 1IGFH 2I9TB 3TJHC 3KDMB 3T0EC 2QKIB 4ZFOB 4Y1AD 3MLYL 3D85D 4GRWH 5DD6A 1KGCD 2B4CC 3OGCB 4QT5B 4LCYA 1HKLL 2P45B 3TO4C 2YEZA 5EIVA 5FM4A 1X9QA 5BZWB 3DX8B 4KROD 4RQQA 4KY1L 4K9EH 4IRSC 4K8RL 1RK1A 1ZHKB 5HI3D 1OSZB 3QFDB 2IANB 4ISVB 4O9HL 3EZJB 3WNOA 4F15B 1KT2B 3HMXA 4NQUA 3E8UH 2VDOH 2EC8A 4ZTOH 1CG9A 2IFFL 2ORBH 2RJMA 2ZCKL 5J57B 1J12A 4E41A 1IQWH 4OD2B 3MNVB 4D0CB 4GUPB 3QEUB 1P1ZB 1S7UB 1U8PA 1F13A 3JWNC 3UTSD 3KVQA 2GITB 1CFSA 8CGTA 4NWUL 3Q5OA 1I9JL 2WK2A 4PRPD 4J4PA 5GISL 3JVGA 5CCKL 2UUDK 1WEJH 4L8CB 5IROA 4JJ5A 3LIZH 3QUZC 4Y4HB 5IHLB 2XI9A 2VE6B 1L6ZA 3RKDC 1G7QB 2HT4D 1S7RA 1KBGL 2PO6A 4QRRB 3P0VH 3OQ3B 4G8GB 3M07A 4G9FB 1EAPB 3ISWA 5HYQB 1UM4H 4DEPB 1PZ5B 4TTDD 4Y5XC 3RWHB 2JCCE 4ZUTB 3VWKC 4ERSL 1ZLUH 1GC1L 3GK8L 5EORH 5DMKB 4MAYB 2D7TH 2HKFL 3OX8B 5E8OB 2X4TB 3DVFA 3PHQB 1A1NA 1LHZA 3HMWL 2C3VA 3ULVH 3MRIA 4P57B 4K23L 1D6VH 1F11B 3G6JF 5DEFB 2APBA 4HSQA 4U1IA 4MNQD 4QNPE 3HE6D 1T1WA 5EBMA 3MROA 1RJLB 3OJ2C 4DWHA 2FX9H 2HH0H 3O2WH 1AJ7L 3MV8B 2BMKB 4GRWF 4Y4FC 6CGTA 1A6TB 2PKDA 2J12B 1FGNH 5AYUL 1EHLH 4OF6A 2OK0L 4H0GA 1FJ1B 4ORZC 4LKCA 4KMTL 3ALWA 5EOTA 1RPQA 2IAMB 4OFYA 1HHIA 1U8OA 2MSPA 1AHWC 2VSCA 3MV7E 1PY9A 3MZGB 1U91B 4Z7VF 5DUPL 4GW5B 5B4MD 1CFBA 4JFDD 4BSWB 3CFCH 2J6EA 3MUGA 5DJCA 3AAZB 1KTLB 3VWJC 4YDKL 5JXAH 2DQEL 2OXHA 2WIIB 5CUSH 5DZLA 5TF0A 2LAGB 4NQEE 4ZUSB 4ZS7H 2UWEA 4BFBD 5HJ3B 2VLMD 5A1AA 4QHLB 4L1HA 4IRZL 4IS6A 4AIZB 5KBNC 1FN4B 4M1GL 1INDH 3WO4B 4UQ3B 1QBLL 3ARFD 3O9WC 3VXSB 4OZIF 3OR6A 1A4JA 4IOFD 5TFSH 3W9EB 1RK0A 4JRXA 5GGSB 5TE7H 3RU8L 3UJIL 4PY7A 4NNYB 3A6OA 4PLKC 1DQML 4MJIE 4L8BA 4FQXC 2BY1A 1D5IL 5C6WH 4FZEL 2JK5A 4MAUL 1M6OB 1KPUA 4JFZH 3WHXB 2EH7H 5I73C 5HDBE 1IAMA 1D9KD 2A6DB 3T2QA 2PN5A 1L0YA 1CD8A 3O3EA 5ITBL 1IGYB 5JUEL 4PUBL 1DVFA 3LS5L 2NTFB 1A7NL 4PRBA 3ULVF 3SJVA 2Z93A 2VR4A 3E3QC 2HYMA 1J8HE 32C2B 5F7NC 2R23A 3QQNA 2EECA 2A9MH 4TSBL 4NOBA 1HCFX 3CFBB 3WLWC 4YE4H 2VDQH 5J11B 1AQKH 3QIUA 3RBSA 3HG1D 1CLOL 1N4XL 5GGTL 3IGAB 4JKPH 3QO1A 3ZKQD 4JG0L 2R0WH 1HCVA 5DD6B 4LCYB 4ZS6C 5I18H 1IFHH 2YEZB 3VRIA 2X40A 2UZIL 2WLZA 3H9SE 3T65A 5K59E 4RQQB 3AREC 4JRYE 4WRLA 4M7LT 1RK1B 3SE8H 1FNGA 5CKGA 3GHBL 4CMMA 3DROA 4M43L 1KCSL 