2YQ3A

Structure of bvdv1 envelope glycoprotein e2, ph5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
273
structure length
243
Chain Sequence
CTRETQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
molecule keywords BVDV1 E2
molecule tags Viral protein
source organism Bovine viral diarrhea virus 1
total genus 39
structure length 243
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq3A01
3.30.70.2550 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yq3A03
2YQ2A 4ILDA 2YQ3A
chains in the Genus database with same CATH superfamily
4YPGB 1MCFA 5CEZL 4M5YL 4RBVA 2UVFA 1IVTA 1NWPA 5KJ7E 3G5ZA 2Q76B 4DX6A 3DECA 1UKSA 2HHVA 3P3SA 2XXMB 1L5GA 4FF9A 1A6TA 3ZC4A 5D6CB 4AL6A 2DYPD 3A4EA 3ATDA 3MRDA 4XP6L 1IM6A 4XZUB 1TZ8A 2VL5A 2VKXA 4X4XA 5J56B 1H2TZ 3NJMA 4HUWB 5IROC 4GSDL 4FXTA 1K4CA 4KTQA 2NQPA 4POZD 2FR4A 1TO5A 4NLAA 2GHZA 1JHTA 1A4KA 2EXTA 4J9NA 1SL0A 1HOCB 1UW4A 2LEAA 3EZJB 4KKBC 2XKUA 4NQQA 3E2HB 4X4UA 1RBOB 1WUUA 4CNIB 4OIXA 1CXEA 5CSBA 5CLYA 2NY3B 3APDA 4ODUA 1F97A 3MOAL 4PGCB 3MMEA 1JJUA 2D7OA 2J6EH 5DR5H 3BIKA 5BJTB 1NUEA 1IBLF 2ADIA 2AJ4A 4RW7A 2HVKA 1KMGA 5E9NA 4F36A 1PYOB 3VG9C 2NY2C 1VGKB 3HVTA 1ASQA 1RT2A 3OLBA 1Y00A 1I9RL 3D0GE 1YEHH 4JFEE 4L3EA 1DBKL 1DLOB 5F9JB 1KOOA 4JVWA 2Y6SC 1DQ8A 3CC2S 5MENA 2YOAA 3ULHA 1T21A 1I8LA 2Q2LA 3L7EA 3ZTCC 4AIZB 4BJLA 3GR0A 4E36A 3I96A 2ZCLL 4NM8L 5J2NB 4CLTA 2FVQA 1OCWH 3T1AA 1N5YL 3UD3P 4TUOB 3JWNC 1F58H 4ZVRB 4PY8I 4U96A 4KTGA 1FSKC 3OLDA 1CR9H 1WACA 2CQVA 4DR5F 4X4YA 1HARA 2OMZA 1U3NA 2RB8A 2AV7B 3J81U 1KS2A 3SO3C 1MFAH 5KYWB 4PG8A 2VJUA 3LV3B 1RUQH 1FX4A 2H47C 1MNUH 3G86A 4N90D 3VG0L 5K39B 2K1RA 1XV8A 5DHYB 5IMLA 2JL9A 1J5OA 2RCSH 3BKYH 3TBYB 5FLVA 1B2YA 1GT8A 4PWKA 2X6UA 1G2EA 5AKVA 4NN6C 4OX9J 3Q5YA 1HKLL 5GGQL 1RAGB 3VXMD 3JVGC 4V33A 3L9RA 5FK9A 1FIEA 5ICUA 1ZLUH 5B7MA 3KLFB 1NJZA 1MHHA 1XQ4A 2QFJA 4LARL 3B2VH 2WSKA 3GGWB 5TFSL 5JQIB 4LQFH 5FGCE 3T0BA 1XMEB 2A73B 4XXDB 3AB0B 5EOCL 1O0VA 2C1PB 3IU4H 1QUNB 1IVLA 4X8GA 4DP1X 5CFAA 2EFOA 4ZSOB 3NOCA 1G6RH 1OGSA 1WISA 3NGBC 2KHAA 5T5FH 3ZUCA 1HXYA 2NUTB 1RIUH 4K0OA 5C0FA 1YX2A 3A8KA 3TIDA 5KJ4A 5IW1B 2KQNA 4YN3A 2UUBF 3BWAA 3NH7H 1G0DA 3FO2A 4C59B 2YPYA 4HLZH 4ZDHB 3WTUA 5HYJA 1D5XA 4PRBA 2YA2A 3FFCE 4UIKL 4XB8A 1PYSB 3NFNA 5FO9B 1IVZA 5ALBL 3ALXA 2UY6A 1JVLA 5I1DB 3HI6H 4JE4B 1H72C 3ZX1A 3MDJA 2FBJL 3NCYS 4M8QA 4WWKB 2Q87A 3VQTA 4DCOB 4DQQA 2MWCA 3MV8D 5AW9B 3LKRB 1R33A 3WO4B 1EHLH 1K5WA 2P5EE 5AUMB 2MMYA 1TZHA 2HRPL 2EDOA 5DHVH 3V5HB 2WYTA 1OEZW 2Y6TE 4K2JA 2O30A 1SH0A 1DBML 5CZVA 1KQSR 4PQUB 5AE2A 1YYML 1U3HD 3NIDB 1J5CA 3ESPA 2X05A 3WDHA 4J37A 4GVLA 1LGVA 3L3JA 3QGVA 4HOWA 4JPVH 2BW7A 2ZM6J 5FDYA 3T1YF 4FX5A 2VL4A 1C9SA 2CALA 2DW5A 3HZVA 5T8IA 3CVIH 2EDXA 3TGXA 2A3JA 3AH6A 2DBLL 1BD6A 2C2EA 5B7EA 2LA4A 4JKPH 1KJ2L 1DZBA 3MRCB 2Y7NA 3FQNB 3PWVA 2H5JB 1AUDA 1WQVT 3MRLB 2CA3A 5GGRY 3Q8YA 3RRGA 4I5BA 4LFHD 1JKHA 4XC1H 2CUYA 3CPWR 3MRHB 1UKTA 5I42A 3ISWA 2ZX6A 3IMQJ 2FDNA 4EO6A 2J55A 5K9KA 1MHPH 3G04B 1CURA 4ZUTA 1I7TA 2JWYA 3UVJB 3S96B 2HFNA 1VZIA 2LE9A 5EOCJ 1K85A 2FLOA 3KZ8A 2GYSA 3Q5TA 4MAYC 2I9SA 1XH1A 2FYVA 5J12C 5KAQG 2F19H 3M8PA 2VLKB 2DWEA 3CPUA 1TKXA 2WQVA 4U6VL 3ZY7A 2HLTA 1PO6A 3VFWA 4S10A 1QLNA 5KFFA 1N0XL 1JS4A 2DH7A 1A7NL 2IG2H 3EH5B 3VX1A 2MLYA 3O3UN 3C16A 3Q8RB 3HFVA 1MFEL 3WUWA 3VWJB 2PP9A 5A40E 2DQDL 3TLRA 2DKOB 3DETD 3AROA 4N1CA 2VIRA 2YKQA 3T8XB 3NIDF 2VBYA 1C5BH 4YR6B 3NXZA 1KJ3L 4LBHA 1L9MA 3VXUB 1K4DA 4RLDA 5LXRA 3WG7B 4WE1B 2ZZNA 2CG9X 3NCYP 2C4FT 3LXAA 2OR9L 3FK3A 4MBRA 1B64A 4HVBA 2K06A 1A64A 2JIXD 2E7LA 2IFFL 2JH2A 4KH0B 6FD1A 2KI2A 5FYKU 4KRPC 5FM8A 3MV7D 5G0RB 3FBKA 2F4VF 3MRIB 5EWGA 4DEPC 4OV5B 2ZH2A 4JI7J 4OHZA 4YOEA 3QEGL 1J1OH 3U1NA 3UZVA 3PWUA 5IW6A 4A7GA 1YN6A 1OCCB 5DK2A 3VTIA 2IGFL 5CGMA 2OYMA 2C42A 2WKOF 2Y06L 1USZA 4S0HA 3U0PA 3H9HB 1FRIA 2OJZL 3RGVA 2YLHA 3DMMD 3EADA 1DJYA 5GAHI 1IBZA 3FSVA 3VFUB 2K7PA 4KHXL 1IB5A 3M2VA 2DQEH 4MSWA 1SH2A 4P49A 3M1BB 3ILOA 4N2DA 1JSYA 4G6FB 1OARL 1JPTH 1Y10A 2PR4L 5DQ9B 3NAAH 4TVPL 3U2JA 3QZNA 4TUJB 4LB8A 3RGBA 1FLRH 4R4FH 2Z35B 3FO0H 1UCTA 4JQXC 2XSFA 3CEDA 4KV8B 3PW2A 1R0AB 1V55B 2R2BA 4Y4KB 4B5ZA 1ONQA 2JJVA 4GBXA 3H40A 3BZEA 3PYGA 2AXWA 5B39A 3IWLA 2HLAB 4AWJC 3IS9B 3D2WA 5E6RB 3P2BA 5L39A 4DSJA 1KGXA 3RVTD 3DSFL 1MIEH 5T5NF 5L88H 1RDRA 1DTUA 4K7FB 5DMJB 3CO9A 1QNZH 3EO1B 1KOAA 5DT1H 1I3OB 4GKZA 2QMUB 2ZJRQ 3E6FB 1ZLDA 2VABB 4WK1A 4LEOB 4JGNA 3SBMA 4G1QA 1VQ7S 1N34F 5I1HL 4RETB 3HS8A 2XGPA 3VDBA 1UB6A 4Y19D 4M48H 4Q9CA 2VM9A 2DJ4A 1ZAVA 4WFGD 4LSNA 2R56H 1FNGA 3DRTB 4W9JC 2G1HA 2TAAA 3LWMA 1XF5A 1P2CA 5LCVA 2Q6WB 3GTTA 3UR3C 5TDPB 1LQSR 1AKJD 1I3GH 2RQMA 4IR1A 1U58A 3PRVA 3CFDB 3EDKA 2B3TB 4IFVB 1QFPA 2VZ1A 2R2HB 3DDFA 3W2VA 1N0UA 3BE1L 1SJRA 4DGWC 1ZMYA 5CBEA 5GADI 3GT6A 1A3LL 1QSVA 2YQGA 5DJXA 4E41D 5A8RB 1BHGA 1FZJA 1AQKH 5CYJA 2VT0A 4M03A 1FEEA 3TBWB 3X17A 4O2CA 1H0DB 1WYJA 2XWXA 3LRSB 4HKZB 4P5RA 3CCMS 1T0TV 3MRJA 4JLRA 1YEFL 4B95C 4YE4H 5EOTB 1EJ7L 3MRPB 3O2WL 1VDGA 3QH3A 4K3DL 5CLWA 4F33A 2DLGA 1Y7PA 4LPTA 4NPKA 3GPEA 2V8DA 1NC4B 