2YQ3A

Structure of bvdv1 envelope glycoprotein e2, ph5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
273
structure length
243
Chain Sequence
CTRETQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BVDV1 E2
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
molecule tags Viral protein
total genus 39
structure length 243
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq3A01
3.30.70.2550 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yq3A03
4ILDA 2YQ2A 2YQ3A
chains in the Genus database with same CATH superfamily
1ET7A 4P4RA 2CDEA 4Q6YA 1UWEH 2AJYL 1RT7A 2LU4A 2A3JA 1L3WA 3VTTA 1DJSA 4AGNA 4DVBA 3BVNA 1FDNA 3P4NB 5B8CA 1NAMB 4G11A 5LKNA 1BSIA 4O2CA 4AL8C 2XFGB 3DRTB 4UQBA 1ZETA 3QO1A 4R0LB 2AQNA 3P77A 4UOCA 2RTTA 1CR9L 3HE7D 1EHNA 1DVYA 3HJEA 2QADB 5IHHA 2N3LA 1KS2A 2FECI 1OAKL 3M2RA 4M7KL 3MTXA 2XI2A 2CIIA 2WBJB 4Z7OF 4X4OA 3FQXB 1P7QB 2F63A 2ZVSA 4JI0F 3L3IA 3AXIA 2V33A 4YDXA 1RTDA 1QBLH 2AFNA 1NM4A 2M83A 2XKNA 3MRHA 5B0BA 4P4KB 4PJXB 2Y25A 2GJ2A 4LFAF 3K7RA 4USKA 1E28A 3GLEA 3VFGH 1A3RH 2F5BL 4R7VA 2YD4A 2BE2A 1TK5A 4MSWB 1XSIA 5ANME 4BFKA 2DYPA 2CPYA 3VXQB 4EDWH 1AO7D 3LRHA 2F3JA 4MCYB 3EOBB 5SWSD 3NJGA 3A6BH 2X6BA 5SWZE 3JSRA 4OHYA 4WFXA 3CCJS 3DPBB 3BMVA 5AZ2H 3EGSB 3SGKA 2W2NP 2AYGA 2X0VA 5AAMA 4OKDA 3VSQA 4ZFOL 2Q76B 5AW5B 1T1XA 5IBUG 3W82A 2HNZA 1RHHA 2KLTA 2QKIC 2Z56B 1HQRA 4LPCA 2F7OA 3TQEA 1PFOA 1FRHA 4C4BA 1XAKA 4WWKC 4YDZA 1ZXKA 2H1PH 5TQ2L 1A4BA 3KR3H 3GIMA 3EZOA 2ZCLH 1AQDB 1DBKH 2XTJP 2E1RA 4NLVA 3RWDB 2D7OA 1EIBA 1NCNA 3GHBL 4NSKB 1HI8A 4NA1A 2EYTA 1I9IL 2I60H 1XK8A 4KC5A 1G9MC 2YGVA 4ZN1A 4X8JB 1H9DA 1XSKA 1WBYA 4FI8A 3K8KA 3W2DH 3JYTB 2AI0H 1E2VA 2J73A 4NZRL 4DVRL 3VI3F 2CO1A 2XB2D 2VLKA 1F3DJ 4B3RF 2HFTA 4XP5L 1FNFA 3KLAA 1HW9A 4R4ND 2ZOGA 3EDJA 5HGDA 5E3RA 2RUGA 4EZMA 4Z7WA 1DARA 2BWDA 3H3KA 2HT4C 4PQUB 3G6JF 2HBZB 4U6PA 4H8WH 1M1KT 1D2OA 4EN3D 1VMBA 4KQ0A 4OV5A 4Z7VF 5D1QA 3GJFK 3VE0A 3X12A 4PJ7F 3G08B 4LCWD 5KFTA 5JO5A 4FG6C 5CZVA 1JF5A 2OTWA 4MAZA 4GXFA 4KJWC 3MRIA 2IDUA 3OKOB 4UTBA 5J06A 2ROPA 1IL1B 3TJAA 1ROCA 1CICD 3QEGH 2XS2A 3O6KH 1RY7B 2XY1A 4M00A 4OCSH 2V4QA 1TFWA 4AQ1B 2KZWA 1G9NH 2EXYC 4NQCA 1XIWB 1D9KA 1HSAA 2FX7L 3KJ4B 1U8WA 3DLKA 1OARH 1ACXA 4AZUA 1DTTA 3W61A 4MWFA 2IDQA 5AOMA 1RAGB 2A6IB 1S6UA 1L3SA 4H5SB 4NKQB 3OX8B 5T1JA 3P96A 5GADI 1LILA 2WN2A 2X41A 4YNYB 3QJXA 5CN3A 3SJVB 5IHBA 5I6XB 3ZZTA 1PLCA 2WVBA 4RDQF 4MH8A 4DUWA 4CLLA 4ELKA 2FEDD 2I5YH 2QSFA 4U1HB 4F7TB 1R0AH 3EGXB 3HI1B 4YS4A 3T6BA 3PX4A 3ERXA 1TTBA 4DHLA 1Z9OA 3MR9A 1YEGH 3VR1A 1T03B 1QSLA 4FMFA 2FIRT 2OBGA 1FSKC 1ZHKA 4B0MM 2VPWB 3AY0A 3UDEA 4J28A 3FCVA 3FFCD 1RWMB 1L7TL 2EK1A 3JQKA 1B0RA 1G7HB 3NCFB 4C47A 4GSDH 3EH4B 3M17A 1OOAA 3MUGA 4IOAQ 3BSAA 3ASWA 3KH4A 2D03L 4ELME 4B9PA 4H26A 2C2EA 4LVOB 2JEFA 5JQIB 1BGXH 1TZIB 2MCAA 2H9ZA 4FPRA 4EWTA 4PY8I 3PAUA 1R17A 2YBRB 3V4LA 2XA8H 2YD2A 4QPEA 1BEXA 1MQKH 4GXVL 5LGYA 1Q94B 3TESA 3I9IA 1OSZA 4H2CA 1HQUA 1FJGF 1MN7A 1IM9B 4I48B 4LLWA 4UMSA 3VI3B 12E8H 4QXTB 4JFWA 3HZVB 5DFAA 2WBRA 2ZEJA 1OM3L 4KB7A 3KUGA 1NOAA 1TETL 3GWCA 2QKSA 2YAFA 4XPHL 1VAHA 1N67A 2BW2A 2NYYC 4HV8A 3SQRA 1FN4A 1VB9A 2VLJE 4KBPA 3OPKA 2ZFHA 3RVTD 5AOIA 4AVKA 1CT8B 5CSGA 3GRWA 2ISDA 3G82B 3PWJA 4OZHE 1N0VC 2YN5A 2L08A 3AD9C 4IOBA 1J8RA 4PJCA 4YAQA 2ZNYA 2WOYA 2XTLA 3ES6B 4F7MB 4PAAA 1BD2B 1QTPA 5CSZB 4Z3HA 3BGMA 1Q8LA 3C6UA 5CP7A 1JDCA 3HB3B 4A6YL 4LF7F 2NT0A 2GY5A 1GW6A 2FX9L 4O4YL 1OB1A 1RWVB 4IBZA 1UWXH 4WFHD 5DYOB 1IZJA 1RQ5A 2GAZA 4UT6L 3VGGA 4U7UD 3NGSA 3BFOA 5RUBA 4YDIH 2WZPD 5DC2A 4QXUL 5CM1A 2WK2A 4FXGC 1FFWB 2D9PA 2E56A 4PBDA 1W72H 1V7MH 5C0RL 3WFEH 3NGRA 4NRXB 1NPJA 2P5WD 3HPLA 1BBJB 2AX1A 3QC6X 1HH9B 4AV4A 2M7SA 3IN0A 1NPRA 1Q0YL 1T7YA 3CDZA 2E27L 2HRGA 3GSNB 4PP1D 3A6CL 5DQJA 3F7RA 5LGJA 3QJJA 2CRYA 4JDVB 3FN0L 3P9WB 4UMGA 3NWRA 5MP6L 1U3JA 5DVOA 1PX3A 1U8JB 5AZUA 3C5SB 3N9UC 2KVIA 3BGUA 3TU6A 1QZNA 3QE5A 4DCQB 1U42A 2VC0A 2FZCB 5AL8A 3V7MA 1S5HA 3D4ZA 5ESAA 5HMYA 3ASNB 4YHZH 3TF7C 1A2YA 3JAMY 1UVLA 1SYSA 1X5ZA 2W07B 2GJJA 5FHBH 3IWUA 1AD9A 1Q9WB 2OW7A 3D0VA 2EIKB 5BZXA 2Y1AA 4AENB 2R7WA 3NEEA 4KHXL 3UI3A 4E9SA 1CN4A 1S7SA 3HC0B 2EBGA 4G82A 1CGYA 4OCYH 1WNEA 3BSZA 4FYVB 1S5IL 1YNTF 3PP3H 1FG2A 2I2YA 3ZZQA 5C97A 4A8YA 2WV3A 1BW8A 1JD9A 2FQQB 1UACL 1NC2D 2YAHA 3NCQA 1E5YA 1F2GA 4NQQA 2DH8A 1BF8A 2EYSA 1GK8A 1BFOA 1EZUA 3VFRA 2QFRA 4TPRL 5ABDE 3A4AA 2UWEF 5EFIB 2MJNA 3RR8A 2VSMB 3VQSA 3TVMA 5FC9A 4H8WC 3QLHA 1U8HB 4GLRH 4WO0A 1ETJA 2BOAA 1WFNA 3N42F 4UUJA 5FO8A 2VH7A 3VWJD 1SBBA 1AI1H 1NCWH 4FQ2L 1CI5A 5D70L 4BZYA 1UD6A 5E9AA 3GR0A 4HWBH 3L5JA 3SQOL 1VGEH 5DGBA 2F6AA 1FVEA 1QFWM 4NIKB 1GS8A 1Z9SB 1ZV9A 2IPUG 4I0KA 3WMQA 5KVEE 2NNAA 3ZTRA 3WTYA 3VCLB 1AYEA 1SN0A 2J6EL 1E4HA 4OQTL 1CI3M 3ZTEA 2AEMA 4LPVA 2R69A 4LLQB 4B6ZA 4UW2A 1X5TA 1X5GA 2Y7QA 4YFLF 5DDQC 32C2B 2HNYA 5B0DA 4LSVH 2QZ5A 1JIHA 3SGJC 2PXYD 3ZE0E 1RAAB 1SYVA 3KG1A 4CSTA 4OYXA 3QIDA 1F58L 5LNDA 1RWKB 4XBGA 5ISZD 1I31A 2EEYA 1U6AL 2DNHA 3IDXL 2VT0A 4JO3L 3QORB 3NCRA 4OLZL 5DZVA 4ZNCD 4BZ2L 3QDJE 1DSYA 2VDLH 2CRZA 