1B2WL 5BOPA 2X1XR 5D5MA 1XMWA 4O2FA 1CG9B 2FO4A 5BW7A 2EEBA 4E41B 4N0RA 4XMPH 3LS4L 1NQBA 3FB8A 5CEYB 5ADOL 5IMMA 1CFSB 2XN9A 4Z7WA 3X3GL 4CKVX 2HKHH 3O4OB 5E2WL 3GJEA 3HUJF 4JJ5B 4M93B 4PJ8D 4AL8L 5D7LA 4RWHA 5AZEL 4PFEA 4HKZA 5D93C 5J1AA 1S7RB 2PO6B 4XNMA 1C5CL 2EDYA 4PJ9D 4WI6A 3VI4E 4LSVL 4KGJA 4LLVA 3QDMD 1CDCA 4PJ7E 1V3MA 3L5WA 1GGBL 5DD3L 43C9A 3CZFA 5C0JB 1OAQH 1YY9D 2IWGA 3ZSTA 5FFLA 4K71C 1ZXQA 4Y2OA 1A1NB 2HTKC 5IB1A 5GQBA 2LFGA 4U1NA 1OSPH 4YHZL 1TIUA 3MRIB 4J7RA 4MA3A 4NSKA 3RVVC 1LP9A 3TYFA 4U1IB 1TJIL 3C8HA 1RI8A 1T1WB 3IDMB 3MROB 3O41A 5EBMB 4P2RD 3WJJC 2DQCL 1HH6A 4OV6F 3QI9D 5TQ0L 1KCUL 3PDDA 1RZKC 5FUOL 3WFCL 1QFPA 2CLVB 1I8LA 5GXBB 4FQ2H 3ETBF 1HE7A 1T0NA 1JTOA 2Z92B 5CGYC 2VXTL 3GRWL 4LKCB 5F7UA 3K7UA 1H3PL 3UTTE 3SDYH 1HHIB 4LSSL 1U8OB 4MQ7A 1F45A 4G43A 4RGMC 2DTML 4J6RL 2APXA 4NZDA 4BFIA 5JZ7C 1LK3L 1TCRA 2AEPL 3EYUL 2VDLL 2MWCA 3QBTB 3MUGB 3X11A 3TBSA 4OGZA 2B0SL 4YGAB 4QHKI 4J2XA 2VMFA 5HGGS 1MJJB 1GPOH 1LO3L 1F4AA 1S78C 2UWEB 1MAML 2V2XA 3CSYA 3T0DA 2D31A 5DHVH 2DQTH 4IS6B 1BFSA 3QUXC 5IHUL 3GO1H 4UU9A 2GT9B 1CICC 4XMLH 4EI5D 3OR6B 3AY4A 15C8L 3DGGA 1BJ1H 1K2DA 5SX4H 1RK0B 3NTCL 1KV3A 4JRXB 3KHQA 4PY7B 4GW4A 5I8OL 5E2UH 1OAKL 2A6JA 1RZ8A 3EJYD 4L8BB 2DBJA 4LLQA 4UINL 1ZAGA 2M26A 3HR6A 5J12B 2JK5B 5ID1A 3FN0H 4I77H 4ALAH 2PYEE 3N1FC 1YNLL 3KJ6H 1MWAH 1KPUB 4JB9L 2DM3A 1IEBA 1F3DJ 1XGUA 3BO8A 2YXMA 3GB7A 2F54D 5GRUH 5I8KL 3L5JA 3OXSB 3O3EB 1R3JA 2FL5A 4MJ4A 4XPHH 2E27H 1DVFB 1H3GA 4XXCA 4KDWA 5C0RH 4PRBB 3SJVB 5AEAA 2Z93B 2NY0B 4JR9L 3VDCA 3DXAE 3OKKA 2R23B 1NMAL 1WIOA 5IFAL 3NFSH 5F3HA 4LSUL 4P3CH 1UH4A 3CMOL 5HI5C 1T7ZA 3SDXE 1BGXL 3P0GB 3QIUB 4CU6A 2ZZUT 2XNAA 4OQTH 4D0DB 3MCKA 4XMKH 1GGTA 4W68A 4EXKA 2EDFA 1MLBA 1PAMA 2R69H 3GSNL 2XRAH 4CMHC 4W6XB 4P5TA 1U95A 4OTXH 3VFPA 1CE6A 3FAWA 3VXMB 2XZCH 5AAWA 1BFOA 5ACZA 3VRIB 5BZDA 2I5YL 1NFIB 3CD4A 1QP1A 1MCHA 4RDQF 4RA3A 3W11C 1QRND 3PE9A 4MD0A 5TE4H 4KZDL 3ARZA 1TZGH 5A2IH 1EJOH 4L4VE 3ESUF 1FNGB 2DQIL 5KSVA 4CMMB 2AXGB 3BHBA 5DHXB 2DYPA 3PL6C 4X6DF 3QUMA 5IQ7L 5D5MB 4O2FB 3P9MA 4LLMA 5BV7B 4L4TD 3D3VA 4XPGL 4GG6A 3VI3E 1Z3GL 3MXVL 3MUY1 4G7YL 1MJ8H 1BHGA 5DJZA 2R2EB 1KUMA 3C9NB 3QPXH 2PYFA 