2YQ3A

Structure of bvdv1 envelope glycoprotein e2, ph5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
273
structure length
243
Chain Sequence
CTRETQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
molecule tags Viral protein
molecule keywords BVDV1 E2
total genus 39
structure length 243
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq3A01
3.30.70.2550 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yq3A03
4ILDA 2YQ2A 2YQ3A
chains in the Genus database with same CATH superfamily
1G7PA 3R3TA 1MJJB 1LK3H 4DX5A 4JQVC 1EEZA 1JHTA 1BD2D 2QFPA 1JYXA 4YFLI 4PWUA 3V8CA 4Y28C 5BS0D 5EEWA 2JEGA 4CSSA 2E7DA 5K59F 3UVJB 3TVYA 1TL3B 4AQEA 1BWEA 4IU3B 2XRAL 1JZJA 1XGZA 3VXNA 1YPZA 3A67L 1MF2H 1QRKA 2G2YA 1F2QA 4IFYA 1RTHB 2DMCA 1BM7A 1T1ZB 3FU8A 1KB5B 3GRBA 2NTFB 4YE4L 3UPRA 4TQ8A 1F3RB 4AYBD 4J9LA 1E8XA 3MRHB 3HN3A 3TF7C 1YLXA 1NSKL 2UVEA 3ZZYA 5GAEI 2GK0B 1MN9A 4BCXA 4N5EC 3ELQA 2B20A 3FRUB 4XNXH 5E1HB 1NNDA 1WSVA 4RNNA 5B0CA 3A4DA 2X4NB 4TTDC 1DQDH 5TF1H 3VD2A 1U2HA 3QRBA 2DH8A 3K5LA 1S7WB 3V52H 4ZUSA 3GLZA 4P48A 3ARDB 2AVFA 4KU1A 4WHYG 5PAZA 4WU3A 2Y6SD 5K8MA 4Y2AA 4EBQL 2CXKA 2Z30B 5AKVA 2JMRA 3BDYH 2L8AA 4IM8A 2OMVB 4U1HB 3VJ6B 3EICA 4IKAA 3ZZ0A 1W72L 1RZGA 2R69A 3TWCH 1MCOH 4LU5L 4U1NA 3CX5K 1J1XH 4FL4C 2BKPA 4C8YA 4N0FB 3HAEB 4GT0A 4EJ1C 2G9KA 1B6DA 3L13A 4OLWL 2B3TB 1YJVA 1UZ6E 4L1BA 4JRXD 4Z7UE 4FBTA 1UCNA 2VL5B 1FZOB 4JMXA 3VFNA 1IAMA 1D8ZA 4AIXA 4BSVA 2DDQH 1QLFB 2DNOA 5KT7A 4KMLB 4B9PA 2NS1B 1I9JH 1PTZA 1K72A 3L3GB 4GFTB 1FE8L 4XNYH 1MCWM 1NAMH 3IFNH 2PPEA 1BVKA 3EFDH 1B4RA 1RT6A 1FL6A 5C0CB 5HGDA 3H8NA 3RVVC 1UM6H 4ACPA 3DMJB 3BKMH 4PGDB 2UY6A 1CD1B 4FYRA 2FSEB 2VDQH 3CZNA 2C3OA 4Y4FC 2AEOA 2EINB 2Y5TB 2DNKA 2E7CA 2YBRB 2P6TA 4XOBA 4WWKC 2V68A 4JHWH 3WIUA 4UBDD 4LLQB 3WQPA 3G6JA 4R0EA 4NCBA 1FXLA 1ZM4A 3QFJA 5AD0A 4RZRA 3VAKA 4R2GD 3WEOA 5I73B 1CK0L 2ZNZA 1G7IB 4HK0B 3SPVB 4HV8A 4N8OA 5DS7A 4C11B 5KN5A 1XIWD 4UMGA 4Z7OB 3GBNH 1KENH 1UJ3B 15C8L 3O3EB 2O61A 5EV7A 1QSSA 3US5A 3CDZB 3OL7A 5GGSY 2WW4A 4J90A 3LMJL 5ETPA 3HVAA 1AFVH 5A8WA 5KOWA 3QIBD 3N2JA 1GGUA 3U48A 4BFRA 5AOLA 2VC2H 1TNNA 2O5DA 2QG9B 2Y3YA 3TNMA 3CFCH 5ITFA 3BP6A 2QVTA 2YRBA 1J5DA 2O5YL 3ECWA 3C5ZB 1S4FA 4J8QA 4QHMA 3D85A 4OD3L 4YHOL 5D55A 2PYED 2WBJD 5LG1A 5DEGB 1IBCB 2QSCH 3KUHA 1KEGL 3C60B 3G87A 4BYHA 5I8CA 3QSIA 4OHVA 1XF5A 3EO0B 2VXTL 4MNQD 4OV6A 3TEHB 4I1RA 4TVSa 3WFBH 4K3HA 1C7SA 2I25N 4K2UL 3GLJA 1A9NB 2E47A 2R1YB 1S6NA 3KYKL 5E6SB 4L0PB 4QXTB 4KNTA 3DGPA 2A9ML 1U48A 1F60B 4P2QE 4ELKB 1JPFB 2BNQA 2X4UB 4GUPA 5E8DH 5A76A 5IQ7H 5F1SA 5EN3A 4GKSA 3Q8SB 5E99L 4LBEB 2O5XH 4NZ7A 1FP5A 2D2OA 5JORA 2UUWA 2P5EE 1V3KA 5LSLA 4X4YA 1KNZA 2KRBA 3BYPA 3PJSA 1RUAL 4J9MA 4OT1L 2D7NA 3NFPA 1SY6L 2KYZA 2B8OT 2DISA 3QULA 1T4WA 4LCWA 1YRKA 1QR1A 5EO9B 4DR6J 2WC7A 4F4AA 3GLAA 4CAGA 1GYCA 1FO0A 2OTUA 1EJFA 1YNTB 2NY3B 2WLMA 4I2XA 3N1PC 3ZZRA 1IL1B 4DP8X 2EVGA 1S99A 2EVHA 1CGUA 4FNUA 4ZS7H 4UQBA 3CGIA 4P2OB 1ZLSL 1FNOA 2E66A 1FZJB 4J2XA 2FGOA 1IM9A 4WY7L 1DUZB 3AD7C 2OEJA 2VQFJ 2DQTH 2O6CA 3DXAE 3LZFH 3FO2B 3T0AA 5B8CB 4F91B 1DTQA 2VKRA 4QRTB 3I6KB 3FFIA 3F7PC 3PW5A 1FUNA 4YS4A 4RBVA 4E9RA 4X2UA 1D5ZA 3AQOA 2K4AA 2MWCA 2ENYA 3OX8A 2R3VA 2F1AA 3EFFB 3V6JA 4JFZH 3SJVA 3L3DB 3QJUB 5EBLB 3QCVL 3DLEA 1KLFA 2AJUH 2FO4B 3ARQA 3DX1A 5CZKA 3TYGL 2NPIA 2PN6A 3UBXA 1SH3A 2HYMA 3GMMA 3Q6GL 3I0SA 4DZDA 2XLIA 4JFEE 5D1XE 4QOTA 3GB7B 3NMAA 1T20A 1GY1A 3M1VB 3D0LB 5K9KA 3L5XL 4FA7B 4M1CC 4D0DA 2JWNA 4FYSA 4K71C 1I8MB 4HIXH 1FX2A 2LEPA 1VS3A 2EEAA 4G5ZH 3M45A 3WS3B 1SIWB 3VG9C 5D7JA 2WZPD 5F0JB 3CVIL 2RT3A 4QHPA 1GCFA 2ICEC 4G6JL 3SKUD 2ZDPA 1E8YA 4LCWE 3PYFA 2BW5A 2NREA 4ZO6A 5FGBC 4UDUB 1H98A 2NX5B 1E43A 3GSQA 2ZF9A 4BFIB 4DR1J 4XDCA 1FV1A 5EU6B 3OLBA 3HC2A 1H0DA 1DJIA 3MLZH 4HEMA 2A9MH 4G7QB 3VXSA 4HH9B 1MCCA 2B59A 2FJHA 4PP2A 3T4YA 1KHVA 1VRUB 2WXFA 5D0RA 5GSRA 4K4XA 4DP0X 1L0XA 4B41A 3TA3D 4XXDB 3UPFA 2D41A 5IB5A 2CKBL 1XF1A 4K5SA 2BW2A 2UUCJ 4PWJA 5C07A 3B2DC 2DNHA 2ADIA 1AUDA 4JFXB 1ZWIA 1IFHH 1FK9B 3DBXB 5GS1B 1G4RA 1JLBB 3FB5A 3OTOF 4OJFH 2NNCA 1VERA 4RFOL 1XGTB 2X89A 1FNXH 2VR4A 3DJZA 3AJ7A 4QWEA 5FW7A 4LF8F 3EOYG 3MRQA 3T9WA 4ZN1A 5CGYC 3APFA 1IGYA 2V3DA 3R8QA 3VCLA 4OX9F 1RL1A 4QPXA 5E2UL 1BFVL 5D71H 1OT2A 4FFWD 2GVDA 1JCKA 4J3OC 3VU2A 2AEQL 4JPVL 3Q8FA 4L8BB 5J1SC 2IM1A 3FEXB 1HHHB 2VSMB 3P11L 1ZLEA 1NM4A 2BM3A 3UCZP 1KN6A 4JR9L 3EGXA 2O1AA 1JHLL 2ZXWB 4AEEA 4X5WA 4TF4A 1FPTH 3WNKA 5CGYD 2L7JA 1RZPA 1X5LA 1IKXB 4I64A 1IQTA 4OCXL 2J6EL 4N0UE 1FRIA 3S4SB 4X6CE 3SE9L 3T2QA 1WKJA 1MLAA 2EIDA 3BS9A 3DOLA 4QGTA 2NR6D 2NUHA 1KXQA 2UWEB 1I1YA 4PWEA 1GPOL 5FO8A 4KY1L 1ICTA 5KAKA 5SWSD 4WNQB 1ORQA 3ZDXE 4KKLD 4MZRA 3QATA 1COBA 4QR1A 3DVGA 4WDIB 2Y7LA 4M6OL 1MXDA 1MJUH 9CGTA 4NP4L 4RAVB 1SUHA 2GJIA 4NMLA 4S0TD 4XT1C 4NO5A 4M6NL 4LHUD 3AUWB 2MKIA 4PAZA 1CD8A 4K94L 2XQ0A 5FM4A 3N5AA 3SDXA 3QPXL 4KUCD 5TQ0L 4F7PB 1ONQB 5ABAA 4FXGA 3HCVB 1NCIA 4GLRH 1VYAA 2O6DA 1BREA 4OI6A 3B8YA 3RAMA 5IG7A 3LGNA 4AXJA 2QSFA 4F0KA 4Y4FA 4J9NA 2YMTA 4OI1A 1LNUA 3ALXA 3M8ZA 3K71A 