3HXMA 3QJPA 2J8SA 3X1FA 3D6TB 5I6OA 2HBZB 4QJ3B 3OD3A 4TUKL 3UG5A 2ZHOA 4ZYKA 4DHLA 2BMBA 5HY9B 1XEDA 1FL6B 3FHEA 4G7VL 3U7WH 3EUNA 3M8WA 4HUXA 3U27A 4UT7H 2RHEA 2BP5M 4AK2A 3QO1A 4HG4J 1MN4A 2V5RA 1N0LA 2B39A 4HOMA 3BAKA 4BWTA 1HQ2A 1UOWA 5DMIL 2VUKA 3E8UH 3B7SA 3WXVH 3QJRB 4NRXA 4WKZA 3ZZ1A 4EIUA 3S01A 2KFYA 3UIYA 4A39A 3SCMA 1ND0B 1R24A 2O6PA 4KKBD 4KY2A 2RHSB 3NP5A 2NYYC 4ZK8A 3CFKA 4A8OA 3ASNB 1FXRA 5LWYH 4YDKL 3OL9A 1KUMA 1Q0NA 1VGEL 3T0WA 2YKAA 4FP8L 3EDQB 2FLRT 2NY2D 5FYJH 2CE6A 3UCRA 3WJJC 4I3SH 3DTDA 43C9B 1X4HA 1JV2B 5CJQH 5CZXC 4F27A 3FCSA 2Y6SD 4JY6A 5HP5A 7FABL 5KFQA 1YQVL 3ARFB 5FYKD 4BQCA 2DEWX 9RUBA 4I2QB 2Q3PA 5EN3A 1WBZA 4XPGL 5CLZA 1AHWB 2UVVA 1Y18A 2WTFA 4B3MJ 1UASA 1ZJAA 1EO5A 3MA7B 1CDHA 1BVLB 1PKOA 2ZE0A 4YO0A 5TE6L 1AKPA 5JW5A 1CJVB 3WHE0 3BKTA 3L4ZA 1WC5A 3FOMB 3ZZYA 3BSOA 1PDKA 3VXPB 4DN4H 2HFTA 4YK4C 3IWXA 3NA9H 4XMTA 4BM7A 2F8VA 2BYCA 4MNHA 3JUZA 3WUWG 4PR5A 4ESKA 4IFYA 3MO1A 5AL8A 1TFWA 1YZZA 4FQ2L 1ICTA 4X7SH 1I82A 1X6NA 3H3PL 3NFPA 1DL7L 1MW2A 4AEHL 1TMCB 1F9FA 1I1FB 1NCGA 2SODB 1TYJA 2H0FA 2WWMD 4MMXC 5D7KE 1AS8A 2DCUB 1U6BA 1AGFA 1BQKA 4ELMB 1SEQH 2Y23A 3N41F 1D7BA 2D4FA 5BRZB 4QR0A 2H5EA 4DN9A 1KIPA 3N42B 2RT3A 4BFKA 3SKNA 3D8MA 2OK0L 3GTNA 4F8PA 5IJVA 4PJ7B 1M90T 3BISA 1XGUA 3ARBB 3DDIA 4CTAB 1FH2A 1DN0A 4UOGA 4G1MA 3T0XA 3BPCA 4WHTA 4BCAA 1E5ZA 1J5OH 2W4CA 3GR1A 1BEYL 1UCBH 3MLSL 2G3XA 3H55A 4M7LL 1TJHL 2X4SA 4PRID 2XMTA 5TDOA 5H35A 3HHDA 3BVNB 4UB0L 3OKKB 2OPPB 1NCAH 3G2XA 3W60A 2GFBB 3OJDA 3OXSA 3L5WB 5IZ7A 4JW3A 3UPRB 4HT5A 5J2MB 3JQOB 4WWOA 4X62J 5HJDA 1JGEB 4KO0A 1P9YA 3TVKA 1YC7A 2XV0A 3HG2A 1SJEB 2LGNA 2ZICA 5HHXL 3VMOA 4P4RB 4EXKA 1S1UB 5EH1A 4MA7L 4FYYB 3BIAX 1M05B 4G83A 1N5AB 2PXYA 4N2NA 2OBGA 1KPUA 2P47B 4G9DB 4WJKB 1HXMB 1Q5YA 3N9GH 2OFQA 3WDOA 2WIIB 3L08A 3BKCL 5AYUL 4CUCA 3QIUB 4JFPA 4BFNA 4Y4KC 3QFJD 4KHPJ 4KTEL 2RU3A 3T1FA 1DRZA 32C2A 3VE0A 1CLZL 4GAYB 4Z7WB 1BQMA 4CLPA 1C5DA 2EYRA 3EOBB 4L6V3 1BWEA 5JPNC 1J0JA 1FWKA 3NN8B 3NNHA 2GHVC 2DWSA 3GMLA 4NENB 3UYRH 3MOJB 4J8RA 5F1OB 5IHHA 2GITB 3BGRB 3O11A 2ITDB 1HCFX 2BIPA 3S34L 3OJUA 1A3RH 1N12A 4ALAL 4MD0B 4ELMF 3TA0A 1F3RB 3TNMA 4CNZA 1EK3A 1KCUH 2YQ2A 1LQ9A 3DU5A 5ID0A 3N42F 3QCTH 3ZO0A 2FB4H 3BMWA 3CXDL 4OGYH 2O93L 2X3GA 3VV2B 1JLEB 2OD6A 4K4YA 4A8FA 4HBCH 3SE8H 1LO0H 2ZH3A 1Z9SB 1BZ9A 2O5YL 4CL7A 5I1IL 5EZLB 2JC1A 4JV1A 1T7PA 4OZGF 2XS2A 3G6JE 4IGBB 4MDIB 3QW9A 4NE9C 3QS2A 4KTDH 3ILLA 3TP4A 1BV8A 3HI1B 1NAKH 2K3TA 4FHJA 4QJ4B 4KXDA 2HK2A 1CTNA 3B83A 4FFWC 3BWUF 4X4ZA 1IQZA 4DV0J 3X11A 1XCWA 1OLZA 1EJ6A 3STZB 3DMJA 3W61A 2B77A 3FFCD 4J12A 2XWBA 3P11H 4OCWH 2PR9A 4QRPD 1EVUA 4B9ZA 3OFFA 3FZBA 2OL3L 1NOAA 1KN4H 1MEXL 4JEGB 5JMNA 3R5DA 4KAQH 3BPOB 3MUY1 1FIGH 3O6LH 4J1UB 1G7PB 4EBQH 1A8ZA 1FFOA 5EDXA 2H51B 4H4KA 1KXHA 3CWGA 2AABH 1KLGB 2JCCB 3FCBA 3BRFA 3QWPA 2YJQA 3SYCA 3EFOB 4I18A 4Z7WF 5AXNA 4EIGB 3IAQA 2VXQH 5I17B 1E6JH 4UQ2A 4I7FB 3ARTA 1OIOA 2XHNA 1ACMB 3BBCA 2F1AA 5EORH 1NDKA 1F18A 4IG3A 1FC1A 4QIWD 4BZ2A 2AGJL 2P7TA 5CN2A 3MR2A 3M30B 4KRPD 4JPKL 4M4PA 4NRZB 4EAEA 1JCKA 4OZGE 5BYRA 4KMQA 5F3FA 3QWRD 2FJAB 3V81A 1Y3KA 4RFNB 5EBWB 3PGDA 4UTAL 2WVVA 4NZFA 1ZA1B 2NY3D 3DVIA 3A8EA 2IOOA 2VFVA 5DDOC 4ZJ9A 2JQAA 5IQ9A 4ZFFB 5HP1B 2WZAA 2PW1B 3C6LB 4Z7VB 5EX0A 1BYPA 4OVUA 4CM2A 2R4RL 5I1KH 2BX6A 1YC8A 1UB5A 3OAUH 1D9KB 2V17H 1F3JA 5EU5B 1ZOXA 3LXCA 2V69A 3FNNA 5GADU 2L7EA 3BOVA 1PQZA 4JFYA 5A8WA 4FHKA 2AQQA 3V4UL 4DGYL 5D55A 1F4WH 5C2BH 2R8SH 1TMQA 3ARFC 4YHOL 3M17A 2IAAC 2GJIA 4YAQB 1FZOA 3Q8BA 4JZOA 3MRKA 3IF1B 2VF3A 5GRJL 1AHWC 1RZ7L 4K3EH 3ENWA 5HGGS 1XMOF 4ECXA 4H88L 2HG5A 1RHQB 3N9UC 2XNRA 4FXKC 4JHWL 3U9PH 2CZ4A 1EZZB 4QXGL 4EWTA 2QR0A 4HMDA 5KZCB 3OFEA 1FJCA 5IB2A 1MWYA 3K80A 1YJNS 1AC6A 4RRPA 4ENZA 2IAMB 3SBQA 5AWNH 1VJQA 5D4QA 5FEBA 1WEJL 1XGRA 4ILLA 4RDQF 4DQAA 2VDNH 3FN0L 2JCCF 2G0CA 2IXQA 4JL1A 4ONFH 3D25A 1C0UA 1L6ZA 5BO1L 4IR9A 4DO4A 3S6EA 5DLGA 4MB3A 4XAKE 4TF4A 1RJZB 2DO0A 2KT6A 3SODB 4AW7A 2HVIA 2BVPB 4G8FB 5J6HB 1DEDA 1LK7A 1OPGH 3IR6B 1BD2E 1ZD6A 4JKLA 5EIQA 1FAIH 3EMTA 1AANA 1FNEA 2Y07L 4XVUD 5EC2A 5JXSA 1E3ZA 3KWXA 4F57H 1L3KA 5KYXA 2QTWA 2HHQA 1ZRUA 2MGZA 5INDB 1FYTB 4KI1A 4AJ0A 5IWLA 2ZWYA 5EWFA 1GYVA 3I6LD 4LLQA 1CJTB 3WL9B 3BP7A 3SBPA 2HRYA 2YNGA 3QK0A 4PWHA 3QWNA 2FEEI 1I1GA 4L4TA 3O3LA 4Z7VF 2OP4L 4QHMA 1N32F 2QIFA 4ZMLA 3QJHA 3C8KA 2LECA 2GIMA 4FLSA 4DKFL 1M7IA 3BWUC 4MFHA 4NBXB 1WC4A 5DI8B 5DJZA 2WCXA 3NACH 3WLBB 4IO1A 2VDLB 4WWKD 4ZIVA 3K3QA 1Q9KB 5JOFA 1AZBA 2GTZB 3GE9A 3F6IA 1RUML 5JDJA 3JYTA 2P24A 2Z2LA 3Q86A 4UZUA 1HQ4B 2O6DA 4GG8B 5LCVH 1EGJA 5TPWH 1WNEA 3HC4L 4BDPA 3A3NB 4FYDA 2PO6B 3PXLA 2VDOH 3O6FA 4HSQA 4LRNH 5JHDB 1J5DA 2MIZA 5D78A 4A67A 2KYZA 2NYKA 3KPSD 2DRBA 1CK0L 2AJYH 1LMIA 2WCSA 4UQCA 4V11A 4QRQA 3H54A 4BGLA 4DKAA 4AUYA 3IFEA 3T9NA 4WCYH 4KKRA 2O5DA 3DC0A 4X4PA 1AGEA 4QAMB 3MR9B 4K07A 1OE3A 1HPZB 2MJNA 2DD8H 1IBGH 3SYAA 2F9JA 3PYDA 4AKQA 5DJCA 2F54A 1CLCA 3IFNH 1TFYA 5C97A 1M7UA 5F8NA 2NYYD 5I0VA 3II2A 2X40A 2QL1A 2ALAA 3W63A 4Z7VE 1HJCA 1EO8L 4NX9A 1FERA 2IPUG 4LSSL 1EEZB 