2YPYA

Kshv lana (orf73) c-terminal domain, decameric ring: monoclinic crystal form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF 73
publication title A Structural Basis for Brd2/4-Mediated Host Chromatin Interaction and Oligomer Assembly of Kaposi Sarcoma-Associated Herpesvirus and Murine Gammaherpesvirus Lana Proteins.
pubmed doi rcsb
source organism Human herpesvirus 8 type m
molecule tags Viral protein
total genus 31
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 2ypyA00
1VHIA 2YQ1A 4UZBA 1B3TA 4BLGA 5A76A 2YPZA 4K2JA 4UZCA 2YPYA 2YQ0A
chains in the Genus database with same CATH superfamily
3CD7A 1TMMA 2QMUB 3H2UB 1VK8A 3VAFA 1S10A 4DUTA 2AJFE 4JI0J 2M3DA 2Y1JA 2W8LA 5DM6Q 1UPMB 2BJ7A 2ZOGA 4TU7A 1MMDA 4NZ0A 2M52A 1I94F 2DCUB 4W90B 2KXFA 2Z4PA 2BKOA 3HF5A 4LF2A 2KB2A 4NCBA 2PI4A 4DSKA 2KM8B 4XDDA 3HSZA 1VHFA 3M2RA 3BYRA 1Y4ZB 2DKOB 4IRDA 3CJ3A 3I5BA 1JB0C 5LXYA 1O8BA 2CFXA 3CGIA 1ZM3A 1HBNB 2MMYA 1NNDA 2DPJA 2MZTA 3CDUA 3BZQA 3C15A 3TARA 4F36A 1S1UB 1EX8A 4Z7CA 1MG7A 1HMVA 2D74B 2G2YA 1X4BA 4OYWA 3M05A 1RT4B 3VHQA 4DV5J 1Q16B 5BYRA 3ZNJ1 1TL3A 4M5LA 4QR0A 3BKTA 1B99A 4LFBF 2BYCA 2GZOA 1WHYA 2GHVC 2OMOA 3J7A1 4C3MA 2QL9B 2ATLA 4ZP7A 2EPIA 3TRGA 1WG1A 2U2FA 2YQ0A 2GMJA 1QTNB 1S1WB 2GX8A 5ETPA 3H0PA 3I55S 2C2EA 3EGVA 2HRYA 2IM3A 1KC8T 5DQGA 3MEGB 5KG1A 2A1BA 3M4XA 3UDVA 2AJ0A 3OR1B 2CVIA 1UMJA 4M5HA 2V94A 2WVBA 1D8ZA 2IAJB 4Y2MA 1WEZA 1YVFA 4U7UK 4RW9B 1TTHB 1U2RA 1HNXF 1ROFA 1UVNA 2CQHA 1TK8A 4ITSA 2HKEA 2C2MB 3V6DB 5HQMA 2QT7A 2W9CA 3SXLA 3J7YI 4URQU 4PG7A 4ED1A 3OFHA 3KLHB 3NXZA 2JLGA 3POTA 4I6AA 3MM8B 1JXLA 4C8MA 2VG7B 1YIJS 1T9WA 2YNHA 3G2XA 2ZHOA 4QIEA 1F5CA 3H20A 3MAQA 4NCGB 3TX0A 1YITS 5E3AA 4GC7A 1S1XB 3JSRA 4ED4A 1ZZNA 1L3VA 2O01C 1REVA 2VQFJ 1KTVA 5F9LA 2OKQA 4DQRA 4DL4A 1WOPA 1RWUA 1UVKA 1FTCA 4O0NA 2F4VJ 1PC4A 2HBQB 3HHLD 3ZZUA 4RUCA 4RNHA 2PSZA 2N4CA 5SZTA 4R8UA 2FVSA 1K9MT 4O44A 1ZPVA 5HVGA 2ZNZA 1N32F 1FNOA 2ZZNA 4JV1A 5C42A 2BDPA 1H3DA 4ZKAA 1CJKB 2DH7A 1RTJB 4XPEA 3I96A 3OL9A 2E5LJ 4K5RA 2PE8A 1GK8A 1RT1B 3CJKB 2OPPA 1HW8A 1KLMA 1U09A 2C22A 1NB7A 3K0JA 1MU2A 4RU9A 1UP1A 3OTEA 4DG1B 1D1UA 2NXJA 2R42A 5HVHA 1NRKA 4DN9A 2RUGA 2V4QA 3EICA 1IM6A 4HACB 4A8YA 1YG0A 2EXUA 3C6TB 2O1PA 2XHCA 4NMLA 4OHYA 2OEJA 2JJ4D 4X66J 4K4SA 4HL9A 4LFCJ 1U24A 3OBIA 1YLXA 5I3UB 3DM2A 5ETOA 3ZTPA 5KFIA 2R8JA 4B3TJ 3BSAA 4WXWA 2RU9A 1WC4A 3M32B 1VISA 3MMAA 4WK1A 2DEJA 4JBCA 1R89A 3KG1A 3I4HX 4HT7A 1C2PA 3Q8PB 3HPOA 3A3NB 5HQLA 2B5JA 3H40A 3H42A 4L75A 5B0EA 2FJXA 2EKYA 5D3GA 1Q8IA 3VQTA 1FDBA 4M5MA 4ILMA 2DYAA 4LF9F 2IFXA 3RUBL 4ED7A 3W5ZA 1VBXA 1I3OB 4KGZB 2GCFA 3QT5A 4A48A 3CCVS 2VFUA 5T7LA 4DL2A 3Q8YA 2YNGB 3Q83A 4Q44A 3B8HA 2VJVA 5L9XA 1IUJA 2IRUA 1AW0A 4KHRA 4CT8A 2XM3A 1FWKA 4ELVA 1R8BA 3QPIA 4DV2J 3CF5Q 5CYMA 2ZH3A 2YKMB 3MOJB 4C8NA 4ZVFA 2EBEA 1P1LA 1LWEB 4I6YA 4A8XA 4USMA 1SIZA 3AJ1A 1N34F 4YEAA 4PWDB 4U7CA 3D28A 3FVYA 5IV4A 5K14A 3BPSP 1DHMA 2WBRA 3ETOA 3O6QA 4LRBA 1PBUA 1RUSA 2DISA 3LP0A 3C19A 4I7FA 3TJAA 4HDHA 4F4KA 4F2RA 3UCGA 4P71A 2UV8A 2MXYA 1NSQA 1S72S 2HNDB 4B17A 1GTHA 4DL3A 2UU9F 1DLOA 1PIEA 2AZ1A 3DRRB 3GONA 3ZC4A 4RL1A 4M5DB 2AYMA 2P5VA 1KQGB 5DG9A 3OXLA 1KHWA 1UFLA 4DV7F 7AT1B 4AQYF 4ED6A 1FEEA 4LF6F 4Q0BA 2FZGB 4F67A 2NSCA 5GAGU 4LFBJ 4ZP9A 2XYHB 1UZDA 1A6LA 4NI2B 3G8SA 1HARA 1O51A 2JLFA 2MLYA 2HK3A 2ASYA 2HMIA 4UY85 5KG6A 1NKEA 3MD3A 1RI7A 4C0HA 3TW0A 2YNIB 3A13A 1JLGA 2CQGA 1TAQA 2IJRA 2WSEC 5EX3A 1HQEB 1P9QC 5LXRA 2DR9A 2QFIA 3UO0A 3DLGB 4MYTA 2KXHA 2XNRA 3DLLQ 2D3OR 3A3OB 4ED3A 2B9YA 1NJYA 1LWFA 4YB1P 3NCQA 1XTZA 3W8GA 6AT1B 3A3PB 3D66A 1FE4A 1HNXJ 1CJUA 3OR2B 4KB7A 1C0TB 3DOMA 1HL6A 2LDIA 2BQUA 4P75A 4HYKA 1RAIB 1X9WA 4GC6A 3ONQA 4UQTA 1X4FA 3GR0A 4NEYA 1SJFA 1LOUA 3DU6A 3FSYA 5J2QA 1VRTA 2JFDA 3DRSB 4I64A 5MAOA 2DH9A 1C1BA 1NSPA 2ZUGA 2MKSA 2V2VA 2ZBPA 3OTOF 1GMUA 4LRFA 3Q8SB 4PUOB 2Z2YB 2E5JA 4KGXB 2BXJA 1S1VA 2FTRA 2KKHA 2GIRA 3EE3A 2E1AA 2ASJA 4JI2J 1S57A 3G8TA 1EHWA 2DH8A 3LWMA 1UW4A 1UFWA 2EFGA 4K50A 4FXDA 4NLWA 3X3UA 2F8HA 4E98A 3CUNA 5F8IA 1RACB 3VGTA 3BSCA 3HD1A 1IQTA 1JXEA 2VASA 1JLBB 3H5SA 2MHNA 2C3MA 5AXKA 3DNCA 2RD5C 3BO4A 1WOOA 3MDFA 1RT5B 4DL5A 1N32J 1F5BA 3W9HA 1GXLA 1U2FA 2FHJA 2XMAA 4DCOB 2LFVA 2ZE2B 1S0MA 4HEA9 2KFYA 1VQYA 2DNKA 3RR8A 1TP7A 3T5JA 1T3NA 1D09B 1HWJA 3UN3A 2GQQA 1S6QA 3J7Z5 2J8SA 2FJVA 3IBFB 2QG9B 1SH3A 3F56A 1GQEA 4EEYA 2KJWA 1NM2A 4DCJB 2C28A 1FX2A 2C3UA 4PR6A 4KHMA 2BJDA 1U47A 3IO1A 2Y8YA 1H98A 3I32A 4C11B 1RHMB 1UPPA 3K5LA 3C6UA 3HZGA 4M63A 3G4SS 4P7VA 1HNVA 3UN2A 3AHPA 1FKPB 2VDHA 1WD6A 3T9ZA 1KTQA 4B3OA 3OHBA 3FC9A 4LJMA 5A76A 3PIPQ 2WB4A 5A0YA 2QA4S 2WTFA 3JS9A 2GFFA 2MGZB 4O3SA 1UEVA 4PXCA 2WVCA 4X2BA 3JYTA 4MFBA 3MPWA 2Q3PA 4CO0A 3CCRS 2VKZG 1QUVA 2HBZB 5E5NA 1V5IB 3Q8QB 3GILA 5IFMA 2W2NP 2HHHF 5KFMA 2B7BB 5E3QA 4O3NA 3BGUA 3D6HB 2J0SD 3IWLA 1IR0A 3GB0A 2JEFA 1F0XA 2RDIA 4ZPVR 2VD3A 4LF9J 1CQNA 3W2WA 5K8PA 5IOLA 2R8IA 4LUBA 4YS2A 1FJCA 5D4LA 3MEDA 2VQEJ 2DTJA 4Q2MA 5DM7Q 1DARA 1HW9A 2YX7A 1TVRA 2IA6A 3AOCA 1UL3A 4ZCKA 2MSSA 3CD6S 4GKJF 3UQSA 4B9NA 1R3NA 5A8WB 2DNHA 4CQ1A 5CYQB 1RKIA 1UFKA 3SYZA 2NPFA 4F3QA 2B6AA 1S48A 3I9ZA 1SXLA 2R8KA 1U02A 1YJWS 1T8EA 3A12A 1T03B 4EO8A 2P6TA 2DNQA 1S6PB 4LIRA 3EDQB 4WYLA 4RW8A 5HVFA 1ZETA 1VQ5S 3T1AA 3VVTA 3UNGC 1XNRJ 5E3RA 3PHEA 3HJVA 4BC7A 3LP2B 4NA3A 4DL7A 1U26A 5I42A 1Q5YA 2UU9J 1OYDA 1SQEA 2HQGA 3R8YA 3BJYA 1R8AA 3AY0A 4Y65A 1RISA 2BV3A 3MD1A 4R25A 3ZNUA 4FP9A 1QAXA 4ZLPA 1LWXA 3I0RB 4LT6A 4NEZA 2Y1IA 2DIVA 3IP0A 1EAYC 1BC6A 4DFMA 3MM9A 4EK2A 1JMTA 1KKHA 2RILA 5CH7B 4AQYJ 4LF6J 1RWXB 4NLQA 2AW0A 4AE5A 2ZWOA 3PW7A 4J7CA 3KLIA 1TL7B 1CPZA 1KRPA 2QSWA 1BGXT 3M1VA 4LFAJ 4I6WA 1RZMA 2MQ8A 3EGZA 2R7QA 2R9LA 5D4OA 4DV0F 4ZP8A 2GO9A 4WYWA 2D7SA 3GZ7A 2QMXA 1FI4A 5GAGI 3R7NB 4WE1B 2PEHA 5IQQA 2XSFA 1FESA 4QR1A 3R97A 1AZSB 1RWVB 1TL4A 3FEYB 2C2RA 3FMBA 2KL8A 4AXJA 1VIOA 2I8EA 1DTQB 3P8BB 3RZAA 1L5UA 2H4WB 1Y0HA 4K5SA 1S4EA 3MEEB 3RB0A 1VQNS 2BEFA 4DMZA 3PM9A 4Z7YA 3DGPA 4XDCA 1BQNA 3C16B 4QPXA 2QGFB 4IYQA 2CYYA 4LBHA 4F0KA 4EBDA 4TKTA 2W4DA 2K06A 1WKLA 2KRRA 4KO0B 4C9DA 4DSJA 4ED5A 2ZHAA 3OTOJ 4CTAB 2RRAA 2A18A 1NHKL 2LQBA 1NK4A 1HBUB 3UW1A 2EG1A 2ZKTA 3D0GE 3ISNC 4LVOP 1PG5B 4OYPA 2FZCB 4KH0B 5HMWA 2J9DE 1BXNA 1X8DA 2J6SA 1NZ8A 2FLLA 1VLOA 2QSFA 3I31A 4C8OA 4RWXA 2MY7A 4UOGA 3Q8UA 4ED0A 4K4UA 1K1QA 2GQ2A 2I2YA 3JB9k 2B0GA 1JQGA 4L6V3 3B78A 5KAKA 4YY3F 1DRZA 1Y7PA 1UEKA 1HBMB 1H7XA 3BSNA 3BDPA 2RUSA 1WEYA 2HNZA 2ZD1B 2DGUA 2CG4A 4CT9A 5IXUA 4L3NA 4I2PA 4MK7A 1PBAA 5D0HA 2KZMA 3H2LA 2RF2B 2YWGA 2YKQA 1AUSL 1NDPA 4ZVHA 4CO4A 3CCZA 4UZCA 2KG1A 4KR0B 1B70B 4K4TA 5KT3A 3DDKA 2B9WA 2CNNB 1N5QA 3U7JA 2YNFB 1LWCA 5IM0A 3K58A 2V9WA 4U8VA 1RHKB 1Q1KA 1TR0A 2X7IA 2OGUA 3GCXP 4ZITA 5HMYA 2HQFA 3HVTB 5ETLA 2PGCA 5J2NB 3LW5C 3CO0P 3TUPA 3UDCA 2BJ1A 3SEOA 1GEHA 4IH5A 4ECQA 3I9V9 4EU0A 3GSDA 2E5GA 2EFPA 2A6OA 4U96A 4OI4A 2PMHA 5CHCB 3ILOA 2D1CA 2MKCA 1LQ9A 5J1NA 4B08A 3W2VB 2H51B 4A8MP 3FNNA 4MMOA 2L48A 5SUHA 4QWAA 4DZDA 4WKYA 1FJEB 1RHUB 4J91A 1NAQA 3SDEA 1DJ0A 4IKAA 3PYDA 2XI2A 1UA1A 3CWJA 4HI1A 5D4PA 3BGOP 3PG9A 2V9KA 1H72C 3DLEB 3HVWA 1EP4A 3BGRA 2VG6B 3PHTA 4IFVA 4JI7F 3KLGA 1LXJA 2CJQA 4GVBB 2R2RA 2NQPA 4QW8A 1DTTB 4WP8A 2N3LA 4V19J 2E1MC 1GX5A 4O4GB 5JVGQ 3E01B 4AD6A 2GVDB 3QT7A 3RYLA 3M8PB 5IWAF 5K8NA 4NLVA 1H38A 3IAS9 3VAMA 3UWTA 6FD1A 2JEGA 3TUZC 1X9MA 1R31A 1FRJA 2HQ3A 4RUHA 1WHVA 3PR4A 3DKDA 2MKKA 2V4JA 4KKOA 1VJQA 2QFJA 4CNZA 3MCSA 1YJVA 3EX7B 1V3RA 4FNIA 4DV1F 3N4WA 4TY8A 1S4FA 3PX4A 2J7KA 4ZP6A 2HVZA 1CJTB 4OI2A 4QU7A 4FNHA 2Q79A 2XWXA 5KFVA 3HMJG 4DR1J 2O67A 2VOOA 4CLTA 4NWBA 3ET6A 2QLJB 5HROB 3M30B 3SCLE 1NK6A 1RHRB 2CRLA 3KLFA 1C0UA 2B43A 3NWGA 2BBEA 5U47A 3WX4A 2VL1A 6FDRA 2MB0B 2WB1D 2XLKA 5BYSA 3BYPA 2F65A 5KT5A 3DI6B 2G4BA 4H54A 1V3SA 1KVIA 3KJNB 2FJEB 3LA0A 3UR0A 2HG4A 4DV0J 3IFEA 2NYHA 4JV0A 3AQOA 4MAKA 1QE1B 4RBVA 1JKHA 1SH2A 2XMMA 3FGVA 3H4BA 4RUAA 1VYAA 5HJYA 3ENQA 1MMLA 3KK2B 1KQFB 4DLEA 2FHJD 2CKWA 4KSEB 4XIUA 1R0AB 4IG0B 1TUWA 3E3XA 3IG1B 2R7SA 3H98A 1IR2A 2N7YA 3T5LA 1RTZA 2RQ4A 1FXLA 4FF4A 1N6QB 3SSSA 4ZCIA 4IFYA 4OI3A 3N9UC 1LFWA 2ZVSA 1RBLA 2ZZMA 3QGGA 3VF0B 4DXLA 1KQSR 2YKPA 1UCNA 4ELUA 2RJZA 2RU3A 1U1NA 4MIAA 3DOLA 2PC6A 3FCVA 1RJJA 1R8PA 3A8JA 1BUXA 3QJPA 1S1TB 4YR3A 1IKWB 3NP5A 3P5BP 3Q23A 4TQRA 3N5FA 1XMQJ 2I6WA 2KRBA 3OVSA 3G82A 3HX9A 1ZTWA 2DNMA 4RJVA 4H4KA 5HMXA 1VRUA 4Y2IA 1FK9B 3GMGA 3HDSA 3NKYA 2V8HA 2HNYA 3FEXB 5C25A 2ZBCA 4ELTA 5E33A 2J76E 1YBUA 4EYIB 3QT6A 4ZVRB 2RS2A 1RA6A 2BE2B 3G6XA 4KHPJ 2CNLB 5KFFA 2C2OB 3D6TB 1NPPA 1IBKF 5I4MA 2ZWPA 3TZWA 1RAJA 1EB0A 1M0SA 1FFSB 5J2PB 4K8RA 3PKYA 3W63A 4N56A 3RW6A 3AA9A 2VBWA 4OZ3A 2LA4A 2AEMA 3W5YA 4V1Ak 1FX4A 4QJVA 4LF4J 1HBNA 5F0WA 3CULA 1KS2A 1QJHA 4G6VB 2BE7D 2FDNA 3HK2A 3GIJA 1N4LA 3SCKE 1U2CA 3DRPB 2M88A 1S1UA 3MPUB 4OZ1A 3L7UA 8ATCB 2POKA 5F3TA 2HGNA 2W01A 3OV7A 4Q7AA 5J1EA 1IKYA 2DR8A 1NLKL 5KG2A 3ULHA 4OYOA 1NK8A 1QSSA 5KFHA 1DY3A 3OPKA 2VPZB 4U7UD 3OL8A 2N7CA 2BJ9A 2HAFA 3OHAA 2ZFHA 4ZK7M 1MLAA 1S1WA 4B3MF 3NRBA 2FLPA 1M5SA 3OVBA 4JI4F 2NXCA 2UUAJ 5KFLA 1HA1A 3LPEA 2OO4A 4U67Q 3PVXA 1KP6A 1RCXB 1D8YA 3MEGA 2MPUA 1UA0A 3OR1A 1CQMA 3M8QB 1AT1B 1YHQS 3D0IE 4ZMMA 3PW0A 3SQGB 2IAJA 3LWLA 4URGA 1VDHA 2BOPA 2XI3A 4RW9A 3N28A 1UJ6A 4LRAA 2JLEA 1D0EA 3SCIE 2AYBA 4TVAB 3T19A 1OWXA 3V6DA 4UOFA 4Y2CA 4JI7J 2R3VA 3ZO7A 4B3SJ 2J8AA 3UVJB 3BH6B 4WWSA 3QRPA 3ADAC 2QLBB 3JAMY 5K5MA 3RU0A 1Q0NA 4HTJA 3GFXA 4MKVA 4CYUB 4WFZA 1Y10A 3KK3B 3A8EA 3QSYB 3MM8A 5IWAJ 4MJKA 1XN9A 3P96A 1W2IA 2KFNA 4IH6A 2VG7A 2M8HA 1YGYA 2ZH6A 2HS3A 3CEDA 1H2VZ 1U7LA 5ETKA 1KSPA 4LMZA 3OSPA 4NCGA 2DGOA 2FJDB 4C3LA 2RB7A 1S1XA 2XZWA 1LW2B 4LSZB 3OD2A 2ZDOA 2G1DA 4ECVA 4TXSA 5GAHU 1T95A 4AFFA 2Z2ZA 3HP6A 3N0VA 3GIRA 3GYNA 2OD4A 3MZIA 3NAIA 3W66A 5L9NA 1H7WA 2ZBRA 4YHHF 1U0HB 2CPFA 4LRCA 4EBEA 3DFEA 2RT3A 4ZLJA 4J9OA 2G13A 2XMTA 4DU7A 5LMNF 4XTTA 1NZAA 1RLDA 4QWBA 3MAHA 3QFHA 1CJKA 1RTJA 5IT9U 1RT1A 3AJ2A 