4XCYB 1AQMA 1MFAL 1OGPA 4PCQA 2Q6BA 1NHUA 5DO2C 5EBGA 1UTAA 3KJQB 1YG9A 4LCUB 2HLAA 1NDPA 1T9XA 4FS1A 3MR3A 1S72S 5IT4A 4OJCA 3KGRA 4N2EA 4TUUA 3QYYA 2AJYH 4MQSB 3D3CJ 1QRND 5IR1A 1BPLB 4OFDA 2DNYA 3RKPA 1MI5A 1IC1A 4LDOB 3TASA 4ES1A 1N33J 3WMSA 4ECYA 5JR1L 3N0VA 3F6IA 3B5GA 1LDPH 5J3HD 2IIHA 4AEHL 1N3NA 2DV6A 4JVPA 4A8FA 1C08B 5EOCH 2VAJA 2WSEC 1A6WH 1MFBH 2E29A 2J6UA 3BKML 1FJGJ 5F1IB 1KYFA 4QRSA 2B0SL 5AZ2L 1SHMA 4WZ9A 4ECNA 1GQEA 1CFSB 4R6UA 1TTAA 1BMWA 1I1CA 2KQNA 3FQWA 3V0WH 2VG6B 3TA0A 4P5MB 2UXVA 3VXPB 2OJ3A 1OD7A 2Y06H 2A6OA 1TYRA 4JPKH 1FRGH 1CFBA 5L9XA 5HGDB 2XY5A 3CH1B 1G4CA 1F4XH 4U0RB 4K7FB 4PEEA 2O66A 4IRCA 2B5JB 2YBRA 4OZ3A 2AJXH 2ZM6J 5IT0A 1U1NA 3GC3A 4JPKL 4MA1C 3KLKA 3Q1EA 2L48A 5B0AA 3S34L 3MLUL 3TH3T 3QEGL 4DZBB 1BLIA 3ULUL 2UZAA 1NGWA 3RWEA 2HVEA 4BZ1L 3NIGF 2DGWA 2JRSA 2CKBA 1WKKA 5JA8B 2X6BA 3FCGA 3RBZA 3CCHA 4ZMTA 3E1F1 2N7AA 3ZKMC 5FCUH 2JK5B 1Q0NA 1MVUB 2Q86B 1SCJB 2Z0UA 2BRRL 4XP4L 4YDKL 1GRWA 4UQEA 4M5DB 2X7LA 2HT2D 2WYZA 1IBBA 4GEIA 3WY2A 2QZ8A 1I8AA 3WNJA 2F54A 1EP4B 2WQUA 2Z92A 4A38A 3C8DA 1J5OL 1UTDA 5A43C 3EM1A 5AYQA 3E6HA 3O0RH 3F56A 3RURA 5TH2A 5E7FA 1AKJB 2FBRA 1AZBA 4QHNB 5BR8F 2VDIA 5CD5D 3MBWB 1MCBA 3QAEA 3QZOA 3RZWA 5IOPB 2NT0A 4DOHE 3TVMD 3QIWA 1NPNA 1MCFA 2K7PA 1U1KA 2FNBA 1JDAA 2Y07L 1AZZC 3MV7E 5IV2B 5AXNA 4TVUA 3ZE2F 4X4QA 2OXHB 4DCPB 3L08A 4PG8A 4PWHA 5BZWB 1WS8A 2BSSB 4XBGA 1XH3B 3VGTA 4PU2A 4MVBC 4USJC 4HCFA 3VXRB 3IAQA 4FJ6A 1AZNA 4ODUA 5IEHA 5L2KD 1I1AC 1DBML 3GRWH 2AP2A 5INCB 3ULVC 5BJTA 4Z7UA 3CDWA 4Q4IA 3NS7B 3LKQB 4NZUL 1DSFH 3KL0A 4QRPA 4C56D 5FC9A 4CDGC 5EU3B 2JEIA 1MFCL 2MCAA 3SQOL 2CH8A 3U4KA 1BJ1J 4NERA 2V3FA 5LAPA 1Q9LA 2VM3A 4K5MA 4TS6A 1MU2A 5GISH 3QFHA 4Q45A 3MYZA 4A8YA 4W9FC 3ARSA 4P9HH 1L7TH 5IQ6A 3SHSA 5DTFA 3B8HA 4NLSA 1OGSA 3BWAB 3TONA 4IG3A 3SKNA 2G5RA 4PWWA 4XP9L 5A8RB 1BOGA 5JPNA 5CGBA 3D9AL 2AJXL 4GMTL 4CMMB 2X9YA 5KVFE 2Z8SA 2DIAA 1T95A 3VGUA 1Z66A 5CEYA 5DMIH 2YBGA 1UXWB 3LHPL 1S3KH 3LKSA 4OKVB 1OP3H 2AWZA 1JGEB 2V6AA 3R8YA 4I9WD 1RZQA 4OZ2A 1WT5C 2LOEA 1FX4A 1HNIA 1U25A 3HZVA 3KK1B 4DR3F 4OX9J 1YBUA 4B9LA 2RFXA 4APXA 4LPCA 4LSLA 3FF7A 5E6ID 1A6TA 3T3PB 4X9HA 3QA3A 4M5NA 3T77B 1ANUA 4K2UH 5ICYB 3I4PA 1KPRA 1QEWB 4P0DA 4GO7X 2E1AA 3PJWA 4DKDC 1L0QA 5GRVL 4BD4A 3TBYB 2MKHA 2WZ5A 4B0MB 1D9KD 2F1EA 4HPOH 5E6ZA 1T03B 1NFDB 4L8SA 4E0RA 1U8HB 4UTAA 2BY0A 5L6YH 4CVZA 1J0IA 3BGMB 1HZHH 3BT2H 3LKPB 4M7ZC 4PPTA 3RL2B 4Q9RL 1Q0XL 3DOHA 3VMNA 1CYWA 1XX9C 2VDLB 3GSOA 4KHTL 3VFPA 1MJJA 2GYSA 1T9TA 4HWNA 1QACA 4HGWB 4R5VA 2SODB 4UI2A 2XWEA 1IJFB 4Q8FA 2QRRA 4U1IA 1KQFB 1TFWA 5F6IC 3UVJA 1FORL 1KPUA 5E00A 5ENWB 2DD8H 2VQ1B 3VXNB 4HIHB 1H6TA 2DQMA 1DJSA 3CCZA 3IKCA 4KQ4H 4PVNA 4F92B 1UWGH 4FQLH 5CCJA 4NXSA 4P99A 5F7MC 1XGPB 3ILIA 2NZ9C 5IM7B 3VI3A 5KFGA 4Y7MA 3FRUA 4N2GA 1NGYB 3FO9A 4MDJB 4B3VA 1GTHA 2HFGL 3RNKB 1FFQA 3BR8A 1J48A 1JGUH 5GISL 2LR4A 3K4ZA 4LLVB 4EF3A 5IJKA 3KLFA 4JM4H 5EF1A 5AZUA 1PKUA 5SV4A 5IT2L 4UV7L 2PP7A 1KGCD 2YXLA 2RHSB 3MZGB 2WBJC 1OY8A 1E4KC 2BP8A 3SBQA 1PYSB 1NPJA 4M1KA 3SZ6A 4ZFGL 3IDUA 4YHKH 3ZJAA 1KTRL 3ZVVA 1IWGA 2F65A 1TOXA 2C7UB 2HJLB 3MTXA 3HAEA 2EIEA 4XMUA 4MS6A 1WELA 4FS2A 2C3VA 3O3AB 5IVXF 3V5KB 4OZJA 1WZ1H 5IBTL 2VUYA 3IRCA 1VQ5S 2IALB 4GIPD 3GIZL 4TLSA 1J1PH 4N86A 1SHXA 3JQOB 5FHAL 3AOAA 3L2MA 1DBAH 2E6QA 1T03H 3SXLA 4MCYA 1AD0A 1OF0A 1X5AA 2HFTA 3EOBA 3MRBA 3N44F 4FADA 2NUUG 4ZFOA 1HINL 1AQKL 1P7KB 1T5KA 4ICWA 4IS6B 1Y00A 1WEYA 3TA3B 1QVGR 3IMRA 5F96H 5L2JB 4I0KA 4P72A 2JQMA 5DMKB 3VAIA 1RJYB 3K8VA 2R7TA 5LVEA 3X1LB 4DK6A 3UCUP 1N0XL 4NSKA 3JWDC 4WTZA 4WWKD 3QJZA 1P2CB 1EZSA 1M7XA 1TQVA 2BFVH 3VI3E 1WWHA 3Q2LA 4PV9A 4MYWB 4CVXA 1KWGA 1O6SA 3WYRA 3US0A 1MRFL 1LFPA 3L5WA 5DRZB 2M7SA 4PJGF 5B4MD 1FFRA 2GI0A 4JCMA 4CN4A 2UP1A 3KLHC 3FZUD 1ZA1B 3KK2A 1A9BA 1C16B 1U8QA 2A10A 1WCQA 2RALA 1RISA 1PJ5A 2XCAA 3BVUA 3EJYD 2QQKH 4YLQT 2DI7A 1CJYA 1H38A 3VWJB 4XCEB 3EF4A 7AT1B 4H8WH 5HHOE 1FE8H 2A77L 4XNYL 1HPZB 1OQ6A 5JO5A 1MSWD 1MLBB 1QVOA 3B7SA 1TQLA 2UWEE 1AOZA 3ISZA 3PDNA 2KHCA 1NMAL 5CJQH 3VI3F 1JLEB 2AJ2A 3H8YA 3CPLB 5KG6A 2CPCA 2XKNB 4LVHC 3B43A 1UXLA 1BZQK 3MR9B 3U9UA 5C0NC 4GKZA 4CILA 3ZYIA 4FPRA 4JPVH 5I74C 3GJFB 3DLBA 4NLDA 4JYAF 4TLQA 4GAFB 4PRHE 5DK2B 2PWGA 4NZ8A 3THTA 1K8IA 3P6YC 3KYMB 2A73A 3HSZA 1T05B 1CF8L 4BSWB 2B9WA 4O5LH 5ICXB 3HLUA 2WQ8A 1NBZA 4HGKC 1NUEA 3NFNB 4JPWL 1YEHL 4FTVB 1JZDC 3CUPB 4KBPA 4WO4C 1KB5H 2QSTA 5E1AB 3ZRSA 4I1PA 1S9EB 1XNQF 2VDRB 5I0ZA 1NH6A 4PJXE 1XBDA 3N04A 1Y10A 3I87A 3RIAF 1C1EL 3ARGD 5D7KD 4A7SA 4MA3B 1OSYA 3I6PA 2X4OA 2JKJA 5A0YB 1ZSDA 3FNKA 5I6XC 2ZOTA 3PJSB 2BX5A 2K8QA 1X6NA 4KJPC 5K1VA 5LT5A 4NQEE 5E0FA 4ZFZA 3R5JB 5CUSL 5DUMH 1P5VB 5B8CC 3KVQA 4U31A 2XV3A 5MI0C 1H3PH 2BS8A 5IQLA 2GQCA 2QA1A 2O6EA 3MGOA 1J05B 2A4CA 4U6YB 4G5AA 4X80H 5AG9A 4S11A 1VPOH 1ZHNB 3P4OB 4EDWH 5E2WL 3AU0A 5HYJA 2I60L 3TVKA 2GBUA 1FZJA 1FVEA 4BFFA 3CCHB 4WGVB 3TUJC 3R0MA 4L9LB 4LFHG 3CG8A 2XKSA 3GMPB 5GSVB 5KAQG 3BN7A 1AZUA 1TK5A 5JYMA 3HZKB 4KHPF 4RGOL 1YN6A 1UA1A 3M8QA 1PAEX 2WUBH 3CMOH 3D39B 4LOFA 5KW9L 1E6OH 