3ENEA 3EKCA 3IXTB 3CZGA 1IC4L 1UG9A 4WK2B 5FECB 3QDME 5IBTH 3QIDA 5ICYA 4PJCE 4JFTA 2DMKA 4X6CA 3EOTL 5H4ZA 5HYFA 2B9XA 2P44B 3B9KB 4LEXL 3IRPX 4LLMA 4NC2B 5AYTA 3ZZUA 1PYWB 3K6FA 2M4MA 2POKA 3OJVC 1XR6A 1RAIB 2JFDA 3FQYA 2E6JA 3V4PL 3BKJL 1FWXA 3WY3A 1H3GA 1T1ZB 3WEOA 4DEUA 1XB6A 5CGBA 3FB7A 4D8OA 1R47A 5E99H 2VMDA 5DUBA 2P5PA 5DZ7A 2VLKD 3JV4B 3CTTA 4ZO6A 1RHMB 5CJXC 1RCYA 1RBLA 4KAIA 3RWFA 3MLTA 1A9EB 3P2TA 2VB5A 1N8ZB 3JAMU 3LX9A 1G9EA 1ZVNA 3NPSB 4J9SA 1UWGH 4YUDA 3HHNB 4ECNA 5LXVA 5KFEA 3BPOC 1ORSB 4UZBA 4GMSL 5LGHH 4JO2H 3IDUA 1RIVH 3D30A 2PWGA 3OLEA 3KLVA 1R8PA 3I2CH 1KCVH 1BMGA 2NPLX 4OFYD 5LGJB 2YH1A 1B4JL 4XNMB 1JOIA 2Y7SA 3ULVL 1KTQA 3VXUD 4D3CH 4PREB 1KRPA 3UTZA 5D6DC 3EYQC 3BUQA 3FKBA 2OMWA 2MRYA 2XXCB 1RJJA 2ZDOA 3RX7A 2ZBCA 3TO2B 4S1RH 1OW0C 2KPWA 3PKMA 4M1DL 3FMBA 1FYTE 4FS0A 4Y2DC 5HI5C 2PWHA 5E1GA 3UGXA 3MJWA 2NR0A 4DK5A 1AD0B 3QEHA 4PB0L 4GAJH 3ZDZB 5I6XC 4X66J 4RFNC 2B2XL 2WP3T 5I9QB 4LRIC 1VKXA 1OOAA 1YJDL 2JKXA 2GUOA 4XN7A 5G2NA 2W2QP 2ODHA 2M2BA 3MM9B 5LJ3Y 3TR5A 2MSSA 4NJ9H 3CUPB 3IJYB 1I9IL 2H1XA 4OHXA 2CJKA 5K9FA 1VSCA 3OAYK 1B4SA 5LBGA 2N4DA 3HZEA 2D8KA 1PAMA 3KK2A 4AM0Q 1EP4B 3T4YB 2FY8A 2B1OA 2OTUB 4JO4H 1AB8A 5FGBC 5GAGU 5KOWA 1NPUA 2COQA 4G6FD 5E2QA 3PG2A 3ENVA 3FZUC 3LP0A 3OHBA 1UA6L 4JB9H 2FWUA 4WEUD 2RQ4A 2QSVA 2J7KA 2MZRA 3NAHA 3NLCA 4OFZA 1L3VA 2Q66A 4FMKA 5JHDE 1JZ8A 2CKBB 4DZ8A 1S3KH 4D94A 2VGLM 3KHLA 3OAZK 2OMXA 1U1MA 4Y4KD 4ZS6D 3IFOA 1RZJH 3VJ6A 5FKPA 4AEIL 2W7PA 1YUHB 2EE9A 4RRPG 4DVBA 2V2VA 4J9MA 5ACZA 2OXHA 2FNWA 3WTSA 3RZCA 2B1AL 3MMAA 2E27H 4YJZL 3ME0B 2ZBIA 2X2UA 1FL5B 1NAMA 1NSNH 4KXZH 3BSZA 4K5MA 1WZ1L 5HHPA 1DTQB 4CLSA 3CDGA 2NY0C 3ZMEA 5ESQB 5BXFA 5E2UL 3DRPA 4OF0A 1X5TA 5KFOA 3GRWA 1KG0B 4XOBA 1EBPA 5LM7E 5D7KD 2AX1A 1AFVL 1JK8A 3BEWB 4I3GA 5DS2A 5B0AA 4MWFA 2GCYA 3EJYC 4F2MA 2I9LB 1ODAA 2I24N 3BCFA 4JO1L 2MY8A 3CIMA 2ZPKH 1HI6A 3L7FA 3ZDZF 5FOBB 2L08A 3GUTA 5ADOL 4G71B 5J1PA 1MFDL 4JKWA 2DPIA 2IY5B 4HZLA 2VW4A 1XNRJ 3IPBA 2MY7A 5GIRB 3WFBH 2F1EA 3U9UB 1G3OA 2CYYA 1XIQA 3TA1A 1Y0LA 3LQZA 1IR2A 1PZ2A 5GHWH 4FFWD 5L9NA 1U1LA 3VXQA 3ADAC 1G4RA 3OHXC 4HXBH 4B0MB 4A7QA 2V8VA 1QBBA 2A6JB 3QXAA 5HLFA 1MVYA 5BV7H 3QORA 4G42B 2CZVC 1K1QA 3R0NA 1KCSL 5DU7A 4L5FH 2WJ5A 3A67L 3RUGA 3G3LA 1MFBL 2CUIA 3SOBL 4QHLA 1KGCE 3F04A 5D1XB 1EAPB 1S7SB 1NC4D 2H3NB 1ZLVK 3SO5A 1T20B 3PWJA 3KGRA 3UJJH 1IGMH 2MQ0A 3DV4B 4TRPL 4IQMA 5KFYA 3H2UB 3PZPA 2EAEA 3GIIA 4L2YA 4H0GA 1CGUA 2CXEA 1EZVX 1A6UH 3HPLB 1CL7I 2XN0A 3FU5A 1JNJA 1UA1A 5DJBA 1H8OA 3T2NL 3W5NA 4HIQA 2JELL 2F1FA 3CDBA 2VIHA 3ZKNC 1UZHA 2VUOA 2X9XA 1E8ZA 4YLQT 2NT0A 3ARDB 1MH5B 3HHSA 1S1VB 1QSEB 3ZDZE 3MNDA 4FTVB 3K7UA 3KM2A 1CXFA 1U8LA 5KYUA 1IC5L 1H3PH 1R89A 2K45A 4OD2B 2R2SA 5F7WC 4JZJB 4TSAL 2GVDA 2HT4D 2AC0A 1DQJB 2AQNA 3U02A 3D69A 4YDVB 3W0WD 4F9LC 2B5JB 5IV2A 4HH8A 4HIEA 2C3UA 3FCVA 3L3DB 4HUMB 1V9OA 1PD1A 3KXFB 4A55A 2CPXA 4NKQB 3BEVA 4L74A 3VRJA 1A4JB 4MCYB 3M7VA 1NJ9A 3V9FA 4G8IB 1VBYA 1UXWB 5JUMA 3X1BA 4AT1B 4M5NA 3O2VH 3PABA 2BXYA 2DB8A 5SWZA 1A4CA 2X6CA 1NGZB 3ISYA 4NWUL 1I53A 3MPYA 4GQPH 4EJ1C 4GKJF 1WOOA 1ROWA 3ARFD 5IBLC 1XMQJ 1JE6A 4HIXL 3DO7A 4ILMA 1X9QA 5DTFA 1HW8A 1Y5LB 1RTIA 4W92B 3UYPA 3NK4A 5ABZA 3S7RA 2KL6A 1YKWA 1DYZA 3ILEA 4YFEA 3J8F7 4MQTB 1DDTA 1RK7A 5DVKA 4FBUA 1EETA 3JTBA 3HZKA 3FRZA 4JUZA 5I0ZA 4ANEA 2FIUA 1NCDL 1QFWH 3NPSC 4HDGA 3QLHB 2V2XB 5JW4Q 2BABA 1G4CA 2BOBA 3D5OF 1CQKA 4XCCH 3O6ML 4XP1H 1UT1A 3SYZA 3ESNA 1HZHH 4QYZK 2D7QA 3DJRA 2CLZA 3VM5A 3W56A 2EBGA 5HVWA 5GS0C 2VH7A 3UD5A 1GC1C 1KELH 5BRZD 1XF1A 5I16B 1WTFA 3H42A 5D3GB 2MPVA 4Y4FB 3RWCA 1OS5A 5D7JC 3ROLB 3SDAC 3V7AE 2RS8A 3CLFL 2AQ1A 3UTSE 2VV5A 4CAGA 4B96A 5SUHA 2VASA 4H13C 4OJEH 1MRCL 4A7VA 4NQVB 3ARBD 2DIEA 4PSPA 1NGPL 1HVXA 5IOPA 4FDWA 4GEIA 4F4AA 3LEVL 1Q5VA 2WTRB 3PJ9A 4XWOC 1GYUA 5HJGA 1MLBA 4Z5RB 4ZA1A 1INEL 2V5YA 1I1RA 2ZUQC 2BZDA 4JVPA 1AOHA 3QXDB 2MLXA 4WGWB 1RT1A 1PLAA 1SOQA 4UDTB 4MYTA 1CFTA 3FB8B 4NZRH 5I71B 4O2FB 2HLFC 3VD3A 1NLDH 1EVTC 4NNPH 5I66B 1NEEA 4QW9A 5IT2H 1FK9A 3BFOA 3DRSB 3M9OB 1W8NA 4G6ML 4LCYB 1R0AL 1PJ6A 2OMOA 5HHQA 4X8XA 2H4YB 1FPTH 2BM3A 2WOBA 4CH0S 4FNPA 3KPMA 4FA6A 1F41A 2W59A 3FT2A 3MLWL 1HIML 1NGWA 1RISA 5MEPB 2IDLA 3GEFA 4IW4C 4U1SB 1H6EA 3WKPA 2X3DA 3PWPE 4HEPG 5AKRA 3HC0B 1MFMA 2ZCZA 1TL4A 1F6FB 1KXVC 4G5ZL 1HMVA 1GZQA 4ZBJA 3TVMB 3AGWA 4FTVE 3FEYB 2W2PP 3UAEA 1G7LA 1E5YA 1J8SA 3EOYG 4X99B 4LGPB 4XX5A 3EJCA 3E38A 1S0MA 3QFWA 1B6UA 4PV8A 3IN0A 2C9UA 5J1EB 3DUSB 5J13B 2HRGA 4E2FB 4XPTH 1L3TA 3DSNB 4M8UA 25C8H 2R2UA 4A2GA 1ZPWX 3Q44A 1LO5B 1XIWB 2Y5TA 3CD0A 3QRPA 2Z31C 3OWEA 3QDGB 5DD3H 4WUUA 4CI0B 3NP4A 4MNGA 5JJBA 2WVDA 2PWFA 1I5OB 2JLGA 4R0LB 3BAEH 3NS6A 1IEAB 1VFOA 1GOFA 3FB6B 4LL1A 4Y2OB 5A2LH 3O41A 1A7PH 1IKFH 2ADJA 3SGEI 5I76A 3FUKA 4KFZC 1MVUA 1I8MA 3M6UA 3JYBA 4MA3A 4NOFA 2Y36H 2OAUA 5F3ZA 1URLA 4OI3A 4ZVGA 4CBZA 1FE4A 3VGUA 2AHOB 4P3WA 3FU7A 3IAPA 4BC9A 3UAJC 4RISH 4ZUWB 1CPUA 4M61B 2J25A 3WYRA 2WNGA 2IDUA 1WUZA 4WNJA 4MGXA 4N1EA 1TU2B 4B3TJ 1E67A 1C1CB 5IT9U 4JUTA 5D1XC 3PL6B 4LCWA 4OGXL 1VIOA 4NNYB 