2DM2A 3D9AH 3PIQA 3IAM9 3IGFA 3MBEB 2VDRL 4JG0L 4K94C 2M88A 1DUZB 5FGCB 3WXWH 2NY4D 3O9WC 1XSJA 5J1AA 4IRZL 4JY5L 2BBEA 4Z7AA 2LA4A 1A6UL 2D4FA 1R24B 3BC9A 4MD5B 4PGZA 1CLOL 4GUQA 2BUNA 1URZA 1J5DA 5BVJB 2NX5D 4ZUWA 5T1LB 2H9GB 2DR7A 4UAHA 1K2DB 4IDJH 1X7SA 1CDYA 3PNWB 4KOCA 3WJMA 2ASDA 4NO3A 3LS4L 3RJMB 1HHGB 2QR0B 4Z1PA 3OW2R 3PX6A 1RIHL 1SY6L 1ZS8B 3G71S 5BOJA 3JTSB 2V3DA 3DGPB 2AQ3A 2NNXA 4X64J 3ZTJH 2G2RA 3HNTH 4IOFC 3TYGL 2Z4QA 4HJGB 3OD2A 1IGYA 3PACA 4AYBA 3ARRA 4QO1B 3BR8A 2A10A 1WI8A 3R1GH 5DRWB 3VALA 2AJ3B 2WBWB 4PJHF 4NHCH 1KPUB 2P8PB 4X4XB 3LN5B 2Z93A 4RFOL 3N42B 4Y5VA 1JB0C 2NTSP 4I4BA 2Y2WA 4Y0FA 1XGUB 5DHYB 5HI4D 4R5PB 4WKXA 2XBZA 3ARED 4JLRB 3TTYA 5CEXA 3Q44A 3HRZB 4Z8FL 2FSEB 3TBYA 5DRXA 2H65B 2BVPA 3D66A 1B3JA 1UZDA 1SJVA 3EVWA 4IDKB 4A7TA 5IVNA 3NNAA 4P5TB 5H37G 1S57A 1AR1C 2PCYA 3SXLA 1JN6B 5B39B 2GJIA 3C6TA 3BKUA 1ASPA 3BZ4B 5D7LB 4ZPTB 4K0KJ 1EHLH 2AP2A 1WIOA 2X1XR 4N5EC 3KDNA 3NPSB 4KI5C 4MVBC 3L16A 1REVB 1VA9A 2W7OA 3UOAB 4LRIA 1TQWA 4LL1A 1GKEA 4Y9BA 3WCYA 4AJVA 3SGEI 5LGHL 2VQUA 4XO4A 2W9DL 5BR8F 2M26A 4FYTA 1SPBP 1ND0B 3ZYJA 1YEHL 1MFEL 4X5QA 2ROEA 2DQHL 3HHLA 4JQIL 3TAMA 4KUCF 3OR6B 3DYAB 4H4OA 1XGPB 3FTWA 4KROC 1HKLL 4DEUA 3QYCA 2JJTA 1SV5B 3ULUF 1WUUA 2N59A 2OX5A 1X4ZA 3TO4B 1SCJB 1U92A 1JZ4A 2VN3A 3H9SA 1IKOP 3FOLA 1H3GA 1XH3A 4IMKA 4JO4H 4ZPVA 2PPEA 3CX5K 3L3OA 5I8EA 3WFBH 1ZKAA 5FX3A 3B9EA 3FT3A 2IDTA 1UL3A 3SCMD 4PSPA 4JQXC 2XN1A 5IVZA 3E9TA 5T7LB 4JO2H 4MB5A 4Y2IA 3AFLA 3HC4H 4UY8T 2QSQA 5ICZB 2PO6A 2WXRA 3CLEH 1MPAH 4JRXA 5A2JH 1TTAA 4EBDA 3REWB 4F92B 3S98A 2J8AA 3C60B 3RZAA 3K4ZA 1MCQA 1OF2B 2VDMH 4UDUB 4HHAA 3QULB 4P23B 1BPLB 4A7GF 4QTIH 1DQAA 1ZHBB 4AW7A 3TFBA 1C5DA 3ALPA 3AY2A 2ICWI 4Q0BA 3WKYA 1CJVA 2DQTL 5H9FJ 1CG9A 1RVFL 2NR6C 2VMEA 4OBRA 4RAUB 1RGVA 3LF0A 3MEDB 1X5IA 1APSA 3LOWA 3WKQA 3QGGA 5HYJA 3BUIA 3W11C 3W5NA 1TTHB 1MI5D 1RSYA 3EO0A 4B9VA 3HE7B 1VCTA 3F58H 3FH8A 1TP7A 3K59A 2E66A 1RAIB 4C57C 1FL6B 1PEWA 4MMZC 4OF7A 1NDCA 1TKZB 1YC7A 4DX7A 4R0EA 4IFYA 4ES9A 4NN6C 2B4CL 1FAKT 4ABUA 2D3O1 3Q8BA 3EGDA 3MXVL 5K59F 1E5CA 4YSTA 1J0YA 1JWUB 2VLLA 5IVXE 2OZ4H 2Y1IA 4PXEA 3HR5B 1G7MB 2VQFF 3BRFA 1TKWA 4RRPM 3B9KD 2V4JB 4TVPH 3T3ME 4YDJB 2W9AA 1FKAF 3A3OB 3E0GA 5C0ND 1AO7B 1E5ZA 4OLEA 3AD8C 3BSGA 2DYPD 4YHPB 5SWSB 4QHLB 1J1XL 4YY3F 3MUMP 3GLDA 1BXXA 3NACL 5F1NA 4OI8A 4UQCA 3NRBA 2NLWA 3SE3C 2CPEA 4WJBA 2ZWKA 1O7SA 2D9OA 1H6TA 4OF0A 5DEGB 2IBZY 4X4YB 2IWGA 4A8KA 1MMNA 4IRJD 1WFIA 2OPQA 4PBXA 1GMVA 2WB4A 4RAHA 1S79A 2YGPA 5I76A 3C8HA 2AGJH 2IDSA 4KK5C 2F1EA 5CFHA 2LEPA 1P69B 3KEHA 2FBRA 3EJSA 2UUBJ 3I74A 3DKHA 3RNKA 2JKNA 2HT3C 2IIJA 4JZOB 4IIQB 4UY85 3VDAA 3MLYL 3RKDD 4O2FB 4H88H 2PO4A 5DEJA 4YB1P 4O58L 2OQJA 4NZJA 5DI8B 1SDDB 4XP9L 2VERN 5DZOA 1WSST 5EOCJ 4JCMA 5D78A 4QWBA 3K46A 2CJTA 4YXHL 3DJTA 5L1KA 2EKJA 4N1EA 1I51B 1QYGH 2GSGA 2CWXA 2JEIA 5E1QA 1BVLA 3EXJA 1MU2B 2XG5B 1KXQA 3WN5A 4GMTL 3GSVA 7FDRA 5F3HA 3VAMA 3QC5X 4EN3B 3PVXA 2A9CA 1S4IA 1A4KA 3KDMB 4TNWK 5DZ6A 4N76A 1IKNC 2DJ4A 1XGRB 3WIFB 4K4TA 2HJLA 4LVNC 2HRLA 1CFTA 5D1QD 2FB0A 5AAWA 3GK8L 4FXWA 3NSCA 2VXVH 3RGVA 1XF2A 2DO0A 4LF6J 5BRZA 4KXBA 5GGUA 1JNZB 2D4DA 2XBDA 1CICB 3IDYC 3TQ1A 3L4BC 3GUFA 4J3SA 1IGJB 2X38A 4G6JL 1ELOA 4B9YA 4KJYA 4RWXA 1FVCB 1MWAL 5MLCV 3J7YU 3IXTA 4LIQL 3CVKA 3Q8SB 4NPKA 5IB2A 1R89A 2LXUA 1ES0A 3I96A 5J13C 2IADB 4HGWB 3M6UA 4HC1L 1WAEA 1ADQL 5DJAB 4E68A 3K89A 1JPFB 3BZEA 1MEXH 3ARZA 4W98A 2FHCA 1NPKA 2YPKA 1H5BA 1JHTA 3II1A 1E6JH 3C2PA 3B34A 4OGAC 2P46B 2WM0A 4WSJA 5FHAL 3UC2A 5HGGS 4D0DB 3DLJA 3MFIA 1HNWF 2GJ6D 1CS6A 3S8SA 3P9MB 1HBOB 3D39A 4F8PA 4RNRB 2VOOA 2R29H 5TK4A 2UUCJ 5D1ZB 4ZMMA 4LF3B 5JW3H 2HHVA 4PGCA 3HZMB 5CINH 3AT0A 3S34L 3ZW3A 1D9AA 1HNXF 1S8DB 2WMPA 4NXNF 3KVQA 1URRA 2K7KA 1XGQB 2IBGA 2HQGA 8FABB 1BMQB 4OZ5A 4IO1A 1UXWB 3MJ7A 4ZJQA 3Q8UA 3TT1H 5F9OL 4AWJC 4IRDA 4X2BA 3WDOA 2KXNB 3TA4D 1TG8A 2VCOA 3EF4A 4KDTA 3NGUA 2DJMA 3BPSP 2VQEJ 1Q9LB 2Z92B 3FT2B 1UWXK 1GJUA 4B97A 2EECA 5MHSE 2XCAA 4J1UB 2APXA 3TBWA 2OR7A 1CLFA 3MRNA 3UPAA 3ULUH 4KDVA 3OUYB 2NQ3A 3KNBB 1UPPA 2LMIA 3GPAA 1O6SA 2EYRA 3RYLA 1EERB 4I3GA 1L5UA 5C2BL 1N5AA 1RADB 4TY8B 3FFDA 4M56A 2MTLA 4G1PA 3CC4S 5C7XL 2JVRA 4XAKE 1CFNA 1CUOA 3VFOB 4DP4X 1FKPB 3OB0H 2EW9A 3A4TA 1GMUA 5D4PA 2BMKA 4QRTA 1FLRH 4MDRA 5CR1A 5FWRA 2PCFA 4KI1A 2DQGH 2DVIA 4A8FA 1JE6A 3J7HA 3M8PA 2IA6A 1TL3B 1N48A 3PRBA 3ARUA 4YN3A 4HETA 4BK5C 1Q9KA 4F2MA 1ACMB 1P0SE 1S9GB 4DR6J 5HY9B 2FHJA 3MRFB 4NBZB 4X4KA 2HJFA 1OW0C 2N0MA 1T7ZA 3AG4B 5C07B 3AAZA 3W9DA 1DJHA 2YQGA 4MAYD 1YYLL 2UY7A 3S0PA 5CO1A 4X4MA 2P5EA 3RY6C 4ES3A 2BK8A 2X4QA 4IEFB 3FN9A 1B0PA 3L54A 1G1YA 3PAZA 3BSNA 1AKJD 3ARVA 2ZZMA 2ZNZA 1JVLA 4J2XA 1MCPH 4USUA 1Q90A 5JPMA 2ZH3A 3PP3K 3ARGC 5C3IA 3TUJC 5L1LA 4U1IA 2B59A 5DUML 5EUOA 4GQ9H 3UD3P 1CU4H 3FHEA 1X4AA 1CVJA 2BSTB 2NPFA 5FM5O 4OZ3A 3U7WL 1M7IB 2CDFB 5F89A 3SQBA 3CMQA 5CN1A 4L8CA 4YXLH 4Z7UA 4EI6B 3AOCA 1JXJA 2XTJD 4YGVB 1QLNA 3V4VH 4LCCC 4ZP6A 25C8H 1BMGA 1IBLF 1YYML 1BHGA 3MO1B 4BCYA 4B53A 1FORL 3PHQB 5DD6A 3ZZLA 4OHZA 1DQTA 1NFIA 1SXZA 2W91A 