2YQ3A

Structure of bvdv1 envelope glycoprotein e2, ph5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
273
structure length
243
Chain Sequence
b'CTRETQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BVDV1 E2
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
molecule tags Viral protein
total genus 39
structure length 243
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq3A01
3.30.70.2550 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yq3A03
2YQ3A 2YQ2A 4ILDA
chains in the Genus database with same CATH superfamily
2VOOA 2XNAA 1U2HA 3FU6A 4BK8A 2LLGA 2HRTA 1SFHA 1MFCL 3H9SA 2GIRA 5LNDA 3SYCA 4G83A 2BR0A 4UOFA 2DBLH 2FRGP 5C0CA 3OKOB 3OFGA 1RTIB 2YWFA 4JZJC 1RZ8B 2E5JA 5JPMB 2GB2A 3WS3B 2FJVA 1Y6NR 3FQTB 5DO2D 4ZPBA 3STLA 2AIRB 4QTFA 4Q2MA 1JN6B 2GI7A 2FHMA 3VDAA 4TSBH 5D55A 4G6AD 3S8SA 2NY3D 2DGWA 4DGYL 4G1IA 4N0FA 1BUXA 1KPRA 5DFVD 3MEGB 2NSMA 2LTQB 1E4KC 2VM3A 5FV2A 1T0OA 1HNIA 2GV1A 4K50A 1QAJA 2CQVA 4YHIB 3GNMH 3TTSA 3GFZA 2VDMH 3U4AA 4M48L 5MAOA 1B90A 1FLTX 3IDYB 3MYZA 4KJWD 4FMKA 4BCYA 1XR5A 3SDAA 5ABAA 4CNZA 2ESVB 2H2PD 4MHHG 3SDDB 1J5OA 2Z64C 4BHUA 2MQCA 2CPEA 2ENYA 1MEXH 2QQQA 4GRSA 1ZHLA 3OXSA 2JIXB 3BIKA 4LMZA 3WTTA 5D8JL 4LF3B 5JXAH 4XO3A 3MV7E 1PDKA 1CFTA 2BP0B 4H25B 5FO8B 2I9SA 4WZ9A 3JVGC 3LNFA 2PE8A 2DLHA 2BEFA 1I3RB 4RAHA 1KKHA 3K17A 2CQPA 4YB5A 1HXMA 2C2MB 2X2YA 1KLMA 3ISYA 5JHMA 4PJIE 3SQOP 1BM7A 1QW9A 2GW5A 5BOPA 4DQAA 4CM0A 5DVMA 4QAWA 4RH4A 3WFBH 2EKSA 2NY3B 3AC0A 5FUOL 5E8NB 4ADJA 2DRDA 2E59A 4YHHF 4K59A 3V5DB 1A6WL 2C3HA 2WP3T 3AOCA 4YHPA 2NW2A 4WUKH 5K8PA 1ZT1A 4FI7A 3PL6A 1KUMA 1F8TH 2WXKA 4WUUE 1GT8A 5IFHL 2GK2A 1EO8L 3N0PB 5L2KD 3F00A 3X2QB 2OR8A 2XQ0A 3L95X 4TTDD 4IS6A 5IHUH 3H42A 2XPGB 1JF1B 1LNUB 2QVIA 4RDQG 4UM8A 1JVLA 4YN3A 3T0VA 2OK0L 4J5OA 4L8CA 1Z4UA 3GSVA 4O4YH 4F15B 