3REVA 3FB8B 2PYEB 5IMMB 2XN9B 3BAEL 1VADA 3QDJD 2MQ3A 2QHLA 3RUGF 3GJEB 4U0RB 5D7LB 5C08A 4HIIA 1REIA 5ICYA 1N6QH 3NIDF 5CJOH 2P42B 3T1FA 3QCTL 2VRAA 5J1AB 5L2KD 3C87A 4XNMB 3MJ9L 4Z7QF 2ZKHL 2ILLA 4IOIA 3GKWH 3EDDA 4LSQL 1HQ4A 1WLHA 3L5WB 4FRWA 3IFLL 2AXJA 4XBPA 4P49A 2DQHH 3CZFB 1UM5L 4HBQA 1WZLA 3DUUA 4MGXA 1T89A 5KVFL 2DQFA 4NN5B 4GMTL 1QR1A 3CXDL 3IJYA 1EGJH 4MB3A 3RZCD 3T0EA 1MHCA 4ETQA 5IB1B 4PJXA 5KJRL 3QCVH 4ODTH 4U1NB 4OF3A 1R6VA 1BQLH 4MA3B 4NSKB 3HLAA 3TO4A 3LZFH 1LP9B 3TYFB 3BPLB 3O41B 4YNYA 3BT2H 3QHTC 3KG5A 4M7JL 3A6CH 1S7SA 1HH6B 4IRSA 2EO9A 4ODBD 3O2DL 3TJEL 3H9ZA 2YS4A 1NC4D 2R4SH 2X9YA 5E6IC 4MX7A 1X7QB 4KZEH 1E6OL 4R4BA 4PRNA 4LPTA 1Q72H 3TT3H 5EU6D 1JGDA 2MQ0A 4KJQD 4A6YA 5CLWA 3BUYA 4MQ7B 1Q0YL 1Q0XL 2BSRA 4TPRH 4G43B 3O6MH 3IU4L 3LN4A 1OW0C 3C08H 4Y5YC 5DXWA 5EUOE 5D2LA 5H8DA 4BFIB 3ZHLA 1TCRB 3QUZA 2QTEA 4NM8H 4OCRH 3PF2A 3X11B 1DBAL 2FECI 3TBSB 3F7RA 4NQVA 1CLYL 1EFXA 5CJXC 5E5RB 4HGMA 4ONFH 4R26L 2V2XB 3H3PH 2D31B 3BSZL 2O5YH 2YR3A 4LHJB 5GGVH 3N85L 4UU9B 1MUJA 2JJWA 4XP1L 4M7ZC 2ZP0T 3QZWA 1K2DB 3TBVB 3VWKA 5CFHA 5C0BE 1DQJA 2X89D 4GW4B 4XVTH 3SGDI 1I3GL 2A6JB 4LVHC 4LLQB 2Y6SC 5KVDH 1ZOXA 4X7CC 3F12A 4U6YA 5ID1B 3KYKH 4PRHE 3GSXA 1SBSL 2PXYD 4EDWH 4YHYC 1BD2A 3O81A 1IEBB 1XGUB 2GSIA 3FFDA 3BO8B 1A64A 1IGIL 3OAZH 3PWPE 3WUZA 2WBJB 5T5FH 2JJTC 3MREA 5HHNA 1R3JB 1RVFL 2FL5B 3KYAA 1I1AC 1JPSH 4Z76A 2Y06H 5TF1L 4Y4FA 2DI7A 5JPNA 1VA9A 4PLJD 1A7BA 4HUUA 3QZWG 4MQXC 4PJEF 3ZYIA 3OKKB 3OAZK 4ZO7A 1A0QL 4OLUL 4O2EA 3SGJC 4NO0A 1AHWA 2KH2B 3PV7A 4PY8J 2KBGA 1MEXH 3MCKB 1A3LL 3DURA 2IBZY 5F9JB 4FXLA 1SHMA 3GMMA 1MLBB 5GS2H 1WBXA 1CGSL 3ULUH 4ZOAA 1UCBL 4P5TB 2JTDA 2D0HA 3VFPB 1I8MA 1CE6B 3VXUE 4MHHG 2GCYA 1BFOB 1IM9D 1E4KC 5ACZB 5BZDB 3TZVC 1FVCA 2KPNA 4APQD 3MA9L 5EC1A 4MD0B 3O9WA 1QD0A 4X7EC 1YEDB 5GZOD 2NZ9D 5KSVB 3BHBB 2DYPB 2UZYB 2CLRA 4WU7A 3B5GA 2ESVE 4FQXA 5E6YA 3P9MB 4LLMB 5H37G 3D3VB 5DHYB 3G6DL 3ARGD 3EOYG 1MRCL 5DJZB 3CFKA 1XGRA 4PRHB 1G9EA 3QQ3A 1B0WA 2PYFB 4P2QE 3M1BA 1VADB 2Z35B 5J6HA 4BK5A 3F6IA 2NLJA 2FB4L 2A1WH 1FQ9C 1PG7H 4XB8A 1H3VA 3D0LA 3I6LD 1MVUA 5C08B 2P5WA 4HIIB 4GFTB 5LXGH 4QXGL 1NGXB 3BKJL 2BFVL 3T1FB 4LNVA 5JPMA 3RL2A 1GGIL 