4X64F 3M8SA 2DBJA 3DOIA 4IKIA 3QT5A 4C3LA 5LKNA 2FYYA 3R6LB 3FTWA 5C0IB 5TJWK 4ANCA 3HKZA 5TDNB 2FJVA 2X53A 1BF2A 1LDPL 4OB5H 4P3DA 3VGFA 2E5IA 3W39B 1EERB 3JTNA 2P26A 4BH7B 3VI3B 2BJMH 4XPAH 4Y2DD 5EWIL 4DV5J 3ARDC 4H8WH 1JYVA 1OSPH 1QWUA 4M7JH 3HHLC 1SJFA 4KK6C 3WHXB 1FLTX 2K8MA 3NTCL 1WIOA 4JKMA 1ADWA 4JGJA 4AC2A 2VDPH 4YNYA 5BW7A 4JZJC 5I8EA 4DR2F 1WC7B 2DI8A 4DPTA 3WTXA 5I74B 4GG6B 1RQ0A 3NT0A 4QQBA 1AVAA 1N5YA 4IRCA 2L04A 3EBIA 1BWVA 1S7UA 1XF4A 4B9MA 2XETA 1OVZA 5D70L 4NCAA 3LTOA 2ILYA 1RXOB 4ZN3A 4NMLA 5T3ZH 4DCJB 3Q2CA 2E5JA 5D2LB 3V79C 1XD1A 3BLKA 2BACA 4IOIA 3ZE2E 5ENWB 4X4OA 4KQ3H 5D5MB 4BKSC 4ZZFA 1ZLWH 2FX9H 2D0FA 2ZQKA 3EIFA 3TF7C 4W4MA 4NO5A 1FJGF 1GZHC 2ZKHL 4FA8A 3KOAA 2CH8A 2OSYA 1T03B 1LO2H 3CLWA 3V9CA 1KPRB 3OFGA 3SQOL 2HFSA 4AC4A 8RUCA 4FVCA 3QI9C 5KZCD 4BA0A 4WXOA 4R8WL 4RWYH 3DLJA 3POCA 4UUJB 2NUPB 4OZHA 6CGTA 1A9VA 3O3DB 2IAMD 4EZKA 3IFPA 1RSCA 2VUGA 2XHCA 4CT9A 4DQPA 5DRNA 5DMYA 3T2OA 1B4RA 3R4RA 3LN4A 4WEBH 4B9KC 3CBRA 2M9KA 3LANA 2NY0D 5DLMH 2XPYA 5D8JH 4HUVB 2BP8B 1NMCB 1FGVL 2XUWA 1UH4A 3TRGA 4HIIA 1EAQA 2R0ZL 1D9FA 1I9JL 2W9CB 1NK9A 1KFGA 5C7XH 5KJRL 4MAKA 2B7DT 5AXLA 1AXTH 3G87A 4Y4FC 3VI3F 1QLEH 4N77A 3EJYD 1W2BR 4QXWA 5A2IH 3MX0A 5TGBA 3G5VA 2R83A 4NRYA 2X38A 4PS8A 4HEMA 2J8UB 4DPOA 4P48A 3DX0A 4ZQKB 4GG6F 1BBJB 4AG4H 1XBRA 2WTPA 2K7JA 1YEDB 1UW9A 1NAMH 1MFCL 2ZOLB 3BSZH 3M46A 3U7YL 4CSSA 2LEBA 5B1BB 3BZDA 3IBOA 5EUOB 5DJ2B 2HBRB 3MEGB 5I71C 1U2RA 2Z4QA 2YD3A 5D2LF 1VQ5S 4BDVA 2DHSA 4GO8A 4D9RE 1I3RA 3CU1A 3GRWH 1LE5B 4M95A 4UNTA 5DJ0A 5FV1L 1WT5C 3ZKMC 2YRBA 3QR1A 3RWDB 3PO5A 5KBDA 3UC0L 5HPMA 2Z92B 1KJ2A 2IM1A 1DJIA 3DURB 3QEQE 1RUPH 4ZOAA 2QMKA 2Y7OA 4P57A 4YMPA 4KITB 3M6VA 1F4HA 3TEYA 1WUNT 3AU0A 1E27A 1T66C 2PO6D 4HPOH 4PJBB 2E9BA 3SE3A 1HBNA 3O8WA 1F3DH 1Q1JH 3NSYA 5JHDD 4QIGA 4DG1A 2BNUB 2IVYA 1HYRC 2VH5H 1NSAA 3FF8A 4HS3B 3V4IB 1IBMJ 3EM1A 5E2VH 2VG5B 1FZKB 3R19A 3ZKND 5T1DL 4EN3A 1F11B 1N7ML 2A4CA 5L8RC 4X6BA 4A2DA 1JHLL 4LF9F 2QC3A 2B0GA 4BFFA 4KUCF 4UUXA 1FV1A 4GG6E 5HTSA 1RT3A 3WD5L 1H5BA 3DXAA 1BQLH 4DV6F 1SZNA 2ZXGA 3I75B 3OKYA 3LW5C 5C42A 5IT0A 2YS4A 2BNRB 3PAVA 2Z8WC 3RDTA 3VA6A 3KPOB 3ISZA 4N2IA 3FN9A 3HZ3A 2F58H 5C8JA 1XIWC 3ET9F 1QA9A 5D2LE 2XWTA 3MJ8A 4N5EC 2C9PA 4F25A 2J8UF 2DQJH 3ZUNC 3QSIA 4UINH 3PRBA 4R0LC 3TEXA 5AD0A 3TFKC 4NLOA 3QQ4A 1HBUA 3DYMA 5E3AA 2EH8L 2UXDJ 1SJ3P 3A4AA 1XGPB 1U3JA 4DP6X 5C1MB 3O8XB 5EUOF 5CD4A 4A04A 3B6SB 1RKIA 3HN8A 4HT1H 1G6RB 8FABB 4LVNB 1SXCA 1JPSH 1ED3A 3U7JA 2BCMA 1KONA 2AP6A 4OI4A 3A6CH 1ZE3H 2KDYA 2OR8A 4XBGB 1TVBB 2ZKYA 4J3OH 1RTJB 3UDCA 2BERA 5E8NB 1SVBA 4G1EA 5AOLA 4FXGB 5ANME 3D67A 4OZ3A 1PBYA 3H0PA 1LO3L 2IWKA 3M8OL 1NMAH 3L1OL 1PY9A 3CCHA 4ENOA 1QHPA 3EYSL 3FF7A 3MXVL 2FZ3A 4OLVH 3STBA 3PL6C 2OFGX 1KN2L 2EIKB 4A8KA 3SGJA 2FHCA 3DOSB 4HKQA 2W94A 1AZZC 4XN2A 3UDVA 5KVGL 5DHVB 4JV2A 4NQEE 1TOXA 3KAAA 5A2CA 2LTQC 2XWZA 2ZWPA 2X4RA 4KKPA 4MJKA 5DZ6A 2Y72A 3KWWB 2J8UE 1FG2A 4AKOA 2JJSA 4M8LA 2F5BL 2VZSA 4ODVL 2DYRB 2DQFA 3VVWA 1J48A 3RL1B 5KVFL 2P3YA 4OCYL 4XWOD 2YAEA 5C6WH 4ZTPH 4KC3B 2D7TH 5I74C 3R5CA 5THWA 1S9GB 2KO1A 2A83A 3T3PB 2ZFHA 4N2BA 3V6FB 4N3UA 2QYCA 4C48A 3WC2A 5T14A 2X10A 5K20B 1KXTB 5L8KB 2EADA 2VL1A 1KACB 1U9KA 4J9LA 3FN3A 3BKFA 3QZWA 2A77L 3LZQA 2V8GA 1AHKA 4JVUA 5FUOL 2NUHA 4J3WA 4YSUA 2VAJA 1VHFA 3BH7B 3CDEA 4DSFA 2O61A 3LQVA 2ZKXA 4JM4H 3O6KL 2B4CH 2H26A 3UO0A 3NBNA 2YGQA 4ZPDA 1MKFA 1B0IA 3HS0A 5C0GB 4F2FA 5ITFB 3NIGB 2O66A 3OKOB 4BKLA 4ADJA 4XAWH 1AGDB 2MHAB 3QG7L 2OQJB 4W9LC 2CZ9A 1C08B 4YHNB 5I28A 3M4XA 4C8MA 3BPSP 5CGTA 3J2PA 3JV6A 1U4BA 1S5HB 1JZGA 4CLFA 5D7LA 3IAM9 4E8UA 1K72A 5I8KL 1WAAA 5M95B 3AAZA 4JRYE 5GGSB 3MAQA 1WTGT 3THMH 3OTOJ 1RJYB 3N44B 5LMUF 4C8XA 5KG7A 4BELD 1HH9B 2TSBA 3L4WA 4HXAL 1BP3B 3RG6A 3GP9A 1T04A 1NMCC 1Z9LA 1HL4A 4X5RA 2DXFA 2UU9J 2HGLA 3BBBA 4GS7B 4O2EA 2NS1B 5JYMA 1RPKA 4HWEL 2GT9B 2RUSA 1XZ0B 2Z31D 4QHUB 2D31B 4F2EA 1CJKB 1XXFC 2CQDA 3FZ2A 4PTTB 2Y2WA 1SDYA 3JYCA 1K8IA 4NEYA 4NEZA 1XCTA 3EE3A 4GXFA 2V7NB 3EJMA 1CS4A 4FQLL 2YOCA 3FO9A 2BINA 3HG1A 1GR7A 3ARGC 3TANA 3K5NA 4ZLPA 3T3PF 1DFDA 3SJVE 1IFRA 2LLNA 1ET7A 3QUZB 4JFDE 3I0RB 4C54A 4XE0A 4YHHF 3VAMA 2XT1B 3DHPA 2LXIA 5D1QB 2RDDA 3LQMA 4UV4L 3CB4A 1J8KA 4GVBA 4WFZA 5JOEA 2BHYA 5CUSH 3SMZA 2WLLB 3AJ7A 3V52L 5CA5A 2R1WA 3DHXA 1C5CL 2K3HA 2P46B 3X3GH 3GJTB 2YPKA 1NM9A 3QDJA 3BR8A 1VEOA 4OD1H 3UAJD 4AEFA 5F8JA 5IVNA 5DS8B 3IGAB 1G7MA 3IVKA 1UEUA 3AXMA 4UTGA 4KKOB 3WFCH 2Y8WA 1WV7T 4J3SA 1CI5A 2JKNA 5D1XD 4ZX5A 1N5VA 2R69L 3LXBA 4ECZA 1J1XH 2YAQA 3TUZC 1KV3A 2UY7B 2NZ9C 4ELVA 4DKDC 3R7BB 4AEIH 2HFEB 3A4FA 5JW4M 2VXVL 1RU1A 2JHEA 4B3RF 3Q2TC 4M5YH 4XHQA 1X4DA 2Q3AA 3DOKA 1AR1C 2ED9A 3D39B 2NRDA 4XBEL 1VFJA 3CFUA 3ARUA 3NJNA 4FZEL 1MCQA 5DK0B 1NFIB 1EHWA 2J6WA 3QIWC 5CCLA 1ZA6A 3N44F 5T1LB 3ARDD 2Q10A 1HWKA 2OXGA 4FULA 4H5SB 4PP2A 1BFSA 1QSED 4QO1A 3BDBA 7TAAA 1BE4A 4FTVD 1AS7A 4NO0A 4KK6D 2GJ6A 4XP6H 5GISL 4Z0XA 2QL7B 5GGRB 1W72L 3UDEA 1U47A 4DR4J 4Z77B 3IETB 4DSYA 1UPPA 1Z6JT 2CDRB 4Y1TA 4XTTA 4GSDH 4P5TA 2AZ1A 3QJFA 5ID1A 2COLA 