2DMGA 3MDJA 3QI9D 4PG2A 1UH4A 3RFZB 5J6GA 3CW2C 1FJCA 2ZUXA 2HHHJ 1FORH 5E1GA 4ZW8A 2DWEA 2ADJB 3VM5A 3BM7A 4JFYA 1CLOH 1OM3L 1KTKE 2GGPB 2W2QP 5KFSA 4HIIA 3R9LA 1AKJA 5DEJA 1P6TA 1IRAY 2EFOA 1INQB 5HPMA 5E2QA 4JI5F 3AQZA 1FHNA 2KVIA 4H0HB 4F24A 3L6FB 3QIUB 3UACA 3V7AE 5E94A 3M30A 1IEHA 4J27A 2MLXA 2NY5H 4EI2A 5CD5C 1RUMH 2YJQA 4ISVA 2HJFB 1XL6A 2B1HL 1DQLL 4U1KB 4Z7OE 1ILUA 3L8QA 4B3MF 2XPGA 3BESR 4IRJD 3BP4B 2DQTL 3LZFL 5JYLA 4XGZA 1TJIH 4F80A 2KXHA 2OO4A 3T6BA 5E7BA 1JXKA 3A67H 4XN7A 2V2KA 2B6AB 1QI4A 2YGOA 3T0EA 1FWLA 1EZUA 3RDTC 3AXMA 3WFCL 4LBIA 4RW4A 1ZPWX 1IQWH 2OR7A 3KYNA 4YB7A 2VC2L 1IGTB 2V5HG 3BSOA 3TUZC 2DRBA 4E2OA 5LB1A 1ZK5A 3WDHA 3V5DB 2NXEA 4RMQA 5AOKA 4D9RD 4QR2A 4XI5D 2DYAA 4HFUH 2DIUA 4J4PD 5I1DA 3I85A 4ECVA 1R5WA 3ZT7A 3DRTA 4OYMA 2ENSA 5DJ8A 4AGPA 1UA6H 1MCIA 2ZE2B 3LPEA 5GMKa 3NUKA 4YEAA 5HLFB 2JEFA 4PBVC 4P05A 3MAWA 2BVYA 2OZ4L 4MTMA 1JK8B 1G1YA 3L95A 1TJHL 4L05A 4PH8A 1H15B 1OPGL 1ZT7B 5F7NC 2IA0A 2JFKA 2QO3A 5C0EB 3TBTB 2NY6B 4TQHA 3O5TB 3AB0B 5DK3A 2R2HB 3UAEA 4MCNA 1OQXA 5D8JL 5T3XL 2PTVA 2VMDA 3UO1H 3TEZA 3W0WD 1OPGH 1ZS8A 1II4E 1JSYA 2H2SC 4P5SA 4W6WB 4NQUA 3VJ6A 5HVWA 2GX8A 4GKJJ 3A4AA 1GS6X 3NGUA 4YK4B 2FD6H 4LLYB 3X17A 4AENB 5LOQA 3V4VA 3MUVP 3KK1A 4UT9A 3FSWA 3NSCA 3FHQA 5DJZB 2JJSA 1NH7A 1RLBA 3L4TA 3L3HB 3I2CL 1WD6A 1BF2A 3OPZL 4XTRC 4IBUA 1REGX 1MHHB 3CDCA 1DQKA 3QQ9C 4JKMA 4KQ4L 4YXKH 5SUHA 5L4MA 4A67A 3QZPA 4Y4HD 2B43A 3IAM9 3T0EE 1ETZB 2WOBA 3OJVC 4P2RA 4WI2A 1LTXA 2R4SL 1FNSH 2QE5A 3ECBB 3TP4A 1QFWI 3C5ZD 1N48A 1UB5B 4XOAA 3BQUC 1TEYA 1T9YA 2M9KA 4Z3TA 2BIOA 3DURB 3L2LA 3MLSL 3MEKA 2D7TL 5IREA 4JI7J 2D8KA 2VBWA 4NLYA 1AG0A 5DJ6B 1L5UA 2W9CB 1JLGB 1E50A 3FTWA 3MHZA 4HCGA 3LHAA 3S35H 3BSHA 4RAVA 3BGFC 1BA9A 3DKDA 5FYJH 4PG6A 1SL1A 2CWKA 2IJFA 1EFXA 2NNAB 3IFPA 4ZZFA 5KFDA 5IV3A 1N6UA 1PX8A 4PLJC 5HSFA 4OIIH 1N5VA 3CDBA 4RW9B 3SQGB 4N0CC 3B7RL 4K94C 3RGVD 1IQDA 4AQYJ 5F9OH 2DQIL 1YEHH 3NJXA 4JI3J 5DQIA 2DY2A 4M8QB 4UQAA 1KELH 3VXMD 4YR0A 1NCCH 4WE1A 2J8AA 3L3IB 3PCYA 2NXZD 1Y07A 4JM2C 5EOQH 3UC0L 3K17A 2WZAA 4UT4A 2ATLA 1T3NA 1FA0A 4YBLC 4GBXB 1K4DB 4GG6E 5H1SV 4MD0B 2G9OA 4KKOA 4MIBA 3KLFB 3KG4A 3CVIH 2VIHA 1CU4H 4N0YL 2G13A 5HHXL 3GHEH 2UV8G 5JXED 2J73A 2ZFHA 1P4UA 3TP2A 1YHPA 4Y4KA 2O6FA 1ZM9A 4XNQA 2P5VA 3TZVB 1FG9C 4XMZA 4WWID 4AEFA 3X12B 4RJVA 4PXDA 1WEJH 2E7BA 3GKWL 5EIIG 4AYEC 4WKZB 4PKDB 4PGZA 4IO1A 4HZLB 4Q4EA 4NXMF 3Q1SH 5GMEA 3RVXD 1AI1L 5A2CA 3MLRH 3L7EB 1CYGA 3GSUA 4MQ7A 5D1ZC 4MCYB 2NUPB 3KG5A 4QHKI 1LDPL 4F57H 5D78A 4GKSB 3KG0A 3RJOA 1MRDH 4WI0B 2FHJD 2W4PA 1X0FA 4BELD 2RH0A 1MCQA 2OTLS 3UTPE 3ENAA 2GHWB 4ALAC 4DT2A 1S7RA 4L75A 5LMNJ 4N24A 5L8RC 1SF5A 4U1SA 3VH8B 1LK7A 2P6SA 2HW3A 1B3JA 2C7FA 2Q7YB 1XBWA 1XNRF 1F3JB 3HKZA 4HJIA 4TLTA 2P80A 4PB0H 1IGFL 2OTUB 2GS8A 2F7QA 2HX8A 4GO8A 3CMES 1T80A 1AFVL 1TV6B 1X7VA 3UJIL 3JTPA 3UAJD 3KEDA 2GTQA 3BEWA 3ZW3A 4YFDB 1W0VB 1OS5A 1PX4A 3CWGA 2NZ4A 1OGAD 3FC8A 3R06A 2YC1A 3TAMB 2NY2C 5EPMA 3JTSB 3ZKND 3UOAB 4J9QA 3HDSA 3W37A 1Q9WA 1A7PL 4TKWA 2Q8AH 3X11A 1PYTA 2F74A 3P9LA 5IFAL 3MFHA 1FJ7A 2HNDB 2EH7L 5C0CE 4A2EA 1WOPA 1PX3A 1S7SA 2BRRH 1A2YA 4XP4H 4OF3A 5B38G 3D67A 4CO0A 3EPIA 4X6FA 1IKYA 1T6VN 4QRUA 3WN6A 3NGTA 3DSNA 3K5OA 2ZTBA 2ZOOA 5T5NF 3H5UA 3NKYA 4RGND 3MNVA 3MRLA 3HEIB 4L4TB 5FA4A 2QL9B 5KFOA 3KLGB 1VZIA 4N1CA 3GV8B 3TM6A 1GXTA 2PA3A 1RAJA 5KFAA 5KFRA 2D3JA 1KWMA 5FJ4A 1A4KA 4ZYKB 2V7NB 3WLWD 4FBUA 5HHXH 2IM2A 5KFWA 4J9RA 4MMZB 2R4RH 4K7QA 3RPIB 2YUWA 2V17H 3OPKA 1DVFC 4Y88A 1KB9J 2HRPH 3US9A 3TFBA 4HKBB 5JMNA 4DQSA 3GS0A 4Z7WF 2FVRA 1WEXA 3DX6A 2J44A 1A1MA 2LV4A 4M43H 3QCTH 1T1XB 4NPYA 4X5RA 2WUCL 5HI5D 5INCA 4ZFQA 5LCVA 4HS8H 1Q8LA 3OJ2C 3AMKA 4MASA 3GS4A 3IF1A 2PTTA 3CCWA 1N32J 2Z8RA 1A7NH 4FQPA 2BW7A 2G3XA 5HVFB 4CO5A 1TR7A 1FRLA 3U1QA 3ASNB 3SFGA 1RAIB 2BBEA 3C19A 1G9ML 2ESVD 3IXTB 3HUJE 1SEBA 1T2XA 2XTJD 3P3RA 2CBOA 1DFBH 4HC1L 3TJEL 5FXCH 4DXLA 4YQWA 1J8RA 4FJZA 2ZWSA 5HGAB 4UTGA 2R7SA 1KB9K 1BP3B 2CCVA 5IHWA 4OZLA 5IBLC 2ZVIA 1RUML 4QO1B 1J8HB 1BOGB 2F53A 3MJ7A 5FYJE 1YIJS 3OZLA 4XHJC 2B15A 3EIFA 3KJVB 4DGIL 4OR1A 4JGMA 1B0GB 5TDOA 2UYLA 3H40A 3EDEA 4ODXB 1MREL 3W5YA 1M7DB 2B1AL 2APXA 1YNKH 2OI9B 2LQJA 5IVZB 3S5LG 2DWEB 4JM0A 3WU1A 3C5SB 1EMTL 5M7QA 2OK0H 4HWBA 5GJSH 4EN3C 3FNNA 5J9PB 4NYZA 3V4MA 4KTQA 4X6BA 4LVNC 4V33A 3W3BA 5EN2B 1E3FA 4W9IC 3VD9A 1HHHA 2Q8BH 2GSMB 5H9FK 3CFUA 5ERWB 1NICA 2WTFA 3EFOA 4K15A 1S1UA 3H5YA 2LQ9A 3THPA 4ONHA 4S0HA 2H65B 5ITBL 2BP3A 4ISVB 1N68A 4OCWH 3LYRA 4PJIE 4DN9A 4OVUA 1OK0A 2H9GB 3BGMA 4N68A 3VQ1C 3EJQA 5KJRH 1WC5A 4HUUA 4KRLB 3LN5B 3HPOA 2D7QA 4B9NA 5GZOA 1USQA 1WZLA 4KPHH 5I1EL 1S0OA 3FT4A 3Q48A 1HW8A 2J8UA 3LNHA 3WFBL 2FJBB 2EZ0D 4OD2B 1WK0A 4B5ZA 1SHSA 2WLIB 1SF3A 2IDUA 3CQFA 3RI5F 5ES4B 4CJ1A 2M2DA 1QASA 3K6SA 4NJ9H 4TU8A 4M6MH 3HC3H 4JVUA 4QRQA 4OIXA 4Z7IA 4LQFL 4JFFB 3BPDA 4FMFA 1M5PC 3RB0A 5DZJA 1OO2A 3MHYA 3B9KB 3W63A 4XCCL 3RIFK 2R56L 4A7GA 2J5LC 3HR5B 3C6LD 3QDME 3QISA 3S0PA 3VD0A 3H2PA 1XMBA 3OG6B 1YJUA 4UBDC 3PHTA 1FCGA 2V9QA 1EHLL 4JI4F 2CHXA 4OZNA 1NGYA 3F85A 