2QT6A 3DXAD 3FRPB 3LQAL 3O2VL 4ZMNA 4ZNEA 2C3OA 3O44A 3VGSA 4PW3A 4M7JH 3OTOJ 3R2CJ 1CPUA 3TO2B 2ROYA 4MS6A 2MOVA 4K3DH 1XMOF 4R3SA 4QAMB 3X3FH 5KVDE 3T65B 3GI9H 5T5FH 4NLGA 1WZAA 4P5SA 3FZBA 2HNDA 1NC2B 5FCUH 3EYFB 2YWGA 2ZD0A 3FUJA 4DW2L 5F6IB 3A8EA 3JV6A 1KLGA 3HE6A 2KG0A 2XZDB 3GKZA 2VFVA 4AMWA 3BKYH 5GRUL 3SBWC 3R5DA 4I6WA 5KFAA 1IQWH 4ZVQB 3VFVB 1WFMA 2A83A 4XVJH 3CCES 2V2VA 1BQHA 4WNQA 3VXRE 1BAFH 3QIWA 2HBQB 2R23B 2OXGB 4JFQA 1KZQA 3O3AB 5DHVH 4PV9B 3IU4H 3VWJB 4RO0A 1BIHA 1NCDH 1P7BA 2ZUQB 3MLXL 1QR1B 3EYUL 4N68A 5BXIA 1EEUA 4DNLA 3TVKA 3QZLA 1I7TA 3MM8A 4LR7A 3L9ZA 3KK3B 1LD9A 1XF4A 1XDTT 4ZZFA 3TYTA 3PG9A 2XHCA 1OO2A 1P4IL 4NLDA 3P02A 2X1GA 4LDLB 5IHLB 2MTPA 1VRTB 4JFTA 2IM1A 1LEGA 5IBTL 2KZMA 3B2DC 1QFUL 1KJVB 4YE4L 3MLRL 1VC6A 4M8RA 4HXBH 2PXYB 4OUUA 1KEMH 1G87A 3EFFA 1K5WA 3ARFC 4BM7A 3GB0A 1KOAA 2RDDA 5LBSL 5BZWB 5ISZB 3EG9B 5AD0A 3WEXA 5SX5H 5FIEA 2J8UF 3KJ6L 3PWVA 4ZAKD 4LSUL 5F3ZA 1RBOB 2WN3A 4FULA 1B4LA 1RHKB 3LKRB 1X5HA 3GJQB 3MCOA 3PGFH 4K3EL 4P2RD 1PW3A 3OSNA 1XN9A 4LAQL 5DLFA 1WITA 4HD9A 2NY4B 4KO6A 3L5IA 1LWEA 1TQVA 2L9DA 2WW4A 3JWOL 1G6RH 1NGZA 3LKSA 4H40A 4MMXB 4PGEB 4QRPD 5H94A 1RCOB 2CNKB 5CYQA 3NSJA 2NX5B 1PKUA 1WC3A 5FYKU 4DWHA 2OJ3A 4JDEA 2R42A 5J2QA 1XB3A 1XH2A 4M94A 1X9MA 1YJDC 2CQCA 2KXHA 3BDEA 3OTDA 1SKWA 1NUDA 5EU7C 5H37H 3NGKA 3V5KA 4YZFE 3QS3A 3U4BH 4LUBA 3W2VB 5AW2B 1MH5A 2NLJA 2YUZA 3MRQA 3RPIB 4NLQA 2DM4A 4JO1H 4C0OC 2GJFA 1J05A 3TBSA 1ZS2A 2JIXD 2QQKL 4IBTA 2EG1A 4ADIA 4LLVB 3KPPA 3CWGA 1RAJA 5F8LA 4ZFGL 1OYEA 5B1AB 3UAEA 5T41A 5K9QG 2C42A 1N6QA 2BS8A 5CCLA 3D3VD 5DYFA 1X5MA 3DGCR 3QR2A 5EEWA 43CAB 3X1FA 3KOAA 2AKWB 4M5JA 2VZOA 1CF8L 1J0IA 3IDIA 2XPZA 1PC4A 1VLOA 3IMRA 5AZ2L 2HZVA 3BUQA 3VI4B 5FOBB 3CE1A 3FH7A 2LLGA 1QM9A 2XN2A 4OLYH 2QSCL 3ZMEA 1OJ4A 2CJYB 3V6KA 4OFYD 4TNEA 2WQRA 3UERA 3IDJB 5C0BD 3GIJA 2R0WL 1Y11A 2LP4A 4ZXBC 2HT2C 4DUYJ 2Z1KA 3IMVA 3D18B 3NQKA 4U05A 4XC1L 1G7LA 3RAXA 1UPMB 3RI5F 2UZAA 4FLOA 2WXJA 2VDQB 2R7TA 2HFSA 2H6PB 3BH8B 3U0WH 1UM4L 2PFDA 5ICXA 2DEJA 1RJYB 3CFDA 4LDOB 3TT3H 2I60L 4U1SA 1E5BA 1JWSA 5KFRA 2GY7B 3WG7B 5L2KE 1EEYB 4HMEA 5E7FA 2ZZUT 4WGWB 3WDIA 1T7XA 4HSCX 1EKRA 2DWXA 4V2CB 3PUCA 1LO5B 1XEUA 1T95A 1URNA 2O61A 4ED5A 3VD5A 5JXEA 5B4MD 5DO2A 5JTWA 5A16B 2FJWA 2K7PA 4U2ZA 3HCVB 5BVPL 4GRMB 2UZPA 1J86A 3SCMB 3A21A 4HCRL 3C14B 1J8HB 3F0NA 4PD4J 2IM3A 1AOHA 1N59B 3O4OC 1TFYA 4J5OA 1KUMA 5IQ7L 2E7MA 2EO9A 5C0IA 1KTRL 3MLZH 3KXFA 3T2NL 3QO0A 2Z4TA 1TL1A 4AD6A 4I18B 2JKXA 4GKKJ 2BVQA 2OJEA 3B2VL 2VG5B 3HHDA 1V3LA 1A8ZA 1F18A 1YUHA 2YJQA 1C1EH 5AB1A 1ITPA 1E4XI 1E3FA 1R34A 3DBXA 1H3TA 3QG7L 1X44A 1DQML 1L7IL 1CDJA 3LHPL 5EUKB 3T4AA 2NSMA 5GISH 4AVIA 5G0RB 3DO3A 3UL4A 1HLWA 4DKFL 2PPAA 5I0DA 3CXHK 1R47A 3O5TB 2JMRA 2W8KA 1WA1X 3G04B 3FFCE 1BOYA 1MW1A 4J2QA 1RT4B 2RS8A 1IU1A 1QHQA 4FNLL 1NXIA 2C1EB 3IMWA 1EETA 1MI5B 3R0NA 3N04A 4LRNL 5HYJD 3M8SA 5KFPA 1G1CA 1L9RA 4MXWL 4TQRA 4LR8A 1C4AA 1AGEB 4C0HA 5J4MA 3K5MA 2A74A 1PKQA 4PB9L 3ENAA 5D4OA 4NCDA 1IWAA 4X9IA 5LJ5Y 3OAWA 1WC4A 2AP6A 3CO0P 4IW4C 4Q9BA 4RGMC 3T0WA 1GHFH 1HMVB 2YNFA 3IU3A 2VM3A 3CDBA 5EDSA 2D7SA 4OI1A 4FG0A 2A73A 5CSBA 3RUGB 3QSIA 2EO1A 3BCDA 1LWFB 5F41A 3SI8A 5E3QA 2IJ0C 3B9KB 4M29A 3OAYH 4X5XA 3EE3A 1HBMA 2LFEA 3NTCL 5EO1B 1T20B 5DRNB 5JYLA 3VGTA 3DHUA 4WEEA 1Q4RA 2V2XB 3ZIYA 1FE8L 1MWOA 1NM9A 3GMQB 2XA8L 5T33L 1R43A 3Q8EA 2P6TA 3HO1A 1MQKL 4JFYA 4PXDA 1QSEA 2UVEA 4LOFA 2YQ0A 4G6VB 3BP7B 1KGCD 5EU6D 5HD8C 5JW5A 12E8L 3VDCA 2DPIA 1WH0A 1CS4B 3J7Z5 5FWQA 1NEZB 4IRJB 4FBTA 5KOXA 4FLHA 4YFUA 5ADOL 1G7IA 2B14A 3VRLF 4IG0A 5DR5L 4DP9X 3DRRA 2Y1JA 2ADIB 4XVSH 5D0HA 3IS1X 3S96B 3DX9A 4BH7A 4PVMA 1UFGA 1S3RA 3ZE1E 2FK9A 3ROLA 1FFNB 5J12C 1GJIA 3FTGA 4JFXA 4WZQA 3DSNB 4G9FB 1N33F 1NMBH 3GDCA 1Q0XH 3O2DH 1JTOA 4LBPA 4HPYH 2P5WE 2H32H 3BPOB 5C9KA 4UIKL 2CA4A 4FQXC 1SC1B 5AFAA 5DVPA 2WCSA 1F3JB 4P5KB 5L4MA 2Z30B 1O5JA 3WTSA 3SV3A 1WOSA 4Z2XA 1MF2L 1UB5A 4OI9A 4PW4A 3UMTA 4ZPDA 4DQRA 4TVSa 3B78A 3FTYA 1L9OA 1A7GE 3CFJA 3D1QA 1PDKB 4M43H 5J2PB 3KJFB 1LP9E 3G5ZA 4Q6IC 3BOVA 1I9EA 4MS8C 3MUZ1 5LVEA 1W72L 4PN6A 1K0TA 5E2TH 2BIQA 3RX8A 3RGVD 3JTTA 5KG5A 2C3VA 1RTJA 3TUPA 3EZ8A 4DPTA 4DLEA 2HFFA 4F3OA 4KTYA 3SE8H 3GXNA 3UJIH 4ONHB 5GJSH 5A2QY 2I24N 2QDVA 3NIDB 4DV1F 1I7ZB 1JZ5A 1KCVH 3HNVH 3L7FA 4H0LC 1TNNA 4BZ1A 3FSXA 3D2TA 3KPRE 4LLUA 1HQ4A 2Q3PA 2ILYA 3OFGA 4ZMWA 1QP1A 2XN0A 3ISRA 1VDHA 1U8MB 2EDRA 4CVZB 2YD7A 3FCGA 1JKHA 3L95X 4C8LA 3KHGA 1ZA6A 4LF8J 3R7RA 2B8OT 4JQVC 1I8MB 4L8DB 2EBEA 3BSCA 2OR9L 3W2WA 2GEQA 4J8RB 1NKEA 2P6SA 3SDCB 5E4EB 2W9EH 2MCG1 4WU7B 2NY5L 2ATKA 3BXNA 3LEYL 4B7LA 2P8MA 3TEUA 1ZMYA 5SUHA 3NA9L 2KG1A 4XMLL 3CBJB 2FDNA 3QRQA 3SSQA 1CXHA 3DOLB 1A5FL 3D39D 3IRCA 3KPMB 3W9HA 4OCYL 4PJAB 1DP0A 1T03L 2NSQA 2B3IA 2YQBA 4JKNA 3AMKA 7FABL 2OIHA 3WFDH 4WW2A 1E4XL 3Q8AA 4QYOA 1S6QA 3H40A 3OB0K 3SKOB 3MV7D 3D2UD 3PX0A 1UA6H 1U91A 3CCVS 1JIBA 3ONQA 3TV3H 1E6VB 5DJYB 2ZQKA 4EU0A 5IJCC 5J9PA 4WWOA 1TU2B 5JQ6L 1O7VA 3K17A 4OZJA 2QKIA 1KPRB 1X4DA 3UDWC 2QLYA 2B39A 4HKBB 3IWXA 4IKIA 4WWKA 4IKNA 3EZ5A 