1YHPA 4D9LL 3KXFD 3N1MC 1OB0A 3O45A 4YSRA 5HI7A 4F5CA 4OGAC 1N5SA 1L6XA 4LF7F 3MLUL 5GSRB 1N6UA 3MOAH 1AH1A 4MD4B 4PJ9A 1RBAA 3D4YA 43CAA 4XNQA 2YUZA 4MQ7B 3TX0A 4PJ5E 2E44A 3CV5A 2WLZA 3O8XC 1I9RH 5C09D 1GOGA 4AVIA 4Z76B 2D03L 2RDJA 3PHTA 3UI3A 1NBZB 3ECBB 3FONA 3REVA 4DUVA 4FKXA 3QI9D 5HMWA 2JMRA 2ZHBA 4QI3A 3REWA 6FDRA 5HQ8A 5CCMA 1MHEB 4NM8H 4O9HL 3TYFB 1NKBA 2P80D 3LP2A 2BVOB 1N5YH 2CDEB 2D3VA 3VWSA 1DSFL 3FUDA 4FXGC 3ELHA 4UU9B 1TL7A 1MCBA 5DC2A 1BF5A 2DM3A 4IBQA 3V0WL 2EXYC 4CC1A 5FR3A 2DCLA 5KG0A 2AMGA 3EJTA 1FESA 4XNBA 4A2MA 3GEWB 2X89A 4GKNB 2FVPA 1FE8L 3VG0H 3M8QA 5JLZB 4LSUH 4UF4A 2RMLA 4PQAA 1E40A 1QO3B 1ZHNB 5MEQA 1RLDA 4ZIWA 4X4QA 1HNVA 3WX8A 5GZOA 3NCWA 3PYCA 2VWEC 4UQIM 4Y4FD 2VFRA 1OP4A 2FGWL 4GO5X 5DRKA 3HUJF 2XYHB 1HKLH 1SVZA 4R7VA 1UYWL 5GGQH 1INQB 1PKQE 3T4AB 5ACMA 1JV5A 5AZUA 1QSFA 4V1DB 4XCYB 4DL4A 5DD1L 4CSTA 1ZAGA 4LARH 3QNXB 4D8PB 1T9WA 3ABMB 5M2PA 2ZSVA 3ZHKA 2FLNA 2X09A 5TFSH 2XNAB 4M5DA 1E28B 1JDCA 1R17A 1T2JA 5F8RC 2HZAA 2A9DA 1ZSDA 4WP3A 5EOCH 1YEEL 1SFHA 3QZWG 2CGYA 3BQUB 4EZMA 4FYSA 4KDWA 4RGOL 5LUMA 2ZZTA 2M8HA 2H0JA 4HYTB 5IUSA 1UXSA 1PJ9A 3EYFA 4HKXA 4OUOA 3ZKMD 1PVHA 2ICEC 3G5ZB 5DVMA 4PS7A 1IAIL 2WWNA 3KBPA 2AEJA 3O9WA 4UDUB 4UIKH 1DP0A 1NANI 4PS3A 4XC3L 2QLFB 1F1AA 3MUZ1 4R96A 4U31A 1E6OL 3DWTA 4FKHA 1L5GB 1A6TB 2J8HA 1MMNA 2BQ3A 1EH9A 3MRDB 2DNZA 4ZVTB 1T66D 2C4FU 2DEXX 2FBJH 1NB2A 2VL5B 4X4XB 3VWKC 2I7OA 2AF2A 4W9EC 3MRRA 3X3FL 2F1BA 2D3UA 1D6EA 1K4CB 2ED7A 4Q7DA 2WC7A 2FR4B 2PP7A 1MU2B 2HRPH 4YOKA 4F67A 1A4KB 3HUJE 1KT2A 3U6RA 3TVMD 4OSUL 2MYFA 1IEHA 4W9GC 1QBML 3BT0A 1DBMH 3T09A 1FO1A 2PCFA 5LDSA 1YYMH 3CZEA 1DARA 2WN3A 4ODUB 1R34A 4M5JA 4DU8A 4JDVA 2QG9B 1CGTA 3WI9A 2YEVB 4JPSA 2ADIB 3HVDA 2OEJA 1X9LA 3CX5J 4RW7B 1F8TH 4GS7C 2EXUA 4KJQD 1OAQL 2DBLH 2IPKA 1PD6A 4HFWA 4E5XB 3HVTB 4PUOA 1KJ2H 3MACL 4HCGA 1XIWD 5DMKA 2J6UA 4L3EB 5EULV 4P59L 3LNHA 1OSZA 3QDGD 3V6ZA 4RMQA 1TFPA 4N5ED 2Y1LB 1AW0A 1LW2A 2RJMA 3KW8A 2M5YA 3LPEA 1T21B 3L7EB 3H1ZA 3LAKA 2OL3A 4MCMA 3RX8A 4ZUUA 2VRKA 4HWBL 4B5EA 3NKYA 1GX6A 4CVZA 1TTBA 1Y6NR 3AY0A 2VE6A 4GAAA 2XFXA 4X4YB 3KDMA 3MJ7B 2OMZB 2TRYA 1MROB 2ZUTA 2JWNA 1K6QL 5D1QC 3T2LA 3KK1A 4Z6AT 2KVQE 2K1RB 3ZGHA 1OAXL 1J5OB 5IMLB 4HP5A 4LT7A 3ZLQC 4DR7F 1JWWA 5F88B 5INCA 3TEWA 2L9NA 1TK0A 2FRGP 6TAAA 1E6VA 3HT3A 2O4EA 4PBXA 3GM0A 1FFPA 1I31A 2E8ZA 1SC6A 1KCKA 3K1DA 2Y1IA 4QXTA 1K73T 4FNUA 5BZXA 4OYPA 2RQ8A 3PL6D 4U6VH 4MB5A 4FERA 4CBPA 1PZAA 4UTAA 2I26N 1MHHB 1N0XH 3LXUX 4LT6A 1A7NH 4M62L 3LNDA 1QVOA 2DR5A 3MPDA 1S46A 1F1GA 2IJNA 3VD2A 4Z7NB 5CD4H 1WDAA 2DQDH 3BSGA 2YUVA 1BQNA 3QJTB 4Y2MA 1UFGA 1HXYB 1KJ3H 5C0FB 2A18A 5L8LB 2FY1A 1EO7A 2MTPA 4YN3B 4XOAA 4LVOP 2DNHA 3VI4A 3FO2B 3HE7A 2OR9H 1U8WA 5EBLB 3M07A 5HYJB 4JMNA 4PRBB 2FO8A 2IFFH 2HWZL 4PUBL 2A7BA 1UUSA 3EDFA 1CYGA 3KPNA 3W37A 4DWHA 1HWLA 1JZDC 3RTLA 2UY6B 3MI7X 3NNAA 4J3UA 1JVOA 1PX3A 5JA8B 4M8QB 4M3HA 1BWWA 5IVZA 1IAOA 3QEGH 2X1QA 1JWUA 2WQ8A 2BFVL 1KIRB 3Q1SL 2HXAA 5B1JA 3DOLA 1TZHB 2IGFH 2Y06H 1PAUB 2OJZH 1XGYH 4JCWA 4AV4A 2W81C 4HCFA 3T0EC 4NJAL 4QJ5B 3CCUS 4Y1SA 3L4YA 2FD2A 2Z2YB 4KHXH 4HI1A 3L3JB 4PJDA 5EO1B 3KVQA 2QV6A 3BYRA 4HHJA 3QUMA 4OV1A 1ZHLB 1J1PL 1XBDA 1B3JA 2IDTA 2X7LA 4NP4L 5C07E 1N2RA 1OARH 2XA8L 3HZVB 1CSJA 2EEAA 4BWMA 2PR4H 1HNWJ 4TVPH 3BH8A 4F1ZA 3A22A 3PX0A 3T0AA 1H9DA 4RW9B 1U8HA 2UZIL 3PWVB 3CIAA 4XNXL 5DURB 4I5BB 5CMAA 1JKHB 2PMHA 3WKML 1SKSA 2OTLS 4EZ9A 5B8CB 5G55A 4RBTA 3MHZA 1NMBL 4TLRA 2NSBA 5I42B 3DSFH 4Z7NF 4ECTA 4LSVL 4GQQA 5K9KB 5I26A 2W0FA 5E0FA 5DO2C 4ZUTB 4QW8A 1I7TB 5LJ5Y 1RWNB 4USUA 2ZH4A 3T4AC 2PYED 1IAKA 1LWRA 5I8CA 2DKUA 1KF9B 1JLBA 1SVDA 4L3NA 1DDHB 5FYLE 2CGRL 2WINA 3ARGD 3MRQA 5J7CC 1KTVA 3A12A 1FVQA 3R4DA 2XBZA 2CK0L 1CGYA 2XYCA 3LQAH 1NPKA 3W9HA 3B7YA 2DWEB 1TKXB 2IAJB 3BWSA 3UEQA 5CAAA 1XMBA 2FJFA 1C8QA 3VFWB 2HFVA 5HAOA 2RQKA 2WQRA 2AIRB 3C16B 3FMWA 4S1SL 1BVZA 3BE1H 2Z0GA 4TYUA 4R9HA 4PBDA 5CLTA 3WUWB 4JR9L 1XTMA 1ETZA 3CVHL 3KJ6L 3DXSX 2XS5A 1P7KA 5K8OA 4LP8A 3RJDA 3HKFA 5KFBA 4DEZA 1U8MA 5A6MA 3L5IA 4V19J 2ZUVA 4ZCLA 1NHUA 3UPFA 1SQEA 1K4DB 2DPKA 4U1KA 5LJYH 4NLGA 3ITHA 2WXHA 5DJAA 1YEFH 3F7YA 3SDYL 3QPXL 3DNCA 4WFHE 4Z7NE 1BVKA 3O2WH 4K3DH 1AR1D 5I1CL 3BUYB 1X7TA 4HALA 4JHVA 1GGIL 1XGZA 3RHWF 1NFAA 1ZY9A 3QIWD 4ZCMA 4EI0A 5SX4H 4FA7B 4TUKH 3QUYA 3SYQA 4DV4J 1DTTA 3PWUB 4G7VH 3IXQA 1UVIA 2MKYA 1YN6B 5DK2B 3LEXA 2RKIB 2IWFA 3GSQA 3A23A 2AJ1A 1D2PA 3V4PA 5JO5B 2BNRD 1FEHA 2VDNB 2XTJE 3MVSA 4LLWA 5CN1A 5DMIH 2A2DA 3OR7A 3SKJH 1IC7L 1JF1A 3M2VB 3KPRA 5H37A 4MSWB 3L4VA 4OGAD 4P72A 2QADC 4NS0A 4F1SA 2GPZA 4H44C 1I8LC 2QDVA 3B78A 1SHMA 1TMMA 4DL2A 4FQCL 2QQLL 4EMZA 3PFEA 2HGNA 4YDKH 3RRKA 4ERDA 5B1CA 1T5WA 3WHIA 4GEJA 1JNRB 4BA8A 3IS0X 1FX2A 1VGEH 5T1KA 4FP8H 2R2BB 5BS0A 1E7VA 3O8XD 3MLXH 2V37A 4W4NA 4EDWL 4Z7OF 2KT5A 4OFDA 4GXVL 1ONQB 2EKSB 4GBXB 2PEHA 3BZEB 3KLEA 3W8GA 2VLJA 2EDJA 2K4AA 3C6UA 5B39B 4Q8FA 7FABH 2L7QA 2IA0A 1YQVH 2GSIA 5GS0L 1FTRA 4M7ZC 1GC1L 5DS1A 3DPDA 4PGZA 1CC8A 4H7VA 3CFJA 4XPGH 1BPVA 2JNJA 3SB3A 4FMVA 3L48A 3SOTA 4JDZA 2CDGA 5TE6H 4QPTA 