5T33H 2Z31C 4IOIB 3HZMA 3I50L 1FZJA 4PD4J 3V0WH 4M3JA 1HQ4B 2Y07H 1MIEL 1MFBH 4I48B 4XBPB 5GRWA 4D8PA 3SGKC 4XT1C 2OR9L 4L3EE 1HNGA 4ZDHA 5FB8A 4OCSH 4RGND 1BVKA 1QSZA 2DQFB 4ZFZA 4WTXA 3SHSA 3T0EB 2JIXD 1MHCB 1X5KA 4ETQB 4PJXB 3Q3GA 4LVOC 3TO4B 4WDIA 3HLAB 2YPKA 1GVIA 4NNPL 4YNYB 3U83A 3C2SA 4WFGE 1CZ8H 1PEZA 3B5TA 3DECA 1B3JA 1RUMH 1VFAA 1S7SB 4IRSB 4X8XA 1I1RA 4FFWC 4HZAA 1FZMA 4NYLA 2R8SH 4MX7B 2OJZL 4PRNB 1EA9C 5E8NA 4JFPA 4W4NA 1JGDB 4XWGL 4EKXA 4TVPL 3BP4B 5KSBF 2CUHA 2IQAA 1LVEA 3X12A 1X4XA 2Y5TA 4A6YB 4U3HA 1C5BH 3ARDA 3BUYB 3S4SA 2WWMC 4UT6L 2BSRB 5DUML 4B7IA 5IBLD 1XR9A 5I1GL 2PR4H 4Q0XL 5D2LB 3NIGF 2NY5H 2QQLL 5D1XC 5E2JA 2EZ0C 2BVEA 4M8VA 3QUZB 4Z0BL 3SKJL 4NQVB 2X1WL 2DB8A 5DRZB 4YFLF 1EFXB 1FL5A 3MV9D 4GJTB 1YPZA 3UYPA 1N7MH 4XNZC 4MXWL 3FL7A 4HJJH 4KHTL 1YECH 1MUJB 3BQUA 4EVNA 5HYJE 2ED9A 3ZKND 3KLAB 3K8KA 3QZWB 4XWOD 5D7JA 1CGUA 5HVGB 2V7HA 3VWKB 1ZT4A 1DQJB 3CLEH 4KK9C 4OCLC 3SDCC 1BFTA 3SE9L 2FCBA 4ZG1A 1NBVH 3FT4A 3KWWA 1SMAA 5J8OA 3F12B 3RDTD 4HBCH 3QWRA 4U6YB 2A6IA 2CR6A 4X7SH 1G9NL 3GSXB 4LHUA 3H6JA 3CDYA 5DTFA 1BD2B 4K7PY 4XCYA 3NA9L 5C07D 3WJJA 3FFDB 2GSIB 4B53A 3U4BL 4KXZI 3MUHL 3MLWL 4PB0L 1SY6H 3MREB 3MACH 5HHNB 1JGVL 2O61A 4IJ3C 3BD4A 2HP4A 3LMJL 4HXAH 4Z76B 3GGWA 2B1HL 2OX5A 3GIVA 5I1IH 3VFGL 1FCCA 5JPNB 4HUUB 1F3DH 1P5UA 4NZTH 4HWBA 4Y2DD 4O2EB 4CU8A 3QIWA 2J8UA 4PJBE 2VLJA 3R1GH 4NO0B 2VLLA 4KJPC 3KYOB 4K8RD 1AHWB 5CEXA 3DURB 5F9OH 4QHMA 5DI8A 3GMMB 1BAFL 3VD4A 5BMFH 3E0GA 3WS3A 4P9HH 1BBJA 1S9YA 3LKPA 1WZMA 4XNUH 4LCWD 2GCYB 3ULSB 5E08H 3UTZA 5MI0C 2XTJE 4M48H 1FVCB 1I1FA 3QUXA 5EC1B 3O9WB 1CICA 1TPXB 5DJ6A 1F90L 5HVWA 4BFEA 1P7HL 5I15L 3HZYA 5CP3H 4WU7B 4BZ2L 4FQXB 3SDAB 4ESKA 4OD1L 2YBRA 4HQQH 4YHOH 3MLYH 2LABA 3L1OL 1ZTXL 3T08A 3CFKB 1XGRB 4FMFA 3QQ3B 1CVRA 4GMSH 4QRQA 5C09D 3MRCA 3INUL 5J6HB 5CINL 4I3RL 3S35L 3MOAL 2NLJB 3LDBC 1DZBA 5I73B 4HX1A 3D0LB 3PNWA 2P5WB 2F58L 3EZ8A 3P77B 1L9NA 2DWEA 4NHCH 1XT5A 4DN4L 5JPMB 4LAQL 1WTLA 4Q9QL 2IFFH 4WGVB 3HZMB 4JKMA 5C92A 4YPJA 4LASH 1BWMA 3P4NA 3HFML 3LKSA 4XI5C 2IQ9L 5FYJH 2R2BA 4D8PB 3KPRD 4PJHF 1I9JH 1BZ9A 5LCVL 3H9HB 5CCKH 4ZDHB 4KI1A 1FO0L 5FB8B 2YA1A 1JHLL 1BVKB 4ZFZB 4H25A 2J7LA 5IEHA 