4DSYA 4ED4A 1WHYA 1EV2E 1F11B 1MFDH 2QHLA 3CCHA 4PQXA 4KX8A 3STZB 4C8KA 4ZOCA 2JK5A 4L8SC 5GSRB 4ZG1A 3OXRA 2RDJA 3L4VA 4UCFA 2EKSA 3VXMD 4HIIB 2Z35B 1IVZA 3MURP 5DSCB 1DCEA 2E4FA 2VWEC 5A0YA 4CO4A 4F1SA 3H3PL 5EEUA 5CD4H 3FCSB 3LQZA 2H0FA 4LHJB 3IFEA 2WXOA 2DNRA 4NNXA 1AQKH 3BO2A 4NDMA 1SXBA 6TAAA 3ZDYE 4D0CB 3BQ1A 4GS7C 3V52H 1QPXA 4DN3L 5F9LA 4YR2A 3IRWP 3I9GL 2VKRA 1T4KA 2R7EA 5EBGA 3SDXA 3OR1B 3ULAB 3GS7A 2E1MC 3ZHLA 1JZHA 2MPAL 2E7XA 1NLDL 2FCBA 4N6RB 5A43C 3C5ZB 5L4IA 3TWCL 1IJEB 4ALAH 2V37A 3PL6C 4LQ1A 4OGYL 4FA7B 2AEPL 4MAYB 4N2AA 1WC7B 2XS7A 2DYSB 3OAUH 2DNZA 2XVGA 2ZJPQ 1MMLA 2H6UA 3Q89A 3RB3A 3ILDA 1B4RA 3D6MB 1AKJB 2D8KA 1BLNB 4QR7A 1EFXA 1J9CT 4ODUB 3FQWA 1HD0A 2VLRB 4TU7A 4N0FB 5EO0A 5G4MA 2N82B 3EGZA 1N70A 2EDLA 1N4LA 3OTCA 2QGCA 4ZVFA 2C3PA 2LYVA 1D2PA 2IPUK 2Z0GA 2V5HG 3FB7A 3R7BB 2XQCA 1LK7A 5IB4A 1K4CB 2XIBA 4RZCA 4Q43A 3GSNL 2M2BA 4XZ4A 2R3VA 3F84A 4M5ZH 1KXVA 5ETUB 4ZDNA 2XTJB 3VFNA 4YSOA 4QJ3B 4O9HL 3RYMA 2APVA 3PV6A 3ISND 3WAKA 3C19A 4P2OB 2I7OA 4TTDC 4YFLI 1JLQA 3EX7B 4X6CE 5INDB 4XZUB 4PWWA 3ZTPA 1MCDA 3DXAB 1A22B 2JB6B 2WC7A 2DQJL 2JJWA 1C12B 3D7PA 3QCTL 2WNXA 3WDHA 3VACA 4C4KO 1B4SA 5I3QA 4ED0A 4NO5A 1FXRA 4CNYA 1GGYA 4I2XB 1MELA 1FNAA 4P3DA 3ULVF 4NQEA 1DBJH 2IAAC 2V7NA 1W6LA 3SY0B 2IMMA 5LO7A 4GUPB 1QUVA 1VJWA 5ETKA 1VLXA 2DR9A 1W2BR 3AU1A 5D0EA 2NUPB 2IF7A 3BBCA 1PD1A 5M2RA 4P75A 3BDXA 2Y3YA 4URGA 4FI7A 4W68A 4JBCA 2JQAA 3KEDA 5JW4N 3BP5B 3IC1A 4PSRA 3BVDB 2GJRA 4ZDHB 2IANE 4TQEL 3QIWD 4NM4H 5I9QC 4F8RA 4MKTA 1T9VA 5SX5K 4N8NA 1CFMA 3QHZL 3OKDA 6CGTA 1DURA 5HHQB 4WEMB 2JWNA 4O02A 1XWVA 1CXEA 3IKCB 3TA3C 4ELMF 5J1TC 2C3MA 5E2VL 5F88A 2WXGA 1OCRB 1WPCA 3BFQG 1Q1JH 1PZUB 4ZLNA 2NYZA 4DBQA 4DPWA 4KV5E 2C4FT 4YR6B 1QSSA 1SXNA 2O3DA 3HM9A 2LGNA 1SNRA 2BE9B 3NBPA 3M7VA 3DRPA 4F8NA 4HJ0C 3RB4A 3CTTA 5I16B 3V4IA 4USIA 4ZOSA 3V79C 2ZICA 3L5WA 5E8PB 3AT9A 2VKZG 5I0YA 4FG4A 3ZGIA 2W92A 2B2XH 2IWFA 1PAMA 3CFCH 1S3KH 2OL3B 2N7AA 4C4UA 1VKXA 3T9WA 1KWMA 4JI8J 4G7QB 4WTYA 4FXGA 1DJWA 4XPTL 4ZAKB 1OQ3A 4X98B 3ILJA 3RPKA 2VDNB 1A9BA 1FBIH 2FYYA 4OZGA 4OZHF 2J8OA 1R3LA 4QTIL 4UINH 4WHYG 1JYWA 1I9JH 4HMCA 4MCMA 4P2RB 1O9ZA 4CAGA 3U6RA 2PW1A 1XXFC 3QDMB 1TK8A 1VZGA 3MV9A 4UOHA 1OL0A 2FVCA 1JXDA 2CXEA 4U33A 2V9UA 3QYYA 4QRPB 4WYLA 4MDIB 2NXZD 3RWEA 1XTZA 2AV7B 3OM3B 3QJUB 4JHWL 3SGDH 2YNHA 4WPAA 5IT9Y 3OKMB 5F0UA 3MJGX 2QA4S 5DJZB 4JI7J 2W0FA 4TSBL 2C4FU 1WC0A 2I32A 4ZTPH 2RA1A 4QWDA 5IV2A 5DURD 3MD1A 3V0FA 5I23A 1SJMA 1D3WA 1MHEA 4GJTB 5E6IC 1J5EF 3H1ZA 3JBG7 1CXKA 4LQFL 5I75B 2CK2A 1S99A 5FYLD 4Z78A 1ZGLP 3VV2B 5AW6B 4ODXB 5IV3A 4X4RA 3KNGA 2W9CB 2IWKA 5FK9B 2JIXB 4GVLA 3HS0B 5T1KD 3PABB 2FJBB 1VPOL 4FNQA 2FJFA 2X10A 1K8DA 3COOA 1EJOH 4P2YA 5TGBA 4AYID 3PDOA 3STLB 3MLVL 1F9EB 1OYDA 1TJIL 3D3VB 4PJ8D 2XLLA 3QQDB 4AMXA 3I9ZA 1B99A 4X5LA 4Y2DB 3H9HB 3K6OA 2BIIA 1AGFA 4NXKA 4RGNE 5EV7A 1F6LL 2ZUYA 3QUHA 2ZSVB 3BW9B 3CZFA 4ZO6A 1IVTA 2AF6A 4ZVTB 2W5PA 4QR0A 2JX2A 3KLFB 1IEBA 2E7BA 5LUMA 4KY2A 4X6DB 2V8PA 3D4CA 5C0FB 2R1WB 5C0BB 4J91A 1VQNS 3O2WH 3SODB 4MNQD 1UT9A 1KB5H 5DUJA 5HO4A 2VLKE 4TOYH 3SZ2A 1Z5YD 3BGFC 3T8XB 1OD9A 1SC6A 4LVEA 4Z7WE 4HEA9 5JHLA 4UZUA 2GG1A 1KWKA 2F8EX 1KIPB 4JPWH 4G1EB 2Y36L 4N2FA 1FNXH 4KPCA 3PWNB 1DZ0A 2QVFB 5IBLC 3IDGB 1WLHA 3ZKXC 1NB7A 2WXPA 5D1QE 4N2CA 4XAWH 4TUJB 3WLBB 5L6YL 2NZCA 2B4CC 4OLVL 2YQ3A 3QUZC 4QXVA 4EGLA 4NERA 1E6YB 3GMLA 2MQGA 3SGJA 1PKOA 2OMVA 3IJHA 5F1SA 2AXJA 5CEZL 5L1IA 1H38A 3UACA 4N8VG 1BXNA 2E7WA 4NQCE 4AYSA 4FQLH 1HZHL 4FBUA 2IFGA 3R5AA 4KH1B 1ZEAH 2EE6A 3CFEA 4ZUTA 2QYCA 5I1IH 4DR4J 3WS3A 3QJHA 4KITB 4F2FA 2WOBA 4JKMA 3KXFD 1RU2A 2VXVL 4OFQA 3FAWA 1VSCA 5FYJL 5MERA 4M63A 4XDDA 1G1XA 3DLHA 3WHXA 3LAMA 2BQUA 2OMZA 2NW2A 2NQPA 3LJ3A 1VC0A 2J1YA 5D1ZI 5CKGA 3O9WA 4AIXA 1WZKA 3VDBA 3SBRA 4AOFA 1VQ6S 3OAYK 1SQGA 5CJQL 2W4DA 3S6CA 4JMNA 2J88L 1RFDH 1IC1A 2XMVA 2B6AB 1U0QA 2IH1B 2LLNA 4QRBA 4A04A 2ODIA 3ZE0F 1A7NH 1XB8A 4RW9A 1MEXL 1NCIA 3NRFA 3IGAA 1K3IA 4KO7A 1WV7T 2GHWA 4HPOL 1T5XA 4R7NA 2OEMA 3D54A 3NZ8B 3P73A 1FH2A 5KG0A 1UVJA 1WHOA 1FZOB 2HW3A 1QATA 3CZJA 3R5CA 1SQEA 3PYCA 3KLSA 4LKXB 4ONGH 4W9EC 2Q6WA 1C8PA 3MOBL 2FEEI 3UJTH 4PJDA 3BJYA 5B09A 2R29L 1KENL 1OGAB 2VXQH 1D5XA 2YA1A 2DGXA 4TLRA 4H1LA 5A2QU 1KN4L 2X9XA 5CINL 2NW3A 3TCXA 2MHEA 1VQOS 4BINA 3BN7A 3EYQC 5FA4A 5BO1L 2RKIB 1JV5B 3GYGA 4OJ1A 4WFFE 1VQMS 4JK0D 1R7IA 4TNOA 3CJTA 1OP9A 3JB9k 2NNFA 1ACYH 4ZZKA 1U8NA 2A3TA 2A7BA 5D71H 4QT5B 1EZLA 2PTUA 4YC2C 4TN9A 1ZT4B 3DX0A 3RPBA 1CTNA 3DARA 4DZ6A 3NP3A 5F3BB 1G7PA 2B0SH 2A0LD 5EU6B 3D28A 4ODBD 1CDBA 1FRGL 3DHMA 3UCRA 4PJCE 3CPUA 2DKMA 1LO0L 2CMRH 2GABA 4GO8A 4WEUD 2FD2A 2DWEA 3LTOA 1T1YA 3UR3C 2NY0C 2YARA 4WF9Q 3VGBA 2HN7A 5L39A 1WQVT 3P4MA 1XQIA 4LF5J 3Q2NA 1JPTH 2WLKA 3X1EA 3QNXB 1MRFL 2YUXA 1CQMA 2DZEA 1GMIA 1Z9NA 4KVNH 2B15A 5D2LA 2FJXA 5DJ0B 3MRMB 1FLRL 4R84A 2F19H 3IETB 2DQGL 4ODTL 2F54A 1ZAVA 4G6ML 3WX8A 5KFHA 3FQRB 3FU6A 3EDRB 2OTUA 4UILL 4JQXA 4BFJA 5T3ZL 2AMUA 1EO8H 1VADA 1QWNA 4I1TA 4MTMA 4F20A 1WI6A 1GA2A 4JI3J 1ORQB 5KFNA 4M7LH 1VF5C 2YWYA 3P3UA 