5HP1B 2K7JA 3CJKA 1SVDA 1OSDA 2DRDA 2KH9A 2XLJA 1H2UX 3HKZD 2KVIA 4FVMA 3SIPB 1S0VA 1T05B 5KFUA 3W5XA 3DYAB 5HLFB 4DG1A 3AAWB 2VOPA 1NB2A 2ERRA 2HQDA 3KJVB 4HACA 1U1RA 3PO4A 3C6TA 2EFOA 4EMDA 1IBLJ 2QC3A 1N52B 4DOZA 5FDLB 1EIYB 4ZPBA 2E1CA 3AB2B 4KY3A 2UVVA 3O8WA 5I3UA 3WX8A 4XAKA 2FC9A 4NL5A 2HFSA 3DLJA 3CCSS 3MEKA 2XB2D 3M32A 2ZDPA 4X65F 2XC9A 2WK4A 1RT6B 4OLPA 3FBEA 4C0BA 4OYIA 2XY7A 2CQ2A 2MZQA 5DZ6A 5KFJA 4OZNA 3A1YG 2C3YA 3IWNC 3NOCA 3PV8A 2GVZB 2HFUA 1WG5A 2QYCA 4FVCA 5EWFA 1VQKS 5HATA 3HD2A 2W2QP 3FEZA 2O66A 1VQ6S 4ANEA 2OMLA 1ELOA 3CJ8A 1FDNA 4CI0B 4O3OA 4ED2A 2YNGA 4MTPA 5LMUF 1GMWD 3VGUA 4P7TA 2L08A 4M95A 3W3SA 3C2PA 3CDEA 1HNIB 4WZQA 1RTIB 5LSOA 3OLAA 1HD1A 3HI9A 4DCPB 3TWZA 4EWTA 2YKMA 1V6HA 5KFCA 2BANB 1REGX 5F8GA 1S7IA 5KFRA 3R5AA 1LWEA 2YX1A 4P72A 1VC5A 3KHGA 3F44A 2P9EA 2GNKA 1SJ4P 4ZIWA 3Q22A 1X5SA 1EZZB 3X1LB 1IBKJ 4N7TA 4O3QA 4G3IA 2MKYA 2NZCA 1S59A 2H9ZA 2GJIA 4OJGA 5KTQA 4EUVA 2C1EB 4HKQA 4JV5J 1VBKA 4OZ2A 1RTDB 1LEOA 2HNDA 3MF5A 4ZVPB 4DR3F 2FVCA 4ES3A 1WDDA 5GADI 2R4FA 1PC5A 3DRRA 4N8OA 5FLXU 4DPUA 3AJDA 4ZS6A 2DB1A 4OL8A 1QY7A 2DHGA 1Y3KA 3RG6A 2IVFB 1QVGR 3BN4A 2KM8C 3MAAB 4M5DA 1DQAA 2RDDA 4PRFA 1FA0A 2VC1A 4HVZA 2JL9A 4LF8F 3MR5A 3M2UB 4AL5A 3JSMB 1YWXA 3WZ0A 2CQ1A 2KZZA 1IWGA 2ZVIA 4LQ3A 1HWLA 3UE2A 4X4SA 2XLIA 4QW9A 3KJQB 3ISZA 5D0RA 3DXBA 4NI2A 1FKOB 4DF4A 1J5EF 3W8PA 3J81Y 3RRHA 4W98A 2XMKA 1MWYA 1FD2A 3V4IB 3R5BA 4P52A 2BABA 1ZAWA 5EWGA 4JI4J 2YNIA 5CD4H 4Q5VA 2KHDA 1W7WA 3GYGA 1HQEA 2JZ5A 3I0SA 4C2MA 2FPHX 1P6TA 3DLGA 1C4AA 2KT2A 2GHPA 1IBMF 5CQGA 5D77A 5KFDA 2IHR1 2MQNA 4DDFA 1RU1A 1QUPA 3D0HE 3PRBA 1QM9A 3QIDA 1K47A 1N0VC 2OTJS 4ENOA 2UUBF 4XPCA 2OI2A 3OR2A 1VFJA 2LXIA 1TFYA 1F1BB 3PEHA 4N76A 5EN1A 3LF0A 1C0TA 1MNEA 4IRCA 1XMBA 2XTJP 2F3JA 1S9EB 5ETRA 4J9KA 3EYZA 4ETXA 4TU9A 4K2XA 3AOAA 3UD4P 1R0CB 3S1TA 2LEPA 2AGQA 4NYPA 5DLGA 2NZ4A 3UCUP 2ZH7A 4KPYA 2F4FA 5KOXA 1F5AA 4XO0A 3I87A 1VOMA 1X60A 2H1YA 3QZ7A 3QATA 4PUOA 1VHIA 1P1TA 1FF2A 2W7PA 4WP3A 3QGPA 2LU2A 4DI6A 5M2UA 4ZLLA 1APSA 4IG3B 3RBDA 2Z30B 2B9EA 3TR5A 2L9DA 1ZM2A 3TAMB 3CCLS 1BQXA 3NG8A 4OV1A 4OZLA 3PACA 2FJWA 1NKBA 4YHHJ 2HGLA 1SQFA 3ETMA 4JI1J 2VG5B 1F6TA 1OYEA 4BHQA 1DURA 2BX6A 4A4JA 5LMNJ 4FF1A 1RT5A 1S77D 2DEIA 2BKNA 5GAHI 2ZE2A 4WCEQ 5D0EA 3BDEA 3SBMA 3HVRA 2FUG9 1QAJA 4DR6F 2YKOA 1N54B 2AJ4A 3UD3P 1M5PC 4HHUA 3PJXA 3LANA 2MY8A 4LSNB 1B0TA 2P8IA 2J6TA 1UZHA 4TYBA 5DQIA 3BEGB 2XYPB 3M6WA 1RBOB 4OX9J 3D6FB 4C11A 5IV3A 1DZ5A 2QMWA 1FKPA 5DDPC 1NSAA 1XR7A 2ZJPQ 3DRXA 4QYZK 4P2SA 3QMQA 3J7ZT 4ZCLA 4NLYA 3S01A 2ZM6F 2MGZA 1ZAVA 4Q2LA 1SC3B 2CUYA 2YY3A 3WC2A 3MR3A 1FT8A 5A8RB 2C2KB 1SKSA 4V19X 4X65J 2AJ1A 4DUZJ 1XIQA 4FN5A 1WI8A 1G1XA 2HVEA 2QA2A 4WKRA 3LTOA 1A7GE 7FD1A 2HVDA 3G8QA 3PY8A 4DBQA 2PT0A 2PA3A 2ATCB 4RPFA 2V0NA 1RGVA 1WC0A 5A8KB 5K20B 2FJBB 3GU0A 2YPZA 3CXCR 2FGCA 2ADCA 1RSCA 3VTIA 2G1HA 2CQ3A 5LMUJ 4FF2A 1HQUB 4ZOSA 2XS7A 1CSJA 4FS1A 3NNHA 4G65A 1CC8A 5A8WA 3TA0A 1I51B 1OMSA 1K8AT 1PYTA 4ZPCA 5CYQA 1FHTA 2IDLA 5GMKa 2RRNA 3HT3A 4DR4F 2LVWA 1WELA 4OQJA 1XC9A 4RLEA 3RRKA 1T03A 5L39A 1S6PA 2QO3A 1NJWA 1K0VA 2MHEA 1M1GA 3V6KA 4LR8A 4NZ6A 1N56A 2BW7A 4YR2A 1TKZB 3LP2A 4K0KJ 4QYZJ 2NPIA 1N88A 2K3IA 4Z2XA 3W61A 4KV8B 1YJNS 2R7RA 3MGJA 2HHTA 1W2BR 2W4PA 2VC0A 1X4GA 1FO1A 3C3LA 4C98A 1C4CA 1VS3A 1F9FA 4JP8A 1RT7A 3O44A 3G96A 3MXHP 2VHGA 2PMZD 3I5AA 3I0RA 2WONB 4LF8J 5F8MA 4F4XA 2M70A 4LBIA 2A10A 3KYLA 4DU8A 2UUTA 4KFBB 4QOTA 4ECSA 1XWLA 1TL7A 1R27B 1P27B 4NLXA 3HFKA 5E41A 1RDRA 4GVLA 1RE1B 4NRUA 3FFIB 2PDAA 5JJBA 1ZOTA 5EX0A 3NWRA 1Q8BA 2ZOFA 2L9WA 5KG5A 4WE1A 3THPA 4Z37A 3BO3A 1NCLA 5KG3A 1MWQA 1JJCB 1AZSA 4DL0C 1LK5A 3TANA 1S97A 3DLKB 2JWNA 1NJXA 1Q4RA 1XMOF 1KFSA 4RW7B 1DTQA 4C6AA 2B4OA 2B8QA 1V3ZA 4UZBA 3FJ2A 2BJEA 2N82B 4X4PA 2VH7A 1ULRA 2OJ3A 4NLPA 2EVZA 3MEEA 3QJLA 3WIUA 2HFOA 2EBGA 2P9CA 2GAHC 3C16A 3DDIA 3CW2C 2ZH2A 3EPIA 3MCMA 1FVQA 3CJ2A 3LUYA 2E9ZA 3DRYA 1FFWB 2JRSA 1JLFB 4JI3J 1HI0P 4KO0A 2A2CA 2JDJA 3NGDA 4OHWA 2AD9A 5K8OA 4CTAA 5B7WA 2HLTA 3NNAA 3FQKA 4TN2A 1HBUA 3S7RA 1UVLA 2HRUA 2DXEA 3IXQA 2OEKA 4CCHA 4OI0A 1VQ4S 2Q6BA 1TMJA 5C2CA 3UN5A 3IR6B 4DUYF 5DG7A 4RO0A 4NCAA 1FRHA 2ACYA 4LF5F 1T94A 2ZEJA 1M5OC 2RQKA 3PYFA 4Y34A 4PG6A 1IR1A 4W4MA 3J7AN 2Y8WA 4YB5A 3GJQB 1Y9OA 3H25A 1R6VA 2IVYA 4O4RA 5L46A 1QTMA 2J0QD 4MYUA 1HBMA 4DR6J 2MZ1A 2ZZTA 2I1RA 2B7CB 1SJRA 2ZD1A 4OYXA 5DS7A 3LALA 1K44A 3DLBA 1P9YA 4ECTA 5CXTA 4Y28C 2ROGA 4DPXA 3UPFA 4F2SA 5GMEA 2HHVA 4DR5F 2RF2A 1JK9B 3PO5A 3SFGA 5KFZA 3NGUA 3ZZRA 1RXOB 5EUHA 3IR5B 2NUUG 2YNFA 5KOWA 4H4OB 4CM0A 2ZM6J 3TUJC 3M6VA 1BD6A 3ZZYA 5C7PA 4IQXA 1VQ8S 1BHNA 2Q6CA 1SL0A 3HVTA 1Y00A 3W60A 4ANCA 5J2NA 4BWJA 2VDIA 1LFPA 1U25A 2B4PA 3OFFA 4K4VA 3HHKA 5BR8F 4B9VA 2CJYB 1VGYA 4DSEA 5F8LA 2XGQA 2AYEA 4N47A 1NK0A 2J6UA 1HWUA 2L41A 3BGFA 1SV5B 5LOQA 3C66A 2DVIA 3MMJA 3HVAA 4DV6J 3EM1A 3W2VA 1KLNA 1S7HA 4OJ3A 2R7OA 4KT0C 4IH7A 4CLWA 3CDAA 5K9FA 1MROB 5HBMB 3K8WA 3QAUA 1L3KA 3HM9A 3W2WB 3K8VA 3M2VB 2AJ2A 3GG0A 3CCWA 3M6UA 2H48B 3D1OA 1KDNA 4I56A 2FQQB 3L3CA 2Z58B 2VG6A 5E7OB 2QYGA 1N5YB 2HFVA 4GVBA 1TKTB 1DTTA 4PQAA 1MMNA 3ILLA 1V9OA 1U45A 4O4GA 3E01A 3MM6B 2FVPA 2KN4A 1HBOA 4UOHA 5A6PA 2GVDA 3G86A 3M8PA 3Q24A 4WIQA 4C7QA 2GO8A 4CLFA 2E5HA 3M8RA 4J9LA 2ASLA 1S76D 1VBZA 2QA4G 1PYOB 4J9NA 4DQSA 4L72B 3QYYA 4UW2A 5B0AA 5KFNA 1KBRA 2FB0A 3CJQA 4OHXA 1FD8A 2HIYA 4ICLB 1YZ6A 3R7SB 1CJTA 3RB4A 4L3KA 1WC5A 1NU4A 5CD4A 1SJQA 2LECA 2RS8A 4CZCA 2OPRB 4ZN1A 2B9XA 3PRVA 5DDOC 1Q8LA 3CJ0A 5IT9Y 2HS4A 2SXLA 2VPYB 5IT4A 1FTRA 3QO9B 4J5OA 1YQHA 3PR5B 5HROA 1BLUA 1WTFA 2KG0A 1SKRA 2GGPB 3M30A 4WTYA 2NYIA 4M5KA 2LEAA 1VJWA 5LJ3Y 3D7SB 4CO3A 4Y6IA 2HBYB 3OXGA 1M1KT 3MECB 3WIVA 1GX6A 3H8YA 3VCDA 1ZM4A 1U8WA 2COLA 3UCZP 2H3EB 4WIIA 3DI6A 3NCRA 3LO3A 5ITHA 1FRXA 3O3LA 2XS5A 1Q95G 1CLFA 2O5DA 1KOOA 5A2QY 1AROP 1H74A 4C8YA 5KFAA 4ECYA 4YMEA 1SL1A 3M9NB 4F26A 1Q53A 1QE1A 2VUGA 5BJRA 4DFJA 4NXMJ 4LREA 3CCQS 5GAEI 4YOEA 2NS1B 3AOBA 2QJ3A 1RT3B 3KK2A 4NRTA 1U8SA 3KNAA 1PILA 2WCXA 3K89A 3TVYA 3BB5A 4HHHA 2DNLA 1R0AA 4IG0A 3IG1A 2XS2A 4FDFA 3K7RA 1ZM9A 1I94J 1RWNB 4P2FA 2FHKA 4R5PB 3LPYA 2IY5B 2JSXA 1N6QA 2CQIA 4CH7A 1BQNB 2HWIA 1IVZA 4ID5B 1IJFB 2F8MA 5CZVA 1S9GB 2HQIA 3IR7B 4X4RA 1RWKB 4DEZA 2F9DA 4ZVUB 2NXEA 2DXDA 1R8HA 2PIIA 1S1TA 4OI1A 1IKWA 2Z2LA 4CDIA 3UI3A 2QE5A 2DCLA 4I2QB 3US5A 2M0GB 2YBVA 4KGVB 5LSLA 3UD5A 4ZCMA 4L76A 1U0SA 2CPHA 2BR0A 3R1LA 3EZOA 2UUCF 2MTLA 3SMZA 4NE9C 1R8CA 2VFTA 2GMHA 2VKRA 4LF5J 2QX0A 2DNYA 1FK9A 1L3TA 1VQ9S 1OIAA 2RIJA 1S12A 2NLWA 3MCOA 3EVOA 1KN6A 1WOSA 2HWTA 3KHRA 4PG5A 2BE2A 5KFTA 1FE0A 5DQHA 4GRSA 1TK5A 2G0JA 2WOMB 2YXLA 1TKDA 1RKJA 1B3TA 3IGNA 4FXVA 4IOBA 3TOQA 1RABB 2V5HG 4WPAA 2E44A 3ENWA 2MEWA 5J2PA 1FRIA 2D9PA 2OFGX 1HWKA 4O23A 3R5DA 2VJUA 3AD8C 2ABYA 3TP2A 4JI0F 3FUYA 4DR5J 5KFQA 5M2RA 4CH0S 2WZ1A 5JUMA 3OVAA 2ZC3A 2BM1A 1D3WA 1HKAA 4QIWD 3DRPA 3D54A 2RE1A 5I3QA 2BE9B 3FSXA 4CLKA 2X1BA 3CC4S 3C8YA 3VZIA 2UV8G 2V8PA 3IS9B 2X1FA 2CQ4A 1YKWA 4DV5F 4AL7A 5L38A 3CJTA 5DLFA 2AHOB 4LBPA 3VWSA 2HFNA 3JTPA 2OSRA 4QBUA 4DX8H 5DO2A 2JVOA 4TNOA 3TAQA 2V8VA 4QYRA 3GV8B 4AXIA 1UWAA 1JIHA 2JEJA 2GV1A 1MW7A 3F73A 5G0RB 2UXCF 3M8QA 3JQJA 1SJ1A 4DSLA 3LQVA 3SQGA 2AP6A 5KFSA 1HNWF 1N48A 3MOZA 2HSEB 3A4TA 3T1HF 4J37A 2CPDA 4NLUA 2I5JB 2LMIA 1N8RT 4ECXA 3M9MB 2CJ9A 3K2YA 1IQZA 1IKXB 3UVJA 3FBFA 1CC7A 5E3PA 3OJSA 4YDXA 3D9BA 2APOA 2FY8A 3L09A 3MPVA 4CYUA 2J9DA 4FS2A 3KK3A 2LQ8A 4NPOA 4ZJLA 3DGVA 5RUBA 3D1QA 4DX7A 2JOQA 5KFEA 2X51A 1URNA 2ZC4A 4ZA1A 3V4MA 3ZXWA 1U4BA 2CPYA 2Z0GA 2VZ9A 1WSVA 2Q66A 1LW2A 2PA8D 3KG0A 5T14A 3PKMA 3BM7A 4USVA 1IWAA 3UNYA 2FC8A 3VZHA 1CULA 4PPDA 3MPYA 2XO6A 4B9MA 1U6ZA 2VV5A 3GE9A 2VA3A 2V6AA 3JSYA 1U0HA 4HDGA 2V67A 4YDDB 1FCAA 4E8UA 2ZJQQ 1U1PA 1CJVB 3EXYA 2YKNB 1Q7LB 2NSBA 2VPXB 2F4VF 3D3BJ 5L1JA 3EUNA 2Y1RI 4GKKF 1KWMA 5AE1A 2AQ4A 1WI6A 2FGOA 3Q0AA 1AA1B 2M8DB 3NGSA 5HJXA 2QLWA 2RMLA 5HP1A 3CJ4A 3NGTA 2LYVA 4M1KA 3KLFB 2BA9A 2HVHA 3THTA 5IC6B 1T05A 1LK7A 3TO8A 2E5LF 3DYAA 5HLFA 3F41A 4LSLB 3BREA 2XY6A 1YJTA 5HL7Q 1Q5VA 4IOAQ 4KTQA 3KJVA 5HN0A 4OJHA 2GW8A 3LP1B 2UZAA 1VBYA 3UR3C 3NNCA 5FDLA 1Q81T 3AODA 4IR9A 1N34J 3SQOP 1D9FA 2XZTB 3Q8VA 4J90A 1F9HA 3PW4A 2G9OA 4X66F 3KFWX 1D9DA 2C2ZB 4LFCF 2F63A 3M9OB 1RT6A 1YTYA 3CCJS 1VMBA 2HEKA 4PPZA 3TEHB 2HYIB 4CLZA 4B3TF 2RQCA 2IRYA 4DFKA 1RAGB 4ANDA 1QAYA 3T6BA 3OW2R 2C2DA 4PG8A 3WQPA 3BBBA 1N5VA 2GVZA 4IUFA 1HI8A 1HPZB 3M8WA 4ID8A 4DPTA 3HHLC 1OPIA 2DGWA 4D3GA 4Q45A 4DV7J 4Q8FA 3MUMP 3DOLB 4KQZA 1KEKA 4NYOA 1SH0A 3I5CA 3G6VA 2YWHA 2VF3A 2GAGC 1PCAA 1X5PA 1V5VA 1VC0A 3W9IA 4WZMA 2QIFA 4BC9A 4JI8F 1JLAB 3P3DA 1HNIA 1RTIA 4K4YA 3OXFA 2OIHA 1TFWA 2CDQA 1NJIT 3KMQA 1FRMA 1Y3JA 4EGLA 1DQ9A 1F3FA 3D67A 2Y3YA 2KYZA 5HSPA 4CM2A 2P6SA 4IQMA 1HD0A 1F60B 1Q86T 2CVEA 1JLEB 4IR1A 4OZ5A 1S0NA 4NZ7A 2PEBA 2X1GA 4FYDA 3S8SA 1EKSA 4C4WA 4ZPDA 2R2UA 5KFXA 1G2EA 1RAOA 1RTDA 3IRXB 4OV6A 4QU6A 2N3OA 2WVDA 4TLRA 2EC0A 1FRKA 4WFYA 1KNZA 3GIIA 3VALA 2VONA 3EVWA 3ZZZA 1UKUA 3EGNA 3GJTB 4R0EA 3V6JA 3IC1A 2OH2A 3GTYX 3MAAA 3D2WA 4ZVTB 3BH7B 3U02A 2I0XA 3M2UA 1M5VC 2M7SA 3PZPA 2HHQA 5L1IA 3OQ2A 3PFEA 3JSMA 1KD1T 3R5GA 1CG2A 4AUKA 1Q79A 3BV8A 3M7VA 1YRUA 5HK4A 4PYAA 3TA2A 4ED8A 2UVUA 1FVSA 5J1EB 1FKOA 1IKYB 4CP5A 3MPDA 1ZPWX 2CPEA 3V4IA 2WVEA 3R9LA 4F02A 4CLLA 2C2NA 2ZBQA 3JQMA 5DGBA 3GR1A 3KNGA 2L9NA 1NH8A 2UXCJ 1RQ0A 1X4DA 3RAQA 5LSRA 4CO2A 3TJ8A 1HNWJ 4EZ9A 2IDEA 1PO6A 1CS4B 3SV4A 3AB4B 3T5HA 1KFDA 3MM5B 4ZDNA 2DD8S 4ECZA 3T1HJ 3TX8A 3SCJE 1HHSA 3ENAA 1S9EA 2OPSB 5G4DA 5DRKA 1RTHB 5LL6d 1G4CA 2FIUA 3EVMA 2BJ3A 4OX6A 1FEHA 2DITA 2VIHA 2NUHA 4ILRA 1O0PA 3TZXA 4OHZA 2IJNA 5KG0A 3QQCD 2PMWA 1SIWB 5DGAA 2LP4A 3J80U 2K8GA 3B4DA 5C24B 3EMTA 4O3PA 2JFKA 4IG3A 2U1AA 1WC3A 1EJ7L 1NMEB 4CO5A 3TAMA 2E1RA 2DHAA 2XBPA 4RR5A 4AT1B 5E0OA 1IKVB 2FVQA 4JI2F 2HHHJ 2VG5A 1JLQB 1JXVA 3MFHA 2IM0A 3G6YA 4L74A 5KFPA 5IC4B 1TK0A 4B9UA 4X4OA 3TVKA 4JI5F 4QZVB 3UFCX 4RW6B 1YJUA 4GKKJ 2V63A 