3KLFB 1Q82T 2Y2WA 3I02B 3II2A 3ZOAA 2H0FA 1A4KB 3BDEA 5EN2B 4WNQB 3P2DA 4X9BA 5L0QC 5MENA 1EP4A 5GSVA 3RVTD 2SODB 3GJFA 3EYQD 2WSEC 1HQ4B 4CQ1A 5EEZA 3LJ3A 1YEJH 4GAAA 3QDHA 4XXWC 2WOMA 1DLHA 1RHFA 4M9PA 3V0EA 1V6HA 2AZ1A 1FIGL 4JUZA 2Z4QA 7FABH 5A43C 4HZLA 1H5BA 1LEOA 3KPMB 2UWEA 3UAJC 2HVZA 4Z1PA 1UOVA 3B1TA 2AJSH 1OAZH 4JM2C 1O7DC 1EDQA 3P77B 1V54B 1F4YL 1G6RA 2CJTA 3WSQH 2EFGA 4CO2A 2RKIB 1NMCB 1IL1A 2OTWA 1Q78A 5IV3A 2EILB 3DX7A 3DSNA 4QRBA 4PS7A 1UD2A 5D7IB 2DJ4A 5I9QB 4OKDA 1SQFA 1EZSA 3KK3A 4TQIA 1S8DB 1NBZB 3KBPA 5DI8A 5JPMC 5L2KB 2MKCA 4DG1A 2DM7A 3HVNA 3ICLA 4YXHH 5IWAF 1U21A 4NZ0A 4Z7WE 1H8SA 3Q8QB 4MJ5B 1JWWA 2R7EB 1OSDA 2VC2L 4M5YH 1S49A 5T41A 2QGDA 3QO9A 3UW1A 4Q5VA 5AXLA 1GTFA 5BJTA 1ZYQA 2YJQA 3ARZA 4B9JA 1IGJA 4I87A 2A9CA 3KYMB 3OR6B 4M1CD 2LXIA 4L3EE 1KCWA 2RCSL 3WY2A 3LANA 1S6QA 2FJWA 3RY5A 3KWVA 1CCZA 2BJ1A 3AM8A 3SDDC 4Z76A 4YDDB 3MZGB 3RKDC 1G1KA 1LLAA 4KXZH 3WNKA 2AV5A 3HKWA 1DQQA 1H0DA 2GC4C 3Q6FA 3FB5B 3QQCD 4QR2A 1OD7A 4UQCA 1OP5H 4JV5F 4ELVA 2VDQL 3O2DH 3DOMA 1PCSA 3SO5A 3TT1L 3CO9A 3H3PL 3JVGA 4A37A 5G4MA 5ILTH 1NDMA 1KLFB 1OY3B 4MD5B 5BRZD 1CGTA 1EJ7L 4X66J 2V50A 4NZUL 4TMPA 5IW6B 3QWRA 3IRPX 5D0RA 5FOBA 4M6OH 1KQFB 4JO2L 1R8PA 3KPSD 5D6CA 4IKAA 3DETC 2CO6A 2N3LA 4G6AC 2AGJL 3DNKA 3LKNA 4TUJA 4HDGA 4YSDA 5E8EB 2R1YA 4WFFD 2FATL 5INDA 1F2HA 2ATPA 4QW8A 3LD8B 4AK2A 4MA3B 1N6QL 3TA1A 1S7WA 2EICA 4UOCA 2PWDA 3O81A 2XV0A 2XFXA 3RR8A 4BXVA 3V2AR 1GX6A 2DEYX 4AE5A 2BJ8A 4ZO6A 2EYRA 1IFRA 3FSAA 5DJZB 3DJRA 3ULVL 3UI3A 4JI0F 2D41A 1S9FA 1C5CL 4N0UB 5KVDE 4OI1A 2CR6A 3CJKA 3IMSA 3NCBB 1D5XA 2IBBA 4XR8C 1XD1A 1SBRA 5DUMH 1HWUA 3ALPA 1AZNA 2DNZA 4Y2KA 1G4MA 3T4YA 1YDPA 4PWJA 3HAEB 4LSRL 4XXWA 1RXOB 3GSIA 4P5SA 5BRZB 1DANT 2OMTB 3OLDA 4PPDA 3QG7L 1QI5A 1X7VA 2MQ8A 4ELMB 1I7RA 3SY6A 1PG7X 4Q0XH 4N56A 2PNDA 