1JZDC 3BVXA 4HFUH 4NI6A 4E98A 1VOMA 4GRSA 4GW5A 2FVSA 1SXCA 1ZLSL 1NK8A 3DMJB 3NZUA 1I5OB 1CD1B 2PE8A 3M1OA 3O4LA 4MNHB 1SXSA 4FZ8L 2RIJA 3E6FA 2QQLH 4NFDA 3GINA 5DVKA 5I18H 4HR2A 2NR6A 3M1CA 4NGHH 4N41A 4IU3B 4NEYA 2BCKA 4IS6A 4MRBA 4GQ9L 3FQ4A 4UU9B 2QV6A 4Z7QB 4UAOB 3VO0A 4DL3A 4WJ5A 1KTLA 2OMBA 4FXKC 4P06A 2XZTB 4LRCA 4DXLA 1BAWA 3OTBA 3MDJA 3SPVA 3QUMH 4Y3CA 4K73A 3FF7A 3RWCA 5EC2B 3BWUC 4YXLL 4ZMAT 1A6ZA 4PG2A 3EBIA 1JWMB 4MMZA 4CH1A 5I73C 2O5XL 5CFAA 4K2JA 4WKRA 3G6DL 1IQDB 4TM9A 2AHIA 3ZT7A 3U4AA 3GBLA 1W2IA 5B1BB 2XMKA 1NJIT 3QPXH 4IH5A 4TSCL 4PREB 1TEGA 2QGDA 4Y5XB 5FGRA 5CJ5A 3SOBH 4LSQL 1IIKA 3I6GB 1RZJH 1RP9A 3BVTA 3X3FL 4CBPA 1NANI 4XBPB 1OIAA 3I85A 2OJ1A 3D85D 3GIZH 3D2UB 3DWTA 3MV7B 5EZIL 5HDBE 4DFHA 1AANA 4CLTA 2YGNA 3BQ0A 1RTHA 2YNGA 4WP9A 5DVNA 1XR8A 3NJIA 3SE3A 1JP5A 3N5FA 3HUJB 4TRPL 3SKJL 4GUOA 5KSUA 2LVCA 5AOZA 1XVSA 3L09A 5HROB 4D0BA 4PJGB 1QZ1A 2A0FB 2VMCA 3IAS9 1MJUH 2H2SC 3NCMA 4NKIH 5DJXA 2XLIA 1IGFL 1S7UA 3Q6FB 5IVXF 4WWKD 4YUEL 4NQVA 1QE1B 4G1MB 5CKAA 5FUOL 4WE1B 2E5LJ 3IDNB 1BWMA 3P2BA 2CQHA 3D05A 3DRQA 3T3MF 2YKOA 3GU0A 3H0TA 3TCLA 2QVTA 3VXMB 15C8L 5A3ID 3EO1B 2Q87A 1UCTA 1KCKA 1TCRB 2EH8H 2FO4B 2L3BA 3NABL 3POHA 3QZWB 4I2PA 2WKLA 4X6EA 2E75C 2CJKA 1RH8A 4PY8J 1E2ZA 4B3MJ 3KYLA 4N5SA 1NZRA 2E9GA 2RHQB 1SUJA 3MRBA 1IAIH 2ZPKL 4Z95H 3REVB 1KFDA 1R3HB 1PCXA 2FB4L 4FQPA 3UZEC 3LQAC 4WXWA 4HXBL 5F8IA 3FB8A 1JZIA 1OE3A 4HK3J 4RFEA 1FXDA 1FO0L 4HALA 1PPIA 3NNCA 3VH8A 2OPPB 2JFCA 3GR1A 5F7BA 2BSED 2FC8A 1BZOA 2R4SH 2KHDA 1HHHA 3O1LA 4M6OL 4R5TA 3TNVA 3MOAL 4FNTA 4GSXA 3SBQA 1OXYA 1RTIA 4WXOA 4FLQA 1F56A 4FTVA 4KY1H 1WS7A 3GQFA 4KJWD 1VISA 1W0YT 1BLIA 3LNIA 3T4YB 3CDFA 5ICYB 1E9OA 1EANA 5KFWA 3EUDA 1IV8A 3UXFA 4NHUA 3WO4B 3BQ2A 1UCBL 1LM8V 1NAMH 3B7SA 3UPRA 3UIZA 3R9LA 1G6RL 2X28A 3QUYD 2O5ZH 1KDJA 4R4FH 1LJMA 5F70A 2NY6B 3V2AR 1EVUA 2R1XB 1M56B 5KVGE 1HL8A 2B1AL 3VXTB 2CQIA 5E2UH 4YB5A 3BKFA 1RT6A 3DTXB 5FYKD 3V6ZA 4AT6A 2LECA 5LAXB 4POYA 4XX1E 4ICXA 3PY8A 3RAQA 1W0WA 3U25A 4QOTA 4XPBH 3KWMA 3EDFA 4EOWL 2C8NA 1KEKA 1AZCA 2ZWNA 4Q0XL 1WC1A 1YMHB 1NFDA 2RE1A 3PJ9A 2ZZTA 5LQBH 4F3MA 4K4YA 2HFZA 3D6GA 3WELA 1U9KA 2CLRA 4DT2A 1QX1A 1FT8A 1R0CB 1R8HA 5F8QC 5T3XD 2DT9A 3B4MA 4L74A 1Y18A 2FSDA 3JWNE 1L0YA 3U30B 3VB9A 4HFWB 4LCYA 2HB0A 2A6MA 4RJVA 3NJVA 3VRJA 3PFEA 5IT9U 2CRMA 3MGJA 2HKEA 1BQKA 1W2KT 3IM9A 3C9NB 3OZ9H 1NGPH 2JL9A 4JFFA 3VXPB 5JIQA 5KTQA 3TV8A 1LWHA 4OLYL 4RDBA 3MREA 3X14A 4ZI8A 3QCVL 4X50A 3T41A 3Q5YA 2FJVA 1X4CA 4CSPA 2AU0A 3ECQA 3RGHA 5L9XA 3H9SE 3WEAA 4A66A 3JWOC 5IT4A 4OQJA 1JDAA 2NYYD 3QRRA 3H7BA 1U7LA 4Y2MA 2MKWA 1U8KB 3ZDZE 2QGFB 4Y9GA 3R1HA 4HLJA 3R6GB 3QW9A 5G5DB 4Q9RL 2WSKA 3PREA 4V1Ak 1Z3RA 4WHYH 3BP6B 3IDMA 4JRXE 4K7FA 3WLWC 3NFNB 4UT7L 3ZUNC 4N25A 4AV0A 4QRRA 3MHYA 2IC3A 1X0FA 1VERA 2NY2D 4KAQH 2PPCA 5AKRA 4L48A 5FDWA 1PCAA 1SJ1A 4O4RA 4WFAQ 4L4TD 4BK5A 3DTDA 3CMAS 4FL4C 3ETBJ 2H4YB 4NUJB 1OW0A 4OL8A 2XFXA 3QQXA 3I50L 4AH2B 3J7AN 1N5YH 5CMAA 2UXVA 1BECA 3T6QC 2RQKA 3LP2B 2R4RL 1YWXA 2IDLA 5D7IB 3RR7A 1Q9OB 1YPZA 1ZT7A 1YEIH 3DJ9A 3GBDA 4P9HL 4Y4HD 1OTUC 4IJ3C 3RY6A 5BS0A 5HYJE 3K8VA 5CJBA 3HPJA 4DR5J 1JV2A 3BIBX 2OZ4A 5A8WB 4M6MH 3CXDH 1C1EL 3AQZA 4X42A 3M8RA 1NC4D 3J2PA 5CCMA 2HKHH 4QRUB 4JV5F 1EXUA 3IWVA 1R6VA 1RZJC 1SIWB 3ARGA 4CVUA 2YBVA 5KFYA 2AXGA 4HEPA 1OAUL 4LNRA 5EBLA 1U8PB 3QWOA 1TZHA 4DZDA 1S12A 1TKTA 3UX9B 2PN5A 1FNMA 5M2UA 1W15A 3HN8A 4JI1J 3NESA 1YN6A 2Z7WA 3GZQA 2ZKHH 3RFZA 1DJ0A 1EZSA 2UZXA 2ZUXA 2VW4A 4KXZH 1HIYA 5DURB 2JSXA 1OIOA 1Q72H 2IG2H 2R2EA 4IGBB 4LCCA 1NIEA 2EC8A 4U2YA 1HYSC 4LLMA 2OCCB 3VGFA 1WHXA 2B9WA 5IUCA 1AG0A 2IQAA 2LU5A 3HG0A 2YOCA 3H4FA 1KTCA 3RWFB 2LU1A 4ZFZA 3V8CA 1TQLA 5I8CA 2JZ5A 4V1DA 5T1KB 4GVBB 3DGGB 4AQAA 4HIXL 2DGWA 2XNAB 4NYLA 1QFOA 4Y19A 3EJTA 3NSFA 1YEJL 3ZKNC 4PJ8B 2JJVA 4Y6IA 4IKLA 3UCGA 2BJ1A 5J6GB 5FKAB 4ZPWR 1DLHA 2R4FA 3CDGA 5C0CD 1HI6A 1WP6A 3GKWL 3X2QB 4UV4L 1EK3A 1ANUA 1J1PH 1U8QB 3SBWA 2AW0A 3SDDB 3UABA 1DHKA 1RZFH 2VMFA 4DV6F 3ARDC 3T0EC 2EACA 4JV0A 4K50A 3K4DA 2ZKMX 4HULB 2VQTA 5GS1B 1WG5A 4MNQB 1T2JA 3FCBA 4NX0A 5EA0L 4AITA 2K1MA 3WIHL 3NL0A 5JXAH 5KSBB 2ZWOA 1M5KC 3V5DA 4ACPA 1UB6B 4M93C 5GJTL 2LQJA 1KXHA 4Z77A 1YEKH 3EADA 2ZCKL 2DMCA 4UQ3B 1M5OC 1KXQE 3TZYA 2WZ5A 3IBWA 3RA7L 4DR1J 2VDQL 2V6HA 3S97C 2YD1A 1HYRC 1CIDA 1OTTC 4K4KA 2GT9B 4X99B 1Q0XL 3GSRB 2WQXA 1SOKA 2FT7A 4R0LC 1GIGH 2FBJH 2YEZA 5F7DB 2V34A 2QADC 4N90D 5F7HA 5BRZE 4XNXH 2J8HA 2HRUA 4XMUA 4NA3A 3CSKA 2WBJC 4OCMC 5I15L 4XPEA 2EC0A 3ARFA 3RILA 4FOMA 3HG2A 4FDWA 3PY9A 4P9SA 3HVAA 1O5DT 2CPDA 2K3KA 5IFMA 5JUMA 1YG0A 2ROGA 3TONA 2VUYA 4NO0A 4HSQA 2FNWA 3N1QC 4HDGA 2YBGA 2VJ0A 1W7WA 1FGNL 1VQ8S 5KG4A 4OFPA 2QTVA 2LQ9A 4ED2A 5CIPA 1FFTB 4CVWA 3WIIH 1FNEB 5KUMA 1B0TA 2ZH7A 2DR5A 2CNZA 4G8FB 3FO2A 5GADU 4PW9A 2KYIA 2WCXA 2G2NA 2HVKA 2R51A 4X7SL 1I1AD 4A7QA 4P73A 4B0MB 4X64F 2BE7D 3ESUF 4NFCA 1ADWA 5JIHA 1PFCA 5HHOA 3D39E 1J10A 2V2TA 4FABH 3BAJA 4WENB 5JUEH 2A77L 2QZ8A 1Y6MR 1IJFB 3FUNA 3LQMA 4PWJA 3UBXB 4EE2A 3WD5L 3EDKA 2QA1A 1RIVH 5GGRA 3CGIA 1ZANH 2X3BA 3HFVA 