2AWZA 1XK8A 5DDRC 2YWWA 4QR2A 5J2MA 5FD1A 2BW2A 3HCXA 4W92B 2PFDA 2HK2A 1GAOA 3JSBA 1U6FA 2YTCA 3GP9A 3KK1B 4GKJJ 4LSNA 4CRJA 4ZIVA 4X62F 2OAUA 3A8KA 4LF1A 5AJ3F 1JLCB 3R6LB 1FFGB 1I6JA 1M5HA 2OHDA 5JXSA 1FXRA 4RNMA 5F8NA 2LLZA 1GMVA 1S9FA 3IMQJ 2BOAA 4X4TA 1B0VA 2F7VA 5F8HA 3V81B 3FRZA 3B6BA 4DSIA 1VI7A 1SC6A 3OTBA 2D3ZA 4JUZA 2UVWA 1YBAA 3KOAA 4WF9Q 1IXKA 2Z2MA 2B4UA 2RRBA 2D3UA 2K7KA 2RKIB 1X4EA 1SBRA 3DCAA 4KGMA 1NDLA 5A8RA 3D68A 2YQ3A 5J1PA 3H7HB 3HFVA 1M90T 2DY9A 3TUIC 1RAAB 1NBEB 3THVA 4NASA 1Z2LA 3U1NA 5CYJA 3IRWP 3AXMA 5THWA 3GQCA 2DNOA 1VC6A 5C2GA 3NS5A 2VFRA 4GO5X 2ASDA 2CJBA 2LQJA 4OYBA 1S99A 4ZPTR 3HSDA 5A8KA 4FYVB 4ECRA 2KFZA 2M9KA 2MLXA 3BN7A 2V4RA 2ZOMA 3ISND 4URSA 1YRXA 2RSQA 3TNVA 3D1HA 1HQUA 2IC3B 2VQEF 7FDRA 2B51A 5F9NA 2FLNA 4JI8J 1ZZFA 3GYXB 2MKJA 4OYAA 3BBCA 4KRWA 4KIAA 2ZJRQ 1UVMA 1LW0B 4PAAA 2CJKA 3V6HA 1BQMB 4WFXA 4YN3B 2LQ9A 1WACA 4EI2A 1H73A 4DN0A 1AUDA 1F2GA 2ROPA 4A8FA 4WP9A 1IJEB 1XQIA 1SC4B 3IBCB 5HMZA 2IA0A 4KJIA 1QSYA 3V2UC 2DHXA 2EFVA 3QRRA 4G1QB 1PJ7A 1TKZA 4USKA 3QWPA 1E6YB 3KUEA 4BWMA 4KV8A 2Y0BB 1X4AA 3T1YF 1W25A 4J9UE 1KVKA 4ZPAA 1J5OB 2RDJA 1XNRF 3QFWA 4P10A 2QN6B 2AX1A 4RWWA 3PFOA 3M8YA 3CPWR 2DR5A 5B0CA 3HHLB 4QCLA 4RX6A 2WONA 2FY1A 3KXDA 1I1GA 4HTIA 4TLQA 4USJC 3IWXA 8AT1B 1WF0A 1R7IA 2YWFA 3FBCA 3NL0A 4KFBA 2HFZA 2H5EA 4Y2AA 1TKXB 1TL1B 3WBZA 3W65A 3QGHA 5KFOA 1SKWA 2W25A 3QT8A 1ZAXA 3O1LA 2XULA 1HYSA 3FFIA 3QIPB 2R2SA 4PQUB 3IN5A 4MH8A 1GNKA 3I56S 1SB6A 2MDAA 3MM7B 4LFAF 2ZH5A 2Y0SD 1XNQF 2GC8A 2PO4A 2I38A 4PZVA 2K1RB 3S6EA 3HKWA 2RH3A 2J9EA 5KT6A 4DV4F 2Z56B 2G0CA 4YY3J 3OSNA 2P9GA 3DLKA 2VBZA 3I0SB 3FBBA 5GADU 3M8ZA 4RW7A 1DBDA 3KUGA 2QV6A 4USIA 3K5OA 2GA7A 2DRAA 3NBPB 1LKZA 4ZHRB 2YKAA 4ZVQB 1JJ4A 2DNGA 3RB6A 3L7OA 2FYXA 4P74A 1J2VA 4B9TA 4F4AA 1Q78A 1E6VB 1EARA 2LXUA 1R0BG 2XSJB 2KXNB 3JTNA 2HRTA 3N6NA 3W62A 4J9MA 1JLFA 4KC5A 5C5JA 2LEBA 4Y0FA 3OL6A 3IA0A 3MMBB 4FKYA 3M8SA 2E7XA 1VR6A 2KVQE 3GFZA 5KFWA 2R7TA 2X3GA 3JAMU 4ATNA 1RT2B 3R5CA 1RT4A 4WFBQ 3T41A 4F50A 3K5PA 4A8KA 3Q89A 2MQOA 2XO7A 3TEGA 1SPBP 2BQRA 1C1CB 3NOGA 4RNNA 1KVJA 2BJ8A 5FJ4A 3R3TA 3DC2A 2XZDB 3DHXA 3RTVA 3RW7A 2W9BB 5ETQA 4UUXA 1QLNA 1YZ7A 3BS9A 3CNQP 4JI5J 3F0NA 1NK5A 1A9NB 2IYIA 2AZ3A 4ES2A 4DR2F 1Y5IB 1NKCA 1NO8A 3OUYB 4B02A 4J9QA 3FZBA 3MFIA 5IQ6A 1WSRA 2H5JB 3KLEB 4FBUA 1UVJA 1WWHA 4EYHB 2W2PP 1XBWA 4X62J 2ILYA 2HIQA 2AX0A 5AJ3J 4B9SA 4FYYB 3ZZPA 2IM2A 4P2XA 4U9RA 1S6UA 3P49B 1U1KA 3KLHA 4IDKB 3VR1A 3NGKA 3C14B 3KDOA 2CQBA 1MSWD 4NA2A 1T9VA 3WDOA 1R43A 3RRGA 4JB8B 3DXSX 1UW9A 1RAEB 4YUDA 2W1BA 2HPUA 4H4OA 1BE4A 1X31C 2KDOA 2LQ5A 4P73A 1VQOS 1H2TZ 2MSTA 2ZBIA 4DV1J 2ZNYA 4CNYA 5ETSA 4H4MB 2YH0A 3H5XA 3I6PA 4RW4B 2J5AA 3QAEA 5IS2A 3KDNA 2LDYA 2BMBA 1LNQA 4WFNQ 4ER8A 4U6PA 2BZ2A 1SV5A 1K73T 3DMJB 2HZAA 1RAHB 2KJVA 2RVJA 1U48A 4AYBD 2G2ZA 1K1SA 4ECUA 1GTEA 2FD2A 5DDQC 3GIMA 2XNQA 1MROA 5HBMA 5HANA 2G0IA 3CC2S 1TV6B 4M8LA 4X4UA 3M2VA 3QLHB 5M2PA 4RU2A 1UETA 2CWKA 2XMJA 1UJ4A 1OY9A 2CXEA 3DOKB 4NLGA 3H5YA 4DX5A 3GJSB 1N5YA 1ZA2B 1T3OA 1TKTA 3RAXA 1T7PA 2CIMA 3MMCB 2QLXA 9ATCB 1FWPA 1WUUA 2GIQA 4NLDA 2V8GA 3MM6A 2YH1A 5H9FK 1D9AA 2B8PA 2V34A 2LKZA 4KPCA 2MJNA 2DK2A 2O3DA 1FJGF 2CJAA 5L1LA 4OJ1A 3EZ5A 1NSKL 4EZ6A 1WF1A 2MQMA 2Z57B 2DRBA 2DHSA 3BF4A 4WFAQ 1Q7YT 2IMOA 3CIZA 4R0JA 4X4NA 1T11A 3IAM9 4USUA 1H0HB 1T9XA 3N5BA 2EFNA 1U1OA 3T1YJ 4UF4A 3CD0A 3FCWA 4ICLA 2IYGA 1SI9A 4OIXA 1X9SA 1UWBB 5E3CA 2H4YB 4BLGA 1TAUA 2RQMA 3JQKA 2KU7A 3FCHA 2OPRA 3RJMB 1HFEL 5EGYA 2RAQA 1SUQB 5JMNA 4NA1A 3U1LA 4LVNP 3QO9A 2OELA 4OHVA 2AEJA 3L9ZA 1RT7B 1N36F 2CQPA 2GGPA 2WRMA 4DR1F 4C3KA 4YB6A 2CPJA 3TAPA 5ADZA 1VQSA 3DN9A 1WTBA 3MECA 4HI2A 2DNNA 3GSIA 1T9UA 2MLZA 2OPQB 3QZ8A 5IT0A 3ITHB 1VLYA 3GPAA 4EBCA 4TU8A 4M5GA 1QVFR 3L4BC 4CH1A 4N8NA 4MKAA 4DV3F 1QD1A 2HWHA 4OX7A 1Y5NB 4CLYA 3KHLA 3R2CJ 1XNQJ 1X4HA 4BDPA 5FIIA 5KFKA 2AGOA 5DJBA 1EETB 2VFVA 3CMAS 4DV4J 2QRRA 2DHHA 4A8SA 2BRKA 3J81U 1RT3A 4FZVA 4PWDA 5L8RC 1U49A 5CZXA 4DPYA 5H9FJ 1S49A 3U1MA 5GVQA 2ALZA 3GWCA 4A8WA 3HXMA 2DBBA 2RHQB 1B64A 4C8ZA 3BKUA 4B9LA 3ZTOA 4LRDA 3BSOA 4R5PA 2E1PA 2Q1LA 3SI8A 1X5OA 1SC1B 3QRQA 1RHJB 2LXFA 4OYZA 3HO1A 2R7WA 4ID5A 3NEKA 4F25A 5B09A 5KG4A 1S9GA 2ZH1A 2EFQA 1HI1A 3CJSA 2DGQA 5IZHA 4P9SA 3M2RB 3EWGA 3HLUA 1T02A 3BQ2A 4J9VA 5D4NA 4FXWA 1G6BA 1B4SA 4QWCA 4ZVGA 4I2QA 3GLJA 4O0IA 1Q82T 4TYAA 3C15B 2JC0A 1XJWB 1HMVB 2JEIA 4K2JA 1XMQF 4DPOA 1ICEB 2R7UA 2ZUAA 1QAIA 1TL3B 3NS7B 4LF7F 5LJ5Y 2CJXB 4B3MJ 4L73A 5KT4A 3LGNA 3CMQA 3KLVA 2E7WA 4J9PA 4B3RF 1RWPB 4DR2J 2IIHA 2JC1A 3CSKA 4ZJOA 3D4JA 3G9CA 2FVRA 4C8LA 2WOMA 1TELA 1SJ3P 2QTWA 3GG1A 5AE3A 1M5KC 2X3DA 1S0OA 3N79A 4NLTA 4KHPF 1T0TV 2M5YA 1F2HA 4J9SA 4USTA 2AEFA 4UY8T 3R2DJ 4ZVEA 3RGIA 2QLFB 3Q8RB 2DGSA 2AT1B 4X64F 3CB4A 2DO0A 3W9JA 3HHNB 4CWBA 3W64A 1IN0A 5KG7A 4PXEA 2W9CB 2UXBF 1I5OB 3DRSA 3OFEA 5B0DA 2V2KA 2K2PA 2QEXS 4M5JA 5B08A 3POTB 1OO0B 1RYRA 4DF8A 3Q2TC 4LF4F 3VAGA 3AD7C 2C3OA 1OQ3A 4NXNF 2YNHB 5B0FA 5L1KA 3SV3A 3IS9A 2QA1A 2WW8A 4YB7A 4ZN3A 1GMWA 1VQLS 2A2DA 4DS4A 3AXKA 5CA5A 1RADB 1UAWA 4P6QA 3CE8A 2LCWA 2XG8A 1REVB 1B7FA 2YQ1A 2Y9HA 5F41A 4RNOA 1JLBA 2BM0A 1IM4A 2YX4A 3H59A 2OD6A 5AT1B 4I69A 2ROEA 2DR6A 2KHCA 4ECWA 4BS2A 3N6LA 5G0RA 2E9TA 1GXTA 4R8UB 2DXFA 3MTKA 2UUAF 1G3OA 4ZLNA 4O44B 2JX2A 2J9CA 3MUTP 2PI5A 2DR7A 2CDRB 5C42B 4I4BA 5T41A 1NEEA 2I5JA 3I4PA 3TZYA 2PFFB 2GJFA 3RAMA 3GFYA 2VB6A 1IKXA 1Y11A 4FYWB 2OPPB 1KLMB 1HNZF 4NLSA 2IBKA 4WBFA 4K59A 2HZVA 4CIOA 3R5JB 1MU2B 2KT3A 3RR7A 2WBMA 1S79A 3HSJA 1B0PA 2E7VA 3G87A 4B3SF 3J80Y 1FJGJ 4UUWA 4F04B 2XCAA 3LAMA 3KHHA 2B4VA 1N0UA 2NXNA 1T9TA 4J9RA 1HBOB 1FDAA 4K4XA 4FKXA 3CDBA 3JXOA 5HI7A 2G2OA 4S0MA 3BR8A 1VCTA 3PW5A 2M4MA 3HHDA 3SFUA 4M94A 2B56A 3DM2B 1P8GA 2E66A 3WHIA 2KTQA 2N4DA 3VV2B 5I3PA 3L95X 3B54A 2XMVA 1FDDA 3NMAA 3FRYA 4DJBA 3MMAB 1A0OB 1X0PA 2AYGA 2R7VA 3CO9A 1CJVA 3OTCA 2YKNA 3E8OA 1QSLA 3PCOB 4DSFA 1N36J 2B5JB 3R27A 3PXGa 1ZS6A 4PABA 2J0WA 1RYSA 4Y3CA 5D3GB 2X1AA 4RUBA 1ACMB 3ICLA 2IPOB 3PIOQ 2R8HA 3PJ9A 1NK7A 1NUEA 4LSLA 4DV3J 5T7LB 4M5NA 3ILIA 1AXQA 1FXDA 2FLOA 4WU3A 1OQ6A 2VFSA 3M6XA 2CPIA 3AFGA 3CCES 3LP1A 4I0WA 2HHPA 4PKDB 3CJ5A 3PDNA 2CQCA 4LQ9A 2RHSB 5CABA 1HHTP 1NXIA 1Z2ZA 2E29A 2VU5A 4OLOA 5CYMB 3H4DA 1DAXA 3WC0A 4FBTA 1M1HA 3ELHA 4DQIA 1OSCA 1IBLF 2W7OA 1HHQA 2J7UA 2EI5A 3FK4A 3SZ2A 2XGPA 1RBAA 1WC6A 3FQLA 5AXLA 2JHEA 3K59A 5K14B 1X4CA 4DR3J 2J7WA 3UDEA 3LP0B 2V2QA 4Y00A 4O3RA 3CDWA 4I7FB 4A47A 2DPIA 1XR6A 3VGVA 1HR0F 2W24A 2KT5A 1OPZA 5A6WA 3OFGA 1VQPS 2D41A 3VGSA 1DLOB 1RAFB 2XY5A 2W2OP 4QWDA 1HPZA 5E2QA 2JVRA 2HZCA 1F3VA 3D3CJ 1OY8A 2R7XA 3ZZ0A 3CIMA 2AU0A 2FJAB 3TYTA 5ETTA 1X0FA 3FMWA 2F40A 1U6BA 2CZ9A 1U1LA 3ILJA 2ZKUA 1J5EJ 4Q0BB 1JLAA 5GAEU 4LF7J 1K0TA 4PXBA 4RNFA 3T5KA 3EJMA 4B3RJ 1YI2S 4IOCQ 2MZRA 4ZJQA 2IVMA 5B0GA 2HMIB 5ETNA 1IBMJ 1RU2A 4QIVA 1AFJA 1JLEA 1JLGB 3BBFA 5MLCV 2NREA 1Z1ZA 2EKNA 1S6OA 2CA9A 2UUBJ 2AF6A 4RZRA 4QPTA 2KO1A 2EK1A 2V68A 2LU1A 3GIKA 1LWFB 4HLBA 3IRXA 3QBCA 3CT9A 2GMLA 4X64J 3NAHA 2PN6A 4RBTA 1CJUB 5HAOA 4CO1A 3GFHA 1ZTTA 1SKUB 2R8GA 3DU5A 1TUVA 4JV5F 5JVHQ 2W8KA 3QGIA 3SSRA 3DOMB 3BQ0A 1PJ6A 2UXBJ 3L7PA 1ZYQA 1W26A 2C42A 3MI7X 2DGXA 3PX0A 2CADA 2PD1A 5J2QB 4OZ0A 1VRTB 4CLUA 5F0UA 1XEZA 4OI6A 4F4WA 2AMCB 4U95A 1G7CB 2YVSA 2F5GA 1C1BB 2MJUA 5CAAA 3RB3A 4NXNJ 2D3O1 1KHVA 5KT2A 2FHMA 1PAUB 2J0XA 2V69A 3P4UB 1NH7A 1BY9A 1YJRA 4MK9A 2UXDF 1S1VB 3KMSA 4N5SA 3P5TL 4OFZA 2F8EX 4DL6A 1NPRA 1O6XA 3I82A 1LV5A 1JX4A 5ETVA 1KONA 3Q86A 4A8OA 1RCOB 3NS6A 2WW4A 4JYAF 4WTOB 1EQ0A 2WVFA 1MN9A 1S5ZA 3FZ2A 1CS4A 4KGKA 3TQ1A 3MM5A 2AV5A 1UJ5A 4D3HA 4QIFA 3BR9A 3N01A 2DO4A 2OPSA 4DQPA 4NLOA 4UQGA 2CNKB 2CZ4A 3LOUA 4KYZA 1RTHA 1AB8A 3HHEA 4I67A 1HNZJ 1S6QB 4X4VA 2XMWA 3AA8A 3VAIA 2WHOA 5KFBA 2CQ0A 3PEJA 4LR9A 4USWA 2WSFC 2HHXA 2EW9A 4OYMA 1FNXH 8RUCA 4USHA 2I9SA 3C6UB 3ZFVA 9RUBA 1HNVB 5LT5A 2IRXA 5C24A 2AKWB 4B3OB 2NXUA 2CG8A 5A0YB 2AJQA 4JI6F 1YJ7A 3T9NA 2MYFA 4A46A 4DZ6A 2XQCA 4WJBA 1WHWA 3W1YC 3KWMA 1NJZA 1IKVA 3JYTB 3QWUA 4MFBB 3TZZA 4FPRA 1R6YA 1CULB 1JLQA 4X84A 5EDWA 4RKUC 3DLHA 2YWEA 1RB0A 3NCPA 3MR6A 2VODA 4RW6A 4MKYA 4F0MA 1N5SA 4PYDA 4JI1F 2GIFA 4K7QA 3UDLA 1EQMA 3NGRA 2HW3A 2L3MA 3QNWB 4ZVSB 1FKAF 3CMES 1KR4A 3MEDB 5D8HB 3KK1A 2UVRA 4MIBA 4C0OC 3MR7A 5D6GA 1TVRB 3DLEA 3GV5B 1JLCA 3HSGA 1TZ0A 1U1QA 3SSQA 2FHOB 2LA6A 2GS8A 4YP3A 2EC2A 1HWIA 4DR4J 3V81A 3PYEA 4OX9F 3W7BA 2MQLA 2HHSA 5A2QU 2B6AB 5KT7A 3FSIA 2HQCA 4E2FB 2EWHA 1X7VA 1H6KX 1DFDA 3AD9C 2RKIA 3H90A 2FZKB 3RBEA 4DR7F 5AXNA 3CCUS 2EK6A 3LAKA 1N5TA 4EO6A 1WKKA 1OJ4A 2D9OA 4RW8B 3GV7B 4WK3A 4UT4A 2W4CA 1HR0J 2IJFA 4LR7A 4DUZF 4UTGA 5I42B 3BKFA 1GT8A 3PTWA 1ZH5A 3B4MA 4JOUA 1Q8KA 1SCJB 4NLRA 2ZITA 4HR2A 3NLCA 3K5NA 2CAJA 3J81j 1TU0B 3V5RA 1URRA 3MM9B 1KOHA 2JH3A 1MN7A 2IC3A 5H9EK 4F3OA 3AT1B 1FRLA 2MKIA 4HH1A 1BWEA 1TL5A 3KLIB 3CC7S 2VA2A 2M2BA 4FPIA 1LW0A 4WXOA 4F8RA 1NK9A 3LGHA 3M1VB 4MT1A 1BQMA 1PYSB 4C8KA 4YQWA 2WSCC 5AXMA 4DQQA 3HJFA 1YRTA 3D6MB 3LH2S 3CCTA 3O2IA 1FJ7A 1UEUA 4H4KC 1WKJA 3BGLA 3MCNA 1XMOJ 2DIUA 5DG8A 2W2MP 2DGTA 1GH8A 1WNEA 2Z8QA 1JWWA 4G1QA 3VAKA 2XWYA 2ALYB 4C97A 2ZH9A 1E6YA 3PW2A 4CLSA 4IRKA 3GCWP 3EGWB 4BCAA 1J5OA 2BACA 4K0KF 2UP1A 3DGPB 3HHLA 3ENVA 3ZTRA 2QL7B 4DPWA 3T3FA 3IM8A 3MURP 1F9EB 2D69A 2E9RX 1OS5A 1RP5A 4NX9A 2Y1LB 1TKXA 1TL1A 2C3PA 4PG4A 2V8DA 1RHQB 4G1PA 2E5IA 2MQQA 1RWOB 1BMQB 4CLPA 2UXDJ 3C46A 5F3ZA 4DUYJ 5KFGA 3QIPA 4PQUA 3ZZTA 2HBRB 1LXNA 2GJ2A 1WG4A 3KUHA 3OTDA 3MM7A 3MUVP 3CTRA 1RWWB 1Y5LB 1YX2A 4JV2A 2K3KA 4TQSA 1FWLA 5H9EJ 2F9JA 3VQSA 3A8IA 1CBKA 2HLUA 3MHYA 2K1RA 2ZHBA 4JYAJ 3HULA 4FYXB 4DX6A 4ZVOB 2DY1A 4XK8C 1PAEX 2MKHA 2ZH8A 3TI0A 1WORA 4KH1B 3T6JA 4K4WA 4G1IA 4QWEA 2HAIA 2A6MA 3NBPA 4KAIA 4ZHRA 1X5TA 2BQ3A 4DS5A 1N33F 1VRQC 5EHHA 4N41A 2OP5A 3N6MA 4PEOA 3G71S 5FLXY 2IM1A 2YWKA 3D5MA 2DNPA 2HNZB 4DLGA 1E6VA 2CWXA 2XSJA 4LIWA 1JJHA 5GMDA 4IO9Q 1GFWB 1XERA 4DFPA 4I2PB 3E51A 3MWBA 4MIWA 3MMBA 2VBYA 2OTLS 1DQ8A 3OLBA 