3NRPA 3N79A 4HMDA 4UDTB 1P1VA 2W07B 3UAJA 5LAXB 3THVA 3TA3D 5C0FB 1HKLL 4JPSA 3BW9B 1T03H 4OLOA 4JM2A 3VQSA 3ZQWA 1RZFH 5FB8B 4OZGE 4ZUWB 3KBHE 5T3ZL 3KPPB 5DC4B 5FO7B 1VQ8S 1K47A 2BXZA 3J7A1 1FL5A 4AENB 3OKOA 3MAAB 2CUYA 3CD6S 4U3XA 1RKRA 1RTIA 5HXMA 4ZP8A 4OFVA 4GI6A 5C24B 3KLGA 2ADGB 3M9NB 3F73A 4MAZA 2LFEA 4M7JL 5JPMA 3NCPA 3WS3A 4AY0A 3FQTA 4I18C 3DSFL 4Y1AD 3MR3A 1NIFA 3UJTL 2NPFA 2W65B 4JDZB 5I2IB 1FHNA 1JN6A 5E56A 2Z7WA 4IDJH 2YBVA 2GJ6D 3ZL4H 3DMJB 3EDRB 3NJFA 1B0WA 3PP4H 1WAAF 2C22A 2A99A 4ED4A 2PPEA 4LBEB 4LP5A 4P57A 3ZE2E 1CFSB 4DK5A 3MEGA 4K0KJ 2HVJB 4GMKA 3QFDB 5INCB 1J9CT 3FUMA 4YHIA 4DR1J 4E68A 3FRPB 2IBZY 3HI5L 5DZPA 3ZU8A 1VBZA 1MJ8H 2HP4A 1W9XA 4XXCC 4BIKA 3LX9A 3HNVH 2ESVA 3CB4A 3SDDA 5EO0B 3SQOH 5DG7A 2VPXB 1U9KA 2DMCA 2B4OA 4L8SB 3HNTH 1LEGB 1IAOB 1WFUA 3TA3B 5CF3A 4LF3A 4EJ1C 2G3NA 5G4DA 2BP0A 5IQNA 1VQLS 4H25A 5FO8A 2IADB 1T94A 3O9WD 4S11A 1I3RA 1M5OC 1DHKA 3IG1B 5AYUL 4A7UA 1KPUB 1TQUA 4I77L 4ZK8A 1O6VA 3H9SE 2EEDA 5F0MB 3V6BR 1JHKH 4R0JA 3NJMA 5C0CE 1XQ4A 2EEXA 5DO2A 4Y1AB 1YBAA 1RQ5A 1JSYA 3CN1A 2AYGA 4HXAH 2ZOKA 4DH2A 4FZ8L 4YHNB 4X8XA 2GJ6B 1RT7B 4ZS6C 5E8NA 3VSTA 3NCRA 3V5DA 1KCUH 1O8BA 5CA5A 1UWGL 3UTPD 1S7QB 1ZT4B 4AL6A 3LD8C 4LGSB 4M1CC 5HDRA 3PAVA 3O6KH 2AXFB 1MWQA 3LTVA 3EO9H 1NB2A 3PW0A 4UZCA 3M05A 3MBXH 1E8WA 2QYCA 4AYGA 4OI6A 1YI2S 3SFUA 4GSDL 2H5EA 2XPGA 1JF1A 2OYMA 2WGXA 4A39A 3BVDB 4I6YA 2NZ1A 2BLFA 3MR9B 3BN7A 2FEEI 3QUGA 2XLIA 3I02A 2D73A 4WDIB 2P24B 2EQDA 2N01B 1A4KA 2V4LA 4H0HB 5EN2A 4WNQA 4XK8C 2DOCA 4P4KD 1XAKA 2BSED 4NFDA 1PSDA 4GKZB 2KERA 1HQ4A 3WNPA 3Q86A 3ZHFA 3AB0B 5DJ2A 1S6OA 1PGZA 4UT9A 2F58H 4HAKA 2ZOGA 1GGYA 3WY4A 4DJMA 1VKXB 4ZFGH 4GP4B 4UUJB 1AC0A 2X2UA 3KPMA 4YSEA 5FECB 3OD2A 4Y2OB 3FQUB 2WBXA 3CSGA 4O9HL 2NUHA 4TU8A 3P77A 3HFKA 4EZ6A 5LBSL 1HD1A 5J57B 4Q52A 2V6HA 