4GKZB 1J9CT 2YAPA 1FI4A 2IANE 2EXYD 3HNSL 4G1QB 4GAGH 4MVBC 2DPJA 4D7PA 2FC9A 3BMVA 5DGRA 3MPVA 4JI8J 1UB6B 1WG1A 2PE8A 3TZWA 2F8OA 4MTPA 3SY0A 4F50A 3B37A 4S1QL 1FNGB 2YQBA 3P4LA 5DEGA 3GBML 4A2LA 1P2CB 4N8NA 4FQ2H 1ES0B 3H3PH 4ED3A 1DL7H 1C1EL 3K8VA 1XZWA 1U58B 2VDOB 1FNLA 2ADGA 3RBXA 1FUNA 2NYIA 3GJFH 4IMKA 4A7GF 3W2VB 5D2NE 4HPYL 3KMSA 1FDDA 4KYZA 1A5FL 1T1WA 4K4WA 4EUPA 1FNSH 5DJXB 3RB5A 1FZJB 3QJUB 1NICA 2OK0H 1H3TA 1MWOA 2UUAJ 4Z7OE 1A47A 2J8AA 3Q9PA 1F2HA 4QR2A 4O2CB 3EICA 2UXBF 3N6NA 2DQ6A 3D2UA 3MRJB 4JLRB 4LCIL 4O51A 2N01B 2JLPA 2E7WA 4R25A 1BEYH 3MLSH 1UOVA 4M7LH 3QH3B 4BFRA 1TJHH 1WO2A 2L3BA 2GJRA 2ZX7A 2AQTA 4EDXA 4F33B 1VYAA 3QQCD 4UB0H 1UKQA 4QHKI 2K7KA 4RMBA 5AKTA 2BA9A 4LGRB 3VTMA 3IDMA 1B3IA 4NZ0A 2KI6A 5I8OL 5IEKA 2YRZA 1Q94A 4RAVA 4Y2NA 3UGUA 3J07A 4HUXB 5CD3B 5HHXH 3FQUA 4MA7H 3VWKD 4XR8C 4MJ2A 2YKNA 1HAWA 2ARWA 4DHVA 1N0LB 2V34A 4N8PA 3HKWA 1NA8A 1FRJA 4ZT1A 1ITCA 4Y34A 4B9SA 4DV2F 1ZA2B 2GW5A 2OO4A 2XMUA 1LYQA 1BQRA 4HAFA 4NRXB 4WKZB 4QWAA 3BKCH 4W6WB 5AYUH 3C12A 1R24B 3SCMB 3D0IE 1KB5A 1KC5L 1M1SA 5JHAA 2AJVH 3QR2A 3CFKB 2V63A 1CLZH 2B1HH 1JGDA 5KBPA 3PW4A 5E1AA 5HDBB 1Q8MA 3N04A 2VPWB 2DIUA 4RAUB 4Y2LA 2XWDA 3S36L 4YXLH 3SIPB 3C09B 1BIHA 4HYKA 3EPIA 5CYMA 3FCSB 3AUVA 2BDNL 4JY6B 4ALAH 3BT2L 4NO3A 5FA4A 5FYJU 2E9GA 4AUKA 1ZETA 1NK4A 1WBZB 3L3KA 3CXDH 5IROA 4ZW7A 3SQRA 1Y18B 4HH0A 4YO0B 2V2WA 4DO6A 3K2KA 3P4NA 5IT9Y 1V7NL 4GUQA 5AKSA 1QRKA 5JW5B 2O5YH 3NSCA 5I1IH 4EMDA 4QPXA 3QUZD 1WELA 4ISVA 1PDKB 4MYWB 4JDTL 2GVZA 5CGYC 5D1QD 5L1LA 2FQQB 1SKRA 2WV3A 4L3CA 2QFIA 1W0YT 3QJJA 3E1F1 4MNHB 3M32B 4IFYB 4MJ5A 4PR5B 2XMJA 3MO1B 2XVBA 2OP5A 1CFNA 4R4ND 3C2AL 3FQ1A 2PF6A 5AL0A 1P8GA 1X4GA 5AAWA 4IDJL 5DFTA 5E4IA 1AGFB 5IW3A 3VRLE 1Q4NX 2W0KA 4GRLA 3PF2A 2E9WA 1PZBA 2RGSA 2OL3H 1B0WA 1KIPB 1MEXH 2CRMA 1RHHA 4UT4A 3BHBA 3SKNB 3JWDL 2E7LC 1ET8A 5IJVB 4X5QA 3FHQA 1TVHB 7AT1B 3D39D 1V3SA 1XGUB 5KANI 1O6VA 2PPFA 3S7GA 1RVFL 4G1MB 5T1LD 4J3XA 3BPCB 4YVNA 5JW4N 2BIOA 5IJKC 4WU3A 5HDBF 1SIWB 2X4SB 4AQZA 3KBEA 5TDOB 4WTOB 5H35B 1CT8A 4APQA 2J9DE 1OM3L 5EF0A 3OJDB 3OXSB 3CCJS 2AGJH 1UOKA 2YSTA 3RGVC 5C7PA 4KO0B 4JPKH 5IB3A 3QULA 5DQDL 5EU7E 5H37G 4L1TA 5GGUA 5C0CA 4XX1G 2YD6A 2O01C 1X6LA 1FVDA 4HWNA 2E6QA 5FGSA 4CC0A 2OLWA 5F8MA 4UTAH 3TP2A 2VR7A 4I68A 2PXYB 4PAAA 3UR0A 3UBXI 1U8QA 1KPUB 2B4UA 5IQNA 3PWNA 4UQBA 4QTHB 4WNQA 5F0WA 4FYQA 5ETQA 2VLRE 3ECQA 4RW6B 5EHFA 1SYSA 3T0ED 3U0TA 2BRKA 3RY4A 1TNNA 3T1FB 2GKIA 32C2B 3VE0B 1BQMB 4GBXC 1C5DB 2EYRB 3EGSA 1FVEB 5IREA 4Y6IA 3ILJA 4I67A 2P8MA 4X2BA 1GAFL 3GMLB 4YHOH 3Q2NA 4YB7A 4UOW1 3O11B 2BJDA 5GRJH 3MGOB 1RZ7H 3K5OA 1W0WB 4NQSA 4H88H 1XJWB 5ETOA 4JHWH 5HDBE 4QXGH 2HJFA 3TNMB 3I82A 2ZNWA 4Y8DC 5BV7B 3VNZA 3OR1A 4ZP8A 5ID0B 1HI8A 2DXEA 2DGQA 1B9ZA 2WTOA 1FNFA 3UIZA 2LQJA 2NXYC 3HA0A 3SIKA 1G5AA 1WEJH 4LFAF 1XGQA 3TX4A 3Q01A 3FUNA 1X31C 1HSAA 4OZ4A 3FN0H 2YBVA 1WS8A 5FFOA 3EVMA 4JKNA 2WYIA 1ZV5A 2E4FA 3P02A 2Z8VC 4KJYA 5DO2D 2UWEE 3U30C 1M2VA 5BO1H 2OLDA 3BRDA 35C8L 4JHZA 3SE6A 2RU9A 3CWJA 3D1QA 1CI3M 4V1DD 1TETH 1ZM3A 5F0MB 3TBCA 3J81Y 2X0WA 3C14B 4GO7X 1NCWL 4UTBL 5JNYA 3GFXA 2Y07H 3X11B 1NK7A 1JFHA 3DMJB 4JI3F 2VXTL 1U1PA 2XWBB 5EF1A 4UUWA 4LDOB 2BC4A 2C34A 3FYIB 3MLVH 4ZMQA 2UUCJ 2P9RA 4FNTA 5LDUA 4BSVA 3BQUD 3SSQA 3QIBA 3MKGA 4L4VE 1RYRA 1EQ0A 1KBPA 3MRFA 1GJIA 1D0EA 1FFOB 2VR8A 1A7RH 4OKVA 4Y7MA 1EARA 4WQOA 2OP4H 2E7HA 2QLYA 1P0SE 3PUCA 4YH6A 4DMZA 3RBDA 2J6TA 1HCYA 4P2RA 5C6PB 5FYJD 4A8QA 1OSYA 4NUMA 4F9PC 2PABA 1IBHA 4PJ8C 3D7SB 1SI9A 4KQZA 3T5HA 1TQBB 2M2DA 3T9WA 4UQ2B 4IJ3B 2DNPA 1CDGA 4FXLA 5F0PB 4IG3B 3SEOA 2XZCH 4O0NA 4DX7A 1RUMH 1O6TA 4UYPA 1S7QA 4PRPA 3VCLA 3Q43A 5F8HA 4MAYA 3HP6A 3C5XA 2MCPL 4WI0A 4HJTA 1W2IA 3KGSA 4OLWL 4BFIA 3HT0A 1ANUA 5LNDA 3H4HA 3HC4H 3DBSA 5ETUA 3EGWB 4HZAA 3SCLE 3TONA 2EFNA 3V81B 4O3RA 1KNOA 3SCMC 3PGDB 4MD5A 2BVZA 2WVVB 2ZT9C 3AWGA 5GS1A 4P74A 4CIOA 2X6BA 3KYOB 4EVNA 3SV4A 4UIMA 4LF1A 1X5FA 1OAKH 2H32H 4WFXA 4NQCA 3ZE0B 1UB5B 2Y69B 4I6YA 3NGRA 1F3JB 5EBMA 4B3RJ 1R5WB 4L3ED 5JXAL 4JFYB 2E75C 4ZFGL 3FUJA 2QADD 5MEND 5A8WB 3MEKA 2ZXBA 2Y9RT 4MXVF 4BV1A 3BZQA 3M17B 3OF6A 3NJKA 1FZOB 5HDOA 4JZOB 3DX1A 1EO8H 2FECI 3RB4A 4LSSH 1JZJA 2EEFA 3MOQA 3OLIA 4YSTA 3RJOA 2QSQA 1FA0A 2W1BA 1XTZA 2ACMA 2I7SA 4KV5F 2EFVA 3TV3L 3GSVA 3MRBB 3OTTA 2KG0A 3ECWA 3KYMB 3ABZA 3EOTH 2NW3A 5IB2B 4J39A 1XQIA 3GYXB 4LEXH 1LE9A 2EC9U 3L2LA 3VQMA 4DPWA 4HX1A 5IXUA 3LSOB 3R06B 3VR1A 2BDPA 3V4PH 3BKJH 4P9HC 3GC3A 1SUQB 3RGIA 2YPLA 4ERSL 5DZAA 4Y9FA 3ZZTA 2IXQB 4W9KC 1C0UB 1IT9L 2Q7YA 3D25B 4UQ3B 5E9DA 2X1WL 5H37H 2AEFA 2VN3A 4MVBD 5TF1L 4P73A 4AMKL 2FTRA 4Z3GA 1OP3H 5BUGA 1YGYA 1Q9WA 4OCSL 2BVQB 3D9AL 1T9YA 3PTWA 2VJVA 3RIKA 3BYTA 3DJZA 1FNEB 4X8CA 5EC2B 4DW2L 1CG2A 1WHVA 4GMSH 3B6BA 3BF4A 2CDFA 3UN5A 1CEZA 5KYXB 1AO7A 2MGZB 2A0FB 2K0RA 4YHIB 5L8JB 1X4FA 2R8HA 2WONA 2YD7A 1RZJC 4APXB 1B4JH 2ZP8A 2YNGB 3BP7B 3ULVH 4E9XA 1MAJA 3WJMA 4Y9EA 1X5KA 4L4TB 3WS6A 1GMIA 3FTYA 2OCCB 4QHMB 2HNDB 1H8NA 1ZT1A 5B21A 5HYJD 1J18A 4KV5E 3QJHB 3C8KB 4M1DH 3ZE0F 1TU0B 1WK0A 1M7IB 