3CVKA 3EXCX 2CPZA 2ZH4A 2GQCA 4JI3F 4FF3A 2DNRA 4UOCA 2HHWA 5HO4A 4I68A 3MR2A 1NHUA 1RT2A 5LM7E 5K8MA 2OLWA 4ERDA 3KTQA 3DDNA 1CEZA 1LWCB 5IM0B 2KI2A 4JI6J 2ADBA 1ZBTA 1WC1A 1WDTA 5BR8J 5EWEA 1TQLA 4NOHA 1ITPA 4E0DA 1C1CA 1FNMA 3OL7A 4YR0A 4P2MA 2W9BA 3K57A 3RBXA 4Q8EA 2DT9A 3EPGA 1SQGA 3PJWA 1U1MA 4HH0A 3QJJA 1FERA 3BPDA 2CQDA 5D78A 4F0HA 3TQEA 5AE2A 3OUYA 3R1HA 3P6YC 4A8QA 2DJWA 2MQPA 1HQ2A 1WF2A 4OZJA 4MK8A 4KBIA 2XHWA 3P45B 3KLEA 3J7YU 5J2MB 1UTAA 3BO2A 3SDEB 2KYXA 4OMFG 1YDLA 2BKPA 1QDUB 2R2TA 5KFYA 1VK3A 3NMRA 3NY0A 3H5UA 2EG2A 4M5IA 3ZZOA 1L3UA 3RBZA 2MZJA 2HGMA 1PGZA 5BXIA 1NPKA 1AYEA 4ZPWR 2CPXA 4N77A 4IDKA 3OT9A 3FDSA 1EP4B 3FKBA 3BGRB 3K5MA 3C14A 4IFVB 3KLGB 4K4ZA 1KQKA 3KJFB 2NCKL 2VICA 4I1TA 4F3MA 4BBYA 4PWUA 2VPWB 1ZA1B 4MKBA 1TUGB 4DR7J 3E2EA 3ZTSA 4PXDA 2JNJA 5F8JA 3TA1A 3OJUA 1EKRA 4AL6A 4NMXA 5DETA 1MWZA 1RWMB 4ALZA 5B0BA 2QL5B 3LGMA 4H4MA 3TVZA 5ETMA 4GO7X 4RW4A 2V4JB 2A0FB 4KKOB 1RK8A 2AGPA 1WJ9A 3DMJA 4TY8B 2OSQA 2VQFF 4PCQA 4RBUA 3MTJA 4U8YA 3O5TB 2HVIA 1AFIA 2XYGB 2RNEA 3VAHA 2ACMA 2DGVA 3VVUA 1VQ7S 2CZVC 5CCLA 1NDKA 4DV6F 4QQBA 1TV6A 2P2CB 4YFUA 3ET6B 1WHXA 4ES1A 1B7YB 3QLHA 3CCMS 4ETZA 2AIRB 1OY6A 3B82A 4DHVA 1C0UB 2MZSA 2B3TB 4NYZA 3DOKA 2OFHX 1L3SA 2YPYA 3CD5A 3PRDA 2EEYA 1HIYA 3ZTQA 2W9AA 1Z4UA 3MMCA 1JNZB 1YBTA 2ILZA 3AQPA 4DWIA 2OEMA 1SL2A 2BRLA 1CVJA 3PYGA 2V2ZA 1O5JA 3IM9A 2BUNA 3IBWA 3R7BB 5BYQA 4KE5A 1JKHB 2NR0A 2GHWA 3PNIA 2IMWP 3H2VE 2H54B 2CNOB 2Q43A 2HS0A 3AH6A 1VQMS 2A3JA 5D0GA 2WAQD 3CJRA 3U27A 4IO1A 1UWBA 4PWWA 4F4YA 1T9YA 4ILLA 1RA7A 2IBOA 3HT0A 5HQ8A 1NHVA 1SUQA 2HURA 1BWVA 3HZEA 2V50A 2H5IB 1YSJA 3DHWC 3EDRB 1JJ2R 1HLWA 4IFYB 2XMUA 5CCMA 3G6ES 2F1FA 2QZ8A 1VIXA 1J27A 4TY9A 5DZ7A 4F4ZA 4WU2A 1XR5A 2OPQA 2W7AA 2DNZA 1JNRB 3ITHA 1YJ9S 2UUCJ 3EZUA 4QIGA 3KG4A 3TJ9A 2HHUA 5D15A 3G82B 1PKUA 4C48A 1IBCB 3KKFA 1HYSB 4X4QA 1PSDA 2H65B 3IGVA 2XEXA 2OUGA 3GJRB 5H1SV 1VRUB 3HFZB 2BANA 1EETA 3Q2SC 2BVZA 4HHJA 2UUWA 1YK9A 1WEXA 3PX6A 2HNYB 2VBXA 5C25B 4DV2F 1UVIA 3K17A 3QSIA 4OX8A 3JTOA 1GXUA 1PJ5A 4Q43A 1NDCA 3R6GB 4NXMF 4F7VA 4EFAC 1N33J 4GMKA 4HT5A 2XCPA 4Y2KA 3VAJA 3BQ1A 1RLCL
chains in the Genus database with same CATH topology
1VHIA 2YQ1A 4UZBA 1B3TA 4BLGA 5A76A 2YPZA 4K2JA 4UZCA 2YPYA 2YQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHI A;  2YQ1 A;  4UZB A;  1B3T A;  4BLG A;  5A76 A;  2YPZ A;  4K2J A;  4UZC A;  2YPY A;  2YQ0 A; 
#chains in the Genus database with same CATH topology
 3CD7 A;  1TMM A;  2QMU B;  3H2U B;  1VK8 A;  3VAF A;  1S10 A;  4DUT A;  2AJF E;  4JI0 J;  2M3D A;  2Y1J A;  2W8L A;  5DM6 Q;  1UPM B;  2BJ7 A;  2ZOG A;  4TU7 A;  1MMD A;  4NZ0 A;  2M52 A;  1I94 F;  2DCU B;  4W90 B;  2KXF A;  2Z4P A;  2BKO A;  3HF5 A;  4LF2 A;  2KB2 A;  4NCB A;  2PI4 A;  4DSK A;  2KM8 B;  4XDD A;  3HSZ A;  1VHF A;  3M2R A;  3BYR A;  1Y4Z B;  2DKO B;  4IRD A;  3CJ3 A;  3I5B A;  1JB0 C;  5LXY A;  1O8B A;  2CFX A;  3CGI A;  1ZM3 A;  1HBN B;  2MMY A;  1NND A;  2DPJ A;  2MZT A;  3CDU A;  3BZQ A;  3C15 A;  3TAR A;  4F36 A;  1S1U B;  1EX8 A;  4Z7C A;  1MG7 A;  1HMV A;  2D74 B;  2G2Y A;  1X4B A;  4OYW A;  3M05 A;  1RT4 B;  3VHQ A;  4DV5 J;  1Q16 B;  5BYR A;  3ZNJ 1;  1TL3 A;  4M5L A;  4QR0 A;  3BKT A;  1B99 A;  4LFB F;  2BYC A;  2GZO A;  1WHY A;  2GHV C;  2OMO A;  3J7A 1;  4C3M A;  2QL9 B;  2ATL A;  4ZP7 A;  2EPI A;  3TRG A;  1WG1 A;  2U2F A;  2YQ0 A;  2GMJ A;  1QTN B;  1S1W B;  2GX8 A;  5ETP A;  3H0P A;  3I55 S;  2C2E A;  3EGV A;  2HRY A;  2IM3 A;  1KC8 T;  5DQG A;  3MEG B;  5KG1 A;  2A1B A;  3M4X A;  3UDV A;  2AJ0 A;  3OR1 B;  2CVI A;  1UMJ A;  4M5H A;  2V94 A;  2WVB A;  1D8Z A;  2IAJ B;  4Y2M A;  1WEZ A;  1YVF A;  4U7U K;  4RW9 B;  1TTH B;  1U2R A;  1HNX F;  1ROF A;  1UVN A;  2CQH A;  1TK8 A;  4ITS A;  2HKE A;  2C2M B;  3V6D B;  5HQM A;  2QT7 A;  2W9C A;  3SXL A;  3J7Y I;  4URQ U;  4PG7 A;  4ED1 A;  3OFH A;  3KLH B;  3NXZ A;  2JLG A;  3POT A;  4I6A A;  3MM8 B;  1JXL A;  4C8M A;  2VG7 B;  1YIJ S;  1T9W A;  2YNH A;  3G2X A;  2ZHO A;  4QIE A;  1F5C A;  3H20 A;  3MAQ A;  4NCG B;  3TX0 A;  1YIT S;  5E3A A;  4GC7 A;  1S1X B;  3JSR A;  4ED4 A;  1ZZN A;  1L3V A;  2O01 C;  1REV A;  2VQF J;  1KTV A;  5F9L A;  2OKQ A;  4DQR A;  4DL4 A;  1WOP A;  1RWU A;  1UVK A;  1FTC A;  4O0N A;  2F4V J;  1PC4 A;  2HBQ B;  3HHL D;  3ZZU A;  4RUC A;  4RNH A;  2PSZ A;  2N4C A;  5SZT A;  4R8U A;  2FVS A;  1K9M T;  4O44 A;  1ZPV A;  5HVG A;  2ZNZ A;  1N32 F;  1FNO A;  2ZZN A;  4JV1 A;  5C42 A;  2BDP A;  1H3D A;  4ZKA A;  1CJK B;  2DH7 A;  1RTJ B;  4XPE A;  3I96 A;  3OL9 A;  2E5L J;  4K5R A;  2PE8 A;  1GK8 A;  1RT1 B;  3CJK B;  2OPP A;  1HW8 A;  1KLM A;  1U09 A;  2C22 A;  1NB7 A;  3K0J A;  1MU2 A;  4RU9 A;  1UP1 A;  3OTE A;  4DG1 B;  1D1U A;  2NXJ A;  2R42 A;  5HVH A;  1NRK A;  4DN9 A;  2RUG A;  2V4Q A;  3EIC A;  1IM6 A;  4HAC B;  4A8Y A;  1YG0 A;  2EXU A;  3C6T B;  2O1P A;  2XHC A;  4NML A;  4OHY A;  2OEJ A;  2JJ4 D;  4X66 J;  4K4S A;  4HL9 A;  4LFC J;  1U24 A;  3OBI A;  1YLX A;  5I3U B;  3DM2 A;  5ETO A;  3ZTP A;  5KFI A;  2R8J A;  4B3T J;  3BSA A;  4WXW A;  2RU9 A;  1WC4 A;  3M32 B;  1VIS A;  3MMA A;  4WK1 A;  2DEJ A;  4JBC A;  1R89 A;  3KG1 A;  3I4H X;  4HT7 A;  1C2P A;  3Q8P B;  3HPO A;  3A3N B;  5HQL A;  2B5J A;  3H40 A;  3H42 A;  4L75 A;  5B0E A;  2FJX A;  2EKY A;  5D3G A;  1Q8I A;  3VQT A;  1FDB A;  4M5M A;  4ILM A;  2DYA A;  4LF9 F;  2IFX A;  3RUB L;  4ED7 A;  3W5Z A;  1VBX A;  1I3O B;  4KGZ B;  2GCF A;  3QT5 A;  4A48 A;  3CCV S;  2VFU A;  5T7L A;  4DL2 A;  3Q8Y A;  2YNG B;  3Q83 A;  4Q44 A;  3B8H A;  2VJV A;  5L9X A;  1IUJ A;  2IRU A;  1AW0 A;  4KHR A;  4CT8 A;  2XM3 A;  1FWK A;  4ELV A;  1R8B A;  3QPI A;  4DV2 J;  3CF5 Q;  5CYM A;  2ZH3 A;  2YKM B;  3MOJ B;  4C8N A;  4ZVF A;  2EBE A;  1P1L A;  1LWE B;  4I6Y A;  4A8X A;  4USM A;  1SIZ A;  3AJ1 A;  1N34 F;  4YEA A;  4PWD B;  4U7C A;  3D28 A;  3FVY A;  5IV4 A;  5K14 A;  3BPS P;  1DHM A;  2WBR A;  3ETO A;  3O6Q A;  4LRB A;  1PBU A;  1RUS A;  2DIS A;  3LP0 A;  3C19 A;  4I7F A;  3TJA A;  4HDH A;  4F4K A;  4F2R A;  3UCG A;  4P71 A;  2UV8 A;  2MXY A;  1NSQ A;  1S72 S;  2HND B;  4B17 A;  1GTH A;  4DL3 A;  2UU9 F;  1DLO A;  1PIE A;  2AZ1 A;  3DRR B;  3GON A;  3ZC4 A;  4RL1 A;  4M5D B;  2AYM A;  2P5V A;  1KQG B;  5DG9 A;  3OXL A;  1KHW A;  1UFL A;  4DV7 F;  7AT1 B;  4AQY F;  4ED6 A;  1FEE A;  4LF6 F;  4Q0B A;  2FZG B;  4F67 A;  2NSC A;  5GAG U;  4LFB J;  4ZP9 A;  2XYH B;  1UZD A;  1A6L A;  4NI2 B;  3G8S A;  1HAR A;  1O51 A;  2JLF A;  2MLY A;  2HK3 A;  2ASY A;  2HMI A;  4UY8 5;  5KG6 A;  1NKE A;  3MD3 A;  1RI7 A;  4C0H A;  3TW0 A;  2YNI B;  3A13 A;  1JLG A;  2CQG A;  1TAQ A;  2IJR A;  2WSE C;  5EX3 A;  1HQE B;  1P9Q C;  5LXR A;  2DR9 A;  2QFI A;  3UO0 A;  3DLG B;  4MYT A;  2KXH A;  2XNR A;  3DLL Q;  2D3O R;  3A3O B;  4ED3 A;  2B9Y A;  1NJY A;  1LWF A;  4YB1 P;  3NCQ A;  1XTZ A;  3W8G A;  6AT1 B;  3A3P B;  3D66 A;  1FE4 A;  1HNX J;  1CJU A;  3OR2 B;  4KB7 A;  1C0T B;  3DOM A;  1HL6 A;  2LDI A;  2BQU A;  4P75 A;  4HYK A;  1RAI B;  1X9W A;  4GC6 A;  3ONQ A;  4UQT A;  1X4F A;  3GR0 A;  4NEY A;  1SJF A;  1LOU A;  3DU6 A;  3FSY A;  5J2Q A;  1VRT A;  2JFD A;  3DRS B;  4I64 A;  5MAO A;  2DH9 A;  1C1B A;  1NSP A;  2ZUG A;  2MKS A;  2V2V A;  2ZBP A;  3OTO F;  1GMU A;  4LRF A;  3Q8S B;  4PUO B;  2Z2Y B;  2E5J A;  4KGX B;  2BXJ A;  1S1V A;  2FTR A;  2KKH A;  2GIR A;  3EE3 A;  2E1A A;  2ASJ A;  4JI2 J;  1S57 A;  3G8T A;  1EHW A;  2DH8 A;  3LWM A;  1UW4 A;  1UFW A;  2EFG A;  4K50 A;  4FXD A;  4NLW A;  3X3U A;  2F8H A;  4E98 A;  3CUN A;  5F8I A;  1RAC B;  3VGT A;  3BSC A;  3HD1 A;  1IQT A;  1JXE A;  2VAS A;  1JLB B;  3H5S A;  2MHN A;  2C3M A;  5AXK A;  3DNC A;  2RD5 C;  3BO4 A;  1WOO A;  3MDF A;  1RT5 B;  4DL5 A;  1N32 J;  1F5B A;  3W9H A;  1GXL A;  1U2F A;  2FHJ A;  2XMA A;  4DCO B;  2LFV A;  2ZE2 B;  1S0M A;  4HEA 9;  2KFY A;  1VQY A;  2DNK A;  3RR8 A;  1TP7 A;  3T5J A;  1T3N A;  1D09 B;  1HWJ A;  3UN3 A;  2GQQ A;  1S6Q A;  3J7Z 5;  2J8S A;  2FJV A;  3IBF B;  2QG9 B;  1SH3 A;  3F56 A;  1GQE A;  4EEY A;  2KJW A;  1NM2 A;  4DCJ B;  2C28 A;  1FX2 A;  2C3U A;  4PR6 A;  4KHM A;  2BJD A;  1U47 A;  3IO1 A;  2Y8Y A;  1H98 A;  3I32 A;  4C11 B;  1RHM B;  1UPP A;  3K5L A;  3C6U A;  3HZG A;  4M63 A;  3G4S S;  4P7V A;  1HNV A;  3UN2 A;  3AHP A;  1FKP B;  2VDH A;  1WD6 A;  3T9Z A;  1KTQ A;  4B3O A;  3OHB A;  3FC9 A;  4LJM A;  5A76 A;  3PIP Q;  2WB4 A;  5A0Y A;  2QA4 S;  2WTF A;  3JS9 A;  2GFF A;  2MGZ B;  4O3S A;  1UEV A;  4PXC A;  2WVC A;  4X2B A;  3JYT A;  4MFB A;  3MPW A;  2Q3P A;  4CO0 A;  3CCR S;  2VKZ G;  1QUV A;  2HBZ B;  5E5N A;  1V5I B;  3Q8Q B;  3GIL A;  5IFM A;  2W2N P;  2HHH F;  5KFM A;  2B7B B;  5E3Q A;  4O3N A;  3BGU A;  3D6H B;  2J0S D;  3IWL A;  1IR0 A;  3GB0 A;  2JEF A;  1F0X A;  2RDI A;  4ZPV R;  2VD3 A;  4LF9 J;  1CQN A;  3W2W A;  5K8P A;  5IOL A;  2R8I A;  4LUB A;  4YS2 A;  1FJC A;  5D4L A;  3MED A;  2VQE J;  2DTJ A;  4Q2M A;  5DM7 Q;  1DAR A;  1HW9 A;  2YX7 A;  1TVR A;  2IA6 A;  3AOC A;  1UL3 A;  4ZCK A;  2MSS A;  3CD6 S;  4GKJ F;  3UQS A;  4B9N A;  1R3N A;  5A8W B;  2DNH A;  4CQ1 A;  5CYQ B;  1RKI A;  1UFK A;  3SYZ A;  2NPF A;  4F3Q A;  2B6A A;  1S48 A;  3I9Z A;  1SXL A;  2R8K A;  1U02 A;  1YJW S;  1T8E A;  3A12 A;  1T03 B;  4EO8 A;  2P6T A;  2DNQ A;  1S6P B;  4LIR A;  3EDQ B;  4WYL A;  4RW8 A;  5HVF A;  1ZET A;  1VQ5 S;  3T1A A;  3VVT A;  3UNG C;  1XNR J;  5E3R A;  3PHE A;  3HJV A;  4BC7 A;  3LP2 B;  4NA3 A;  4DL7 A;  1U26 A;  5I42 A;  1Q5Y A;  2UU9 J;  1OYD A;  1SQE A;  2HQG A;  3R8Y A;  3BJY A;  1R8A A;  3AY0 A;  4Y65 A;  1RIS A;  2BV3 A;  3MD1 A;  4R25 A;  3ZNU A;  4FP9 A;  1QAX A;  4ZLP A;  1LWX A;  3I0R B;  4LT6 A;  4NEZ A;  2Y1I A;  2DIV A;  3IP0 A;  1EAY C;  1BC6 A;  4DFM A;  3MM9 A;  4EK2 A;  1JMT A;  1KKH A;  2RIL A;  5CH7 B;  4AQY J;  4LF6 J;  1RWX B;  4NLQ A;  2AW0 A;  4AE5 A;  2ZWO A;  