2RKIA 4XPEA 4DU8A 3C5SB 3MDJA 5AWNH 2H3KA 5D7IA 4OZIB 2H5UA 3SPIA 5IGXH 4X7CC 4RUAA 4WEMB 1S8DA 1SC6A 1NBZA 5AZ2L 1MCJA 3MFGB 5EOTB 4YMPA 5L2KA 2CAJA 3I6LD 3SDXB 2HJKA 1QWHA 2AU0A 4ZMPA 2YARA 2BINA 2EINB 4WNSA 2D9QB 3Q43A 4MJ5A 2R7EA 3WC2A 2KZZA 2CIKB 1KOOA 1V27A 3BUYB 4N2GA 4U7SA 5D7JB 2YXVA 2GCFA 5SX4I 1B64A 4K5NA 3L7EB 2QFIA 5B0AA 2XFGB 1WD8A 3KYMA 3OR6A 4FJYA 4X80L 2W0KA 1UENA 5LXGH 5D7KE 4EKXA 3JQMA 4ZAKD 4BCAA 4XXCA 3S3JA 1CJYA 3L3OB 3O2WL 3HRZA 3IU4H 4BXSV 3IFLL 5C7XL 2VBZA 4L8SC 1VGEH 2GHVC 3UDEA 4KU1A 1IGFL 2AK4D 2GMLA 1BVZA 1RHKB 3MBWB 3H98A 5C0NC 4DSEA 2QSCH 4FQIH 4NUMA 5BVJA 2UWEE 3NGKA 5LGHH 4PJCB 4DP6X 5CZKA 4XBPA 4ONHB 4A67A 3TWCL 1KLFA 3ARWA 4G9FD 2PIIA 3OL6A 3LPPA 4X6CF 1L3VA 5IW6A 4ICLB 2XX1A 4HUMB 2VXVL 4FNIA 3BAKA 3BSHA 2HRPH 4NZRL 4RDBA 2NY7H 2ZHBA 4TQPA 5E6ID 1A7RH 4AJ0A 1H6FA 3T41A 3BRGC 1QI4A 5T3XH 4ZS6A 1A6TB 1SPBP 3S36L 5EDSA 4JJHA 1DQIA 3QPIA 3FU5A 4G5ZL 1XO8A 1CF1A 2ICCA 3AS2A 5E8EA 4ZS7L 1MNUL 1OQOA 2V2ZA 5CLZA 2GVYA 4MXQC 4WI3A 5KBNC 2FTRA 3I82A 1C1BB 2DWEB 2DLFH 2OJZL 4ZAKB 5AKTA 4A47A 1E4XH 3KGSA 1TSHA 5AW4B 4F8LA 2OZ4L 1U8QB 4XX1E 3IGVA 1CDHA 3GSXB 4GVBB 3EJJX 4JO5A 5DJZA 3V4IB 5I1JL 4FQ2H 4N0UA 2U1AA 3MR5A 2WZAA 4PVBA 4XVTH 5B22A 3S48A 4WW2F 3RIFK 4Y16C 4LF5F 1OVZA 3EDDA 3QORD 2OHDA 5DWUH 5JIIA 1MNNA 4NIKB 3S5LB 3AB0C 1SQGA 3O3LA 2ROYA 4FYXB 4G9FB 3CZFB 2AQNA 3HAEA 3I5BA 5A0YB 3QZLA 1DBML 5BRZA 2R4SH 2OMTA 2X4OB 1TL4A 1UWBA 3AWFA 3WFDL 1OB1B 3DVNB 4ELMA 5JR1L 1YBTA 1N4LA 3QWPA 3RHWK 4XPHH 3KPSA 4UDTA 2W07A 2WN2A 3GTNA 4W9HC 5LAXA 3WLBB 5C0FA 1ZM4A 2C2OB 3BW9A 2PA8D 1TVDA 5E6IB 5FB8A 2C9AA 2F7QA 3NPZB 4ZX5A 2VXSL 2OMXB 3GHBH 4ZUWA 1RAOA 3KPPA 1QR1A 5FO7A 2FGOA 3MPWA 2PR4H 2D3OR 1TYEB 3FCWA 3AWEA 2NCMA 1XF4B 4AENA 3MAAA 3P5BP 4RW7A 2OTJS 1CDIA 4HFUL 2L7EA 5C24A 2ADGA 4JEGB 1UYWH 1LO3H 3RDTD 3VD3A 