2KC0A 3NGBB 3BEVA 2IPKA 2PYFB 1NCLA 1UOKA 5FO7B 5HHVL 4E9RA 3N41F 4XMKL 5DQDH 2P8LA 1RD6A 4XIUA 3OVUB 1GGCH 2HKFH 1KV3A 1MZZA 2ATPA 3QXAB 3UTPE 5EIIB 5I1GH 3ADAC 3VX1A 1DCLA 1PYWA 4YIQA 4QYRA 5KT7A 1N18A 2M8XA 3A0OA 4FFZL 4OX9F 3OVAA 2WXMA 3VRIA 1XH0A 4K0KF 1GTNA 2QMJA 3JXAA 4DV2F 1X9SA 5C0JB 3QRPA 3RBDA 3UG3A 4E2FB 1BBDH 2TRHA 1BYPA 3S37X 3TYFB 4LLDB 1GZHC 3OR2A 3L6FB 5GZNC 1HVXA 1MHCB 2EH7H 2EK6A 2OMTA 2W1NA 5HJ3A 3HJ0A 1AR1D 1CURA 4YZFF 2ADBA 3S37L 4GO9A 1FL3B 3SYZA 4ZXBA 1TMJA 3KE0A 1A1NA 2PCXA 4Z5RB 4N5ED 5KN5B 1F97A 4QHUB 3QUXB 2XSJA 4NCAA 3RL1A 3QZNA 3AITA 4XCNA 3EFDH 4PWGA 4HUVA 4XH2A 1FTCA 4NRYA 4BHUI 5GGTL 1LK3H 2DQIL 3TIEB 4OFZA 5F9AC 4AQ1C 4E41D 2H5IB 1UYWH 4F2ME 1XIWC 3KJ4C 1UC6A 1Q5YA 3E8UL 4OZFG 1UWBB 5E70A 1AY1H 1USZA 5K9QI 1OCWH 3V0IA 1CVSC 2P5EE 4P2SA 1AQKL 2XMWA 4AL7A 4FXDA 1NGXB 1IVLA 3MNMA 4KX7A 5HI5D 3KBFA 3NGDA 4R5XA 3Q8RB 2VFSA 4Z6AT 3NJHA 4M95A 1NBCA 4L37A 2H5JB 3M88A 3V4VA 4APQD 5EUOE 1AJ7H 5EO1A 2HS0A 2C3HA 5IROC 4MFHA 3M8ZA 2BJML 4F4AA 1YQ2A 1VACB 5LGKA 3LKPB 4NC1C 2F1BA 5E6YA 3OAUL 4UDTB 4AV5A 2WSEC 4ZFOA 2IEPA 4ZRGA 3O4LD 1CDGA 4Z7UE 3N41B 5BZDB 3PW5A 4HHUA 2WVVB 4I3SL 3KPOA 1WCBA 2C7FA 3CHXA 3LX9A 4FQCH 3AGWA 1FA4A 4W4MA 1W0VA 3VXUA 3MROB 5I1DA 5JA8B 1XBWA 1KFAL 3BZFA 4G65A 4PYAA 2CDGB 3VD7A 3V6FA 4ZNEE 1O0VA 1OY9A 3TX8A 4CGTA 1OTSC 5CBEB 3R19A 1IM6A 2J1ZA 2UYLA 1FJ7A 1JI1A 2IFFL 2RQ4A 4JFEA 2WQVA 1UM5L 2DNYA 2BNRB 3IF1A 1P9YA 4OZIB 1F42A 1Y7VA 4HS8L 1PZBA 1TO5A 1KPVA 2CLVA 2D2CC 3DNKA 4LNVA 3NIGE 3ESVF 4XBEH 4AQ8A 1SL1A 1HOCA 4P8QA 3LXCA 1UEMA 1ZM4A 1IR0A 1IFHL 1T9TA 1VFAA 4G7RB 4PV8B 5DMKB 4DL0C 1LKZA 3DX8A 4C3KA 4ZHRA 3QZ8A 2VZ1A 1GAFH 5IOKA 1OT2A 5GGVH 5FV1L 3D85B 1L6XA 4FLSA 4OVVA 1J9TA 1DBJL 2GBAA 1OALA 3HB3C 3LEXA 1X6NA 3A3NB 1H98A 2QTEA 3MRLA 3X13A 2UUBF 3MRKB 1J8SA 2DD8L 4OI0A 1XGYH 4AYEC 1PJ9A 1CLVA 3C6SB 3FU9A 3OKEA 1QD1A 6FABH 2KO1A 3K6SA 1R31A 3OL7A 1AC6A 1P4BL 4WI0B 4ALZA 3M7FB 3SQOP 1NSAA 1BM3H 4NM4L 2BC4B 5E8NB 5IQNA 1RURH 3HIZA 1QLEH 3MMAB 2CG9X 5IJBC 4HUCA 3PIOQ 4FRWA 3BSOA 5EU3A 3U1LA 1Y5IB 1MY7A 2JF1A 1T0OA 3Q43A 5PCYA 4WIQA 4XPAH 1TV6B 4DF8A 1C16A 2UZYB 5IESL 2FQEA 1BVKA 2RJMA 2RFXA 3QZMA 1BF5A 4JY6B 4JZNB 1COBA 1N8ZB 5MENB 2C7UA 3DUSA 1JGDA 5DMYA 2QC3A 5F0JB 5H9EK 3RWJA 5L2KB 3JV4A 3X11B 2G2PA 1MXGA 3ZL1A 1G1OA 2J8SA 4XTTA 4DV3J 4FQXA 3TJPA 2ZITA 4KH9A 2R8SH 1IFRA 3F5WB 4D8OA 1VRUB 4D9LL 4HCGA 2VFTA 3EGVA 3FSZA 5DCCA 3BREA 3JS9A 3IS9B 5EOQH 1SJHB 3C6EA 4CW1B 5F8GA 2GHZA 3MXHP 1UD5A 4BDVB 5I0XA 1NMAL 4R7DB 2Q1LA 5ACZA 1U6ZA 4WTXA 5IQ9B 4G83A 3ULSA 2JE8A 4Q6IA 3N43F 4PBVC 5E8EB 2ED6A 4YPGA 3CDCA 5SWQA 5IIEA 4UT9A 1FBIL 2O1AA 3ZE1F 4UINL 4DEWA 1JSYA 3RDTD 2RR3A 1M7XA 1QAIA 4AEFA 1I9JL 1QLRB 3CX5J 4OIFA 1H15B 4TS6A 5BUAA 1TYJA 3CN2A 1IGTB 5FYLE 3TUZC 2E6PA 3BUPA 3ESOA 3QUYB 2OI2A 4P7TA 4MHHG 2WOMB 5TFSL 6FDRA 4ZW3A 3U4EA 2Q3AA 1SQ2N 4DU8A 4DSLA 4P2AA 5AKVA 1MFBL 4O2EA 3BZQA 1RULH 5EBMB 1HHJA 2UUCF 5D72H 5E03A 3VB8A 4NLRA 2CKBB 5KAQG 1GOHA 2Q3ZA 1HH6A 2V6AA 5TDOB 1U41A 2D2OA 3IE4A 4QTHA 1T0NA 3POTA 3HPOA 1LP9F 4BWUA 2VPXB 5BMFL 5EZJB 3CXFA 4FP8L 3MGAA 2XSFA 2EO7A 3NIFB 3QEQE 5AVVB 5C0EB 1X0PA 3TNMA 4LSSH 4DUVA 3LH2H 2VR7A 1L6PA 1QVOB 4YQWA 4GKSA 5EGYA 1M1SA 4XN2A 5LXVA 4QIRA 2VQEF 1AXSA 5CILH 2CHXA 4MKYA 4NP4H 1UH4A 1M1XA 4NQDD 2LE9A 4H25A 4PRNB 3QNZA 4BSJA 1FNGB 3VXSD 2HX8A 1FX2A 3WX4A 2J4WL 4K8RC 4PJ5A 5JNYB 4F0MA 4MQXC 3SQGA 4PRPD 1AE6L 4TLTA 5CH7B 3KK1B 1UTAA 1WWWX 1A14H 2L4OA 4OJFH 5A7EA 3PYEA 4JM2F 3VFMB 2VERA 1ACCA 1P4UA 2OEJA 3ZFVA 5EPMA 1S1TB 2HRPH 4U7MA 5ICUA 1ZVHA 4L8SA 3MBEC 3W9EB 2GVZB 4JYAJ 1UZ8B 4OAWB 1TVHB 2A9DA 2G0LA 4JPWL 4MD0A 2BY1A 1HZKA 3PW4A 4DR6F 1ASOA 1JXGA 4FCAA 4LSPH 2MEJB 2UVFA 5D2NB 4DQSA 1GYCA 2Z31D 3KXFE 3MCLH 4IBUA 5GGSA 1S7RB 5IG7B 4K9EC 1CFQB 4WKZA 4XC3H 1NHUA 4CILA 3UN5A 2NY2B 3MVSA 3FPYA 5CF3A 1SBRA 1FV1B 5IB5B 4S2SA 3KXDA 3O6FA 2BSSA 4L4TB 1UT2A 2EVJA 3QIBD 4URTB 1JLEA 4FQLL 4MJIA 4DPCX 4XNMA 1N5SA 1ZEAL 4JRYA 3PL6A 4IQMA 2PP7A 2CO2A 1N64H 3T1FB 2PLTA 4Y4HB 3OJ2C 2MNUA 4OYAA 1CQYA 3V4UL 1CZ8H 3K4AA 4YEFA 3Q0HA 1B0GA 5T5NF 3H2UB 1LP9B 1B6UA 1NC4B 2BFVH 3CN3A 4FNSA 4DX5A 1P1VA 2F74B 2ABYA 4YJZL 1PKQE 4XO0A 4DL5A 2VDNL 2QT7A 3T5JA 1X60A 4MLIA 5I5IA 1RFDL 4XMWA 4P5TC 4RNMA 1FFPA 1I4FA 2X0UA 4YBHA 3UBFA 4I6AA 2IMNA 5J1EB 3OR7A 4BDPA 4DR2J 2ACYA 5MI0C 5KFIA 4ZIWA 2W2PP 3TIDB 3IMQJ 3FUHA 1FIGH 1QSZA 2Q8AH 1DQQA 1WZLA 3OTOF 4Y89A 2GUOA 2M1KA 3H2VE 3Q9QA 4OGXH 5IW6B 1FH5H 2J6EA 3U0PB 3WE6B 5LLIC 5B0GA 1E8WA 4WTOB 3MNWB 3M1VA 3D87B 1QSEE 1OAYH 1KN2H 1MJJB 3DYOA 3ULVL 3EDEA 3N6NA 3EOYG 3I9PA 3OTTA 4ETXA 1DTQA 4CLSA 4HVBA 3UCUP 1FK9A 4V1DD 2DM3A 1XAUA 1WT5C 1X7VA 1H3PH 2BOCA 2FJAB 3TO4C 4N9GB 1YK9A 2HFEA 3S36H 4FFVC 1I6JA 5J6HB 3ULHA 1U1PA 1IAII 1MLCB 3FU7B 3MBXH 1KB3A 1KC5H 1ACYL 1YEWA 4E9LA 5C0CB 2ZX5A 3ET9F 1YN7A 4UYPA 3VM5A 3BCFA 5KVFH 2FLBT 2APSA 5EOCH 3WL9B 3A23A 4QIWD 4RMBA 4L3AA 1JLAA 4GG6A 2FJHB 3IG1B 4TUOB 1ED3B 4AQEA 1QABA 3HBGA 2I27N 4IRZA 4X6CF 5I1EH 3C60C 1Y4ZB 1OGTB 4MMYA 3KK2A 2ENJA 3BX7C 3OKYA 4NENA 2Y1VA 2JEGA 4P23C 4M1DL 1VRSA 