5I71B 1DJYA 3QUMA 2J0SD 1GMEA 1BY9A 2CVIA 1LEKA 3BJLA 4Z8FH 4B9JA 1HSAB 1FAIL 4DQOH 1EKRA 1KJVB 4F8LA 2CQ2A 5EF3A 2QHRH 1OSZA 4FQHB 1XF2B 4R2GB 1NOFA 3I2CH 1D7FA 1T22A 3FCSA 2PIIA 3LH2S 3CULA 3S37H 2YLHA 5GGQL 3VTAA 4QYOA 1CDJA 4J5VA 2H45A 3VRLE 3EYZA 4PD4J 3N06B 3THML 2WBRA 5KSUA 2NXYC 3DUUB 3MRNB 2XNAA 3ROOA 4F27A 3SPIA 3V5KA 2IYGA 1CD9B 3KGUA 4A47A 4UV7H 2VPYB 3B82A 4WZMA 4CDHA 1QHQA 3QQNA 3IFLH 2DQIH 1FDAA 1G0YR 1DLFH 5E6UB 1YY8B 1FO0L 2OR9L 2V4RA 3ALWA 1F97A 1GPOH 4RMTA 4QRSB 4K59A 4PJEB 2ZNWA 5E8NB 1CBVH 2C8NA 3HFFA 3PR4A 2Q8AL 5C3LD 2CO6A 5DJ2A 1BW8A 3P73B 5FYJL 3QEGH 2WLNA 2OZNA 3Q86A 4OGZA 3TZYA 4PTTA 3SBWA 1QZ1A 5CCHE 5KT6A 2P8PB 3CFKA 5E9AA 2XWCA 5K9FA 2Y36L 2D3VA 5E8EA 4KUCF 1WAAA 4HUNB 1OGTA 2KKQA 3BZDA 2N3LA 4OYZA 4A2MA 1UFGA 1X5OA 3SY0B 4UQ3A 1HWHB 5DHXB 4DEPC 4LHJB 1S6OA 1NBCA 1ZSHA 1S1XA 4YB6A 3GXDA 4GRLC 4L73A 4R5XA 1HI6B 3P77A 4Z7VF 3KEHA 3IC1A 5FHAH 3ULVH 4JAMA 1TCRB 4AQOA 2AERT 2KT3A 2XVBA 4YHPB 3F12B 3ESNA 5EO0B 3CJ5A 3HBGA 4FYQA 2H8PA 4CW1A 1NDMB 1KTDB 5DVLA 5E03A 3MJGX 1XERA 5BZXA 3KPSA 1CGXA 4B97A 1F9EB 3CJTA 1PAZA 2XN0A 4BFOA 1QX1A 5JZ7C 3QIBB 5F3ZA 3ZQWA 2EDKA 4FQXC 4NPKA 3BVVA 2DHGA 2X1AA 4OHYA 4HKJB 4EDXB 4MKTA 2VDQL 4CIOA 4U9RA 2ZUVA 1VQ6S 2ADGB 1YEJH 4YXHH 5HYQB 3ARFD 2BXJA 4XCNA 2BIQA 1JV2B 3OB8A 4ZO7A 5HYJD 3VGEA 4PI2A 3CVKA 3CTRA 4OQTH 4KX7A 1CXLA 3OAZK 2EO7A 2N01B 4ODWB 1H3XA 3GZPA 2HT4C 4UUJB 3KWVA 4MWFA 5GRVK 5ID1B 2DQGL 2VDQB 3WDIA 3U25A 3UJJL 3HZGA 4IHOA 2LXFA 3H5SA 4DUWA 4HZLA 2BJMH 2PF6A 5DVPA 5C0JA 2QV2A 4XBGB 1JXVA 1FFNB 5C08D 1RT5A 1WFMA 2KLSA 3Q83A 5ETRA 1YKWA 3NCQA 5K9QG 5DZVA 2NNFA 4I69A 2WCGA 4MD5A 4IQXA 3ECVA 2VV5A 4WFFD 3ZTSA 2ZIDA 1HWKA 1ZJBA 2JCCB 4D9RE 1A66A 4G8GB 1S6PB 1P84K 3FT3B 1KR4A 4Z7VE 4KRPC 4TULH 3MUGA 1D5IH 4MXWL 1WG4A 4B3TF 5HPOA 5F7YC 4PIRF 3FXIC 1TTBA 43CAB 4KI5D 5DJXA 1VQSA 3ZE0F 2YGQA 5I15H 5C0GB 1X60A 1QUNA 1NMBL 4FHKA 2ICCA 2OL3L 5D6DA 3WHXA 4YC2B 1YUHA 4YGVB 2NY4D 2YPKB 4JM2B 2UXGA 3L09A 4CQ1A 1BVOA 4AT1B 3UYPB 2FUG9 3D7SB 1U41A 4PGCA 5DJCA 2P24A 4WUKL 4GC7A 1QD0A 2X1FA 3BH8B 2WSCC 2D3O1 4K3DH 2DR8A 2XNRA 1A1NB 4JDVB 1NLDL 3BD3A 4CNIB 5F7WC 2OGUA 3T2PA 2Q7NA 4BBYA 3RUGB 1RTIA 2YWGA 1IC4H 3SJVD 4LRIC 1AGBA 1KBRA 1KP6A 2M83A 4R5PB 3C2AL 4QYZK 1MDTA 4HISA 4L4VD 4P2MA 1RH8A 3MI6A 4L8CB 1TMJA 3DX8A 2YPYA 3L48A 3B2UC 3H3BC 1KNOA 3HG2A 4IW4C 3ZTJG 4WTXA 1MFMA 2YMOA 3O4LD 4RGOH 2IPUG 1ZAXA 4WENB 2JKIS 2OPSA 4PRFA 3ZKXC 3L6FA 1AGFA 1SFHA 3QIUA 1QBML 3PQYD 1QQDA 4ED0A 1KN4H 2RUGA 3CF5Q 2G3ZA 2VABA 1XGRA 4FMKA 2DGSA 4B53A 4UT6L 4HHGA 3SCMA 4N1HB 3TBYA 3OKMB 1D6EB 2IRUA 3MREA 5T3ZE 3E01A 1XSIA 4MAYA 3H2QA 1RU2A 2AKRA 2QN6B 1LE9A 3D0VB 1HBMB 3ABKB 2AQSA 4FQJL 4MJIE 3VFWB 4L3NA 4E2FB 2V5SA 3WXVL 3R0NA 3ZMRA 2I07A 4G6AD 4HLBA 1X4YA 4Y9FA 4B3MJ 1EKSA 5BQDA 4G80A 4NO2A 2PO6B 1KLUB 2G4GA 2HS3A 2OXGA 3EDJA 3CWJA 2ROYA 2N7YA 3UGUA 2FVQA 4U1IB 2AMCB 1YMMD 4MQXD 1TYJA 4PVBA 1NK7A 4XPAH 4ICXA 2NXYB 5MI0B 5E7OB 1NDCA 2IY5B 4C4KT 1A0QH 2XTLA 4FZEL 1NOAA 3TTYA 4LRBA 4KH2A 1FIGL 1GW6A 1FGVL 5AZEL 2PXYD 2OPCA 4ERSL 1RXOB 2ZDOA 4CO3A 2X1QA 3D7PA 1IU1A 2C26A 2JXMA 3HLKA 5I1DB 2V4QA 1RZMA 4R2GC 3JWOL 4I0PB 3UJIH 4DKAA 3DOMB 2ZE2A 5I28A 1H3DA 3NFSH 2ZPKH 1EEUA 2DKUA 3HFMH 1CDHA 3Q6FA 1VDHA 5J56B 1AW0A 1UT1A 3BPCA 1IE5A 5DDHA 3TJPA 1AB8A 1S3KL 3W60A 2PCFB 2KT6A 3NAHA 5ETOA 4X8GA 2CQPA 3MUJA 3Q5YA 4NASA 2VLLA 5KVGL 2QEXS 3VFSA 2X9ZA 1G9HA 1XNRJ 2W95A 1A6UL 2Z93A 4L29B 3T6VA 1U8NB 4PREB 1SLXA 3NJKA 3AQDA 3HG0A 2BNQE 1M7DA 2F7IA 4TRPH 3G7TA 2OPRA 1C1EH 3ABLB 2VDKB 2Y23A 1BGXT 2GQ2A 3ET6B 5DD3L 5DZLA 3G2XA 3S5YA 1MHPL 3G6JF 1AR1B 4DV4J 4K7PH 2BOLA 2YRPA 2NYIA 4KGVB 4APQD 4I13B 4BXSV 4DG1A 1ZY9A 5F97E 3UGEA 4IH6A 3KJNB 1RU9H 2Q3ZA 3GI8H 3PHOA 1ETZA 1DFXA 2X6CA 1WEJL 2Y24A 3GKWH 4KJQC 2LLLA 3UP6A 4BGDA 1FVQA 2MQMA 1GH8A 1EETA 2FD2A 2Y6SC 1FE4A 1CWVA 3QUYA 5DM7Q 4NZRH 4GFXA 3UXFA 2ERRA 2BSEA 3KJ6L 2O72A 1A4JA 3HG1A 4ZP6A 2IFFL 3WEXB 5GVQA 1RMFH 2B9YA 2CHNA 2VBZA 5TK4A 5F1KC 3H6JA 5H4YA 3CK0H 1JGVH 2CA4A 1I5OB 5THWA 2WK4A 3VAEA 4P59H 3SCLE 2OJ1A 3QUKA 1WBZA 4D7PA 1TZGL 5T1MA 4D8PB 2VG5B 2A0LC 1XBRA 2W7OA 2YH1A 1F5WA 2JKXA 2XZWA 3H2UB 1KG0B 1XR9A 1BWMA 4Y3CA 2ZH4A 3MUY1 1NCTA 4UUXA 1H0DB 3HHLD 4NUGL 5EZPA 4ZDHA 1I31A 1MFBL 1QHOA 4FFZA 3M2UA 4K4VA 2YEQA 4QT5A 4JS7A 4OJFL 1BQLH 2VXUL 2BERA 5B1CA 4CLUA 1SUQA 3MMCB 4OLUL 2CDFB 2FHJA 4R97C 4N20A 4NZUH 3W5ZA 5IHUL 4PFEA 3QAZC 3BFWA 1N6QB 2DAVA 2JCCE 2C9RA 2H2PC 3NGBB 4NNXA 1HESA 1P1VA 4LQ9A 2XTJP 2VH5L 3FL7A 3VDAA 4B9VA 1SC6A 3L1GA 2D74B 1IX2A 3OR7A 3G5XA 3OXLA 1XIWA 4MJKA 5C25A 3G08A 1P27B 1R9FA 3MM6B 2DT9A 2N1TE 3IPFA 4KFZC 4QHUB 4WBFA 1R24A 4WWSA 4LBHA 3OR6B 3P49B 3TO8A 4UZCA 2VQFF 2PA8D 3BO3A 1L3KA 2QFJA 1MROA 5FK9B 1NBZB 2FIKA 2QVMA 2D69A 1PCAA 5F7DB 3BBCA 3QDMB 2NY1D 4FMVA 1IFGA 2HBZB 4DS4A 1KCBA 3KBHE 3K8MA 3VG0H 3HE6A 1CGSL 4RMRA 4WI0A 2CNLB 2GIRA 4BCAA 2YPLD 3HB3D 3U6XA 1NDLA 5HI7A 4AD6A 3J7Z5 5DT1L 1HU8A 1I7ZB 1JZGA 2IDEA 4PJ5B 1ZV9A 2OM5A 4TSBH 2V2QA 3GU0A 1JPEA 2CBQA 4HACA 2BSCA 4UIKH 5FWRA 4DV6J 1ET7A 1GX5A 2Y6TE 1V10A 2QTEA 