4K4SA 4N2MA 4ELTA 3MEEB 1T20B 4AJYV 2V6AA 3E1ZA 4NQTA 2W65A 2YMTA 5I2IA 3SIPB 3A1YG 3DN9A 4XHQA 1JJ4A 1BW8A 2VQ4A 1B4LA 5D7JC 3WUWB 4MCYB 4LBEA 3VQMA 1FWKA 3TN0B 1SF5A 4NM8H 3AB2B 1Q9LB 2HVJA 1EDYA 5INCA 5KAQF 3QORB 1B3IA 1C5DB 4G7YL 1OIAA 1J8HD 4O23A 3FK3A 3RAMA 1KN2L 1VA9A 2AD9A 4IMKC 1NGXB 2YLHA 3UYRL 4B50A 1QBML 1PC4A 1KIUB 4PPZA 1FDBA 3QT6A 3GPEA 3F7RA 3R5JB 1NUNB 4S2SB 4DPTA 3RRGA 4O3RA 4OIIH 5EO0A 1HXYB 2YNHB 4X0NA 4L8SA 2FZCB 3R5CA 1JDCA 3P9LB 3SZ2A 4R8UB 1LEGA 4L48A 2YD6A 3RB7A 2O93L 1IAOA 2WY3B 3TA3A 4D0CB 2UUDH 4TNVF 3F56A 4C3KA 2ZKXA 4JQIL 4WWOA 3HHDA 3NIDE 2IADA 5DVNA 5EBGA 5TK2A 4AMKL 1RABB 3U2IA 4XMWA 1HH9A 1O7DE 3IK2A 1NQBA 1U33A 3IG1A 1KPUA 3EJPA 1KEML 2ZJSH 1RZPA 2HGMA 5DJCB 2F6AA 4UZUA 1UJ5A 1NSQA 1M3JA 3DBXB 4Y1AA 1YQHA 1URRA 1LTXA 4MK9A 1TLMA 3HHSB 2WVBA 4YHNA 4J9OA 2GJ6A 1TXKA 5KG0A 3L13A 2EDQA 2BIMA 5CU5A 1RT7A 2CDGB 3U6RB 4NQDD 4JV0A 1QX1A 4B41A 4K8RL 3NCFB 5FD1A 4QYZJ 4TULL 3B9VA 3RG1C 1A0QL 1S7QA 1ZT4A 2ZQKA 4QUOA 1P2CB 2FX8L 1J8HB 1YEKH 2AXFA 3PDDA 5KBKA 3QGPA 3OLEA 4P2RB 2E7LC 2P9EA 1P4BH 3G9AB 4G43B 4JMXA 4FDWA 3AOAA 1K3ZA 3MRRB 3MR9A 4FYTA 1C7SA 4P23D 4XXDB 3SDEB 2HFNA 2HHVA 2ESVE 2NY4C 3RY6C 1TOXA 4JBCA 4WDIA 5BV7L 2AJYH 1RZIB 1XXFC 2P24A 4WO0A 1RE1B 4DAGH 4HIEB 3VV2B 3BJYA 1QASA 4XNUH 4XTRC 2AGPA 3KJQB 1JHLL 1GRWA 4GKZA 3IAGC 2YPKA 4ZDNA 1A3LL 3NJJA 5H37H 1SXZA 3BBBA 1AS6A 4Q74A 4RAUA 4LIQE 1G7JB 1ID2A 4WK2B 5M2UA 4RGMB 4U6PA 1VKXA 1VRSA 1ZGLP 2OR9H 3ARBD 4UUJA 2MQOA 5FECA 1UCBH 4X8GA 4U33A 2YD3A 4Y2OA 3HN8A 4HUUB 5E6IC 2RF2B 2UUTA 1OO0B 4TLQA 3DLHA 1CO1A 4W9ZA 1RHRB 1UZ6F 2PCPB 3ARFD 4NQDB 3CE8A 3R5BA 1PAMA 3VGUA 5LXVA 4KJQD 2OV0A 2Q8BL 3C5SA 3FF7A 1FFTB 2Z1KA 2ZXDA 3NCXA 3CFJB 5L6YL 3IGLA 4OZIA 2FUG9 1WGVA 4RNRB 4D3CL 3V8OA 1F18A 4O5LL 5KZCD 3KDNA 3F7LA 4WI6A 4QO1B 5EOTA 5I1EH 3SDXA 1J5CA 