3CFKB 4L5FE 1OSYA 5F1OB 1IWGA 4M8QA 3TBCA 3ZKMD 4NRUA 3TA3A 2VC2L 4CU8A 3FPXA 3P0YL 3P9LB 1UVMA 3MACL 3OTEA 4EEEA 4M1GL 4UT4A 3ETTA 4MCZA 2X3GA 1AGBA 3K71A 1I85C 3ENEA 1KTDB 1FDAA 1NCHA 2G5BA 3MXWH 1TKXA 3RWHA 3ZHDA 3PLYA 2P9EA 4L72B 3L7OA 5DD5H 1THCA 3B8YA 3HE7C 4OLUL 5A6WA 1KNOB 3UVJA 1RK0A 3MFGB 5IOPA 4ZPTR 3FEZA 2KT6A 1NJXA 5DUBA 1RAHB 4CDIA 2YGQA 4OJEH 4BFNA 2I6WA 3I6KB 3IRZA 1S9EB 1CC8A 3BWZA 1MLAA 4XGZA 4I1PA 3QFWA 4HFUL 1LW0A 2PYED 4XK8C 4NO0D 3KGSA 1RP5A 3BKCH 2X1OA 4ZTEA 4QCIB 5KFEA 4HF5H 1B9KA 1QAWA 1KCUH 4HT1L 1A7OH 4KV5F 2ZYRA 5F1IA 2ZX8A 2QQLL 5I1LB 2FWOB 1TT6A 1SVDA 4U1MB 5I18L 4JI0J 4CVXA 2LAAA 5KAQF 4JI2F 4PJFB 1IAKA 2J25A 2XVLA 4FN5A 1I1AB 5HYEA 4FF9A 1X7TA 5MEOA 4LFBJ 3L17A 3H8NA 1DSFL 2FH8A 1TR0A 3NFSH 4I9XA 1KJMB 4V11A 1KBBA 4ZA1A 3L2LA 2A5UA 2AJUH 2FNBA 3EBAA 3M46A 3VGHA 5FPIA 4AC2A 1P6WA 5C8JA 2M9KA 3CZGA 1U36A 4JQIA 1IC4H 2CPZA 4I7FA 1QFPA 3BO3A 1FJEB 5E6IA 1SUHA 4YPJA 4FJYA 1RBAA 4Q44A 1RUKH 2DYAA 1P7KA 1SJEA 4IIQC 4AIEA 2FGOA 4PCTA 3TP2A 1WZ1H 5BQ7B 2CO7B 2XWZA 4B50A 2ROXA 4F7PA 3JWDC 4X6CB 4M61B 2V0NA 2VUOA 1BQNA 3RWIA 1KCRL 2GTWA 1EA9C 3KYMA 5E2WH 4RMQA 1A7BA 5KANG 2NZ9D 4R4NC 2YKMA 2Z3FA 2KL6A 3MR5A 2AXFB 4OZFH 4DCOB 3QIPA 3HP6A 5KW9L 1ZHLB 1F4XH 2K7QA 3KWTA 2GHVC 3BIKA 3MM7A 1ZTTA 5E9DA 3SDAB 4G5ZL 1ZXQA 2O66A 3MMBA 1Z3GH 2AJ0A 4Q56A 4RX6A 4EN3C 4LSTL 4HUWB 5HYQB 3Q2VA 2DPJA 1P84K 2DQUH 1FP5A 4B3RJ 1V3JA 4KFBA 5J3HD 1D5BB 1A7QH 4L4VA 2I9SA 3BGFA 3E8OA 1CICC 4HH1A 4E41B 4GUCA 3SDXE 3GV8B 2VIRB 1MRDL 1FKOB 4D9QD 1DLFL 3E8VA 2OMUA 5I1AB 3PV7A 2RF2B 4C0BA 4DOZA 5DU7A 1HWLA 1I3RB 3I3BA 4GSQA 5KG3A 3PR4A 2HVBA 4NQSA 2ITDA 4HGMA 2VFRA 3WQPA 1CO1A 3QUZA 1IAIL 4Z95L 2K1RB 3ZNUA 5I19H 3CJRA 3I4HX 3MZIA 2TSBA 1NGWA 4KXZI 2VG6A 5TQ0L 4QIVA 4GKKF 4N28A 4X7DC 1D7DA 2FEDC 1HHKB 3MODL 5KVEL 3O6LH 4U1LB 1ZGLB 4K5PA 1L3NA 2AGOA 1RXOB 2WIIB 1KJ2H 1GRWA 5KS9B 4XCCL 1HBNA 4HI1A 4L3EA 4APQB 1VFUA 1GCYA 1C5CH 3U7YL 4HD5A 4Z7WF 2V69A 2X3DA 4WUKL 4RX4D 1H74A 3F65A 5F0WA 2G3ZA 4GAJH 2O26U 4IK7A 2KXFA 2XMMA 3WFHA 5I1HH 4QHPA 2CLZB 1GVIA 3QXVA 4F04B 1YI2S 1CDIA 1KY7A 2HJKA 3M6DA 4U3SA 4CO2A 4DGYL 4FP9A 4O3NA 4PFEA 2DEYX 2O5ZL 2DMKA 5IK3A 5F9JB 4L1HA 43C9B 2P26A 1N3NA 1E9QB 1IMHC 3ECUA 4NUPA 3ZSSA 2EVGA 2PWHA 3FEXB 5T3XE 3BYRA 3CHRA 3LRSA 3I5BA 3MJ8B 1IEHA 4GAGL 1BQSA 1GS7A 5F7EH 3CTRA 4XPBL 3ZTNH 2F4VJ 2A2DA 1KIRB 4X5WA 4Y4FB 3LP1B 4CO5A 1MJ8H 3F7YA 3FNKA 5DK2B 2Q86B 4NQEE 3II2A 3RTLA 1ONQA 2GAGC 3ZDXE 2BVOB 5CZXD 3KHRA 1FJGJ 1ROWA 1EMTH 3LRKA 5HLFB 1EPFA 4JJOA 3EICA 2XWTA 2DHHA 4JFDA 4HACA 3US5A 4DQIA 4G8EA 3G3LA 5E1GA 1P27B 1RABB 4WU5B 1KEGH 2E59A 4Y16B 4LRBA 1FERA 5DUPL 2OJZH 3FZ2A 1IAOA 4KAIA 1UFKA 5BYRA 4NLYA 2QL1A 1OGPA 1RZIB 2W94A 3OKLB 3B3IA 3OZ9L 3ZE2E 1NGPL 3EYSL 4PRAA 3ZYOA 2BS9A 4NZTH 4C48A 4O4GB 1XMQF 3HHEA 4HS6B 4M3HA 2BP3A 4KHTL 3WGVB 2FJGA 1LHZA 3MOQA 1NUFA 1BGXT 4K7QA 1KY6A 1HEHC 4WI8A 3JTOA 5KJRH 3PFQA 3UYRH 4RWYH 1P1ZB 5I6MA 4B9UA 1CPZA 2WSDA 1YECH 2EUVA 5IC4B 2PA3A 3D0HE 4KKOB 5L9NA 2Z0UA 4P0DA 3O81A 4OTXL 4BSWB 4XX1G 1M71B 1T66C 4IBQA 4Z3GA 1RA6A 1NCGA 1MUJA 1T04B 3L3KB 3DLBA 1ADQA 4UV7H 2QPUA 1KD1T 3DMMD 3HAEA 4YHNA 2R8HA 2FX8L 1ZPLA 4LEXH 4ZFQA 1FYHB 1VHPA 3FB6B 2YOAA 1K4DA 2J56A 3MGOA 2AD9A 1UVQB 4PP1C 4F58H 5DWUH 2F5GA 2V94A 2FR4A 2BSCA 4HIEA 5HDOA 3M9NB 2EDYA 4RIRA 4ETYA 4NZDA 4KZDH 2V50A 3MCYA 4G6AD 5IMMB 2XHWA 4U67Q 3D67A 3HI9A 4LHUD 4OZGE 4ONFL 1IM3A 5EN2A 5BV7B 4PEOA 4DV5J 1DBML 3KYOB 5G2NA 3HNSH 4PJCF 3V7AE 5I8KH 1QRND 3MV9E 3OV6A 3OKNA 4NO2A 1PZ5B 2VZVA 4TNGA 4YHOH 1C9SA 3BBFA 4KGKA 3ICLA 2BNUB 4PYDA 2Y5TA 5ETQA 3PKYA 2YAMA 4TXVB 3LMJL 1YEIL 2A6KA 5E5MA 1MJ7H 1TR7A 2W65B 5ID0B 1UEKA 4HSAC 5AE2A 4MS8D 5CJ8A 4RGOH 3RJOA 4PRDB 3VYNA 3ENVA 4LF8F 4A48A 2HKHL 4GKNA 1NCAH 3QT6A 2D9QB 5HYIA 3SY6A 1UGNA 5F6IC 3DI6A 1QQDA 3DJZA 3FB5B 3MAAB 1LEIA 1MCWW 4KTDH 1T8EA 4FXKA 3UP6A 3C16B 3HG1B 2ZYSA 4IOSA 4B9CA 3LGNA 4KGXB 2Q7AA 3EH3B 3Q8CA 4WCYH 3CUNA 4F4WA 2JTDA 3MM9B 2FZ3B 2ZKWA 1WORA 2HMIB 3D50A 4A68A 4U7KA 1YJTA 2HK2A 2DR8A 5J1SC 4XNUH 4PP2A 3VWJC 4ZQTA 2H26A 1KB5A 4F15B 2ZUQC 1QUNA 2J1XA 4Y1AD 3U9PL 4CMMA 4L1BA 3VTIA 2WBMA 3CNKA 4BK4A 1NAKH 3QQ3B 3CSYB 4NN7B 2CO6B 3CXHJ 3II3A 3MEEA 4P5MB 2UVVA 4S1SL 4UTAL 4ZUSA 1DQ8A 2J71A 2WLLB 1ECYA 4Y5YB 4ES1A 3QQ4B 2AERT 2YMTA 3CO9A 3RBXA 1J12A 1QG3A 2IC2A 3VFTA 4ZD3H 1Q0NA 4AIZB 3D12B 2F53D 3PWLB 4F9PC 3UE2A 5IV4A 4PCYA 2LR4A 3PYDA 4NQDB 5LWYL 2OFHX 4XXDA 2PXYC 4N2IA 2FD6H 5EIQA 4ZP9A 3VXSB 4PI2A 3R2DJ 1MRCH 5TE6H 2V5RA 4GG8B 4PRPB 3BSHA 3I0SA 1FLTX 2XHNA 3K5OA 2UU9J 4YHKH 5B7MA 4L18A 1Y0HA 2JH3A 3UBGA 3U36A 3F41A 4L05A 5C6TH 1T3OA 3BH9A 1WO2A 3GB7A 1G7CB 2AJSH 3TAQA 2DEIA 1MSWD 1LE5B 2WVFA 5IM7A 2X4PB 2IH3A 4HUNB 1QEWA 2NY4C 1WWCA 3CN0A 4OFVA 3INUH 3FO0H 3BPCA 4K0OA 1CXLA 4MMXC 4U6XB 4JG5A 5HDBF 3FJ2A 1ZTXE 3K91A 3TH4T 3N85H 1JLCA 4ELVA 2Z31B 3HI6L 4U0QB 5ITBH 2AZ1A 5FLXY 5J2MA 5CWSB 4JW3A 4JHUA 2AK4A 4DEPC 3CLFH 2UV3A 3GFYA 2BKPA 3HG4A 3UZEA 1HNIB 2F8IA 2YKQA 5L38A 1RT5A 3WZ0A 4F33B 3KMDA 4P2CG 3GBNL 4B9GA 3EMTA 1I3GL 3O6FD 3QIBB 3SE4C 2CRLA 1S0MA 4A8QA 