5F6IB 4DX6A 4DL6A 1IM3B 1PF3A 4R0LC 2XQBH 3TCXA 1N56A 2HGNA 4R9HA 4IQHA 2IPKB 4IRJB 1RT3B 1MHEB 4NRTA 1KKHA 3BBBA 4XN5A 4H20H 1JUFA 2IF7A 4ZPBA 4AMKH 4XPHH 3U0WH 3SCKE 3O4OC 2FL5B 1KONA 4HOZA 4BC7A 3MOQA 1PEWA 2CO1A 2CQCA 2ZCKH 5CCKL 2BHUA 3RR8A 1XWVA 2ZJRQ 4Y16D 3K2KA 3QNYB 1ZZFA 1T4KB 2R4SH 4PG5A 2OX5B 4NNYB 4WFXA 5I42B 2ESVA 4ATNA 1GS7A 5BRZB 5I5IA 2VMEA 4YVUA 1DZ0A 2EC9T 3FB6B 1K47A 1S48A 4Z7NB 1C8PA 2W80C 1NMCC 3V5RA 3P1VA 4FEMA 2DICA 4W9EC 3SD2A 1N5YH 2GJPA 2E9GA 5EOCL 2MLZA 5JVGQ 4ZPWR 4G8EB 3ZTRA 4L4VE 4A8OA 4L4JA 3QS2A 4U6HB 2R42A 2DQJH 5ETKA 4FLHA 1DJXA 4LSRL 4N2IA 4DVRL 2VFUA 1SKWA 2BHYA 3M8YA 1SOXA 2QMJA 5D4OA 3CN3A 5KSBA 3CSYB 4KXDA 5TQ2H 3CN4A 3KXFB 3J7AN 1EZVX 3RU8L 1RZJH 1WBXA 3BUIA 2MKWA 3M1CA 5T5FA 4UOZA 5A6LA 4KQ0A 4FG0A 2QKIC 1FVCA 4TN2A 4NCC2 1NFIB 4KY1H 5A6MA 3BB5A 4FF3A 1RAMA 4RUAA 3AODA 2EC9U 2WCXA 4TOYH 3TA2A 1ACYL 3PHSA 4LCYA 4PG2C 4WCEQ 1NUGA 3ESMA 4K8RL 1PZ5A 3OQ3B 3ULUH 2AC0A 3ZTQA 4B95C 8PAZA 2EIZA 1OGAE 2FJSA 4JRFA 4TNEA 5CIPB 3G5ZB 1KCRL 4UQ2A 1P7HL 1EARA 4Y1AD 1H5BC 1JXDA 5FDWB 3ZIMA 1OZTG 3DHXA 4DL3A 4LDLB 4L5FH 2VN4A 3TO4B 3KNAA 4AI7A 3V0EA 4NRYB 4WW1B 4OH2A 3FUDA 2OSLB 5AB9A 5DHVA 1FZMA 1I1AB 3QRFM 3LP1A 4OL8A 4X6DF 3GT6A 3MRDB 4NN7B 4PJ7B 1JQGA 2WLJA 1SHWA 4GXUN 4YGVA 5J11C 1AFIA 3QDJA 2ILZA 2KLRA 2X4TA 3MTRA 4MJIB 3NJJA 1T9WA 4OCNC 5DJCB 4BDVB 2F4VJ 2VLKD 1CICA 3QJPA 4BA8A 3J81j 4M5DA 4GPVA 3STBA 1GMWA 2LU1A 1K0TA 1FWKA 2CIIB 2CO4A 3QJQB 2EDOA 3QQDA 4JG0H 4MJ6B 4JX0A 1MKFA 5C0DB 3BWSA 3MSPA 5C08B 4F58H 1RAEB 1F4AA 2BANA 3QPKA 1J88A 4Y8AA 3UBGA 4R7NB 1NSAA 1BLNA 1Z2KA 4IOSD 2V94A 3WNLA 4WJBA 5J2PA 2R27A 4HC1H 3NZ8A 4MNGB 1JWSB 4NC0B 5ERWA 3TJEH 2XYGB 3UEQA 2AEPH 3ILPB 4LAQH 4G9DB 3NPSC 5JQIB 2YNHB 1AA1B 2NSBA 3MMBA 4LJMA 2ZICA 4DH2A 3UTSA 3APCA 1YJ7A 2VXSH 1IKVB 1JGIA 3NY0A 4HCRH 3O9WA 5D7JC 3VE0B 3GBLA 3U1LA 4ALAL 1T6BX 2DMHA 5J57B 1L4IA 2XBTA 5CLZA 3UTTA 2F8XC 4DF9A 4WQOA 1T89C 2BVQA 4USIA 4WFNQ 2B4OA 3TZXA 3UD5A 2ZWOA 4PJEE 4WFHE 2H1YA 2P9CA 1Y1UA 2AMGA 2MQLA 5KYYA 2IDSA 1OALA 4Y9BA 1S5HA 2BOCA 3QGPA 3PYCA 1HI0P 1TO5A 4W1TA 2J8UF 4NO0B 3IXQA 2QADC 2CYYA 3BE1L 5I1IH 3OZKA 4PW4A 2AV1A 2EXWD 4UDTA 1XJWB 2HZCA 2RJZA 3HHEA 4P52A 1GC1H 2R8SL 4QZVB 2X1XR 3E6FB 2Q76A 4HZ1A 4XMPH 1FYHB 5EBMA 1NBEB 1OPZA 3MAQA 1G0XA 3K6OA 4JE0A 3LRGA 2ZH6A 1KEKA 2PPAA 3VX0A 4TNOA 1EANA 3PIQA 4YIQA 2W38A 4MIAA 3JSBA 3W65A 5MLCV 1P4LA 4DW2L 4DL4A 6TAAA 2W2OP 3D2WA 1BXXA 1NDGB 1SJHA 1T22B 2VNCA 2CQVA 2ZOUA 2CDGB 3NZUA 4RGNC 2CGRH 5G4NA 1BAFL 3OUYA 2XFGB 2P1YA 5C9JA 2F3JA 3H7BA 5IW1B 3VGFA 5CZVH 4ELVA 1ZBTA 2WLLB 5T1LA 3WO4B 4WW2A 1E7UA 3W64A 1BHGA 3ROLA 4DKFH 1MFVA 3REVB 2DHHA 2Z2ZA 3LPYA 5F9LA 2CK2A 3PP3K 5ICZB 2NQDA 4LEOA 4LP4A 4OZHA 3VFMA 1RAOA 1BOYA 1WC4A 4NQCD 2O3DA 1YY8A 1JJCB 2XUWA 5KVDE 4MQ7B 1BG1A 4AEHH 4UY8T 1TUGB 1P5UC 3HRPA 1WFIA 4G7RB 1U8MB 4ANVA 4IRSC 4U6XB 5C6PB 2H4YB 3OQRA 4WEBL 4F7CB 2BACA 5A2QU 1DUYB 1UADC 2B7DT 2IOMA 3POTA 2MZ1A 2NR0A 3SDEB 4FG6D 4NXKA 1YJDH 3S3PA 2UUDK 2FSEA 5FUCE 4KROB 4R84A 3MGAA 1TU2B 3MRPA 1XF4A 1SB6A 1YDPA 4LOVA 5FYJU 1MFCH 3UFIA 3OR2B 4EO6A 3LIZA 2W60A 1R5VA 3L7FA 2W9EH 2ZC4A 3IGLA 4C97A 2P42B 4G7YL 4RNRB 3RB4A 1U1RA 1F5BA 1VRSA 5ENWA 5HJGA 5LMUJ 4OIAA 4P4KD 4RBPH 5EUKB 4ODSH 4EIGB 1WD8A 2XWBA 4JR9H 3D1HA 2RTTA 2HGMA 4D0BB 3F12A 2HQFA 4DDFA 3CDZA 3FTSA 3M8RA 4UV4L 3RWCB 2PWHA 3QFJE 3DTUB 1FLTX 3JSSA 1H2TZ 1DEEA 4GLRI 4AM0B 1N0VC 3TF4A 1P5UB 3TAMA 4AJ0A 4WIIA 4KVCH 3FS9A 5CHNB 5JHBA 6AT1B 3V0DA 3P9LB 3BDYL 4P07A 2IAMB 3HBZA 2HNDA 4ES8A 1R19A 4R4ND 4F3OA 4PJ5E 1OW0C 3PP4L 1VFAA 1PGRB 3NOGA 3AOCA 4CADB 4U3HA 4A6YH 4Z23A 2V8LA 1WZ1L 1O9WA 2R2EA 2BSTA 3BP5B 5IBTH 3IRXB 2ZHAA 1S9FA 1C12B 4K7PL 5H9FJ 5DHVH 1HZLA 4PW3A 1EFQA 3FTYA 4R90H 1TTCA 5F8JA 4NRXA 1PDKA 4OHXA 2GHVC 2R7OA 4R4NC 4B9KC 2C28A 5ALBH 1JZ5A 4NUPA 1FKOB 3MGTA 4JI5J 3O3AA 4PJCE 1QFWM 2OJEA 2JOQA 1EDHA 3V4PB 5D4PA 2DYSB 3RTLA 5EOCJ 5IFHL 5IWLC 5F8LA 3NNAA 2XS5A 2JI1A 2AI0H 3G3LA 4L4VA 2BNQB 2NYZA 2BQRA 4WTYA 1VC5A 4GRMB 4OAWB 1H7XA 1U8KB 3H9SB 3QWUA 5FFGA 5CYQA 4FA6A 2GABA 5JPMB 2X38A 4U3SA 1HW9A 1ADQL 2QLVB 1RJYA 4IGBD 2H26A 1UZ8B 1CGTA 3QIUD 5DVOA 1U9KA 2DNRA 3VF0B 3OR1A 2OMXB 1LEGA 1FE0A 4GAGH 2YPVL 5DJDB 5FO9A 2IWFA 4XPHL 1ET5A 1YYCA 2G2NA 1D2PA 3U0WL 3UJTL 1H6KX 2V0NA 4I88A 4FFVC 1NMCB 4DTGH 5AB1A 5I76A 2DM3A 4OQTL 3WHXB 1JKHB 5L46A 4OU3A 4YDVA 5KVFL 1AD9B 5IMKB 3TIDB 5GGRB 1E27B 1Y5IB 2ZC3A 3HD2A 2NPFA 1AXIB 1X9QA 2ZXEB 4R8UB 5KFKA 3LXAA 4G43B 2ARWA 4MBOA 4N5UA 5K1JA 3CO0P 4P71A 1R8AA 2CSPA 5B8CA 1EGJL 2Y8YA 4PJIF 1YMMA 3CFTA 4X7EC 3RUGA 3G9VA 4KV5F 4ZUTB 1RTIB 5GADI 3CFBB 3HHSA 2A1WL 5T1DL 1Z6JT 3KHHA 1HN1A 3O2WL 1D2OA 2P8MA 3GEWB 2OIHA 1QVFR 2KB2A 1RI8A 4P3DA 4ECTA 3FQ1A 3ILDA 2AGOA 1JI2A 4GBXC 3QEQE 5CJOH 3B9KD 3RVUD 1UVMA 2HG5A 2L3MA 2C4FT 2MNUA 4HFUL 4WI5A 4D0CA 4ZPDA 3MR9A 5C0CD 1V6HA 1ZIBA 4DF4A 2CMRL 1WZAA 3GB7A 1T7PA 4AG4L 4LSUH 4C83A 1AGDB 4WV1A 2YGNA 4YPJA 1XGRB 1Z1ZA 2E5IA 4F4KA 4GIOA 1IBMF 3OKOB 3D6FB 3PYGA 2XWJA 3HI6H 2A9CA 3FO0L 4JG1H 4NHCL 4YPGA 3L4CA 4MKVA 1Y6MR 3HFVA 4LSUL 2ZWLT 3MJ8B 