3PW7 A;  4J7C A;  3KLI A;  1TL7 B;  1CPZ A;  1KRP A;  2QSW A;  1BGX T;  3M1V A;  4LFA J;  4I6W A;  1RZM A;  2MQ8 A;  3EGZ A;  2R7Q A;  2R9L A;  5D4O A;  4DV0 F;  4ZP8 A;  2GO9 A;  4WYW A;  2D7S A;  3GZ7 A;  2QMX A;  1FI4 A;  5GAG I;  3R7N B;  4WE1 B;  2PEH A;  5IQQ A;  2XSF A;  1FES A;  4QR1 A;  3R97 A;  1AZS B;  1RWV B;  1TL4 A;  3FEY B;  2C2R A;  3FMB A;  2KL8 A;  4AXJ A;  1VIO A;  2I8E A;  1DTQ B;  3P8B B;  3RZA A;  1L5U A;  2H4W B;  1Y0H A;  4K5S A;  1S4E A;  3MEE B;  3RB0 A;  1VQN S;  2BEF A;  4DMZ A;  3PM9 A;  4Z7Y A;  3DGP A;  4XDC A;  1BQN A;  3C16 B;  4QPX A;  2QGF B;  4IYQ A;  2CYY A;  4LBH A;  4F0K A;  4EBD A;  4TKT A;  2W4D A;  2K06 A;  1WKL A;  2KRR A;  4KO0 B;  4C9D A;  4DSJ A;  4ED5 A;  2ZHA A;  3OTO J;  4CTA B;  2RRA A;  2A18 A;  1NHK L;  2LQB A;  1NK4 A;  1HBU B;  3UW1 A;  2EG1 A;  2ZKT A;  3D0G E;  3ISN C;  4LVO P;  1PG5 B;  4OYP A;  2FZC B;  4KH0 B;  5HMW A;  2J9D E;  1BXN A;  1X8D A;  2J6S A;  1NZ8 A;  2FLL A;  1VLO A;  2QSF A;  3I31 A;  4C8O A;  4RWX A;  2MY7 A;  4UOG A;  3Q8U A;  4ED0 A;  4K4U A;  1K1Q A;  2GQ2 A;  2I2Y A;  3JB9 k;  2B0G A;  1JQG A;  4L6V 3;  3B78 A;  5KAK A;  4YY3 F;  1DRZ A;  1Y7P A;  1UEK A;  1HBM B;  1H7X A;  3BSN A;  3BDP A;  2RUS A;  1WEY A;  2HNZ A;  2ZD1 B;  2DGU A;  2CG4 A;  4CT9 A;  5IXU A;  4L3N A;  4I2P A;  4MK7 A;  1PBA A;  5D0H A;  2KZM A;  3H2L A;  2RF2 B;  2YWG A;  2YKQ A;  1AUS L;  1NDP A;  4ZVH A;  4CO4 A;  3CCZ A;  4UZC A;  2KG1 A;  4KR0 B;  1B70 B;  4K4T A;  5KT3 A;  3DDK A;  2B9W A;  2CNN B;  1N5Q A;  3U7J A;  2YNF B;  1LWC A;  5IM0 A;  3K58 A;  2V9W A;  4U8V A;  1RHK B;  1Q1K A;  1TR0 A;  2X7I A;  2OGU A;  3GCX P;  4ZIT A;  5HMY A;  2HQF A;  3HVT B;  5ETL A;  2PGC A;  5J2N B;  3LW5 C;  3CO0 P;  3TUP A;  3UDC A;  2BJ1 A;  3SEO A;  1GEH A;  4IH5 A;  4ECQ A;  3I9V 9;  4EU0 A;  3GSD A;  2E5G A;  2EFP A;  2A6O A;  4U96 A;  4OI4 A;  2PMH A;  5CHC B;  3ILO A;  2D1C A;  2MKC A;  1LQ9 A;  5J1N A;  4B08 A;  3W2V B;  2H51 B;  4A8M P;  3FNN A;  4MMO A;  2L48 A;  5SUH A;  4QWA A;  4DZD A;  4WKY A;  1FJE B;  1RHU B;  4J91 A;  1NAQ A;  3SDE A;  1DJ0 A;  4IKA A;  3PYD A;  2XI2 A;  1UA1 A;  3CWJ A;  4HI1 A;  5D4P A;  3BGO P;  3PG9 A;  2V9K A;  1H72 C;  3DLE B;  3HVW A;  1EP4 A;  3BGR A;  2VG6 B;  3PHT A;  4IFV A;  4JI7 F;  3KLG A;  1LXJ A;  2CJQ A;  4GVB B;  2R2R A;  2NQP A;  4QW8 A;  1DTT B;  4WP8 A;  2N3L A;  4V19 J;  2E1M C;  1GX5 A;  4O4G B;  5JVG Q;  3E01 B;  4AD6 A;  2GVD B;  3QT7 A;  3RYL A;  3M8P B;  5IWA F;  5K8N A;  4NLV A;  1H38 A;  3IAS 9;  3VAM A;  3UWT A;  6FD1 A;  2JEG A;  3TUZ C;  1X9M A;  1R31 A;  1FRJ A;  2HQ3 A;  4RUH A;  1WHV A;  3PR4 A;  3DKD A;  2MKK A;  2V4J A;  4KKO A;  1VJQ A;  2QFJ A;  4CNZ A;  3MCS A;  1YJV A;  3EX7 B;  1V3R A;  4FNI A;  4DV1 F;  3N4W A;  4TY8 A;  1S4F A;  3PX4 A;  2J7K A;  4ZP6 A;  2HVZ A;  1CJT B;  4OI2 A;  4QU7 A;  4FNH A;  2Q79 A;  2XWX A;  5KFV A;  3HMJ G;  4DR1 J;  2O67 A;  2VOO A;  4CLT A;  4NWB A;  3ET6 A;  2QLJ B;  5HRO B;  3M30 B;  3SCL E;  1NK6 A;  1RHR B;  2CRL A;  3KLF A;  1C0U A;  2B43 A;  3NWG A;  2BBE A;  5U47 A;  3WX4 A;  2VL1 A;  6FDR A;  2MB0 B;  2WB1 D;  2XLK A;  5BYS A;  3BYP A;  2F65 A;  5KT5 A;  3DI6 B;  2G4B A;  4H54 A;  1V3S A;  1KVI A;  3KJN B;  2FJE B;  3LA0 A;  3UR0 A;  2HG4 A;  4DV0 J;  3IFE A;  2NYH A;  4JV0 A;  3AQO A;  4MAK A;  1QE1 B;  4RBV A;  1JKH A;  1SH2 A;  2XMM A;  3FGV A;  3H4B A;  4RUA A;  1VYA A;  5HJY A;  3ENQ A;  1MML A;  3KK2 B;  1KQF B;  4DLE A;  2FHJ D;  2CKW A;  4KSE B;  4XIU A;  1R0A B;  4IG0 B;  1TUW A;  3E3X A;  3IG1 B;  2R7S A;  3H98 A;  1IR2 A;  2N7Y A;  3T5L A;  1RTZ A;  2RQ4 A;  1FXL A;  4FF4 A;  1N6Q B;  3SSS A;  4ZCI A;  4IFY A;  4OI3 A;  3N9U C;  1LFW A;  2ZVS A;  1RBL A;  2ZZM A;  3QGG A;  3VF0 B;  4DXL A;  1KQS R;  2YKP A;  1UCN A;  4ELU A;  2RJZ A;  2RU3 A;  1U1N A;  4MIA A;  3DOL A;  2PC6 A;  3FCV A;  1RJJ A;  1R8P A;  3A8J A;  1BUX A;  3QJP A;  1S1T B;  4YR3 A;  1IKW B;  3NP5 A;  3P5B P;  3Q23 A;  4TQR A;  3N5F A;  1XMQ J;  2I6W A;  2KRB A;  3OVS A;  3G82 A;  3HX9 A;  1ZTW A;  2DNM A;  4RJV A;  4H4K A;  5HMX A;  1VRU A;  4Y2I A;  1FK9 B;  3GMG A;  3HDS A;  3NKY A;  2V8H A;  2HNY A;  3FEX B;  5C25 A;  2ZBC A;  4ELT A;  5E33 A;  2J76 E;  1YBU A;  4EYI B;  3QT6 A;  4ZVR B;  2RS2 A;  1RA6 A;  2BE2 B;  3G6X A;  4KHP J;  2CNL B;  5KFF A;  2C2O B;  3D6T B;  1NPP A;  1IBK F;  5I4M A;  2ZWP A;  3TZW A;  1RAJ A;  1EB0 A;  1M0S A;  1FFS B;  5J2P B;  4K8R A;  3PKY A;  3W63 A;  4N56 A;  3RW6 A;  3AA9 A;  2VBW A;  4OZ3 A;  2LA4 A;  2AEM A;  3W5Y A;  4V1A k;  1FX4 A;  4QJV A;  4LF4 J;  1HBN A;  5F0W A;  3CUL A;  1KS2 A;  1QJH A;  4G6V B;  2BE7 D;  2FDN A;  3HK2 A;  3GIJ A;  1N4L A;  3SCK E;  1U2C A;  3DRP B;  2M88 A;  1S1U A;  3MPU B;  4OZ1 A;  3L7U A;  8ATC B;  2POK A;  5F3T A;  2HGN A;  2W01 A;  3OV7 A;  4Q7A A;  5J1E A;  1IKY A;  2DR8 A;  1NLK L;  5KG2 A;  3ULH A;  4OYO A;  1NK8 A;  1QSS A;  5KFH A;  1DY3 A;  3OPK A;  2VPZ B;  4U7U D;  3OL8 A;  2N7C A;  2BJ9 A;  2HAF A;  3OHA A;  2ZFH A;  4ZK7 M;  1MLA A;  1S1W A;  4B3M F;  3NRB A;  2FLP A;  1M5S A;  3OVB A;  4JI4 F;  2NXC A;  2UUA J;  5KFL A;  1HA1 A;  3LPE A;  2OO4 A;  4U67 Q;  3PVX A;  1KP6 A;  1RCX B;  1D8Y A;  3MEG A;  2MPU A;  1UA0 A;  3OR1 A;  1CQM A;  3M8Q B;  1AT1 B;  1YHQ S;  3D0I E;  4ZMM A;  3PW0 A;  3SQG B;  2IAJ A;  3LWL A;  4URG A;  1VDH A;  2BOP A;  2XI3 A;  4RW9 A;  3N28 A;  1UJ6 A;  4LRA A;  2JLE A;  1D0E A;  3SCI E;  2AYB A;  4TVA B;  3T19 A;  1OWX A;  3V6D A;  4UOF A;  4Y2C A;  4JI7 J;  2R3V A;  3ZO7 A;  4B3S J;  2J8A A;  3UVJ B;  3BH6 B;  4WWS A;  3QRP A;  3ADA C;  2QLB B;  3JAM Y;  5K5M A;  3RU0 A;  1Q0N A;  4HTJ A;  3GFX A;  4MKV A;  4CYU B;  4WFZ A;  1Y10 A;  3KK3 B;  3A8E A;  3QSY B;  3MM8 A;  5IWA J;  4MJK A;  1XN9 A;  3P96 A;  1W2I A;  2KFN A;  4IH6 A;  2VG7 A;  2M8H A;  1YGY A;  2ZH6 A;  2HS3 A;  3CED A;  1H2V Z;  1U7L A;  5ETK A;  1KSP A;  4LMZ A;  3OSP A;  4NCG A;  2DGO A;  2FJD B;  4C3L A;  2RB7 A;  1S1X A;  2XZW A;  1LW2 B;  4LSZ B;  3OD2 A;  2ZDO A;  2G1D A;  4ECV A;  4TXS A;  5GAH U;  1T95 A;  4AFF A;  2Z2Z A;  3HP6 A;  3N0V A;  3GIR A;  3GYN A;  2OD4 A;  3MZI A;  3NAI A;  3W66 A;  5L9N A;  1H7W A;  2ZBR A;  4YHH F;  1U0H B;  2CPF A;  4LRC A;  4EBE A;  3DFE A;  2RT3 A;  4ZLJ A;  4J9O A;  2G13 A;  2XMT A;  4DU7 A;  5LMN F;  4XTT A;  1NZA A;  1RLD A;  4QWB A;  3MAH A;  3QFH A;  1CJK A;  1RTJ A;  5IT9 U;  1RT1 A;  3AJ2 A;  5HP1 B;  2K7J A;  3CJK A;  1SVD A;  1OSD A;  2DRD A;  2KH9 A;  2XLJ A;  1H2U X;  3HKZ D;  2KVI A;  4FVM A;  3SIP B;  1S0V A;  1T05 B;  5KFU A;  3W5X A;  3DYA B;  5HLF B;  4DG1 A;  3AAW B;  2VOP A;  1NB2 A;  2ERR A;  2HQD A;  3KJV B;  4HAC A;  1U1R A;  3PO4 A;  3C6T A;  2EFO A;  4EMD A;  1IBL J;  2QC3 A;  1N52 B;  4DOZ A;  5FDL B;  1EIY B;  4ZPB A;  2E1C A;  3AB2 B;  4KY3 A;  2UVV A;  3O8W A;  5I3U A;  3WX8 A;  4XAK A;  2FC9 A;  4NL5 A;  2HFS A;  3DLJ A;  3CCS S;  3MEK A;  2XB2 D;  3M32 A;  2ZDP A;  4X65 F;  2XC9 A;  2WK4 A;  1RT6 B;  4OLP A;  3FBE A;  4C0B A;  4OYI A;  2XY7 A;  2CQ2 A;  2MZQ A;  5DZ6 A;  5KFJ A;  4OZN A;  3A1Y G;  2C3Y A;  3IWN C;  3NOC A;  3PV8 A;  2GVZ B;  2HFU A;  1WG5 A;  2QYC A;  4FVC A;  5EWF A;  1VQK S;  5HAT A;  3HD2 A;  2W2Q P;  3FEZ A;  2O66 A;  1VQ6 S;  4ANE A;  2OML A;  1ELO A;  3CJ8 A;  1FDN A;  4CI0 B;  4O3O A;  4ED2 A;  2YNG A;  4MTP A;  5LMU F;  1GMW D;  3VGU A;  4P7T A;  2L08 A;  4M95 A;  3W3S A;  3C2P A;  3CDE A;  1HNI B;  4WZQ A;  1RTI B;  5LSO A;  3OLA A;  1HD1 A;  3HI9 A;  4DCP B;  3TWZ A;  4EWT A;  2YKM A;  1V6H A;  5KFC A;  2BAN B;  1REG X;  5F8G A;  1S7I A;  5KFR A;  3R5A A;  1LWE A;  2YX1 A;  4P72 A;  1VC5 A;  3KHG A;  3F44 A;  2P9E A;  2GNK A;  1SJ4 P;  4ZIW A;  3Q22 A;  1X5S A;  1EZZ B;  3X1L B;  1IBK J;  4N7T A;  4O3Q A;  4G3I A;  2MKY A;  2NZC A;  1S59 A;  2H9Z A;  2GJI A;  4OJG A;  5KTQ A;  4EUV A;  2C1E B;  4HKQ A;  4JV5 J;  1VBK A;  4OZ2 A;  1RTD B;  1LEO A;  2HND A;  3MF5 A;  4ZVP B;  4DR3 F;  2FVC A;  4ES3 A;  1WDD A;  5GAD I;  2R4F A;  1PC5 A;  3DRR A;  4N8O A;  5FLX U;  4DPU A;  3AJD A;  4ZS6 A;  2DB1 A;  4OL8 A;  1QY7 A;  2DHG A;  1Y3K A;  3RG6 A;  2IVF B;  1QVG R;  3BN4 A;  2KM8 C;  3MAA B;  4M5D A;  1DQA A;  2RDD A;  4PRF A;  1FA0 A;  2VC1 A;  4HVZ A;  2JL9 A;  4LF8 F;  3MR5 A;  3M2U B;  4AL5 A;  3JSM B;  1YWX A;  3WZ0 A;  2CQ1 A;  2KZZ A;  1IWG A;  2ZVI A;  4LQ3 A;  1HWL A;  3UE2 A;  4X4S A;  2XLI A;  4QW9 A;  3KJQ B;  3ISZ A;  5D0R A;  3DXB A;  4NI2 A;  1FKO B;  4DF4 A;  1J5E F;  3W8P A;  3J81 Y;  3RRH A;  4W98 A;  2XMK A;  1MWY A;  1FD2 A;  3V4I B;  3R5B A;  4P52 A;  2BAB A;  1ZAW A;  5EWG A;  4JI4 J;  2YNI A;  5CD4 H;  4Q5V A;  2KHD A;  1W7W A;  3GYG A;  1HQE A;  2JZ5 A;  3I0S A;  4C2M A;  2FPH X;  1P6T A;  3DLG A;  1C4A A;  2KT2 A;  2GHP A;  1IBM F;  5CQG A;  5D77 A;  5KFD A;  2IHR 1;  2MQN A;  4DDF A;  1RU1 A;  1QUP A;  3D0H E;  3PRB A;  1QM9 A;  3QID A;  1K47 A;  1N0V C;  2OTJ S;  4ENO A;  2UUB F;  4XPC A;  2OI2 A;  3OR2 A;  1VFJ A;  2LXI A;  1TFY A;  1F1B B;  3PEH A;  4N76 A;  5EN1 A;  3LF0 A;  1C0T A;  1MNE A;  4IRC A;  1XMB A;  2XTJ P;  2F3J A;  1S9E B;  5ETR A;  4J9K A;  3EYZ A;  4ETX A;  4TU9 A;  4K2X A;  3AOA A;  3UD4 P;  1R0C B;  3S1T A;  2LEP A;  2AGQ A;  4NYP A;  5DLG A;  2NZ4 A;  3UCU P;  2ZH7 A;  4KPY A;  2F4F A;  5KOX A;  1F5A A;  4XO0 A;  3I87 A;  1VOM A;  1X60 A;  2H1Y A;  3QZ7 A;  3QAT A;  4PUO A;  1VHI A;  1P1T A;  1FF2 A;  2W7P A;  4WP3 A;  3QGP A;  2LU2 A;  4DI6 A;  5M2U A;  4ZLL A;  1APS A;  4IG3 B;  3RBD A;  2Z30 B;  2B9E A;  3TR5 A;  2L9D A;  1ZM2 A;  3TAM B;  3CCL S;  1BQX A;  3NG8 A;  4OV1 A;  4OZL A;  3PAC A;  2FJW A;  1NKB A;  4YHH J;  2HGL A;  1SQF A;  3ETM A;  4JI1 J;  2VG5 B;  1F6T A;  1OYE A;  4BHQ A;  1DUR A;  2BX6 A;  4A4J A;  5LMN J;  4FF1 A;  1RT5 A;  1S77 D;  2DEI A;  2BKN A;  5GAH I;  2ZE2 A;  4WCE Q;  5D0E A;  3BDE