3FFCE 1CD1B 1TJGL 1UZ6F 1GOFA 4YHML 2YMXL 3WNLA 4ZUWA 3Q3GB 2EDRA 4WDIB 5F6IC 2YPKB 2FYYA 2C1PA 4AM0A 1Z6JT 1IC7H 1I9IL 3ABZA 2X41A 4I9WE 4NCC2 3C2AL 2FGWL 2EIEA 2NZIA 5CILH 2YXFA 1FZMB 4NYLB 2R1YA 1TQBC 4AQOA 4U0QB 2V5YA 3PL6A 3VXTA 2C9AA 5E2TH 2HKFH 2R0ZL 4OZHF 5E8NB 4JFPB 4FFVD 3IDUA 2Q20A 2ZCHH 3HMWH 4KI5F 1H3TA 3R8BB 4YGVA 4Q74A 4EBQL 3X12B 3MNZA 4K23H 4NRZA 3RNKA 5DEGA 3ARDB 4HLZH 3S4SB 4CDGC 4CNIA 2WBKA 2GUOA 5HI4D 4WNQA 4KK5C 3QG7H 2BZDA 5E9DE 4QRPE 4ORGA 3ARQA 1DSFH 4LEOA 1AC0A 3RPKA 2VXVH 5SWSD 1O5DT 5FF6A 5D93B 1FL5B 5GSRA 1YPZB 2F8OA 3G6JE 3LEVH 3OG6B 4TUOB 5HHMB 4XRCA 2AJXL 2DDQL 5FM8A 2NXYB 1DJSA 1YEGL 3BQUB 4EVNB 1GCFA 4WEUD 2BVQA 5D7JB 2XACC 5HXMA 5DUPH 2V7HB 4LLAA 4WFED 4PREA 4WUUA 3VGHA 1ZT4B 1P7QD 4GRWE 5GS0C 2YD8A 5F71A 5C0CB 4ZXBC 4U1LA 4RNRB 2FIRT 3VCLA 1WT5C 4OGXH 3FT4B 1XIWD 1YEFH 3KWWB 4RFNC 5ACLA 5ISZA 1OLZA 3H0TA 4EN3C 3D39D 2A6IB 1UGNA 2X4RA 3HE7C 4LHUB 4BYHA 3BIAX 5DTFB 2XKUA 4DW2L 4ZYKA 4DCQA 2XA8H 1EO8L 2VXSL 4DN3H 1OOAA 4JQIL 2MQCA 1BM3H 1J0JA 3CVIL 5LAXA 3B9VA 1JVKA 4O58L 2O61B 5E6IA 3RU8H 4K3EL 3UJIH 2UVFA 4JZNA 3GGWB 4GSDL 3GIVB 4Y7MA 5IBTL 5IVNA 1D5IH 4WO4C 2VR5A 2NY3B 1VERA 4FZEH 3OAUH 1S9WA 4LL9A 3VGFA 2A6KA 3NGBB 2VNCA 4JPWH 3BFOA 3EOBA 4NQCE 3ARWA 3QIWB 2A0LC 2VLJB 3K81A 2J6EL 4P59L 2VLLB 4RGMB 1OW0A 4Y5YA 4KTEH 3VU2A 3HPLA 1FPTH 5CEXB 2AS5M 1U36A 2D9CA 3DPBA 4BSJA 4QHMB 5DI8B 3LH2L 3ZE2F 4MQTB 3NAAL 3MRMA 1QSEE 3O2VH 2P7TA 1A6ZA 1BBJB 1S9YB 3DTXA 1MHPL 3LKPB 2A2QT 3QJFB 5CJXA 1G9ML 2OMNA 3FTGA 4K94H 3UTZB 2XKSA 2Y25A 4BQBA 1G6RA 1OP3H 3VXRE 2DLHA 1I1FB 3D5OF 1EIBA 4Z7UA 1OARH 1CICB 5DJ6B 2Q8BH 2YN3A 4WTWA 3S36H 1CLOH 3OHXA 4KAQL 5GGTH 3O3BA 1K3ZA 2IMMA 3HZYB 5HHOA 1AP2A 4MZ2A 2YRLA 2F15A 3ULVE 4NZRL 4XP9L 1KYOJ 2YBRB 1OP3K 3DO3A 1FFPA 4JFYB 1MLCA 1VKXA 3LQAC 3WNNA 2BOBB 4QRQB 3TN0C 2UZIH 1U3JA 3F7QA 3MRCB 5DQJA 3TV3L 2DQUL 5DRWA 1YZZA 4HX1B 3WDJA 2MCG1 4XZUA 3ARPA 2JJTA 4M61A 1MFNA 2DLFL 2X42A 4HCRH 4M43H 1OTTD 1KCSH 1B2WH 2DWEB 4NQTA 12E8H 3IU3A 4P4RA 4WY7L 3FQTA 4XTRD 4Y19E 4KQ3H 5BRZD 4FQCL 3P4NB 5FM5M 3LKSB 3SGJA 2R2BB 3CAFA 2VAAA 3HZVB 4TVSa 2ZUQC 3BIBX 1BZ9B 1YNKL 3RWCA 5B21A 5T1KD 3VXOB 3ZYJA 4OCYH 4H25B 5ALBH 4CMHB 5TE6H 