4JO4L 5KG4A 1YYLL 3C75A 4BM7A 5ANMB 4LE8A 3J07A 2A18A 5IEKB 5GQBA 2XN9D 3TLRA 5E5MB 4J9OA 3QJVB 5DJBA 2Q9OA 3JYBA 2YQGA 1HBOA 3RUGE 1NGZB 4XN8A 1QFOA 2Y1ZA 1M5KC 4E36A 2OJZL 4B9GA 2AFNA 4HLZH 1A3QA 4DL5A 4USKA 5EWIL 1ZSDB 4G11A 1SXCA 4OZ5A 4PRPE 1JWUA 4G8FB 4NLOA 2BVTA 5FWQA 5GJTL 3ZTCC 1TENA 1RWNB 5AVWB 3IJEA 5BMFL 3MLXL 1U8SA 4RWXA 4DVBB 1UD2A 4H25B 2NXZC 4WFHD 5C7ZA 3QCUH 5J13C 4M56A 4PJHE 2M1KA 2XC8A 1NK5A 1G6RA 1NC4B 3EFDL 1UPPA 4YLBA 1JPGA 3HN8A 3VB8A 3N85L 1N34J 1PSKH 5CZXA 3V8OA 2VW4A 5DCCA 3GGWA 5DQJA 3RNQB 5HYJB 3T2LA 4BE5A 4I6WA 3T71A 3B6SA 2ICES 3VA2C 1QTSA 1KIQA 5DJYB 4E98A 1XGTA 1G1CA 3I32A 1HOEA 4MNQE 1BIIA 3FU7A 4IKLA 4YSEA 2WVDA 1S5IL 2EDMA 1QW9A 2J56A 1UHVA 3OJMB 5B7EA 3SB3A 1QBLL 1S7VB 2NDGA 4ZMNA 3HHLA 3CMAS 5I8OH 4I3RL 4I2PB 3WXWL 4TQEL 1A7QL 4R7NA 4QIGA 5KSUB 2X1PA 2X4RA 2WP3O 3LZNA 1A02N 3J81U 3HP6A 4KFMA 5IB2B 3JSMA 4PJAF 4AYBA 1QKZH 2YWYA 3BIKB 5K9JH 2AK4A 4HD5A 4KSEB 1RZKC 1H3WM 4WJKB 1EETB 5DD3H 3UD3P 4IG0B 4AUKA 3RR7A 3P2BA 2G9HB 2F7VA 2CPDA 4YSRA 1A4JB 3HG1B 3L5JA 3C15A 4TUKH 5DHMC 2MTAA 4Q8EA 1YLBB 2NY4B 3BP4A 3QC6X 4PJFA 4X6CA 3IDXH 3ECQA 3CV5A 4ZOSA 2B5IB 4EVNB 1YK9A 1J8SA 4LSVH 4AE0A 3WKPA 3AS1A 2B6AA 3R7RA 3NCFB 4AIZB 4OZIB 3D48R 3DC2A 4LNRB 1HFEL 3NGDA 2VDNB 5EDWA 4NO5B 3AREA 1P4IH 2X28A 3DM2A 1ES0A 2RU9A 1AY1H 3M8PB 1FJGF 4NLVA 1QYGH 2MKJA 4LKCA 1R5WB 3MXHP 1KTDA 2HKHL 4XP1L 1IBGH 1UUSA 2K9UA 5GAHI 2WZ1A 4AH2B 2EFPA 3EO9L 1N6QA 1W16A 4FN0A 4POYA 4FN5A 4P73A 2FIUA 1GXEA 5J1AB 1SBBA 4IEFB 1HL6A 1ZDSA 5E0OA 3BAXA 2QZQA 1H8SA 1CQMA 1QW8A 3GFHA 4M8LA 2FX9L 3QGGA 1FWXA 2WCPA 4IDJL 5KFLA 2OPPA 3D3VB 1NLBH 1U3HA 5KSAC 4ENOA 3A6BH 5JW4M 4NLTA 1FRKA 5FO7A 5IMLB 3LNEA 1C5CH 3EZJB 3MNMA 3TFKC 4CU7A 1OIOA 5L9DL 1FNMA 3JYTA 2WXRA 4QBUA 2AS5M 2AYEA 3IWLA 2JLPA 2Z2LA 2CALA 5BXFA 1HNXJ 4JI8J 3SE3C 2PPDA 4RQQB 4ZT1A 5HHOB 4HFWA 3RX9A 1N4XH 2CA9A 2RQ4A 5IZHA 4QU6A 4RDQF 3WTXA 1HNVB 4NO0D 3ICLA 1HIML 1TKWA 1PO6A 3S37X 4DWHA 1XMQF 3LEXB 2UXDJ 3WXWH 2FWLB 1VMBA 1HHKA 1KEMH 2JELH 2CUMA 3BKCH 3BVNA 1EBPA 1NEPA 1EEYA 3NA9H 4FXKA 4N26A 4P5MA 3VXPA 3CEDA 1I7ZA 1U33A 5KYUA 3CH1A 4KKCD 2UUBJ 4JQXC 4DCQB 2I5YH 3IMBA 2IXQA 1RTJB 1L7IL 5L4IA 2WONB 2ZOKA 4L4TD 2YN3A 2Z1PA 4RVBA 1M1XB 1UCBH 3QUXA 4GW1A 1U8WA 3H59A 4RNRA 3BZEA 5CU9A 3MPDA 1DQQA 4CBPA 3QORA 2R7EA 4IU3A 5EUKA 2YKLH 2RH3A 3DWTA 1CEZA 4P5TC 4DPBX 2J5LB 4AGMA 4KGZB 2P5WB 1AZSA 3B3IB 5DZPA 4Q0BB 4P7TA 3ARGA 3S35X 1BECA 4NA3A 2XWRA 3L3IA 4NP9A 5E95B 5L8JB 2XLLA 2JV6A 1U4FA 3C46A 1ND0A 4ZQTA 2E86A 1HYSB 3U4BH 3HJFA 1RCXB 2APOA 3QBCA 1R5IB 2FEEL 2A2QT 5TH2B 3C8KB 4XNUL 2XN9E 3RL1A 4NZFA 3U82B 3MBXL 2HG0A 3L3OC 3GP9A 3PJ9A 2ZUYA 3MM7B 3NTCL 4PJHA 5D7LB 3VGVA 4CT8A 1IKFL 4ACTA 1CB4A 2KLTA 2D0HA 4N9OB 1ZH5A 2PLTA 1GYUA 2BHZA 1FN4A 4WO4D 3SE4A 1LO0L 3V6ZB 3MO1A 4ABQA 4U1NB 1LEIB 3W5XA 2XO6A 1K1QA 1S9WA 4KKCC 4PHZA 3FTXA 4IUFA 4ZOBA 1JMTA 1X5YA 4DGIH 3E3XA 1HNZJ 3REWB 1AFJA 3V4PA 1A8ZA 5A2JH 3N41F 2C1PA 3O6MH 3D50A 5KUKA 1LQ9A 5FIEA 3L4BC 4Q2LA 5KVGE 4DUYJ 4UINH 3ZDYB 1FCAA 2QQNH 4GKLA 3RQ3A 1M0SA 4ZIVA 2CJXB 2YTCA 4GXVL 4I0PC 3HHLC 1XR7A 3B2UD 1FESA 5I5JA 2XETA 3M9NB 5CGMA 2OR9H 1KB5L 1CD1A 1AO7D 2B77A 1F6FB 2IGFH 2WNWA 3LVEA 3V6FB 4U7SA 1LEGB 3ZU8A 2DLIA 4PWIA 4LUBA 4HF5L 2XTJB 3IDMA 4R26L 1F6AB 1KLMA 3DGDA 4O3SA 5C25B 3W2WB 2X87A 4ELMB 2C22A 4L3CB 3CXFA 3TOPA 1E8ZA 2X53A 1UJ3A 4HIPA 4KK8C 2I32A 5BZZA 2RE1A 4L5FL 1FGNL 2ZYRA 4G43A 1O5DT 4JI6F 3UADA 2YEZA 4K0KF 2EXUA 4Q2MA 3GTTA 3D5OF 1HXKA 1RJZA 4PRHA 4AYGA 2FECI 5E2WH 3E8UH 4K8RH 1HX0A 4PV8A 2HVDA 4F20A 4C59B 2VXQH 3W9DA 5F21B 2HA1A 5DRNB 4DEPB 3VV2B 4NWTL 3GMLA 3DSFL 2NOYA 4LF8J 3R2CJ 1JWSA 3Q2NA 3LKNA 1R1CA 3FQXA 2BY3A 2MZSA 5EZLA 3KYKH 3CXCR 1YVFA 4IGBB 5DEGA 1WOOA 1S0NA 3UTSB 3G6YA 4M3HA 2V9TA 3WKYA 2Z31B 1UA3A 3MNVB 2QT6A 2EEXA 5F88A 1K2DA 2XGQA 2Z91A 4FC3E 4POZC 2FYXA 5LXGH 2YA1A 2IH9A 2GUOA 3VW3L 1JLFB 4TL5A 1QRNA 5CYMA 3W5MA 3NP5A 3NIFB 5GRUH 4CGUB 4YUEH 4DN0A 4O44A 4EWTA 2MQ8A 5ELIA 3SV3A 2GB2A 4RZCA 2CZVC 5BUGA 2FGWH 2V69A 2CADA 3RWDB 3ARWA 3MKGA 4TVPH 5G0RB 4WTZG 4PJCA 5D71L 4OI9A 1PEZA 4C4KO 2MCPH 2DBJA 2D9CA 1PZ3A 4XK8C 3R1LA 1Q94B 2WINB 3NABL 4HHAA 1U26A 3UWTA 2YKAA 3FUEA 4RUHA 2AYGA 2DL2A 3BFOA 5C09D 2EBGA 1RTDB 1KXVA 3PWUB 2FEDD 3RP1A 1R3HB 3E6FA 4QWWC 2WHOA 3G04B 1A0QL 2ARJQ 2CDFA 5ETNA 5IVXB 5EO1A 3QQ4B 4CNZA 1YJ9S 3I9GH 4F5CE 3QG7L 1L9SA 1RP9A 1YNKL 3EW3B 3E3QE 4ZAKC 1YMHB 1BZ7A 4YN3B 3GM0A 2APWA 3N44B 4Y5YB 4AZ8B 2Y9HA 4NNXB 3O6FD 3FB8A 5D2LF 3KDMB 1WC3A 4J9PA 3DRQB 1WHVA 2XVKA 4KO5A 3FO2A 4NNPH 4NLWA 1KDIA 3QUMH 2HFOA 3IMVA 1CBKA 1MW7A 5HI4D 1REVB 4JLRB 4DV3F 3IBEA 4LSSH 5IHBA 2LDIA 2E9BA 3HE6C 3O41B 2BNRE 4GAYB 4O2EA 1MJ7L 5TGBA 3K57A 3FTUA 2Y22A 3GXUB 2X4SA 1C2PA 1Q90A 2KFZA 2W9DL 3PXJA 1GZHC 4B02A 2J6SA 4C56B 1X9LA 3DIDA 1OCWL 4F7MA 4XNAA 2RQMA 3EUUA 5EFIB 3DECA 3M1VA 1LO3L 1TR0A 2F63A 4KQZA 2OCJA 4JI0J 2XIDA 3DHJA 4HJ1A 4HSQA 1HL8A 4HWBL 4KZDL 3QH3B 4Q9BA 1NC4D 2ZKHL 4KFBA 3OAYH 3QCTL 2MPAH 2BWQA 2BP5M 4NLGA 4P5TB 3W81A 1TL7B 1IEAB 2ROEA 3AFGA 4P2RE 1AQHA 3QQ3A 5DDPC 4LF5F 1MEXH 2OCFD 