A;  3SBM A;  3HVR A;  2FUG 9;  1QAJ A;  4DR6 F;  2YKO A;  1N54 B;  2AJ4 A;  3UD3 P;  1M5P C;  4HHU A;  3PJX A;  3LAN A;  2MY8 A;  4LSN B;  1B0T A;  2P8I A;  2J6T A;  1UZH A;  4TYB A;  5DQI A;  3BEG B;  2XYP B;  3M6W A;  1RBO B;  4OX9 J;  3D6F B;  4C11 A;  5IV3 A;  1DZ5 A;  2QMW A;  1FKP A;  5DDP C;  1NSA A;  1XR7 A;  2ZJP Q;  3DRX A;  4QYZ K;  4P2S A;  3QMQ A;  3J7Z T;  4ZCL A;  4NLY A;  3S01 A;  2ZM6 F;  2MGZ A;  1ZAV A;  4Q2L A;  1SC3 B;  2CUY A;  2YY3 A;  3WC2 A;  3MR3 A;  1FT8 A;  5A8R B;  2C2K B;  1SKS A;  4V19 X;  4X65 J;  2AJ1 A;  4DUZ J;  1XIQ A;  4FN5 A;  1WI8 A;  1G1X A;  2HVE A;  2QA2 A;  4WKR A;  3LTO A;  1A7G E;  7FD1 A;  2HVD A;  3G8Q A;  3PY8 A;  4DBQ A;  2PT0 A;  2PA3 A;  2ATC B;  4RPF A;  2V0N A;  1RGV A;  1WC0 A;  5A8K B;  5K20 B;  2FJB B;  3GU0 A;  2YPZ A;  3CXC R;  2FGC A;  2ADC A;  1RSC A;  3VTI A;  2G1H A;  2CQ3 A;  5LMU J;  4FF2 A;  1HQU B;  4ZOS A;  2XS7 A;  1CSJ A;  4FS1 A;  3NNH A;  4G65 A;  1CC8 A;  5A8W A;  3TA0 A;  1I51 B;  1OMS A;  1K8A T;  1PYT A;  4ZPC A;  5CYQ A;  1FHT A;  2IDL A;  5GMK a;  2RRN A;  3HT3 A;  4DR4 F;  2LVW A;  1WEL A;  4OQJ A;  1XC9 A;  4RLE A;  3RRK A;  1T03 A;  5L39 A;  1S6P A;  2QO3 A;  1NJW A;  1K0V A;  2MHE A;  1M1G A;  3V6K A;  4LR8 A;  4NZ6 A;  1N56 A;  2BW7 A;  4YR2 A;  1TKZ B;  3LP2 A;  4K0K J;  4QYZ J;  2NPI A;  1N88 A;  2K3I A;  4Z2X A;  3W61 A;  4KV8 B;  1YJN S;  2R7R A;  3MGJ A;  2HHT A;  1W2B R;  2W4P A;  2VC0 A;  1X4G A;  1FO1 A;  3C3L A;  4C98 A;  1C4C A;  1VS3 A;  1F9F A;  4JP8 A;  1RT7 A;  3O44 A;  3G96 A;  3MXH P;  2VHG A;  2PMZ D;  3I5A A;  3I0R A;  2WON B;  4LF8 J;  5F8M A;  4F4X A;  2M70 A;  4LBI A;  2A10 A;  3KYL A;  4DU8 A;  2UUT A;  4KFB B;  4QOT A;  4ECS A;  1XWL A;  1TL7 A;  1R27 B;  1P27 B;  4NLX A;  3HFK A;  5E41 A;  1RDR A;  4GVL A;  1RE1 B;  4NRU A;  3FFI B;  2PDA A;  5JJB A;  1ZOT A;  5EX0 A;  3NWR A;  1Q8B A;  2ZOF A;  2L9W A;  5KG5 A;  4WE1 A;  3THP A;  4Z37 A;  3BO3 A;  1NCL A;  5KG3 A;  1MWQ A;  1JJC B;  1AZS A;  4DL0 C;  1LK5 A;  3TAN A;  1S97 A;  3DLK B;  2JWN A;  1NJX A;  1Q4R A;  1XMO F;  1KFS A;  4RW7 B;  1DTQ A;  4C6A A;  2B4O A;  2B8Q A;  1V3Z A;  4UZB A;  3FJ2 A;  2BJE A;  2N82 B;  4X4P A;  2VH7 A;  1ULR A;  2OJ3 A;  4NLP A;  2EVZ A;  3MEE A;  3QJL A;  3WIU A;  2HFO A;  2EBG A;  2P9C A;  2GAH C;  3C16 A;  3DDI A;  3CW2 C;  2ZH2 A;  3EPI A;  3MCM A;  1FVQ A;  3CJ2 A;  3LUY A;  2E9Z A;  3DRY A;  1FFW B;  2JRS A;  1JLF B;  4JI3 J;  1HI0 P;  4KO0 A;  2A2C A;  2JDJ A;  3NGD A;  4OHW A;  2AD9 A;  5K8O A;  4CTA A;  5B7W A;  2HLT A;  3NNA A;  3FQK A;  4TN2 A;  1HBU A;  3S7R A;  1UVL A;  2HRU A;  2DXE A;  3IXQ A;  2OEK A;  4CCH A;  4OI0 A;  1VQ4 S;  2Q6B A;  1TMJ A;  5C2C A;  3UN5 A;  3IR6 B;  4DUY F;  5DG7 A;  4RO0 A;  4NCA A;  1FRH A;  2ACY A;  4LF5 F;  1T94 A;  2ZEJ A;  1M5O C;  2RQK A;  3PYF A;  4Y34 A;  4PG6 A;  1IR1 A;  4W4M A;  3J7A N;  2Y8W A;  4YB5 A;  3GJQ B;  1Y9O A;  3H25 A;  1R6V A;  2IVY A;  4O4R A;  5L46 A;  1QTM A;  2J0Q D;  4MYU A;  1HBM A;  4DR6 J;  2MZ1 A;  2ZZT A;  2I1R A;  2B7C B;  1SJR A;  2ZD1 A;  4OYX A;  5DS7 A;  3LAL A;  1K44 A;  3DLB A;  1P9Y A;  4ECT A;  5CXT A;  4Y28 C;  2ROG A;  4DPX A;  3UPF A;  4F2S A;  5GME A;  2HHV A;  4DR5 F;  2RF2 A;  1JK9 B;  3PO5 A;  3SFG A;  5KFZ A;  3NGU A;  3ZZR A;  1RXO B;  5EUH A;  3IR5 B;  2NUU G;  2YNF A;  5KOW A;  4H4O B;  4CM0 A;  2ZM6 J;  3TUJ C;  3M6V A;  1BD6 A;  3ZZY A;  5C7P A;  4IQX A;  1VQ8 S;  1BHN A;  2Q6C A;  1SL0 A;  3HVT A;  1Y00 A;  3W60 A;  4ANC A;  5J2N A;  4BWJ A;  2VDI A;  1LFP A;  1U25 A;  2B4P A;  3OFF A;  4K4V A;  3HHK A;  5BR8 F;  4B9V A;  2CJY B;  1VGY A;  4DSE A;  5F8L A;  2XGQ A;  2AYE A;  4N47 A;  1NK0 A;  2J6U A;  1HWU A;  2L41 A;  3BGF A;  1SV5 B;  5LOQ A;  3C66 A;  2DVI A;  3MMJ A;  3HVA A;  4DV6 J;  3EM1 A;  3W2V A;  1KLN A;  1S7H A;  4OJ3 A;  2R7O A;  4KT0 C;  4IH7 A;  4CLW A;  3CDA A;  5K9F A;  1MRO B;  5HBM B;  3K8W A;  3QAU A;  1L3K A;  3HM9 A;  3W2W B;  3K8V A;  3M2V B;  2AJ2 A;  3GG0 A;  3CCW A;  3M6U A;  2H48 B;  3D1O A;  1KDN A;  4I56 A;  2FQQ B;  3L3C A;  2Z58 B;  2VG6 A;  5E7O B;  2QYG A;  1N5Y B;  2HFV A;  4GVB A;  1TKT B;  1DTT A;  4PQA A;  1MMN A;  3ILL A;  1V9O A;  1U45 A;  4O4G A;  3E01 A;  3MM6 B;  2FVP A;  2KN4 A;  1HBO A;  4UOH A;  5A6P A;  2GVD A;  3G86 A;  3M8P A;  3Q24 A;  4WIQ A;  4C7Q A;  2GO8 A;  4CLF A;  2E5H A;  3M8R A;  4J9L A;  2ASL A;  1S76 D;  1VBZ A;  2QA4 G;  1PYO B;  4J9N A;  4DQS A;  4L72 B;  3QYY A;  4UW2 A;  5B0A A;  5KFN A;  1KBR A;  2FB0 A;  3CJQ A;  4OHX A;  1FD8 A;  2HIY A;  4ICL B;  1YZ6 A;  3R7S B;  1CJT A;  3RB4 A;  4L3K A;  1WC5 A;  1NU4 A;  5CD4 A;  1SJQ A;  2LEC A;  2RS8 A;  4CZC A;  2OPR B;  4ZN1 A;  2B9X A;  3PRV A;  5DDO C;  1Q8L A;  3CJ0 A;  5IT9 Y;  2HS4 A;  2SXL A;  2VPY B;  5IT4 A;  1FTR A;  3QO9 B;  4J5O A;  1YQH A;  3PR5 B;  5HRO A;  1BLU A;  1WTF A;  2KG0 A;  1SKR A;  2GGP B;  3M30 A;  4WTY A;  2NYI A;  4M5K A;  2LEA A;  1VJW A;  5LJ3 Y;  3D7S B;  4CO3 A;  4Y6I A;  2HBY B;  3OXG A;  1M1K T;  3MEC B;  3WIV A;  1GX6 A;  3H8Y A;  3VCD A;  1ZM4 A;  1U8W A;  2COL A;  3UCZ P;  2H3E B;  4WII A;  3DI6 A;  3NCR A;  3LO3 A;  5ITH A;  1FRX A;  3O3L A;  2XS5 A;  1Q95 G;  1CLF A;  2O5D A;  1KOO A;  5A2Q Y;  1ARO P;  1H74 A;  4C8Y A;  5KFA A;  4ECY A;  4YME A;  1SL1 A;  3M9N B;  4F26 A;  1Q53 A;  1QE1 A;  2VUG A;  5BJR A;  4DFJ A;  4NXM J;  4LRE A;  3CCQ S;  5GAE I;  4YOE A;  2NS1 B;  3AOB A;  2QJ3 A;  1RT3 B;  3KK2 A;  4NRT A;  1U8S A;  3KNA A;  1PIL A;  2WCX A;  3K89 A;  3TVY A;  3BB5 A;  4HHH A;  2DNL A;  1R0A A;  4IG0 A;  3IG1 A;  2XS2 A;  4FDF A;  3K7R A;  1ZM9 A;  1I94 J;  1RWN B;  4P2F A;  2FHK A;  4R5P B;  3LPY A;  2IY5 B;  2JSX A;  1N6Q A;  2CQI A;  4CH7 A;  1BQN B;  2HWI A;  1IVZ A;  4ID5 B;  1IJF B;  2F8M A;  5CZV A;  1S9G B;  2HQI A;  3IR7 B;  4X4R A;  1RWK B;  4DEZ A;  2F9D A;  4ZVU B;  2NXE A;  2DXD A;  1R8H A;  2PII A;  1S1T A;  4OI1 A;  1IKW A;  2Z2L A;  4CDI A;  3UI3 A;  2QE5 A;  2DCL A;  4I2Q B;  3US5 A;  2M0G B;  2YBV A;  4KGV B;  5LSL A;  3UD5 A;  4ZCM A;  4L76 A;  1U0S A;  2CPH A;  2BR0 A;  3R1L A;  3EZO A;  2UUC F;  2MTL A;  3SMZ A;  4NE9 C;  1R8C A;  2VFT A;  2GMH A;  2VKR A;  4LF5 J;  2QX0 A;  2DNY A;  1FK9 A;  1L3T A;  1VQ9 S;  1OIA A;  2RIJ A;  1S12 A;  2NLW A;  3MCO A;  3EVO A;  1KN6 A;  1WOS A;  2HWT A;  3KHR A;  4PG5 A;  2BE2 A;  5KFT A;  1FE0 A;  5DQH A;  4GRS A;  1TK5 A;  2G0J A;  2WOM B;  2YXL A;  1TKD A;  1RKJ A;  1B3T A;  3IGN A;  4FXV A;  4IOB A;  3TOQ A;  1RAB B;  2V5H G;  4WPA A;  2E44 A;  3ENW A;  2MEW A;  5J2P A;  1FRI A;  2D9P A;  2OFG X;  1HWK A;  4O23 A;  3R5D A;  2VJU A;  3AD8 C;  2ABY A;  3TP2 A;  4JI0 F;  3FUY A;  4DR5 J;  5KFQ A;  5M2R A;  4CH0 S;  2WZ1 A;  5JUM A;  3OVA A;  2ZC3 A;  2BM1 A;  1D3W A;  1HKA A;  4QIW D;  3DRP A;  3D54 A;  2RE1 A;  5I3Q A;  2BE9 B;  3FSX A;  4CLK A;  2X1B A;  3CC4 S;  3C8Y A;  3VZI A;  2UV8 G;  2V8P A;  3IS9 B;  2X1F A;  2CQ4 A;  1YKW A;  4DV5 F;  4AL7 A;  5L38 A;  3CJT A;  5DLF A;  2AHO B;  4LBP A;  3VWS A;  2HFN A;  3JTP A;  2OSR A;  4QBU A;  4DX8 H;  5DO2 A;  2JVO A;  4TNO A;  3TAQ A;  2V8V A;  4QYR A;  3GV8 B;  4AXI A;  1UWA A;  1JIH A;  2JEJ A;  2GV1 A;  1MW7 A;  3F73 A;  5G0R B;  2UXC F;  3M8Q A;  3JQJ A;  1SJ1 A;  4DSL A;  3LQV A;  3SQG A;  2AP6 A;  5KFS A;  1HNW F;  1N48 A;  3MOZ A;  2HSE B;  3A4T A;  3T1H F;  4J37 A;  2CPD A;  4NLU A;  2I5J B;  2LMI A;  1N8R T;  4ECX A;  3M9M B;  2CJ9 A;  3K2Y A;  1IQZ A;  1IKX B;  3UVJ A;  3FBF A;  1CC7 A;  5E3P A;  3OJS A;  4YDX A;  3D9B A;  2APO A;  2FY8 A;  3L09 A;  3MPV A;  4CYU A;  2J9D A;  4FS2 A;  3KK3 A;  2LQ8 A;  4NPO A;  4ZJL A;  3DGV A;  5RUB A;  3D1Q A;  4DX7 A;  2JOQ A;  5KFE A;  2X51 A;  1URN A;  2ZC4 A;  4ZA1 A;  3V4M A;  3ZXW A;  1U4B A;  2CPY A;  2Z0G A;  2VZ9 A;  1WSV A;  2Q66 A;  1LW2 A;  2PA8 D;  3KG0 A;  5T14 A;  3PKM A;  3BM7 A;  4USV A;  1IWA A;  3UNY A;  2FC8 A;  3VZH A;  1CUL A;  4PPD A;  3MPY A;  2XO6 A;  4B9M A;  1U6Z A;  2VV5 A;  3GE9 A;  2VA3 A;  2V6A A;  3JSY A;  1U0H A;  4HDG A;  2V67 A;  4YDD B;  1FCA A;  4E8U A;  2ZJQ Q;  1U1P A;  1CJV B;  3EXY A;  2YKN B;  1Q7L B;  2NSB A;  2VPX B;  2F4V F;  3D3B J;  5L1J A;  3EUN A;  2Y1R I;  4GKK F;  1KWM A;  5AE1 A;  2AQ4 A;  1WI6 A;  2FGO A;  3Q0A A;  1AA1 B;  2M8D B;  3NGS A;  5HJX A;  2QLW A;  2RML A;  5HP1 A;  3CJ4 A;  3NGT A;  2LYV A;  4M1K A;  3KLF B;  2BA9 A;  2HVH A;  3THT A;  5IC6 B;  1T05 A;  1LK7 A;  3TO8 A;  2E5L F;  3DYA A;  5HLF A;  3F41 A;  4LSL B;  3BRE A;  2XY6 A;  1YJT A;  5HL7 Q;  1Q5V A;  4IOA Q;  4KTQ A;  3KJV A;  5HN0 A;  4OJH A;  2GW8 A;  3LP1 B;  2UZA A;  1VBY A;  3UR3 C;  3NNC A;  5FDL A;  1Q81 T;  3AOD A;  4IR9 A;  1N34 J;  3SQO P;  1D9F A;  2XZT B;  3Q8V A;  4J90 A;  1F9H A;  3PW4 A;  2G9O A;  4X66 F;  3KFW X;  1D9D A;  2C2Z B;  4LFC F;  2F63 A;  3M9O B;  1RT6 A;  1YTY A;  3CCJ S;  1VMB A;  2HEK A;  4PPZ A;  3TEH B;  2HYI B;  4CLZ A;  4B3T F;  2RQC A;  2IRY A;  4DFK A;  1RAG B;  4AND A;  1QAY A;  3T6B A;  3OW2 R;  2C2D A;  4PG8 A;  3WQP A;  3BBB A;  1N5V A;  2GVZ A;  4IUF A;  1HI8 A;  1HPZ B;  3M8W A;  4ID8 A;  4DPT A;  3HHL C;  1OPI A;  2DGW A;  4D3G A;  4Q45 A;  4DV7 J;  4Q8F A;  3MUM P;  3DOL B;  4KQZ A;  1KEK A;  4NYO A;  1SH0 A;  3I5C A;  3G6V A;  2YWH A;  2VF3 A;  2GAG C;  1PCA A;  1X5P A;  1V5V A;  1VC0 A;  3W9I A;  4WZM A;  2QIF A;  4BC9 A;  4JI8 F;  1JLA B;  3P3D A;  1HNI A;  1RTI A;  4K4Y A;  3OXF A;  2OIH A;  1TFW A;  2CDQ A;  1NJI T;  3KMQ A;  1FRM A;  1Y3J A;  4EGL A;  1DQ9 A;  1F3F A;  3D67 A;  2Y3Y A;  2KYZ A;  5HSP A;  4CM2 A;  2P6S A;  4IQM A;  1HD0 A;  1F60 B;  1Q86 T;  2CVE A;  1JLE B;  4IR1 A;  4OZ5 A;  1S0N A;  4NZ7 A;  2PEB A;  2X1G A;  4FYD A;  3S8S A;  1EKS A;  4C4W A;  4ZPD A;  2R2U A;  5KFX A;  1G2E A;  1RAO A;  1RTD A;  3IRX B;  4OV6 A;  4QU6 A;  2N3O A;  2WVD A;  4TLR A;  2EC0 A;  1FRK