1CR9L 3ZYZA 1BMGA 3DVNA 1OQXA 1MCQA 2WUBH 3HAEA 2FYYB 2Y36L 2C1PB 3TZVA 4AM0B 4DZBA 5DLMH 4PD4K 3KS0J 5DO2C 2QSCL 3HUJE 2Y23A 3SKNA 1MHHB 2UY6A 3PL6B 5BV7L 3VXTB 1QSVA 5HHXL 1IM3A 2ZOLB 1NAMH 4YGVB 4OBSA 3BDYH 3MNZB 4NRZB 3LPWA 5DEGB 3ZDYF 4CNIB 2VIRA 1JGLH 2GUOB 3JWOH 1V8HA 4ORGB 3I75A 2X9XA 4PJ7A 4B41A 4LEOB 3QWQB 1AO7D 4DGVL 1XEDA 3UX9B 1L7TL 3CDCA 2IGFH 1N2RA 2Z31A 2E6QA 3FJTA 1QBMH 4XRCB 1B6UA 5IP4A 2GAZA 3UPAA 1H3PH 3O0RL 4ELMF 3SGKA 2BVQB 2DD8H 4J6RH 4XBGA 3WD5H 4W4OC 3EYUH 4K7FB 4PREB 3Q2CA 2JJSC 4WUUB 5F3BA 1OTUD 2NY7H 4YXHL 4UTBL 3VCLB 4U1LB 4UILL 3EGSA 4TN9A 2YKLL 1LMKA 1INEL 2OZ4A 5DJ8A 5DJ2B 5ISZB 1EX0A 3H0TB 3S34L 3LVEA 4ONHB 3O6KH 4QRTA 4LKXA 1D5BA 2X4RB 1L4IA 4ODWA 4MXQD 5T3XD 4ZYKB 1UENA 4DCQB 5E70A 1HDMA 3PV6A 1CXFA 3NTCH 5LAXB 5E6IB 4KQ4H 4Y88A 4JZNB 1QVOA 4UUJA 1JGUL 1FYTE 2HVJB 4JY4A 3LRSB 3Q5TA 4JM2D 4UINH 1S9WB 3I02B 2WUCL 5EOQL 3EOBB 3IXTA 5EZIL 4Y5YB 5F7LB 5D1XA 4S1SL 4XPAL 1DFBH 4UV7L 1ORSB 3MRMB 3ZKXB 2P7TB 4MD4A 3JWDC 1A6ZB 3DTXB 5AWNH 1KCVL 2VXQH 4FQJL 5DSCB 3C5ZC 3FTGB 2YZ8A 4KKBD 1I3UA 1NMAH 1INQA 3QEQA 1KB9J 4OT1L 1G6RB 3TGXA 2VITA 4Z7UB 4M7ZB 1A2YA 3G9VA 1OAUH 4OZGA 2F5BL 3OHXB 1Z2KA 4M1CC 3RGVD 4XCEA 1IAIM 5HHOB 3SDCA 1AP2B 1XGTA 5GHWH 1A1OA 4LVHB 1NCDL 1XFPA 4YX2L 5J89A 4YFDB 1JRHL 2BXYA 3GI8H 4AH2A 1FFPB 1MLCB 1V3JA 5DJDA 4JKLA 3TCXA 1VKXB 2FO1A 4UOJA 1Q94A 5C0AD 3TVMC 2C4XA 3ECBA 1NMBH 2P49B 3B9KC 5DQJB 4YHYB 2Z9TA 4EUPA 1N6VA 4KZDH 5FEBA 1U8IA 3DXAA 3TA3D 1HI6A 5BVPL 4F7CA 4XZUB 1I7RA 4M61B 1ZT1A 1RFDH 2R29L 3IAGC 4PRID 3VWJD 3IU3B 1YN6A 4G7YH 3ZE1F 3KYNB 3EUUA 5AG8A 1G0DA 3U0PB 1CBVL 5EH1A 4WW2C 2VAAB 4X0KA 1C1EL 3RWCB 4HS8H 1KG0B 1AKJA 3UBXI 2X7LB 4XC1L 4X6DE 5E95B 2EDTA 3AMKA 5KVMC 1TVDA 4UDTA 4EUPG 5LQBH 5DMGD 1ZVSA 3DVNB 1WITA 4M1DH 3QDGE 5CZKA 1S3KL 4OLZL 3HAEB 3WIIH 3FT3A 4Z95H 4DZBB 1EO5A 3W2DH 2YK1H 1WIUA 3QULB 2GJZA 4W6WB 2DQJL 5H2BB 1CLZH 4FP8H 3RUGE 5A16A 4L9LC 1OCWH 2APFA 3SKNB 1QA9B 5E4IA 5IR1A 3NIDE 3SDDB 4TRPH 3I84A 4XAKD 4DFIA 3CXDH 1A6VL 1XAUA 1IM3B 4Z7QE 1B0GA 1YN7A 2BSED 5L0QC 1NLDL 5CZXD 3U9UA 2F8VA 2VIRB 5KVEH 1P53A 5HGAB 2HLFC 4K3DH 3WLWD 2W9EL 5K9OA 2E7LC 4HUWA 1FFNA 2ADJB 2GYSA 2FX7L 3TJEH 2AI0H 3IFNL 