3FQNB 4HHUA 5AAPA 4AMKL 3EHBD 3OR2A 2BC4A 2X3DA 4KAIA 3WIFA 1EEZB 1DJWA 1JHTB 1PD6A 1A65A 4OZIA 3AROA 4UILL 2V5TA 4PQUB 1C5CL 5HDBB 4G1EB 4K8RD 3F58H 1RWPB 2KTQA 1TL3A 2NCEA 1S9YB 3DARA 3TEWA 2Y8WA 2CA3A 2XICA 1JUFB 2CXGA 2L7UA 3BKJL 2X42A 1Z9SB 3OMZA 5I30H 2HZVA 4Y7OC 4ZPCA 5IB4A 1UOWA 2QYCA 4NLUA 5ALCH 2I9LB 5I19H 3U9PH 4JRXE 3CPWR 1LL1A 3F0NA 2DTMH 1B0PA 3TUPA 2HNZA 1NCAL 2AEFA 3QYCA 3FFDA 2UXCF 2FHKA 2P8LB 1MG7A 1QI3A 2ROGA 2YX7A 5D7IA 2ZWPA 4M8RA 1OCOB 3DNKA 2XIIA 3LNDA 4NPOA 2HFZA 2V2XA 1SJXA 5DUPL 2RBLA 2E8ZA 4OI2A 1KJVA 3TO4D 1FH2A 2G2RB 4KMTH 3FOMA 3U9UB 1IKWA 4LSQH 1JRHH 3PHQB 1U3HB 1JGLH 4XIUA 3KPPB 4IRZA 2XLKA 2HVBA 4FZ8H 5EZOH 2QV6A 5G4OA 2FX8L 4ZS6D 3GMGA 9ATCB 4C9DA 3QIPB 1FKOA 4GRWE 2HQCA 3FEZA 1L5GA 1NGQH 3GJSB 3UW1A 5DQ9B 4JANA 3KPOB 4NKOB 1OTSD 3B78A 3VD7A 1BZ8A 2GCYB 3OV7A 3UCQA 1S9EA 2EDLA 3CCLS 2WQRA 4GRMA 2B4CH 4HG4J 1P7QB 3PABB 4XNXL 4XOCA 2W2NP 3MUZ1 4FXKB 5JPMA 4L0YA 1DQTA 3FGVA 3P96A 4UNTA 4NQDD 3FOLA 1SEQL 2DW5A 3PGCA 3MLRL 2EE6A 5GS0C 3MM8A 4KJYA 3IFOB 3GG1A 5M2UA 4G3YL 1T0NB 3QJFA 2AJYL 4C3MA 1Q9KA 3U79A 2HRHA 3CHOA 5IJBC 1O5JA 3W3SA 1WFUA 4OZ0A 1B7YB 5I26A 4DOHB 1RZ8B 4PXCA 2ZKHH 1R89A 1U3ZA 4F7TB 1LWFA 2Y07H 4YWGL 1NU4A 3K5PA 1HVXA 2RR3A 3RVTD 1JKHA 3H5XA 1ZHNA 3OXRB 1B99A 2R23B 4PS3A 1S59A 3LH8A 4GG6B 4KXCA 1OAYL 3LZQA 5EIIB 3MNWB 3EXLA 2MDAA 1BGXL 2XA8L 3GLEA 3RWHA 3RWFA 2H8PB 4OMFG 4Y2DB 2DXFA 4Q0BA 3IDNB 5FGCE 3K71B 2ZG3A 3O4OB 2LFVA 1LE5A 3FH5A 4PJFF 1RJLB 2AEWA 4G9FB 3S9DB 4JJ5A 2DLFH 1O7SA 2L0DA 2NY5L 4JFYB 1HKAA 3BSCA 3ZZ1A 4AVJA 4X64F 1X4BA 3T19A 1YEEL 4K3JH 5K5YA 4HHHA 4D0CB 3CZKA 5J2PB 4LARH 1LP9A 4ATTA 4P5RA 2IMMA 1V7MH 2E5GA 2C3UA 2G75A 2FQDA 4F8NA 4HR2A 1PGZA 1IBKF 3IDJA 4L37B 4JZNA 4YPGB 2YOCA 3PW0A 1BAWA 4OCXH 1GK8A 4ZLNA 4OV1A 2WQSA 1JLAA 4LHUB 3SQBB 5DGAA 1WDDA 1AVAA 3ISYA 3MEEB 1K8DB 3AS2A 4O2CA 3VALA 3EDKA 4YNYB 4O58H 1YSJA 3IS0X 2J7KA 2M4MA 1E9PA 2QSQA 4ED1A 3ZYOA 2BOPA 3FU9A 3KPMB 1N6VA 4JG1L 4NHCH 1CT8B 1DVSA 4HUVB 5GGVY 3GMNB 3PAYA 1CVSC 1NIFA 1T0OA 3CH8A 1S46A 1GIGL 2VMJA 4Q8BA 2IA6A 1JWUB 4G8FA 3WE6A 3ZHLA 2WXPA 3EO1B 35C8L 3HE7B 4M03A 1SM3H 1OCWH 4A04A 3F00A 4ILRA 1NCBL 2PFDA 5HMYA 3CDGA 2WXMA 2YA0A 1UQSB 5ADPL 1S0VA 4F15C 2ILYA 1F6AA 4XMWA 3GZ7A 1IJNA 4V1DB 4EUVA 1RWMB 4DR6F 2APVA 4XRCA 1G6RL 2N7BA 3LXCA 4U6VH 4P75A 1IL1A 3MLTB 1T5WB 3ZTDC 2DEYX 3FQ2A 3B6SB 1U95A 2FHMA 2ZJSH 5IWAF 2KZMA 1KTLB 3U7JA 3P4UB 5J1PA 1NOLA 1E0OB 1DUZA 5A7EA 4ZLLA 4R8WL 1X3DA 3D1QA 5IESL 2DEJA 4PJXB 3AWFA 1A3ZA 4NS0A 3K6DA 2ZZNA 1TQWA 1WO2A 1YY9C 1BBJA 2CCLA 2FH8A 2WTPA 4ETZA 1HL9A 3LPPA 3E6HB 4KJIA 3NEEA 1E6OL 1T1WB 5GGQH 1GY2A 2WWKT 4PTUA 1CDCA 2BVPA 1KLFB 2FO4A 5FYLL 4TNWK 3BWZA 3IM1A 4JFOB 4HUMB 5H35A 3EGVA 2D3ZA 2OPSB 4ILMA 2JH3A 3GMMB 2QTVA 3LX9A 5KUMA 1N2RA 2PETA 4HJGA 3I0SB 3GV5B 3GYXB 2CO7A 3FW6A 4U4IA 5HP1A 4J3OG 4G8IB 1CVRA 1G1KA 2VRKA 3NJVA 1MAKA 4UT9L 3U7WL 5J1EA 1PSKL 4NFBA 1ZK9A 1JTOA 1F3DJ 1N36F 3I75B 1IAII 4X5XB 5HYJE 2ZXBA 3VACA 5K9OB 5I66B 3R7BB 3DURA 3TVZA 5BZWA 4PZVA 4PJBB 3W8PA 5CSGA 3GSNH 4HWEL 4KXAA 1PIEA 3MRPB 3RVWC 3S5LA 1P53A 4Z7QF 3QRRA 3STLB 1YPZF 3GK8L 5GGVL 1ACMB 3D0IE 1QAWA 2XTJC 4A2DA 4D94A 2DI9A 2TSBA 5F7EL 5T1DH 1LILA 2F5BH 4H8HA 2Y5QA 3OB0H 4DR1F 1ES0B 5EGYA 4NCAA 3NIDF 2NY1B 4ZW7A 3RVTC 1H6UA 4JNXA 4KVNH 4YHOH 4OZGF 1U58A 3HX9A 2VU5A 4GRLA 2VXQA 3JWDL 2MY8A 3UI3A 4NQVB 4XP5L 2VDOL 3P3DA 3EGSB 4AL8H 2D9QB 2APBA 1E4XL 3AA8A 1DEEB 4AM0A 2EEDA 4AYFB 2FO8A 4M93C 4AMWA 2BVZA 2IFXA 3PACA 1W0WA 2J6EA 4HX1A 5D1ZB 2RU3A 4JGJA 3M8WA 2BIMA 2F8OA 2X88A 1YG0A 3MACL 4XO8A 1K4DA 3G9AB 5T3XE 4JFHD 1WGOA 3FRPB 3H3PL 3KDPB 1ZPLA 5DRWA 1KCSH 1KLGA 4WWKA 2ROXA 3T6XA 1CC7A 2VDLH 4MA7H 3S6CA 5AVXB 4LREA 4NUJB 1Z1WA 4F33B 4Q9CA 1B64A 3QORD 3C6SB 4MCZB 2A6JA 5EUOB 2FY1A 1ZHBA 3DRRB 3UDLA 3TPUB 3R7QA 1DP0A 4WUUD 4BZ1A 3DO7A 1H3TA 3UCRA 3U6XS 4L8BA 4R8WH 4IDJH 5HHOA 2DQHH 1RE1B 1V5IB 1WJ9A 2EYRA 5BMFH 1PW3A 3QIBC 2PUQT 3GSVB 2F1FA 5HANA 4Y16B 4YHLL 4JRXB 3T9ZA 1N34F 1I3UA 2F18A 3G6XA 3DYAB 4FPIA 4YE0A 3MRMB 4XVJH 1FRXA 1AKJD 2W1BA 3PPSA 4PI0A 3RPKA 3G71S 2GTZA 3HZMB 2F0CA 2ZITA 4N8VA 1Z5HA 2GT9B 1NBVH 2VBYA 3SFUA 2F5GA 2YJLA 3B37A 4MNQB 4LVEA 4CTAB 1FRGL 1M1XA 2G2OA 4ALAH 4N22A 4D8PA 4C11A 1ZA6A 3PUCA 3HSJA 3VQSA 3INUH 4QAMB 1S9YA 5KT3A 1B2WL 5KS9A 4ZVFA 3QSKB 2APSA 3BSZA 3UZQA 3MV8B 2GAHC 4DHVA 4F02A 5IM0B 3LALA 2PMZA 2EJ1A 3WKQA 3R7SB 4J8RA 1TQTA 2HRTA 2GAZB 2JKLA 4LSTH 2F7PA 4Y2KA 2EXWC 4Y6IA 5CO1A 3VO0A 1B0TA 1OY3B 3HHSB 3IA0A 3VXME 2KZWA 2J2ZA 2XPYA 4KITB 3PDGA 4PRPB 1WTGT 1WG3A 3DIVA 1YQHA 2V2XB 2DYRB 1G43A 1OE2A 3LPWA 4YSTA 1DRZA 3PWPD 4PY8I 1LQBC 1EVUA 2M52A 4DUVA 2QLBB 2BNRB 5AFAA 4ICLA 1JIBA 5D7LA 3FFCE 3PEJA 1M5OC 4FCHA 1SVBA 3LH9A 1LHZA 2BP8B 5KG0A 4PJGA 5E9DE 1PVHA 4DPWA 1Z9MA 3KLLA 4HKQA 4HCIA 4BCZA 2UU9F 4QHUA 4X9IA 2YNFB 3GSNA 4BQCA 5GS0D 3ATFA 1C9SA 3ETOA 5MEOA 3EOAB 5I1GL 2HMIC 2VDLL 5KT4A 4ED7A 1TEGA 1FJEB 2Y3NA 5DA0B 1KPVA 3KPOA 3SDCD 1OARH 1QYGL 3V6DA 4ZODA 3GFUA 1JK9B 2F4VF 2ZAIA 2CPUA 5AVZB 5HI4C 3I5BA 4BH7B 4C8KA 3FQ4A 4BE6A 4GNKB 2CR6A 2ICWJ 