A;  4WFY A;  1KNZ A;  3GII A;  3VAL A;  2VON A;  3EVW A;  3ZZZ A;  1UKU A;  3EGN A;  3GJT B;  4R0E A;  3V6J A;  3IC1 A;  2OH2 A;  3GTY X;  3MAA A;  3D2W A;  4ZVT B;  3BH7 B;  3U02 A;  2I0X A;  3M2U A;  1M5V C;  2M7S A;  3PZP A;  2HHQ A;  5L1I A;  3OQ2 A;  3PFE A;  3JSM A;  1KD1 T;  3R5G A;  1CG2 A;  4AUK A;  1Q79 A;  3BV8 A;  3M7V A;  1YRU A;  5HK4 A;  4PYA A;  3TA2 A;  4ED8 A;  2UVU A;  1FVS A;  5J1E B;  1FKO A;  1IKY B;  4CP5 A;  3MPD A;  1ZPW X;  2CPE A;  3V4I A;  2WVE A;  3R9L A;  4F02 A;  4CLL A;  2C2N A;  2ZBQ A;  3JQM A;  5DGB A;  3GR1 A;  3KNG A;  2L9N A;  1NH8 A;  2UXC J;  1RQ0 A;  1X4D A;  3RAQ A;  5LSR A;  4CO2 A;  3TJ8 A;  1HNW J;  4EZ9 A;  2IDE A;  1PO6 A;  1CS4 B;  3SV4 A;  3AB4 B;  3T5H A;  1KFD A;  3MM5 B;  4ZDN A;  2DD8 S;  4ECZ A;  3T1H J;  3TX8 A;  3SCJ E;  1HHS A;  3ENA A;  1S9E A;  2OPS B;  5G4D A;  5DRK A;  1RTH B;  5LL6 d;  1G4C A;  2FIU A;  3EVM A;  2BJ3 A;  4OX6 A;  1FEH A;  2DIT A;  2VIH A;  2NUH A;  4ILR A;  1O0P A;  3TZX A;  4OHZ A;  2IJN A;  5KG0 A;  3QQC D;  2PMW A;  1SIW B;  5DGA A;  2LP4 A;  3J80 U;  2K8G A;  3B4D A;  5C24 B;  3EMT A;  4O3P A;  2JFK A;  4IG3 A;  2U1A A;  1WC3 A;  1EJ7 L;  1NME B;  4CO5 A;  3TAM A;  2E1R A;  2DHA A;  2XBP A;  4RR5 A;  4AT1 B;  5E0O A;  1IKV B;  2FVQ A;  4JI2 F;  2HHH J;  2VG5 A;  1JLQ B;  1JXV A;  3MFH A;  2IM0 A;  3G6Y A;  4L74 A;  5KFP A;  5IC4 B;  1TK0 A;  4B9U A;  4X4O A;  3TVK A;  4JI5 F;  4QZV B;  3UFC X;  4RW6 B;  1YJU A;  4GKK J;  2V63 A;  2AWZ A;  1XK8 A;  5DDR C;  2YWW A;  4QR2 A;  5J2M A;  5FD1 A;  2BW2 A;  3HCX A;  4W92 B;  2PFD A;  2HK2 A;  1GAO A;  3JSB A;  1U6F A;  2YTC A;  3GP9 A;  3KK1 B;  4GKJ J;  4LSN A;  4CRJ A;  4ZIV A;  4X62 F;  2OAU A;  3A8K A;  4LF1 A;  5AJ3 F;  1JLC B;  3R6L B;  1FFG B;  1I6J A;  1M5H A;  2OHD A;  5JXS A;  1FXR A;  4RNM A;  5F8N A;  2LLZ A;  1GMV A;  1S9F A;  3IMQ J;  2BOA A;  4X4T A;  1B0V A;  2F7V A;  5F8H A;  3V81 B;  3FRZ A;  3B6B A;  4DSI A;  1VI7 A;  1SC6 A;  3OTB A;  2D3Z A;  4JUZ A;  2UVW A;  1YBA A;  3KOA A;  4WF9 Q;  1IXK A;  2Z2M A;  2B4U A;  2RRB A;  2D3U A;  2K7K A;  2RKI B;  1X4E A;  1SBR A;  3DCA A;  4KGM A;  1NDL A;  5A8R A;  3D68 A;  2YQ3 A;  5J1P A;  3H7H B;  3HFV A;  1M90 T;  2DY9 A;  3TUI C;  1RAA B;  1NBE B;  3THV A;  4NAS A;  1Z2L A;  3U1N A;  5CYJ A;  3IRW P;  3AXM A;  5THW A;  3GQC A;  2DNO A;  1VC6 A;  5C2G A;  3NS5 A;  2VFR A;  4GO5 X;  2ASD A;  2CJB A;  2LQJ A;  4OYB A;  1S99 A;  4ZPT R;  3HSD A;  5A8K A;  4FYV B;  4ECR A;  2KFZ A;  2M9K A;  2MLX A;  3BN7 A;  2V4R A;  2ZOM A;  3ISN D;  4URS A;  1YRX A;  2RSQ A;  3TNV A;  3D1H A;  1HQU A;  2IC3 B;  2VQE F;  7FDR A;  2B51 A;  5F9N A;  2FLN A;  4JI8 J;  1ZZF A;  3GYX B;  2MKJ A;  4OYA A;  3BBC A;  4KRW A;  4KIA A;  2ZJR Q;  1UVM A;  1LW0 B;  4PAA A;  2CJK A;  3V6H A;  1BQM B;  4WFX A;  4YN3 B;  2LQ9 A;  1WAC A;  4EI2 A;  1H73 A;  4DN0 A;  1AUD A;  1F2G A;  2ROP A;  4A8F A;  4WP9 A;  1IJE B;  1XQI A;  1SC4 B;  3IBC B;  5HMZ A;  2IA0 A;  4KJI A;  1QSY A;  3V2U C;  2DHX A;  2EFV A;  3QRR A;  4G1Q B;  1PJ7 A;  1TKZ A;  4USK A;  3QWP A;  1E6Y B;  3KUE A;  4BWM A;  4KV8 A;  2Y0B B;  1X4A A;  3T1Y F;  1W25 A;  4J9U E;  1KVK A;  4ZPA A;  1J5O B;  2RDJ A;  1XNR F;  3QFW A;  4P10 A;  2QN6 B;  2AX1 A;  4RWW A;  3PFO A;  3M8Y A;  3CPW R;  2DR5 A;  5B0C A;  3HHL B;  4QCL A;  4RX6 A;  2WON A;  2FY1 A;  3KXD A;  1I1G A;  4HTI A;  4TLQ A;  4USJ C;  3IWX A;  8AT1 B;  1WF0 A;  1R7I A;  2YWF A;  3FBC A;  3NL0 A;  4KFB A;  2HFZ A;  2H5E A;  4Y2A A;  1TKX B;  1TL1 B;  3WBZ A;  3W65 A;  3QGH A;  5KFO A;  1SKW A;  2W25 A;  3QT8 A;  1ZAX A;  3O1L A;  2XUL A;  1HYS A;  3FFI A;  3QIP B;  2R2S A;  4PQU B;  3IN5 A;  4MH8 A;  1GNK A;  3I56 S;  1SB6 A;  2MDA A;  3MM7 B;  4LFA F;  2ZH5 A;  2Y0S D;  1XNQ F;  2GC8 A;  2PO4 A;  2I38 A;  4PZV A;  2K1R B;  3S6E A;  3HKW A;  2RH3 A;  2J9E A;  5KT6 A;  4DV4 F;  2Z56 B;  2G0C A;  4YY3 J;  3OSN A;  2P9G A;  3DLK A;  2VBZ A;  3I0S B;  3FBB A;  5GAD U;  3M8Z A;  4RW7 A;  1DBD A;  3KUG A;  2QV6 A;  4USI A;  3K5O A;  2GA7 A;  2DRA A;  3NBP B;  1LKZ A;  4ZHR B;  2YKA A;  4ZVQ B;  1JJ4 A;  2DNG A;  3RB6 A;  3L7O A;  2FYX A;  4P74 A;  1J2V A;  4B9T A;  4F4A A;  1Q78 A;  1E6V B;  1EAR A;  2LXU A;  1R0B G;  2XSJ B;  2KXN B;  3JTN A;  2HRT A;  3N6N A;  3W62 A;  4J9M A;  1JLF A;  4KC5 A;  5C5J A;  2LEB A;  4Y0F A;  3OL6 A;  3IA0 A;  3MMB B;  4FKY A;  3M8S A;  2E7X A;  1VR6 A;  2KVQ E;  3GFZ A;  5KFW A;  2R7T A;  2X3G A;  3JAM U;  4ATN A;  1RT2 B;  3R5C A;  1RT4 A;  4WFB Q;  3T41 A;  4F50 A;  3K5P A;  4A8K A;  3Q89 A;  2MQO A;  2XO7 A;  3TEG A;  1SPB P;  2BQR A;  1C1C B;  3NOG A;  4RNN A;  1KVJ A;  2BJ8 A;  5FJ4 A;  3R3T A;  3DC2 A;  2XZD B;  3DHX A;  3RTV A;  3RW7 A;  2W9B B;  5ETQ A;  4UUX A;  1QLN A;  1YZ7 A;  3BS9 A;  3CNQ P;  4JI5 J;  3F0N A;  1NK5 A;  1A9N B;  2IYI A;  2AZ3 A;  4ES2 A;  4DR2 F;  1Y5I B;  1NKC A;  1NO8 A;  3OUY B;  4B02 A;  4J9Q A;  3FZB A;  3MFI A;  5IQ6 A;  1WSR A;  2H5J B;  3KLE B;  4FBU A;  1UVJ A;  1WWH A;  4EYH B;  2W2P P;  1XBW A;  4X62 J;  2ILY A;  2HIQ A;  2AX0 A;  5AJ3 J;  4B9S A;  4FYY B;  3ZZP A;  2IM2 A;  4P2X A;  4U9R A;  1S6U A;  3P49 B;  1U1K A;  3KLH A;  4IDK B;  3VR1 A;  3NGK A;  3C14 B;  3KDO A;  2CQB A;  1MSW D;  4NA2 A;  1T9V A;  3WDO A;  1R43 A;  3RRG A;  4JB8 B;  3DXS X;  1UW9 A;  1RAE B;  4YUD A;  2W1B A;  2HPU A;  4H4O A;  1BE4 A;  1X31 C;  2KDO A;  2LQ5 A;  4P73 A;  1VQO S;  1H2T Z;  2MST A;  2ZBI A;  4DV1 J;  2ZNY A;  4CNY A;  5ETS A;  4H4M B;  2YH0 A;  3H5X A;  3I6P A;  4RW4 B;  2J5A A;  3QAE A;  5IS2 A;  3KDN A;  2LDY A;  2BMB A;  1LNQ A;  4WFN Q;  4ER8 A;  4U6P A;  2BZ2 A;  1SV5 A;  1K73 T;  3DMJ B;  2HZA A;  1RAH B;  2KJV A;  2RVJ A;  1U48 A;  4AYB D;  2G2Z A;  1K1S A;  4ECU A;  1GTE A;  2FD2 A;  5DDQ C;  3GIM A;  2XNQ A;  1MRO A;  5HBM A;  5HAN A;  2G0I A;  3CC2 S;  1TV6 B;  4M8L A;  4X4U A;  3M2V A;  3QLH B;  5M2P A;  4RU2 A;  1UET A;  2CWK A;  2XMJ A;  1UJ4 A;  1OY9 A;  2CXE A;  3DOK B;  4NLG A;  3H5Y A;  4DX5 A;  3GJS B;  1N5Y A;  1ZA2 B;  1T3O A;  1TKT A;  3RAX A;  1T7P A;  2CIM A;  3MMC B;  2QLX A;  9ATC B;  1FWP A;  1WUU A;  2GIQ A;  4NLD A;  2V8G A;  3MM6 A;  2YH1 A;  5H9F K;  1D9A A;  2B8P A;  2V34 A;  2LKZ A;  4KPC A;  2MJN A;  2DK2 A;  2O3D A;  1FJG F;  2CJA A;  5L1L A;  4OJ1 A;  3EZ5 A;  1NSK L;  4EZ6 A;  1WF1 A;  2MQM A;  2Z57 B;  2DRB A;  2DHS A;  3BF4 A;  4WFA Q;  1Q7Y T;  2IMO A;  3CIZ A;  4R0J A;  4X4N A;  1T11 A;  3IAM 9;  4USU A;  1H0H B;  1T9X A;  3N5B A;  2EFN A;  1U1O A;  3T1Y J;  4UF4 A;  3CD0 A;  3FCW A;  4ICL A;  2IYG A;  1SI9 A;  4OIX A;  1X9S A;  1UWB B;  5E3C A;  2H4Y B;  4BLG A;  1TAU A;  2RQM A;  3JQK A;  2KU7 A;  3FCH A;  2OPR A;  3RJM B;  1HFE L;  5EGY A;  2RAQ A;  1SUQ B;  5JMN A;  4NA1 A;  3U1L A;  4LVN P;  3QO9 A;  2OEL A;  4OHV A;  2AEJ A;  3L9Z A;  1RT7 B;  1N36 F;  2CQP A;  2GGP A;  2WRM A;  4DR1 F;  4C3K A;  4YB6 A;  2CPJ A;  3TAP A;  5ADZ A;  1VQS A;  3DN9 A;  1WTB A;  3MEC A;  4HI2 A;  2DNN A;  3GSI A;  1T9U A;  2MLZ A;  2OPQ B;  3QZ8 A;  5IT0 A;  3ITH B;  1VLY A;  3GPA A;  4EBC A;  4TU8 A;  4M5G A;  1QVF R;  3L4B C;  4CH1 A;  4N8N A;  4MKA A;  4DV3 F;  1QD1 A;  2HWH A;  4OX7 A;  1Y5N B;  4CLY A;  3KHL A;  3R2C J;  1XNQ J;  1X4H A;  4BDP A;  5FII A;  5KFK A;  2AGO A;  5DJB A;  1EET B;  2VFV A;  3CMA S;  4DV4 J;  2QRR A;  2DHH A;  4A8S A;  2BRK A;  3J81 U;  1RT3 A;  4FZV A;  4PWD A;  5L8R C;  1U49 A;  5CZX A;  4DPY A;  5H9F J;  1S49 A;  3U1M A;  5GVQ A;  2ALZ A;  3GWC A;  4A8W A;  3HXM A;  2DBB A;  2RHQ B;  1B64 A;  4C8Z A;  3BKU A;  4B9L A;  3ZTO A;  4LRD A;  3BSO A;  4R5P A;  2E1P A;  2Q1L A;  3SI8 A;  1X5O A;  1SC1 B;  3QRQ A;  1RHJ B;  2LXF A;  4OYZ A;  3HO1 A;  2R7W A;  4ID5 A;  3NEK A;  4F25 A;  5B09 A;  5KG4 A;  1S9G A;  2ZH1 A;  2EFQ A;  1HI1 A;  3CJS A;  2DGQ A;  5IZH A;  4P9S A;  3M2R B;  3EWG A;  3HLU A;  1T02 A;  3BQ2 A;  4J9V A;  5D4N A;  4FXW A;  1G6B A;  1B4S A;  4QWC A;  4ZVG A;  4I2Q A;  3GLJ A;  4O0I A;  1Q82 T;  4TYA A;  3C15 B;  2JC0 A;  1XJW B;  1HMV B;  2JEI A;  4K2J A;  1XMQ F;  4DPO A;  1ICE B;  2R7U A;  2ZUA A;  1QAI A;  1TL3 B;  3NS7 B;  4LF7 F;  5LJ5 Y;  2CJX B;  4B3M J;  4L73 A;  5KT4 A;  3LGN A;  3CMQ A;  3KLV A;  2E7W A;  4J9P A;  4B3R F;  1RWP B;  4DR2 J;  2IIH A;  2JC1 A;  3CSK A;  4ZJO A;  3D4J A;  3G9C A;  2FVR A;  4C8L A;  2WOM A;  1TEL A;  1SJ3 P;  2QTW A;  3GG1 A;  5AE3 A;  1M5K C;  2X3D A;  1S0O A;  3N79 A;  4NLT A;  4KHP F;  1T0T V;  2M5Y A;  1F2H A;  4J9S A;  4UST A;  2AEF A;  4UY8 T;  3R2D J;  4ZVE A;  3RGI A;  2QLF B;  3Q8R B;  2DGS A;  2AT1 B;  4X64 F;  3CB4 A;  2DO0 A;  3W9J A;  3HHN B;  4CWB A;  3W64 A;  1IN0 A;  5KG7 A;  4PXE A;  2W9C B;  2UXB F;  1I5O B;  3DRS A;  3OFE A;  5B0D A;  2V2K A;  2K2P A;  2QEX S;  4M5J A;  5B08 A;  3POT B;  1OO0 B;  1RYR A;  4DF8 A;  3Q2T C;  4LF4 F;  3VAG A;  3AD7 C;  2C3O A;  1OQ3 A;  4NXN F;  2YNH B;  5B0F A;  5L1K A;  3SV3 A;  3IS9 A;  2QA1 A;  2WW8 A;  4YB7 A;  4ZN3 A;  1GMW A;  1VQL S;  2A2D A;  4DS4 A;  3AXK A;  5CA5 A;  1RAD B;  1UAW A;  4P6Q A;  3CE8 A;  2LCW A;  2XG8 A;  1REV B;  1B7F A;  2YQ1 A;  2Y9H A;  5F41 A;  4RNO A;  1JLB A;  2BM0 A;  1IM4 A;  2YX4 A;  3H59 A;  2OD6 A;  5AT1 B;  4I69 A;  2ROE A;  2DR6 A;  2KHC A;  4ECW A;  4BS2 A;  3N6L A;  5G0R A;  2E9T A;  1GXT A;  4R8U B;  2DXF A;  3MTK A;  2UUA F;  1G3O A;  4ZLN A;  4O44 B;  2JX2 A;  2J9C A;  3MUT P;  2PI5 A;  2DR7 A;  2CDR B;  5C42 B;  4I4B A;  5T41 A;  1NEE A;  2I5J A;  3I4P A;  3TZY A;  2PFF B;  2GJF A;  3RAM A;  3GFY A;  2VB6 A;  1IKX A;  1Y11 A;  4FYW B;  2OPP B;  1KLM B;  1HNZ F;  4NLS A;  2IBK A;  4WBF A;  4K59 A;  2HZV A;  4CIO A;  3R5J B;  1MU2 B;  2KT3 A;  3RR7 A;  2WBM A;  1S79 A;  3HSJ A;  1B0P A;  2E7V A;  3G87 A;  4B3S F;  3J80 Y;  1FJG J;  4UUW A;  4F04 B;  2XCA A;  3LAM A;  3KHH A;  2B4V A;  1N0U A;  2NXN A;  1T9T