4X6DA 5DJZB 4CLKA 3DBXA 1MCDA 2CHXA 4NT6A 3JTOA 3UJTL 1A1NA 4F7PA 1JBJA 2XN1A 4YFLI 2JOQA 3HS9A 2YD4A 4ORZC 2B2XH 5CCKL 1LWXA 3LZOA 2H2PC 1YJDH 2PXYC 4UT9L 4ZOSA 2P24B 5HHNA 3SDCC 2B8OT 4XRCA 5JOPE 3F6JA 4XMWA 2Q9OA 1WF2A 4L05A 4P5SA 1I9IH 4OV6A 2BJEA 4ZPTA 1VGYA 1UD3A 5KT6A 3O6FB 1U1NA 4WHYG 1R43A 4XCEA 1X5PA 5MEOA 4L9LB 5KS9B 3MCMA 4OYWA 4A8MP 3MUMP 4KI5C 4U4BA 4KXAA 3P4OA 2HZHA 4Q43A 2WAQA 2CJBA 1NDTA 4QRQB 3ZK0A 2IEPA 3MNWA 4EUPH 3OMZA 1AGEB 1UA6H 1HNYA 5B0GA 1T22A 1V27A 2GEQA 3IDYB 2FAUA 3MOBL 2F54B 4NSKB 5DJCB 3MURP 3FT1A 4HPHA 4XO5A 3P3RA 1AP2B 1KEGH 1DBBL 4AQYJ 5IV3A 5DURD 2F74A 1FNOA 2GFFA 3EH4B 3VQLA 4B27A 3I5AA 3MM6A 3BO3A 1Z7JA 4IBLT 1B7FA 1S2EA 2B1AH 2DHXA 3ZE0E 4XBMA 1FQ9C 4LP5A 4QOKA 3I55S 3ZMNA 3R6GB 3WAJA 1WZ1H 4IQHA 2FJBB 4K59A 1AHMA 3PHSA 5ICYB 4X6CB 4D3HA 1O9VA 2MOGA 4G8GA 3RBSA 3WIFA 4OYIA 4LLMB 3SDDC 5E2UH 5A76A 2MB0B 3D50A 4B9GA 3V8CA 1SC3B 2CKNA 1Z9PA 3O4LA 2WB4A 1R31A 1AFVH 3KD4A 1GH8A 4I89A 2ZKUA 2HWTA 5I3PA 4QWEA 1MRFL 2PC6A 2RQEA 1G1CA 1F6TA 4JO1H 4NUGL 4AVJA 4ZVHA 3GZ7A 4PWDA 5CGYD 4U3SA 1GPOL 5EZOL 2QSCL 2VDPB 3MLTB 3RWFB 1MFDH 5ADOH 1R9FA 5IGXL 4OTXH 3CSBA 3ROOA 2BUNA 2GGPA 3B4MA 1AIFB 5J6GB 3THTA 1L9PA 5EO9A 4X5WA 4H4KC 1D3CA 4TN2A 2ZH7A 3MWBA 3RJMB 2VM3A 4HWZA 4B0MM 1PEZA 4FG0A 4TQ8A 5A2AA 2VSMB 3QJVB 5KS9F 3NAIA 3T5LA 4K5OA 5CZXA 2B7CB 4I9XA 1MFAL 1MQKL 4I18C 2Q1EA 3NRBA 5E3PA 3UTZB 4RQQA 3AS2A 2AEMA 1L7IL 2OMWB 1LV5A 1CWVA 4PI0A 2ZOMA 1BPLB 1KCSH 4Z0BL 3BKYL 1B0RB 3A67H 3HJ0A 3EGZA 1S7RA 1MFBH 5CLXA 3SOBH 1ZH5A 4X6EA 1QTMA 3TO4A 4QIFA 4P5KA 3VD1A 3HTLX 4ZD3L 3RVXC 1RZKC 4PS4H 2EDKA 4TRPH 3WN6A 4DS5A 2K70A 1K8AT 2GK0A 2JDJA 4GINA 3VGEA 4A8WA 2OX5A 3L7PA 2R9LA 4RBPH 3GMMA 5KG6A 2GUOB 2UUWA 5ETSA 2VDML 4N0FA 3F7VA 3T2NH 3HCVA 1I1YB 2JELH 2HVBA 1Z9OA 1AG6A 2X4QA 3C5JA 1C4CA 3RGVD 4WFEE 2CA4A 1TL1B 4J4PA 4QPEA 1YWXA 5C0JA 2HVEA 3RAXA 3U9WA 5FO2A 1RAHB 1IC5H 3ML8A 4MMXA 5DJDB 4EN2A 4PYDA 3FCTB 4TSAH 1YPZA 2DMGA 2G2PA 3FH8A 1GX5A 2JLFA 3I9PA 1SEBA 5EEYA 4JY5L 3NSFA 5L4JA 1QLEB 2G9HA 2BHFA 1AD9A 2OPRA 3WV0A 4DZ8B 1L9TA 2YAOA 5KS9E 2LLZA 2ZOKA 3HZMB 4FFZL 5E95B 5FKPB 4O58L 4PMFA 3VJ6B 1GXTA 3ETMA 3JSYA 4GBXD 2XPZA 7FD1A 3HG5A 5IESL 2OXHB 3RZCB 4NWUH 1NFDA 4J2XA 3N85L 1YJTA 3WAKA 4J9PA 2ATKA 2VKRA 1IBKJ 4M93C 1NAMB 3CC7S 1Z5HA 1OGAB 4HIXH 4QLRA 4MNQA 2JKIS 4FNLL 3VO0A 3OVUB 4TMPA 5BXFB 1D7FA 3EXJA 1WPCA 2CJXB 2X3BA 4GRMA 4C8YA 3DRPB 1IGIL 5DEFB 1JLAA 4DCPB 1GXUA 4P2QA 4JV5F 4AZ8A 2ZUYA 4GYBA 4HU2A 1E8XA 3UPAA 5HD8C 4F24A 4AI7A 4NLYA 4YSEA 1ZAWA 4MWFB 1NCDH 2GCYB 2FJWA 3H9SA 4OL8A 1LWJA 3MA9L 1SOXA 4AV0A 4F2MB 4CGUB 1AQHA 4AUUA 3N1GC 1R5VB 4IBVA 3D1OA 3O6MH 3L7FB 4X9HA 2HRHA 4LPVA 2X4PA 4QD2E 4WHYH 5KFCA 4HZLB 1ML0A 2IFXA 3QQXA 1U8SA 4XC1L 1H6TA 3CZNA 4UBDC 4DFKA 4J90A 4LSQL 1Y0LB 2XB2D 3LQZB 3CLFH 4HT7A 5KVMC 1CD0A 4NKOA 3VXQB 3VVUA 3SI8A 4I0WA 3VXRE 4XB7A 1MRCH 4FQHA 3QXAB 1TL5A 5HLFB 1NGPH 3MAAA 2BKPA 5LO7A 3PHAA 3H2QA 1HD1A 3LEVH 3QORB 3QZMA 5D93B 3OC5A 4CVXB 3VQSA 4ZUSA 1UKUA 1INEH 2NT1A 2ZOOA 3OLGA 5T3ZE 4QHLB 3B7UX 1TTHB 3QRGL 2UVRA 3HJVA 4HJ0D 1E90A 3PWJB 2G2OA 5J06A 4R2GB 5SZTA 1RABB 3MGTA 3O6FC 4BBYA 4OIAA 1WSRA 2ADBA 5I73C 3GJSB 3AQXA 3QZLA 3CE1A 4KRMB 4LBPA 3UP1A 2VMJA 4MH8A 4OLOA 4G6MH 1HWWA 1H73A 4KE5A 3HHSB 2ENQA 5AQ0A 4YLCA 2H3EB 3OSKA 4PD4J 2FIRT 1G6VK 5E8OA 2YBRB 1XEZA 5KYUB 3MLWH 5DZPA 1LK3L 3VFPB 3SCMD 3VXTB 1HIMH 2GVDB 1EV2E 1XN9A 3BPLB 3MYJB 2APOA 2CPJA 3UWTA 4N2LA 3D69B 5KFVA 3IK2A 1P9MA 4HIEB 5IV2B 5LL6d 3TVZA 4G5ZH 4NZDA 2X2YA 5KSBA 3TPKA 3MAHA 2U2FA 4RNNA 2QFPA 2V5MA 1IC0A 1NJ9B 5DVOA 2MPAL 5DG8A 4U8YA 2PMZA 3SPCA 3WENA 1TZAA 3TXAA 4P9MH 4HULB 2IVFB 1X5ZA 4PVMA 3PABB 4OF3A 1ETA1 2G2RA 3IJHA 5SWZB 2WOMA 4ILRA 5D71H 3OVBA 2X6AA 2EDHA 2NW2A 3CZKA 4DGUA 1SH3A 3A6BL 4LFCF 3BCDA 2LU2A 4OUUA 2FZKB 5DSCB 4CP5A 3DO7B 5DTFB 4HJJL 1VQ8S 1MG2C 1L9SA 2ZOFA 1UVQB 4QJVA 4OI9A 4U49A 4H8WC 3P77B 2VXUL 3G9AB 2R69A 2V5TA 1J9SA 4W6XB 3A3OB 4UV7L 1AAJA 2DQEL 4K0KJ 1U8IA 1EETB 2BY2A 4KXBA 3VFGL 1X9SA 4C58B 1B3TA 1DQKA 2BNQA 3ARSA 1OGAE 3B2PA 1JLQA 1YNLL 2DQUL 2H7WA 5JHLA 5GRWA 1DVXA 3L3OC 3POHA 2UZXA 1CMOA 3TPUB 2CWXA 2P28B 2X9WA 3POTA 3ABKB 2BOCA 1MPAL 2FT6A 1KVIA 3LVEA 4NWBA 4PJFA 3DRRB 1FH5L 5AVYB 2Z3FA 2QQKL 1ID5I 3P9LA 3RWCB 2E59A 2I5YL 1HTYA 2UX7A 2NPFA 3AU1A 1MIEL 4UZSA 1OO0B 3OTBA 2MDAA 3FH7A 3AY4C 3HC3L 4NUQA 2O6CA 2ZWLT 2M8XA 4NOHA 3OGOE 5DT1L 1TK5A 4OGXH 3KKFA 3NQIA 5K1VA 4BUGA 5IOPB 4FXKA 2YWEA 4Y3CA 1A21A 5CU5A 4UM9A 2ZCKL 4J3OF 1SXNA 1M7XA 1MLBB 3K1KC 1LDPH 5LXGL 1HCVA 2QPEB 2YKOA 1RT1B 3NWGA 3IRZA 4UOQA 1T1XA 4UQTA 2W91A 4OM0L 2R2EA 3LKSA 5EWIH 2AX0A 5FB8A 3P9MA 2VPXB 2E3VA 1G7QA 5J5EA 2J7UA 1FRXA 4J7CA 4PJEA 3MUVP 1DLFL 4LF6J 5IB4A 4F04B 1FK9B 1IFHL 3NTCH 4MS8C 4BXSV 1H7XA 4KNSA 1KGJA 1XH3B 4IOFC 4P2AA 4PY8J 2H2PD 1JTTA 2PXYD 4ODSL 5HHQB 1ODUA 4AE5A 3SE4A 2CG8A 5AOZA 1TZIA 3KPMB 5C2UB 5HGHA 4F92B 4LF8F 4K3HA 4O3SA 4RGMB 4PJAA 2Y24A 3O2IA 3FT2B 5D70H 2WIMA 1IBLJ 2R7XA 1NGWB 2AKRA 2UV8A 2EE3A 4KI5D 2JVRA 3WTTA 2M52A 2XMAA 1EPFA 3RZCC 2N7SA 3VXOB 1IL1A 3OKNB 1GZQB 4WRLA 5SWSE 4GW1A 