5FOJA 3MX0A 2GI0A 2WUBH 2CIKA 3PL6D 5CZVH 2MRYA 4AK1A 4JN2A 2XY6A 1KDIA 1M1GA 3KM1A 4UTBH 2I5JA 3IRPX 1GPOH 5KYUA 3OV7A 5I0ZA 2W4CA 5HI4C 5C0AD 3ZOAA 3FKUS 4ICLA 5B3SB 4NMLA 4ANUA 1M1HA 4I77H 2Y5QA 1TUVA 1KGJA 4YHMH 5D6CA 3NYKA 1CQNA 2EC2A 3Q6GL 1FZJA 1A2YB 1NBZA 4PJDE 3PWPD 5DZLA 3QZOA 5JUEL 3VQ2C 2BANB 3EJQA 4IMLB 2ZWZA 3UYPB 2COVD 3O11B 4U0RB 5I66A 1XSOA 2RJZA 3W81A 1LW2B 1S7WA 1NSPA 3P0VH 4X5PA 3MNZB 1GMWD 3AOAA 3A3YB 1TVDA 3QBTB 4EIGB 1EEZA 5JMOC 4KKAD 4U6YB 3P11L 3Q22A 2G75A 4H2AA 3F83A 3IFPA 4NPYA 2TAAA 3D07A 1ZDQA 1CE6A 2I25N 4UQTA 2KRBA 4F4YA 3QPIA 1OK8A 5KYYB 2J44A 2IA0A 2O67A 4X9BA 3ATBA 4KI5E 5IHWA 1BYOA 1PNCA 3C75A 6PCYA 1E4WL 5LBSA 2ADFL 3EWGA 1UM6H 4OMFG 3UD4P 2ZXAA 4F8OA 4MKVA 1CK0H 3SCMC 4OI4A 1ZTMA 2EH7L 4TL4A 1Q8KA 4UNVA 3V10A 3VX0A 3FAXA 4PH8A 3QFJB 4Q2ZA 4XRCA 5D2LE 4U7UK 3MA7B 3NDZE 5DJ8A 3FFIA 1S7QB 4AG4H 4RW7B 1P1TA 1S9VA 3L4XA 4I18C 3GMOB 3Q2SC 3MGTB 5AYUL 2R7UA 4ER8A 4F80A 3EFDL 2F54E 3CCWA 3BJLA 1LK3L 3MOZA 5TPWH 4LSDA 4I67A 5D8JH 4FFYH 3QT5A 2C2MB 4MXVE 5C92A 4CU6A 1RYSA 2WLHA 2N7BA 5A6MA 2N56A 3GEWB 3L3HA 1A3QA 3GMMA 4ZOEA 3CJKA 4QF1B 4BA8A 1YX2A 4HCIA 4JI8F 3VW3H 4X65J 3GT6A 1GCFA 2KDYA 4F91B 3O4LE 2A6DA 4E0RB 3BT2H 5DD1L 4LLYA 2XRAH 5AENA 4OIXA 4GKLA 4ENEC 1QO3A 5L88H 4AZ8A 1E50A 1LE9A 4LREA 3QK0A 1FZMA 3GV5B 3IAGC 3QZWG 2F8MA 1AJ7L 2WWOA 2BRRL 1SHXA 4UANA 4X4PA 1DVFB 1F90H 2PYEB 4MXQD 4KKCC 4Z0XB 2MSTA 3MRRB 4JHZA 4Y9EA 1JTTA 4PB0L 3ZDZF 5KT5A 1AACA 2HHPA 1A7PH 3B9KC 5HPOA 2XIIA 1IT9L 3SE9L 3H55A 5E4AA 2VQ1B 4JI7F 5F9DC 1W26A 2C1PA 2HVHA 4OX8A 1T22A 3AWFA 3QG6B 3OHXB 3EF7A 1DQJA 5AVXB 3RUBL 3GMPA 1IC5H 3QDGD 5HGHA 3GSQA 3ESPA 3DX6B 3OL9A 4P48A 3OJVC 4L3CA 3MM5A 2TSAA 4MMOA 3W0WA 2G3MA 4LRDA 5AB9A 1A1MA 2IOMA 1ODAA 3IFNH 4LARH 5KYWB 2V8HA 1QFWI 5BRQA 4GAYA 3WE1A 4WUUD 5IJKC 4IRJC 4DIXA 1CIUA 4K5RA 1MCRA 1HYSA 3ZMRA 1TZGL 1HBUB 4RMUA 2KL8A 5E6ID 5DDHB 5E00A 3OG6B 2CNOB 4H8QA 2CQ2A 4E9XA 4JUZA 2KN4A 1LO2H 3EZJB 4YDKH 4WHTA 1JNNL 1Z5LA 4D9RE 3RKDC 4P71A 3DV6A 1QOKA 3BSZH 4KNSA 1M6OB 3HFML 1FDLH 3UGXA 4KXDA 5IFAL 1O51A 1YITS 3AWGA 1FHTA 3ARSA 2P80D 1GGUA 5FD1A 1WGVA 3CIZA 5I6NA 1UZGA 3H2LA 4YBLB 3GGWA 2YKLH 2GZOA 4LVOP 3BPOC 4G5AA 3TJHD 2RMLA 2NOYA 3W37A 4ZPBA 2VICA 1T1WB 4FQQA 1JFHA 1LO4H 2YKAA 3OFEA 4KIAA 1FYTD 4RMSA 2XQBL 2ERRA 2WO3B 2FHOB 1EJ8A 3ARDA 3T0EA 5GXBB 1XGYL 1Y00A 4X2UA 5E5UB 1JK8A 1NDMB 2VZTA 4GNKB 4M9OA 5KVDL 3M1BA 4CO0A 1KBWA 3L3DA 4DV4J 3MUVP 3Q3GA 1S7XB 4QIGA 1AR2A 1QLEL 4R83A 2AV1B 4ORGA 4C4KT 1P5VA 4L4VD 5CCHE 3UH8A 3KLGB 4JPSA 2C9SA 1DQLH 3UWTA 2YD5A 4NWUH 3HG5A 3RURA 2FJDB 4HT5A 3B4DA 4ZUUB 3P4NA 1NAMA 4L9LB 2R69H 3DRTA 4S0HA 5A2KH 4R0LA 3PGCB 2F9BT 4HLEA 4DR4F 5IQMA 4HT7A 4HWZB 4DQOL 4FTVE 3LKNA 2DBBA 2V17H 3UC0H 5DG8A 1BQHG 1J48A 3QUZD 4JHAH 4JO8A 2WBJA 2GNKA 3FQXA 1P7QA 2ZNXA 4OD1L 2UXCJ 3SDCC 2A4EA 2QRRA 3IXQA 1U45A 3MUJA 2DIJA 4HHAB 4S10A 3S8WA 3DK0A 5C08D 2NREA 2E29A 3GFHA 4P4KA 4PJXA 5D9SB 1WK0A 3SCJE 1PG7H 1QD0A 3OC5A 4L3ED 1MHPL 1ZS6A 5GS0L 2ENYA 2BXJA 2DIAA 3I56S 2WKOA 4MSWA 1G4MA 3OGCB 3VXQA 3NAAL 2OPRB 5CUSL 4MCYA 4ERSH 3NSXA 3EOBA 2ZIDA 1RUQL 3VAFA 1V7NL 4QRAA 1G5GA 4C54A 3D1OA 4OYOA 4DL7A 3KYKL 1E40A 2BIOA 3QARA 3J81j 3DPBA 3OLBA 1KVIA 3EGSA 1NFDE 5ESVB 1MW0A 4JG9A 2Q76A 1NSNH 3DLEB 1ZHNB 2OH2A 3RZCD 4S0MA 2BIMA 2CADA 5B08A 1GOGA 3WNPA 3EYZA 3U2SB 3RRQA 2CM5A 2BX5A 5EU5B 4LL4A 1RHUB 4OQ1A 2VJXA 1AQDA 5B1CA 4C56D 3RWDA 4G43B 5HI3C 4JFFE 4CLKA 5C2GA 4NSKA 1N88A 4KRNA 3LH2L 1Z7JA 4CNIB 4X8JA 2P8IA 2ORBL 3JYTA 4MDJB 2MWCA 2P9RA 3ECWA 5CYMB 4CSZA 3K2KA 4PHZA 1JLBB 1SEBB 4AEHH 4LU5H 3MC0A 3F62A 3KMSA 3HN3A 1GZHA 3KPNB 1XCQB 5DC9B 3TJEH 3PS6A 3MRDB 5GZNA 1KKHA 5CLZA 2HWHA 4PQUA 2D7PA 3IPEA 3L5XL 4Z76B 5FYJU 2MEWA 3FCHA 2LFVA 4B9SA 4XOBA 4YZWA 3MCKB 3SKUD 4ESKA 4XPCA 4G3IA 4P59L 2RH3A 2VU5A 4G1QB 1QFWL 3G08A 4MAYC 4QRRE 5K9OB 4TSAL 4WHDA 1DEDA 2MIZA 1K6QH 3OKOA 3VVWA 5JHDB 4BQ8A 1NB2A 1IL1A 3TN0D 1RHRB 2HRPL 2MB0B 2CHWA 2DQ6A 2NY0D 4N2BA 2ETWA 1UJ4A 1G9HA 4AQ1A 3G96A 5AVZB 3DMMB 1XIWA 4M5YL 3SHSA 3RWGB 2VFUA 2X2JA 5JPNB 1FD8A 1D5IH 4MJ5B 4XOCA 3OZKA 5EIVA 4LSPL 4H5SA 3OX8A 1S76D 1IIIA 5KT4A 2GIYA 4JI3F 3MCLL 2BZ2A 1YPZE 1BX2B 3N1GC 4YNYA 4JKLA 3SJVA 5BS0E 4PJBB 5IREA 4LHUB 2XLKA 3FNNA 5F7NC 4ECUA 2AJVL 1NKCA 4U1HA 5F2FA 1IM3D 2FO8A 2XTJC 3EGXA 4LFHD 4PTUB 1QRNB 4JM4H 5DZNA 4F27A 3B2MA 5BRZB 4XCFH 3ZL4L 1KTJA 5IKCB 3MWBA 1FNHA 4XODA 3K5PA 1OGSA 4K2UL 3PNIA 1H3DA 5DHMC 4M5NA 5J1PA 2OSWA 1HQEB 3OSPA 4C8OA 5IROA 4ADGA 3ZHNA 2FHMA 1N64L 1G7HA 1FUNA 3A8KA 3VWKB 2LXFA 3CFBB 2XCPA 1FFOB 2R56H 1JFQL 3N5AA 3QS2A 1OPZA 1SGKA 1TZIA 3PHAA 5DA0B 3RIAF 4DJMA 5FLXU 4HKZB 3TC9A 2XSKA 4J9RA 1IBLJ 2YBRA 4I0PD 1W9XA 4K3JH 2XI9A 5CGTA 2Z7UA 1Q94A 4AQZA 3DVGB 1UOVA 3HHRB 4DX6A 3PHTA 2ESVA 5TF1H 1D9DA 1PS3A 2FVQA 1IM9A 1RJLB 3G6AB 4I48A 4V1DE 5AW0B 4JPKH 1E27B 4QXTA 2XY2A 3VI3A 3HZVA 5I30L 4USVA 2EP6A 5HMXA 1JGLL 3A4DA 1MW3A 5EUOF 3CVHB 3PPSA 4XI5C 2Y7NA 4Y19E 4EPSA 4IU2B 3FXIC 1ZIAA 3J27A 2ZVIA 2WMPB 1U0HB 4Y2NA 3S36X 2JFKA 2A6JB 3DHXA 4GC6A 1CT8A 4HH8A 2JLEA 4Z7UF 4PWDB 1MLBB 3KHOA 4OZNA