A;  4J9R A;  1HBO B;  1FDA A;  4K4X A;  4FKX A;  3CDB A;  3JXO A;  5HI7 A;  2G2O A;  4S0M A;  3BR8 A;  1VCT A;  3PW5 A;  2M4M A;  3HHD A;  3SFU A;  4M94 A;  2B56 A;  3DM2 B;  1P8G A;  2E66 A;  3WHI A;  2KTQ A;  2N4D A;  3VV2 B;  5I3P A;  3L95 X;  3B54 A;  2XMV A;  1FDD A;  3NMA A;  3FRY A;  4DJB A;  3MMA B;  1A0O B;  1X0P A;  2AYG A;  2R7V A;  3CO9 A;  1CJV A;  3OTC A;  2YKN A;  3E8O A;  1QSL A;  3PCO B;  4DSF A;  1N36 J;  2B5J B;  3R27 A;  3PXG a;  1ZS6 A;  4PAB A;  2J0W A;  1RYS A;  4Y3C A;  5D3G B;  2X1A A;  4RUB A;  1ACM B;  3ICL A;  2IPO B;  3PIO Q;  2R8H A;  3PJ9 A;  1NK7 A;  1NUE A;  4LSL A;  4DV3 J;  5T7L B;  4M5N A;  3ILI A;  1AXQ A;  1FXD A;  2FLO A;  4WU3 A;  1OQ6 A;  2VFS A;  3M6X A;  2CPI A;  3AFG A;  3CCE S;  3LP1 A;  4I0W A;  2HHP A;  4PKD B;  3CJ5 A;  3PDN A;  2CQC A;  4LQ9 A;  2RHS B;  5CAB A;  1HHT P;  1NXI A;  1Z2Z A;  2E29 A;  2VU5 A;  4OLO A;  5CYM B;  3H4D A;  1DAX A;  3WC0 A;  4FBT A;  1M1H A;  3ELH A;  4DQI A;  1OSC A;  1IBL F;  2W7O A;  1HHQ A;  2J7U A;  2EI5 A;  3FK4 A;  3SZ2 A;  2XGP A;  1RBA A;  1WC6 A;  3FQL A;  5AXL A;  2JHE A;  3K59 A;  5K14 B;  1X4C A;  4DR3 J;  2J7W A;  3UDE A;  3LP0 B;  2V2Q A;  4Y00 A;  4O3R A;  3CDW A;  4I7F B;  4A47 A;  2DPI A;  1XR6 A;  3VGV A;  1HR0 F;  2W24 A;  2KT5 A;  1OPZ A;  5A6W A;  3OFG A;  1VQP S;  2D41 A;  3VGS A;  1DLO B;  1RAF B;  2XY5 A;  2W2O P;  4QWD A;  1HPZ A;  5E2Q A;  2JVR A;  2HZC A;  1F3V A;  3D3C J;  1OY8 A;  2R7X A;  3ZZ0 A;  3CIM A;  2AU0 A;  2FJA B;  3TYT A;  5ETT A;  1X0F A;  3FMW A;  2F40 A;  1U6B A;  2CZ9 A;  1U1L A;  3ILJ A;  2ZKU A;  1J5E J;  4Q0B B;  1JLA A;  5GAE U;  4LF7 J;  1K0T A;  4PXB A;  4RNF A;  3T5K A;  3EJM A;  4B3R J;  1YI2 S;  4IOC Q;  2MZR A;  4ZJQ A;  2IVM A;  5B0G A;  2HMI B;  5ETN A;  1IBM J;  1RU2 A;  4QIV A;  1AFJ A;  1JLE A;  1JLG B;  3BBF A;  5MLC V;  2NRE A;  1Z1Z A;  2EKN A;  1S6O A;  2CA9 A;  2UUB J;  2AF6 A;  4RZR A;  4QPT A;  2KO1 A;  2EK1 A;  2V68 A;  2LU1 A;  3GIK A;  1LWF B;  4HLB A;  3IRX A;  3QBC A;  3CT9 A;  2GML A;  4X64 J;  3NAH A;  2PN6 A;  4RBT A;  1CJU B;  5HAO A;  4CO1 A;  3GFH A;  1ZTT A;  1SKU B;  2R8G A;  3DU5 A;  1TUV A;  4JV5 F;  5JVH Q;  2W8K A;  3QGI A;  3SSR A;  3DOM B;  3BQ0 A;  1PJ6 A;  2UXB J;  3L7P A;  1ZYQ A;  1W26 A;  2C42 A;  3MI7 X;  2DGX A;  3PX0 A;  2CAD A;  2PD1 A;  5J2Q B;  4OZ0 A;  1VRT B;  4CLU A;  5F0U A;  1XEZ A;  4OI6 A;  4F4W A;  2AMC B;  4U95 A;  1G7C B;  2YVS A;  2F5G A;  1C1B B;  2MJU A;  5CAA A;  3RB3 A;  4NXN J;  2D3O 1;  1KHV A;  5KT2 A;  2FHM A;  1PAU B;  2J0X A;  2V69 A;  3P4U B;  1NH7 A;  1BY9 A;  1YJR A;  4MK9 A;  2UXD F;  1S1V B;  3KMS A;  4N5S A;  3P5T L;  4OFZ A;  2F8E X;  4DL6 A;  1NPR A;  1O6X A;  3I82 A;  1LV5 A;  1JX4 A;  5ETV A;  1KON A;  3Q86 A;  4A8O A;  1RCO B;  3NS6 A;  2WW4 A;  4JYA F;  4WTO B;  1EQ0 A;  2WVF A;  1MN9 A;  1S5Z A;  3FZ2 A;  1CS4 A;  4KGK A;  3TQ1 A;  3MM5 A;  2AV5 A;  1UJ5 A;  4D3H A;  4QIF A;  3BR9 A;  3N01 A;  2DO4 A;  2OPS A;  4DQP A;  4NLO A;  4UQG A;  2CNK B;  2CZ4 A;  3LOU A;  4KYZ A;  1RTH A;  1AB8 A;  3HHE A;  4I67 A;  1HNZ J;  1S6Q B;  4X4V A;  2XMW A;  3AA8 A;  3VAI A;  2WHO A;  5KFB A;  2CQ0 A;  3PEJ A;  4LR9 A;  4USW A;  2WSF C;  2HHX A;  2EW9 A;  4OYM A;  1FNX H;  8RUC A;  4USH A;  2I9S A;  3C6U B;  3ZFV A;  9RUB A;  1HNV B;  5LT5 A;  2IRX A;  5C24 A;  2AKW B;  4B3O B;  2NXU A;  2CG8 A;  5A0Y B;  2AJQ A;  4JI6 F;  1YJ7 A;  3T9N A;  2MYF A;  4A46 A;  4DZ6 A;  2XQC A;  4WJB A;  1WHW A;  3W1Y C;  3KWM A;  1NJZ A;  1IKV A;  3JYT B;  3QWU A;  4MFB B;  3TZZ A;  4FPR A;  1R6Y A;  1CUL B;  1JLQ A;  4X84 A;  5EDW A;  4RKU C;  3DLH A;  2YWE A;  1RB0 A;  3NCP A;  3MR6 A;  2VOD A;  4RW6 A;  4MKY A;  4F0M A;  1N5S A;  4PYD A;  4JI1 F;  2GIF A;  4K7Q A;  3UDL A;  1EQM A;  3NGR A;  2HW3 A;  2L3M A;  3QNW B;  4ZVS B;  1FKA F;  3CME S;  1KR4 A;  3MED B;  5D8H B;  3KK1 A;  2UVR A;  4MIB A;  4C0O C;  3MR7 A;  5D6G A;  1TVR B;  3DLE A;  3GV5 B;  1JLC A;  3HSG A;  1TZ0 A;  1U1Q A;  3SSQ A;  2FHO B;  2LA6 A;  2GS8 A;  4YP3 A;  2EC2 A;  1HWI A;  4DR4 J;  3V81 A;  3PYE A;  4OX9 F;  3W7B A;  2MQL A;  2HHS A;  5A2Q U;  2B6A B;  5KT7 A;  3FSI A;  2HQC A;  4E2F B;  2EWH A;  1X7V A;  1H6K X;  1DFD A;  3AD9 C;  2RKI A;  3H90 A;  2FZK B;  3RBE A;  4DR7 F;  5AXN A;  3CCU S;  2EK6 A;  3LAK A;  1N5T A;  4EO6 A;  1WKK A;  1OJ4 A;  2D9O A;  4RW8 B;  3GV7 B;  4WK3 A;  4UT4 A;  2W4C A;  1HR0 J;  2IJF A;  4LR7 A;  4DUZ F;  4UTG A;  5I42 B;  3BKF A;  1GT8 A;  3PTW A;  1ZH5 A;  3B4M A;  4JOU A;  1Q8K A;  1SCJ B;  4NLR A;  2ZIT A;  4HR2 A;  3NLC A;  3K5N A;  2CAJ A;  3J81 j;  1TU0 B;  3V5R A;  1URR A;  3MM9 B;  1KOH A;  2JH3 A;  1MN7 A;  2IC3 A;  5H9E K;  4F3O A;  3AT1 B;  1FRL A;  2MKI A;  4HH1 A;  1BWE A;  1TL5 A;  3KLI B;  3CC7 S;  2VA2 A;  2M2B A;  4FPI A;  1LW0 A;  4WXO A;  4F8R A;  1NK9 A;  3LGH A;  3M1V B;  4MT1 A;  1BQM A;  1PYS B;  4C8K A;  4YQW A;  2WSC C;  5AXM A;  4DQQ A;  3HJF A;  1YRT A;  3D6M B;  3LH2 S;  3CCT A;  3O2I A;  1FJ7 A;  1UEU A;  4H4K C;  1WKJ A;  3BGL A;  3MCN A;  1XMO J;  2DIU A;  5DG8 A;  2W2M P;  2DGT A;  1GH8 A;  1WNE A;  2Z8Q A;  1JWW A;  4G1Q A;  3VAK A;  2XWY A;  2ALY B;  4C97 A;  2ZH9 A;  1E6Y A;  3PW2 A;  4CLS A;  4IRK A;  3GCW P;  3EGW B;  4BCA A;  1J5O A;  2BAC A;  4K0K F;  2UP1 A;  3DGP B;  3HHL A;  3ENV A;  3ZTR A;  2QL7 B;  4DPW A;  3T3F A;  3IM8 A;  3MUR P;  1F9E B;  2D69 A;  2E9R X;  1OS5 A;  1RP5 A;  4NX9 A;  2Y1L B;  1TKX A;  1TL1 A;  2C3P A;  4PG4 A;  2V8D A;  1RHQ B;  4G1P A;  2E5I A;  2MQQ A;  1RWO B;  1BMQ B;  4CLP A;  2UXD J;  3C46 A;  5F3Z A;  4DUY J;  5KFG A;  3QIP A;  4PQU A;  3ZZT A;  2HBR B;  1LXN A;  2GJ2 A;  1WG4 A;  3KUH A;  3OTD A;  3MM7 A;  3MUV P;  3CTR A;  1RWW B;  1Y5L B;  1YX2 A;  4JV2 A;  2K3K A;  4TQS A;  1FWL A;  5H9E J;  2F9J A;  3VQS A;  3A8I A;  1CBK A;  2HLU A;  3MHY A;  2K1R A;  2ZHB A;  4JYA J;  3HUL A;  4FYX B;  4DX6 A;  4ZVO B;  2DY1 A;  4XK8 C;  1PAE X;  2MKH A;  2ZH8 A;  3TI0 A;  1WOR A;  4KH1 B;  3T6J A;  4K4W A;  4G1I A;  4QWE A;  2HAI A;  2A6M A;  3NBP A;  4KAI A;  4ZHR A;  1X5T A;  2BQ3 A;  4DS5 A;  1N33 F;  1VRQ C;  5EHH A;  4N41 A;  2OP5 A;  3N6M A;  4PEO A;  3G71 S;  5FLX Y;  2IM1 A;  2YWK A;  3D5M A;  2DNP A;  2HNZ B;  4DLG A;  1E6V A;  2CWX A;  2XSJ A;  4LIW A;  1JJH A;  5GMD A;  4IO9 Q;  1GFW B;  1XER A;  4DFP A;  4I2P B;  3E51 A;  3MWB A;  4MIW A;  3MMB A;  2VBY A;  2OTL S;  1DQ8 A;  3OLB A;  3CVK A;  3EXC X;  2CPZ A;  2ZH4 A;  2GQC A;  4JI3 F;  4FF3 A;  2DNR A;  4UOC A;  2HHW A;  5HO4 A;  4I68 A;  3MR2 A;  1NHU A;  1RT2 A;  5LM7 E;  5K8M A;  2OLW A;  4ERD A;  3KTQ A;  3DDN A;  1CEZ A;  1LWC B;  5IM0 B;  2KI2 A;  4JI6 J;  2ADB A;  1ZBT A;  1WC1 A;  1WDT A;  5BR8 J;  5EWE A;  1TQL A;  4NOH A;  1ITP A;  4E0D A;  1C1C A;  1FNM A;  3OL7 A;  4YR0 A;  4P2M A;  2W9B A;  3K57 A;  3RBX A;  4Q8E A;  2DT9 A;  3EPG A;  1SQG A;  3PJW A;  1U1M A;  4HH0 A;  3QJJ A;  1FER A;  3BPD A;  2CQD A;  5D78 A;  4F0H A;  3TQE A;  5AE2 A;  3OUY A;  3R1H A;  3P6Y C;  4A8Q A;  2DJW A;  2MQP A;  1HQ2 A;  1WF2 A;  4OZJ A;  4MK8 A;  4KBI A;  2XHW A;  3P45 B;  3KLE A;  3J7Y U;  5J2M B;  1UTA A;  3BO2 A;  3SDE B;  2KYX A;  4OMF G;  1YDL A;  2BKP A;  1QDU B;  2R2T A;  5KFY A;  1VK3 A;  3NMR A;  3NY0 A;  3H5U A;  2EG2 A;  4M5I A;  3ZZO A;  1L3U A;  3RBZ A;  2MZJ A;  2HGM A;  1PGZ A;  5BXI A;  1NPK A;  1AYE A;  4ZPW R;  2CPX A;  4N77 A;  4IDK A;  3OT9 A;  3FDS A;  1EP4 B;  3FKB A;  3BGR B;  3K5M A;  3C14 A;  4IFV B;  3KLG B;  4K4Z A;  1KQK A;  3KJF B;  2NCK L;  2VIC A;  4I1T A;  4F3M A;  4BBY A;  4PWU A;  2VPW B;  1ZA1 B;  4MKB A;  1TUG B;  4DR7 J;  3E2E A;  3ZTS A;  4PXD A;  2JNJ A;  5F8J A;  3TA1 A;  3OJU A;  1EKR A;  4AL6 A;  4NMX A;  5DET A;  1MWZ A;  1RWM B;  4ALZ A;  5B0B A;  2QL5 B;  3LGM A;  4H4M A;  3TVZ A;  5ETM A;  4GO7 X;  4RW4 A;  2V4J B;  2A0F B;  4KKO B;  1RK8 A;  2AGP A;  1WJ9 A;  3DMJ A;  4TY8 B;  2OSQ A;  2VQF F;  4PCQ A;  4RBU A;  3MTJ A;  4U8Y A;  3O5T B;  2HVI A;  1AFI A;  2XYG B;  2RNE A;  3VAH A;  2ACM A;  2DGV A;  3VVU A;  1VQ7 S;  2CZV C;  5CCL A;  1NDK A;  4DV6 F;  4QQB A;  1TV6 A;  2P2C B;  4YFU A;  3ET6 B;  1WHX A;  4ES1 A;  1B7Y B;  3QLH A;  3CCM S;  4ETZ A;  2AIR B;  1OY6 A;  3B82 A;  4DHV A;  1C0U B;  2MZS A;  2B3T B;  4NYZ A;  3DOK A;  2OFH X;  1L3S A;  2YPY A;  3CD5 A;  3PRD A;  2EEY A;  1HIY A;  3ZTQ A;  2W9A A;  1Z4U A;  3MMC A;  1JNZ B;  1YBT A;  2ILZ A;  3AQP A;  4DWI A;  2OEM A;  1SL2 A;  2BRL A;  1CVJ A;  3PYG A;  2V2Z A;  1O5J A;  3IM9 A;  2BUN A;  3IBW A;  3R7B B;  5BYQ A;  4KE5 A;  1JKH B;  2NR0 A;  2GHW A;  3PNI A;  2IMW P;  3H2V E;  2H54 B;  2CNO B;  2Q43 A;  2HS0 A;  3AH6 A;  1VQM S;  2A3J A;  5D0G A;  2WAQ D;  3CJR A;  3U27 A;  4IO1 A;  1UWB A;  4PWW A;  4F4Y A;  1T9Y A;  4ILL A;  1RA7 A;  2IBO A;  3HT0 A;  5HQ8 A;  1NHV A;  1SUQ A;  2HUR A;  1BWV A;  3HZE A;  2V50 A;  2H5I B;  1YSJ A;  3DHW C;  3EDR B;  1JJ2 R;  1HLW A;  4IFY B;  2XMU A;  5CCM A;  3G6E S;  2F1F A;  2QZ8 A;  1VIX A;  1J27 A;  4TY9 A;  5DZ7 A;  4F4Z A;  4WU2 A;  1XR5 A;  2OPQ A;  2W7A A;  2DNZ A;  1JNR B;  3ITH A;  1YJ9 S;  2UUC J;  3EZU A;  4QIG A;  3KG4 A;  3TJ9 A;  2HHU A;  5D15 A;  3G82 B;  1PKU A;  4C48 A;  1IBC B;  3KKF A;  1HYS B;  4X4Q A;  1PSD A;  2H65 B;  3IGV A;  2XEX A;  2OUG A;  3GJR B;  5H1S V;  1VRU B;  3HFZ B;  2BAN A;  1EET A;  3Q2S C;  2BVZ A;  4HHJ A;  2UUW A;  1YK9 A;  1WEX A;  3PX6 A;  2HNY B;  2VBX A;  5C25 B;  4DV2 F;  1UVI A;  3K17 A;  3QSI A;  4OX8 A;  3JTO A;  1GXU A;  1PJ5 A;  4Q43 A;  1NDC A;  3R6G B;  4NXM F;  4F7V A;  4EFA C;  1N33 J;  4GMK A;  4HT5 A;  2XCP A;  4Y2K A;  3VAJ A;  3BQ1 A;  1RLC L; 
#chains in the Genus database with same CATH homology
 1VHI A;  2YQ1 A;  4UZB A;  1B3T A;  4BLG A;  5A76 A;  2YPZ A;  4K2J A;  4UZC A;  2YPY A;  2YQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...