3I75B 3FO0L 4G7VH 2HFTA 4YUEH 3WUWA 2W0FA 4JM2F 3KPOA 4ZD3L 3QUYC 2FLBT 3UBXG 2J4WL 1OP5H 2Z31B 3Q5YA 1H9VA 1J1OL 5CIPH 1J1PL 1ZSDB 2GAZB 5DK2A 4ZS6D 4C83A 1C5DA 4Y4KD 3RWEA 1Q0YH 4GAYA 4XBGB 3V7MA 1YQVL 5F3BB 1KENL 5KANI 4R7DA 5CSGA 1OP5K 5HSFA 1FH5L 2VDPH 4U6VL 5KSAC 1IL1A 1QSFA 3EGSB 2VTFA 5HGHA 4AG4L 5T3ZH 2YD2A 2ZNXA 2GJ6D 2CK0L 5CWSA 4LVOB 4UTAH 5IQ9A 1Z9OA 3F62A 2DM2A 3BWAA 4M7LL 4ODWB 1U92A 2MPAL 3WUWG 4D2NA 3TLRA 4XP1H 3BJLA 1A7QL 1CK0L 3NABH 5E24E 1HDMB 1RUAL 4FXGA 1MJ7H 4RBPK 3U30C 2YWYA 2BHZA 4GAJH 2R56L 4K7PH 1QVOB 2NQCA 4PTTB 1I3GH 4UUJB 3LY6A 4JY4B 2XQYK 4POZC 1JIBA 3S37H 3QFJD 5DFVD 3BE1L 1QFUH 1MFEH 1IEAB 5GJTL 4KRPB 3IXTB 5LBSL 1SBSH 1ORQA 5ALCL 5I76A 2JELL 2X09A 3R06A 4Z9KB 2LTQC 4KGLA 3THMH 5F97E 3EFDH 4KROC 5D1XB 1KPRA 3LOWA 3OPZH 2WV3A 2FEDD 5HI3C 4MD4B 3KXFE 4AIXA 5MENA 1JYNA 1QFWL 4XNZB 2HTKD 3BYTA 1INQB 3QEQB 1A0QH 2VITB 4XHJD 3RVVD 3H3KA 1A2YB 1X6LA 4OZGB 5IHZA 1BVLA 4OFDA 4NBXB 4V1DE 4R4FL 4XCEB 1BREA 3SDCB 3VGAC 4ZXBA 3GFUA 1A1OB 1WT5A 5IVOA 4XPFL 1UCBH 4PJEE 5I8EA 1ZHBA 3PWPA 5KN5A 4AH2B 4OLVL 4EN3A 3SOBH 5KZCB 3BPNC 2HFGL 4OIIH 4N0UA 5FUCE 1Q94B 1I3RA 3HE7A 1TFHA 5JMRA 4K3JL 4LCCC 3VMOA 4M6AA 1QFHA 3ECBB 1NC2D 3IVKA 3BGFB 4EUPB 5EA0H 4MJ6A 1VFUA 1G1YA 2L7JA 5J06A 4JFOA 3MA7A 1QYGL 4F7CB 2DQGL 1DBBH 1I7RB 4TTDC 1ZT1B 5JA9A 4XB7A 4FQLH 4JO3L 1Z9LA 4DKFL 3I6KA 1NFKA 1YN6B 4WO4A 1GGUA 1I3VA 2O5XL 3WJLC 3F6LA 1JCKA 1MRCH 2X4NA 4NGHL 1NCWL 1AH1A 1KYOK 3T4YB 4HXBL 3GEWB 5CGTA 3CJJA 5JHDD 1DLFH 3HE6C 1AKJB 1YMMA 5IB3A 3WO3B 4LU5H 1E4XI 3L7FA 4BUHA 4R97C 4WENB 3W5MA 4LRNL 2LVEA 1RZ7H 3ZKSD 4RMRA 2BFVH 5F7MC 4UDTB 4UNVA 4MLIA 2MFNA 4X6CF 4TVPD 1ZVSB 1HWGB 2ZJSL 5KS9A 3FT3B 3I50H 1RHHA 5MI0B 2GJZB 5SV3A 4MWFA 1RZJL 4G3YL 2HVKA 4IRJD 4Y4HD 4PJFE 1N3NB 5A16B 1TITA 3OJDA 5M7QA 1NGWA 2VDKL 1MCJA 1JNLL 4GLRH 3NN8A 3DOSA 4H1LA 4I5BA 3C60D 5B4MC 5IFHL 4G9FD 4N0YL 1V7NL 3MLRL 1B0GB 1CXLA 2FX8L 1YN7B 1A14H 5FYKU 2W38A 1S7XA 3SPVB 1ZANL 5D7SH 3TN0A 2IALA 4N1CA 3U9UB 1N0XH 4CN1A 1T6WA 3T0AA 3MR9B 5HI5D 5K9OB 4HUWB 1FFNB 1EHNA 3C5JA 1E4WH 3ARFC 1KEGL 3RWFA 4IOFC 5IFJA 3WUWB 4FOMA 2W0FB 4G5ZL 3KPOB 3MLXH 1G7JA 3K80A 1UM6H 2PTUA 3VGBA 3EHBD 5DK2B 4C83B 2GTZA 4W6YB 