2JSFA 5ACMA 3QG6B 1JBJA 2CIKA 3J80U 4BKLB 5C0AE 4BHUA 1JWWA 1E65A 4TUOB 3LEVH 4XBPB 4PJ9D 1J1OH 3MU3A 4BA0A 1G7MA 4L3EE 4DLGA 4R3SB 1TF4A 3LV3B 2K45A 4RRPA 3PJLA 1HQ4A 5C0AB 4G6VB 4CT9A 5D7LE 4R4BA 2UVRA 4IIQA 5AVSB 1FO1A 1WI6A 2JLGA 5F0MB 5TPWH 3L5HA 5F7HA 1RZ8A 4YHYC 2JLFA 3GO1H 1D0EA 2J0XA 4JI8F 3SDDD 1CLVA 2YWKA 4N47A 4CNYA 2HHTA 3BZ4A 1JF6A 2BZ7A 3R1GH 4KJPD 2XEXA 4X4XA 5E56A 4YL4A 3IG1A 5DR5H 5ESQB 2G5UA 4WXWA 5B09A 3DVIA 1NAKL 2AXGA 1N6QH 5DA4A 1H73A 2P52A 4LLDB 1JGUL 3AGVA 4EFAC 2FK9A 3I6GB 1O6XA 2IRXA 5B1BB 3VWJA 4ODXA 3N1QC 1U2CA 3MRJB 2BE2A 3DLKA 1DTUA 2F5AL 4KUZL 4OZGA 3L4VA 3BRDA 1XHHA 5I42A 3HIZA 2HFSA 1M7UA 4OFIA 4W68A 1SKRA 5CBEA 1SJRA 2V3EA 4N85A 1Z3GH 1IGCH 1YECL 3VAHA 1SVCP 1V05A 2O93L 1J10A 3MEGA 3A6CL 3S88L 3DRYA 5F7UA 4F37K 5CJOL 1FYTB 4MGXA 4UQDA 3NSJA 4DSKA 1I8UA 2BEFA 5AW2B 3STZA 5SV3A 4LBPA 5C0ND 4HPYL 1UM5L 1F3FA 2XQYG 5FOBA 5CQGA 4DFKA 3O6FA 4U1GC 1U02A 4UQTA 3W9EA 2YXVA 2QPSA 3R27A 2ZCLL 3ESVF 2A38A 4MB5A 2YA2A 3H9SE 4OF8A 1M1KT 1XMOJ 3U6RB 4PBXA 1P1LA 2AJZA 4U1MB 2DB8A 2XCMC 2OFQA 4DP6X 1HHIB 1CSJA 3RWDA 4AYMC 1E9PB 4FNTA 4XC1H 4X8XA 5JXEC 3UTTE 3KVDD 4PQAA 1MWAA 5DFAA 5B22A 4DQAA 2CQ3A 3D54A 4APQA 1KJ2H 2Q79A 1JF5A 5FUZL 1IUZA 1MNUH 4XVTL 3PNIA 2AABH 2IVMA 1N4LA 4WU7A 4QTHA 3HR5A 1XMWA 5BR8J 3VFUA 1ERNA 2AHOB 2FLMA 2EIJB 2CPHA 1YN7A 2Y4SA 3H56A 5DDQC 3L45A 1OLZA 4GSRA 5I4MA 4BDPA 3BAJA 3QEQD 2WB1D 1E6VA 2WMPA 4P9HC 4Y2NA 2BOBA 2YAEA 2VZSA 3GHBH 3Q5TA 4IEFA 3RY5A 1EJ7L 1R43A 3B54A 2VZ3A 3MC0A 1TJIL 1V9OA 1XR6A 3N6YA 1QLNA 4MCMA 2AJUL 2VLRD 3QYNA 1QBAA 1WRFA 1TPXC 3ZDYE 4AL5A 2Q10A 4XP9H 3EBAA 2OTWA 4K8RA 5SWZE 1WNEA 4AYSA 4X98B 5FX3A 3JT0A 4I3SH 5E70A 3CZUB 3QWPA 5F8MA 1HR0F 2V37A 3PXHA 2DH2A 5I74B 4UTBL 3SN6N 2ENJA 2HXAA 4DKTA 1HNIB 3U30C 5HMXA 1O51A 4UTCA 2XG4B 1BMQB 1TKXB 3K5SA 4YZFF 2IHR1 3D0GE 3MX0B 1U8OA 3OL6A 2VDRL 2B3RA 4P6QA 2VERN 3OKEB 3VXMA 1EIYB 2EKYA 1G87A 5I1AB 1RZKL 3WN5C 1NGQL 2ZKTA 1DLHB 3JWOC 3KYOA 2XSJA 1CCZA 1I8IA 3AD9C 4P23A 4RISH 3CC5B 1UENA 3F73A 4JCWA 1NFDA 4L8SB 5FO8B 3IBWA 4NEZA 2R0WH 1UJ5A 4PJ8D 2LU3A 5F1NB 4ESKA 3C08H 4KKPA 1CR9H 5JHDB 2BVQB 2X3AA 4WDIA 1NQBA 3QZWB 1O9VA 5B0EA 1AZCA 1TAUA 1SDYA 1PNCA 4E41E 4U1LA 4ZPVB 4MKBA 3KDNA 2UXBJ 2RHEA 9RUBA 2U1AA 2ZXAA 3H54A 4H8VA 2WKGA 1KPUB 2JI3A 3U0PB 4Z76B 2X2UA 4ZZKA 2Y2WA 3KR3L 1W26A 3SIPB 1BVNP 4UIMA 1JNHA 3M32B 3HOGA 5C6WH 1ONQA 1MG2C 4FXGB 3X3UA 2PGCA 4P4KB 2AJ1A 3OKDA 4P5KB 2MKCA 2HHHF 3OAZH 4LCIL 4LQFH 3TV8A 3FPXA 1DBBH 3HW7A 4QHKJ 1P8GA 2J8SA 3EGSA 4HPOL 3DDGA 1ED3B 3BGFA 4WEMB 3RDTA 1F0XA 1SZNA 1DSYA 4FJYA 4UNIA 4I18C 2LTQB 5F44A 3SDAC 3ENQA 4JG0L 3V4IA 3VTMA 1JJ4A 3CC7S 4M5YH 4W9CC 5C1MB 3MR2A 2A0LD 3TV3L 3ES6A 2RIKA 3IWVA 1D9KC 3QFJD 1FNEA 2PT0A 5DVNA 3MM7A 2RRNA 4PJHB 4P2QA 3TBVB 4LEXL 2AQRA 5J13B 3LNIA 4KH9A 3TI0A 3D52A 4B3SJ 2YMXH 3LD8C 4JPQA 3ZLQC 3N1GC 1YAIA 5DYOB 1CC3A 3T3FA 1P4BH 2CBPA 5FYLE 1LO2L 3PWPE 1VHIA 2C2ZB 2XQYA 2JNJA 4X7TB 1E6JH 2Z7UA 3W11C 4ZUUA 5ADZA 3WC2A 5BZDA 4GG8A 1LK5A 4QI3A 1YJRA 2HHXA 4B9IA 2YXWA 2BJ3A 3I0RA 1FDLH 3H4BA 4KUZH 2PR9A 4E9SA 4H5SA 2N1KA 3W38A 3DI6B 3VAGA 4NP4H 2JCCA 2U2FA 3R8BB 2Z6FA 3E2HC 2MJUA 2H3NB 3PGFH 4KJYB 3CCJS 1VQPS 1GSKA 3HZMA 1T0NA 3T3MF 1UEMA 2R9HC 1AIFA 3TA4D 2VO5A 3SYZA 4B0MM 4R0LA 2H6OA 4U2ZA 3RW6A 3V6HA 1RT2B 2E1CA 3C6LC 1HHGB 1UWXK 3QT5A 3NYKA 1KT2B 4U3XA 1IM4A 1UM5H 2NNAA 3ZZQA 4P06A 2PXYC 2WZPA 1B0WA 2WZ0A 4NFCA 4PR5A 3CD7A 5JLZB 3QYMA 1KTJA 2ZOMA 4RW9A 1RULL 1X9RA 3MNWA 5A2LH 3R5AA 4ZLJA 3VI4A 3KPRB 3QRGL 4Z78B 3PW7A 2A9NL 4ZLPA 2M8DB 1FNGA 4WJG3 3J7ZT 1H8NA 3T1FA 4BHUI 1JZEA 2GKIA 4G7VL 1MCPL 1KIRA 2AQ1A 1RJZB 2PR4H 4PRHB 3VGGA 3NRQA 4FYVB 3IP0A 1BZDA 1GOHA 2GIQA 4L23A 5KFXA 2D03L 1ZXKA 2DJMA 3IGKA 2ZCKL 3KPTA 2XGPA 2C9QA 3DOSB 3KBEA 5HHQA 2MMYA 4MHHG 1R3KB 2FHBA 4MBRA 3LP2B 2JH2A 5GRUL 3IRXA 4P57B 3CDAA 2CUYA 4ENZA 1UKTA 2IC3A 3FRZA 4WNSA 3V0HA 4NRXB 1X4HA 3DKHA 1D6EA 3X12A 1IM9D 2HHQA 4JI2F 4A7TA 2X89D 2E4TA 3BWUF 3V4UL 4O44B 5DM6Q 3NFNA 1FEEA 1VJSA 4FTVA 5E1AA 3VXRA 5IEHB 1QSVA 5D5ME 2OAUA 2MKSA 1IZJA 3T8XA 1NCLA 3DLHA 2CK0L 1M7IB 2HT2C 1Q95G 3U36A 5JVHQ 4LO9A 4GEJA 4JJOA 4Z7UB 3S2AA 5FFLA 1NFKA 2VQEJ 1E5BA 5E6IB 3MR5A 2GHWA 3IGFA 2H32H 3IRWP 2MTLA 2ZUSA 3UC2A 2BJ9A 2YPZA 4KO0B 2MQPA 1G7MB 4BWTA 1A6VH 1TVHB 4OD3H 4OLXL 4BFKA 4LMQI 5GS2D 3APNA 1S7QB 2JXMB 5FO9B 1JB0C 1OXYA 1QAYA 4FG4A 2EC0A 5KSAD 4BWWA 2NR6A 4HIXL 4NX0A 5F9NA 4ZD3H 1EHAA 3CZEA 4FKKA 2PCPA 4NT6A 1O5PA 2JKSA 4Q14A 3U30B 3NJLA 4YDVB 1XR8A 1RLWA 4CVWA 4UZGA 4YSSA 1C1CA 1MMDA 4HF5H 2IAND 2VDOH 3MODH 1OL0A 5M95B 3VD1A 3DFEA 4G7SB 1Q8IA 1IGJA 2O1PA 3IAPA 5KYNA 3SMZA 2HVHA 1NANH 3EGDA 3VSUA 1AQDA 4WHTB 4XPFL 5C8JA 4NQXA 1ZAGA 3LKSB 1OB1B 4LIQH 1JGEA 3CFBA 3S36H 2VLME 5K59E 5ICXA 1MY5A 3DYMA 4FGMA 1X8DA 3V4VH 4N9GA 4C0OC 3NG5A 2HT4D 4NLPA 2WAQD 2ARJB 2FQFA 3EYOB 4IOFD 4OGXL 1OEZW 5HPMB 5KZCD 1YBTA 4G8GD 1N2RB 4OJYA 1DZBA 3NP4A 3KPSD 1X5SA 2PEBA 3MEGB 5EFIA 4FDFA 4LR9A 3PTWA 5KFFA 3EJZC 4FNHA 5E94B 5GS0H 1QEWA 5DK0A 1OM3H 4FERA 4E9QA 5E08L 2CQBA 3LSOA 3FDSA 1HQEA 1KBBA 4HS8L 3RPBA 3ZDZB