3BLBA 4I88A 1NM4A 3RKPA 2NCKL 3L2MA 3QHTC 3IBCB 4H1LA 1GXLA 4G9FA 1G7LB 3BVTA 1TVRA 2EEXA 2QZ5A 2ZKHH 4U1MB 4Q2ZA 2WUBL 2DYAA 3MUGA 4MRBA 4M6NL 4PV8B 4UOHA 1FWLA 3DYAA 3SQOH 4IU2A 1I8IA 1FNAA 4KOCA 3B82A 3PGFL 1R3HA 4R8WH 4UT7L 4Y9BA 3IB4A 1EDHA 3TZVB 4NRTA 3HAEH 2Y5TB 1NCBL 4KRWA 3PJNA 5BR8F 2W9AA 4CZCA 4J8QA 4WUUB 1G84A 4MNGB 4GI6A 2YEZA 5L6YL 3BW9A 4M00A 1P27B 4HF5L 3EW3B 4FEIA 3EO0A 1RTHB 2DRDA 2I1RA 2Z8QA 2DJUA 3H0TA 2R0ZH 2HHWA 5FWRA 2WLMA 1I9JH 3O41B 4PI2A 5KJRH 3R1LA 1D09B 1HR0F 2ADJB 1MVUB 4CMMA 9CGTA 1CD1A 2VERN 1Y6KR 1Q78A 2CO6A 4MA3B 1KULA 4L8CA 4G6KL 2MQMA 1ZVSB 1RURL 2XWCA 2I32A 4JHAL 4Q52A 4EEEA 5KYYA 3MMCA 3FU7B 2CPFA 1O6SA 3FSAA 2W9DL 2VC0A 4QGTA 3RPIA 3E7JA 3QORC 3UTTA 1MLAA 3DCAA 1J5IA 3MEDA 2ITCA 4G80A 3SZ2A 1FDLL 4PPDA 1J8HA 2NX5A 3J80U 4ER8A 5ERWA 2GQ2A 4JQVC 3AT9A 2X70A 3CDZA 3GM8A 1MFCH 3SE9L 3U7YH 4LCWB 4B60A 5KUMA 2XPGB 2ZDPA 2X87A 4ICXA 1TQLA 1I1AA 1RZIA 3MRNA 4FVMA 5EU4A 2FYYB 3BP4A 2K4WA 4DN4L 4GO6B 3N40F 3CC4S 2QLBB 5HN0A 2ZOTA 1CUOA 4P3DB 3H4FA 5IEHB 2VITA 3UC0H 1NAQA 1OGTA 5KFPA 1M5HA 2AQSA 2JFCA 4TL5A 1QAJA 2GQHA 2F7QA 4J9OA 5I1GH 1JLGB 4HZ1A 4MFBB 1TV6A 4YNYB 1OT4A 4HFUH 5I8EB 1KHVA 3NCQA 2MOQA 5ECJE 3O3BA 3HFZB 3BPLC 5I1JL 1ZZNA 4HV8B 4HWBA 1N5YB 3EDDA 3NZSA 2X9ZA 4PRHB 5LSRA 1S7UB 4NLQA 2B9BA 3T1YJ 5T1DH 3MECA 4A1RA 2AQ4A 2AV5A 2Z91A 1N7MH 5DRWA 1LO4L 4F7CA 1JHLH 1QFHA 2IVFC 2FGZA 4OX9F 3PDNA 4IOIB 1S12A 4DR3J 2HFUA 1RCXB 4W4OA 3SSGA 3WD5H 1X5OA 4WSKA 3CCWA 4EGLA 1NCNA 1KTJA 5M7QA 2YPZA 2YIHA 3IMTA 4WFFD 3MN8A 5E00B 4NO5B 1SMDA 1H8SA 2ASJA 1X7QA 4R4BB 1LFWA 3CD4A 3FBQA 4Y16A 3WNJA 1ESOA 4X7DC 2X3AA 4XO3A 3KJVA 4Z23A 2AXJA 1O7VA 4OZHB 3ZSSA 1GS7A 1N36F 4LRIA 3K0JA 3IFPB 2EH8H 3U36A 3ZYOA 4E9WA 3OKLB 3IR7B 2FHFA 3ZPDA 3I9V9 4MIBA 1TR7A 1OF2A 2EWHA 3ICLA 5L1KA 2R4SL 1ROCA 2H6OA 1JGUL 1Z9MA 4QF1B 4K2XA 1FKAF 1IXKA 2K6WA 3PS6A 5F9AC 5HD8D 5DC9B 4DF4A 4YSQA 3RBEA 1M7DA 3SCIE 4NL5A 1G1OA 2DH3A 3HE6B 4NCC2 2WBRA 1FG9C 3M8OH 2IPTL 1YY9C 3KCPA 3MX0B 3L1OH 3GSNL 1NIEA 3G5VB 5TGBB 3EYSH 4NRYB 1AZUA 5TQ2L 2XY1A 1ZHBA 1KN2H 1PEWA 5CEZE 5K9OA 1R8AA 5ITHA 1K5NA 4PRDA 4EI5A 4MS6A 4TLTA 3VD7A 3UD4P 4BSWA 2BK8A 4HUUA 1SL1A 4UBDD 5KVGH 2VDRL 4L4TD 3E3QC 1YJRA 5JVHQ 4X8JA 5DF0A 3TCTA 3JAMY 2DRAA 3Q7JA 1Q8LA 2CQ3A 4HQQL 5IIEB 4QCLA 5CZVL 1DJGA 3SDEA 4BDVB 2F5BH 1CVJA 4Y2AA 2YLKA 3GB7A 1CFMA 1I3RB 4ODVH 5CBAA 5IF0A 1URRA 5DJ0B 4H2CA 2G0JA 2DL2A 4WIQA 3G82B 1UVJA 2F4VJ 1CICC 2C9AA 2H5UA 2ZP9A 4OCYH 1MCNA 4F02A 5A2QU 2LAGB 1NBCA 1KJ2B 1TTFA 2N7BA 2ZUWA 3BZ4A 1JB0C 4OYOA 2VSKB 2AD9A 1UHVA 4P57B 2BHZA 3LD8B 3HHEA 4C4WA 4RGMC 2J12B 5J11B 5DZ9A 5C6TL 1E27B 4U6YA 4K7PL 2UV8G 1HBNB 3O6FD 5DHMC 5HSPA 4OCWL 4DG1B 2RF2A 1E4XI 3QAZB 2QELA 4KVCL 3F44A 3ULUH 4OZHF 5HHOA 2DJSA 5F44A 4CLLA 4DPYA 4X9YA 5FUOH 4H1LG 4EN3B 1CQMA 2XZZA 4N0UA 4PCQA 3DJ9A 3O6KH 4X6BB 1LXMA 2F54D 4D0BA 3BVWA 5EU6E 4LCCB 1H5BB 2YWYA 3DXAB 4F15B 4PRHE 1OAZL 5C42B 3QG7H 2AVFA 1U95A 3MBWA 3RDTB 2WVFA 1HHIA 4KGVB 2RTTA 5FPIA 1OKEA 4K94C 5C8JB 2ESVA 5I8KH 2B8PA 1QA9B 2C22A 2XWTB 4JDEA 3MJ8B 5D4OA 1SPDA 4J3TA 4YHLL 4Q0BB 1A65A 3CLEH 4YBHA 3U0PB 5LLIC 2I60L 1JWSA 1WJ9A 3M2RA 2MZTA 4HXAH 4TU7A 4DL7A 4PJHA 5AD0B 1N6QL 3L16A 5IBUG 3DVNB 3QQ4B 4ZNEE 1HBUB 3IAGC 3NSXA 5DZLA 2YNFA 3ZTNH 3O1LA 3CMOL 4RNRA 4HWEH 2UYLA 2BSSB 2PI4A 4BFOA 5DZJA 4QIEA 3II1A 4YDDB 2R0LL 2EE6A 1AJ7L 2A9ML 2AERT 1WSVA 3TUJC 2GUYA 3PP3H 2OW6A 4OZHE 3ZZZA 2DDQL 3T1WA 1L5UA 4YGVA 4FQLH 1UJ3A 3Q8VA 2I85A 3FBCA 4TVAB 3VVTA 4G1EB 4N8CL 1U8NB 5HYQA 3V9EA 2Q20A 1M57B 4M9OA 5IFHL 3CCHB 1RAFB 1GS8A 2WVCA 2FZ3B 1ZIBA 3B1UA 4UANA 4ZO7A 5FW6A 4UV4H 2XY7A 1NCJA 3HNTL 4B7IA 1FL3A 2NXZB 4F8LA 2CO1A 3OKEA 3V52H 5DDQC 3IRWP 1C5CH 1XSIA 1HNXF 1OQXA 2NZIA 4ODWA 3RB0A 2DTSA 3NEXA 3PWLA 2X4RB 5EZJA 4FADA 1Q0XL 1W6WA 4FN5A 4RZRA 2BANB 2YR3A 1FG2B 2XC8A 1ETJA 2C3WA 2QGCA 2YGOA 3ZE1B 3AAWB 3QZ8A 2R69H 2I6WA 4YIQA 2GSGA 4RGNC 5E6IC 1MJUL 3O4OC 2WZ0A 2VXVH 4G7QB 5A16A 1HX0A 3RNKA 4K73A 4XBEH 5JHLH 1I6JA 4JG0L 2A83B 2BZCA 5GRUH 1S78C 2R29L 3VTTA 5GAHU 1P7QA 3SYOA 1ZTWA 4GFTB 3H5UA 5AB0A 3RIAK 1FKOA 3I31A 3NDYE 3QZWB 3N6MA 4U2ZA 5GISH 4OZFH 1ECYA 2GAZA 3L4TA 4MS8D 1W72H 4HTIA 1L0XA 5LAXA 4IOFD 1RUKH 4N4YB 4TQHA 1QRNE 2O61B 4TY9A 3K6SA 3BSNA 2YO3A 4LASL 2A5UA 5D7JA 3SDAA 1V05A 1WE5A 4D9LH 1N70A 1GYWA 4EYIB 2J0WA 3MLUH 1ZPUA 4BKLB 2CPIA 3FQWA 1J87A 1AY1H 1QI5A 1TKTA 3RZCD 3QB7C 5D7LB 4FGMA 3AAZB 4POUB 1BECA 1P6WA 4M5IA 2ETWA 1WGVA 2IMNA 4DL3A 2GIYA 3IE4A 5C08A 5TPWL 2ZXAA 3DXAE 1TL3B 1TEFA 4OGQC 4YSPA 4LPXA 3K71B 3QA3A 2D03H 4C83A 2VDOL 5ESAB 1T04B 5JIIA 4AENA 3C5ZB 1XR5A 2G5BA 4MKBA 4O2EB 3HFFA 4WEMB 5PAZA 2ARJA 1BCIA 3RR7A 2CQIA 3OT9A 2AEQL 1NOFA 3RVWC 3UDWA 4F80A 3N3EA 2V7HA 3LGMA 4LRBA 3ZE1F 2G4GA 2JJTA 4LLAA 1ADQA 3J7Z5 1K8IB 2XCMC 1XCTB 4XGZB 4ZS7L 1CS4B 2LXUA 3FO9B 4JM2A 3HG1B 4PBWD 4GUOA 1FE8H 4RWWA 4RUHA 3F58L 4WPAA 2W7OA 4AIXA 3QZBA 4LIWA 1LD9B 2VR9A 5K1JA 4X84A 5FIIA 2FGWH 2J21A 1SY6L 2HUHA 3RIAF 3BN7A 3R27A 3TU6A 4GVBB 2DR8A 4GP4B 1NIDA 4GSUA 1UYWH 1B6DA 1MJ7L 2R1WB 3OKDA 5JHBA 3EBHA 3QRLA 2QA1A 1BLNA 2YPK