4LP4A 1C5DB 4P5KB 3RWEB 4UT6H 3GMPB 5DUMH 4ZSOA 3SE3C 5F96H 4GAYB 5I1GH 1J0YA 3ULUE 3W11D 4M9PA 3Q6GL 2QQLH 4BZYA 4R7DB 2XZQH 2H41A 5I75C 2E7CA 1IL1B 1QSFB 5HGHB 1JNHA 1Q9OA 3BZFA 5KSBE 5CWSB 1U8NA 4P4KD 3ZTNL 2QLVB 2EDLA 4MXWH 4S1DC 1A9BA 3BWAB 1F2XK 1U92B 4JKWA 2GSGA 4PJFB 3NIGE 1EEQA 2VLKA 3SQBA 3PQYE 1WV7T 3W0WE 4JDVA 4WHYG 4FXGB 1TQBB 1AIFA 4R0LA 1VGEH 5F72S 1U9KA 4HZLB 1N26A 1CGTA 1OGAE 1LWRA 2B8OT 3JV0A 2FDBP 5JW5A 2MKWA 3O45B 3T8XA 1I1YB 3GSVA 4J3VA 1KTRL 5I76B 1W8OA 1MCPH 3WKML 4WUKH 4ZODA 2OL3A 3R06B 5KOMC 2W91A 5E7FA 4HPOL 1KPRB 5FK9A 2H3NA 1YJDH 4YHKH 4PB0H 2EKJA 1GZPA 4M5YL 3TESA 5GGQL 3UDWC 4XCCH 5MENB 3T4AA 5KW9H 1RY7B 1ZT7A 4YDJB 2CKBL 1LO4L 5HVHC 3X17A 3DJ9A 1M7IA 1FZKA 1V7ML 3BDXA 3E6FB 4XXDA 4ZAKC 3MNWA 1JWMB 1VPOL 4W4OA 5IHZB 1BVLB 5FO8B 4ZXBB 1KIQA 5I8EB 4RFNB 4QHKJ 1ZHBB 5KN5B 4EN3B 1S5IH 5F1NA 1DP0A 2ICEA 2X10A 1NGQL 2CRYA 1UYWH 4N0UB 3MV7D 3HE7B 2ENYA 5JOFB 1J18A 3L3GA 4H88H 5E56A 2FJGA 3QHZH 3IVKB 1NBQA 4PJ9C 2V9RA 1Q1JH 3P0YH 4MJ6B 4JFOB 3MA7B 4NQED 4F37K 1WBYA 3IAPA 1NBYA 3BMWA 3WCYA 5I15H 3BZ4A 2AERT 5I9QC 4LVNC 4NQDA 1WK0A 1YY9C 4Z5RA 3QSKB 3U4EA 4WO4B 1UH2A 3L1OH 4HWBL 5F7WC 2X4NB 4Z7NF 4MB4A 5JNYA 2XG5A 1FFQA 1W2KT 1DQQA 4YH6A 5CINH 3MOAH 1D5XA 2BHUA 2F53A 4MJID 1IVLA 4RGNE 1A6UH 2FATH 1YMMB 5IB3B 1H15A 1DBJL 4ODXA 5SWZA 3RQ3A 2V5RA 1VFBB 3B5HA 4I2XA 4C56E 4X4YA 2FHFA 3QI9C 4JHWH 3P9WB 35C8L 4X7DC 4DN4H 4Q9QH 4ODSL 5ILTL 5EOCJ 3K8MA 4XC3L 5KS9B 1NEUA 2AJSL 1RHHB 1M71A 3U7YL 3EO9L 1IGFL 5HVFB 4MWFB 3HFMH 1KJVA 2HVKB 3CU7A 1A6PA 4ZOEA 3OJDB 1NGWB 3GNML 3NN8B 1J8HD 1RUQH 4H1LB 4I5BB 4AT6A 5K9JL 4K9EL 1TJGH 5KAQG 1I1AD 2ICCA 4YHMH 5EU4A 2HG5A 1HSAA 4PJAA 1C12A 3E8UL 1S7XB 4ZUUB 4MQXD 5FGCB 2IALB 4PJHE 4ZFGH 1KNOA 4OKVA 3HR5A 1EHAA 1H0DA 1FP5A 4FZ8H 2ORBL 3C2AH 3HMXH 5DURB 1AGEA 1IQWL 3C5JB 4EI5C 3RWFB 2EE6A 1UZ6E 4XVSH 4UT7L 5IFJB 1L0QA 1F4YL 3H9SD 1WTGT 4MJ2A 4HUMB 4R6UA 5DJ0A 4JRYD 1WEJL 3QCUL 3O4LA 1G7JB 2AXFA 4PBXA 3LIZL 2ZWLT 2PUQT 3EJYC 2DKSA 4Y8AA 3FFCA 2VLRE 4WW2A 2ITCA 4NUGH 3UPCA 4Y16B 3P0VL 4GKSA 5I1HH 4WW1A 1NFDE 4C56B 4OZHE 5JIIA 4KI5E 1JNHB 5ERWA 4DFHA 4ZNEE 1Q9OB 3CDFA 2F74A 4IBLT 4X4ZA 1K6QH 1U8NB 4JPVH 5EORL 3RP1A 2YC1B 1LDSA