2HWIA 1WD9A 3RL1B 1BBDH 1NCDH 2DEXX 3BH6B 3B9EA 4DERA 5IUCA 3HZGA 2FLBT 2Z2LA 6FDRA 2MWCA 2A9MH 4ZMNA 1L9TA 2CIKA 3BUYA 4N5UA 2VFVA 4P23B 4UV4L 3LDBB 3WJMB 4CC4C 4LE8A 3EZ8A 1NLKL 4GFTB 3FMGH 3TN0C 3ILOA 5HN0A 3BSNA 2AQQA 3L7EA 5HHQB 4WK4B 3EDQB 2V0AA 3QORC 4L0ZA 1Z2ZA 2A18A 1XZWA 4YDIL 3V4VB 3SMZA 5EG6C 3QCTL 2VDHA 1ZHNB 4IMKA 1SVDA 3MNDA 2VDIA 2LLLA 2Q8AH 1KVIA 3L3OA 5E23A 4MJ6B 4ZCLA 3MLVL 4TVAB 7FD1A 5DDPC 3GEWB 1KJVB 4XIUA 3ARBB 2F5AH 2D31B 2PMHA 3JB9k 3KEDA 3ZHNA 1S5IH 4JN2B 1X4YA 3MBWA 4XMUA 3L2LA 4ANVA 3UPAA 1R8CA 3QQXA 4NO5B 1T22B 5F93C 4QPXA 1N10A 2GJJA 4URTB 1NIBA 4PJCA 4POZD 4ONHA 3W66A 1KCVL 2IAJA 1VQ6S 3GBDA 3ZKMD 2LU1A 2VMDA 3UE2A 3ZKND 2F2HA 2OL3B 3ABLB 2H3NB 3RX8A 5KZCB 4ICLA 2ZX5A 1GMIA 4NEHB 5D7IE 2MY7A 4FQCL 1M56B 4R6UA 3T8MA 4XVJL 4TVSa 2RB7A 5L2KE 2CH8A 4NM4L 3VCLB 3L4XA 4LR8A 1A6TA 1FBIL 1VQ7S 1V7NH 3HS8A 4E8UA 3T04D 4F1SA 2GAHC 4CCHA 1F41A 1WELA 1X5ZA 3MGOB 3G87A 4R25A 2M9KA 2YUXA 3KGUA 4ZAKA 2E7LA 3FQ4A 3NBNA 3ZYZA 3F64A 2J2ZB 4D0BB 3N1MC 1RP8A 1U8QA 2OW7A 3K2UL 3THPA 4GVBA 1EZVX 3V4IA 3J7AN 4J4PC 1JJCB 3D0GE 5A8KB 3NS6A 3A6BH 4HOWA 4MKVA 2AK4A 4MRCA 2JCWA 1FTRA 1HL6A 1E9QB 1QRKA 1YY8B 2GIMA 2M8HA 4O3OA 3LUYA 2AGQA 3I9IA 3FFIB 2B0SL 3H9ZA 1NDKA 2VDOH 2QRRA 4ZP6A 3S5LA 3CVIL 1IVTA 1V10A 2DWTA 4G9FA 3SBRA 4ED8A 3IPFA 4X9YA 5A0YA 4XCYB 3KH3A 2F1AA 2WAQD 3HKZD 2X4OA 5G4OA 2ZCKL 1W8NA 4HKBB 4ECTA 1OB1A 1NGPL 1R27B 3MRJB 4E9RA 2I24N 2XIDA 3G8QA 3QJOA 3WLBA 4KK9C 2R7TA 3TPKA 5E6IA 3DC0A 1YEEH 2PETA 3KCPB 1RJZB 3CVHL 2OMXA 1Y07A 4WIIA 4OCWH 5DRWA 4ICWA 3B9AA 4X64F 3WFZA 4ODVH 1XF4A 3F6IA 1VLYA 1NK9A 1RTJB 3U4EB 3EF4A 2GQHA 3ISNC 3KYAA 2ZWOA 1CVSC 3LQZB 1JYVA 2J9CA 3PO4A 2NTSP 1T20A 2EXWC 1Y1DA 3GXTA 1KFSA 1BM3H 3UO1L 3BMWA 3MV11 4P23C 4MTMA 3LDBC 5M7QA 4CC4A 3WUWA 2KTQA 4EAEA 4MCYA 3D8MA 3GMPB 2JXMB 4F4KA 1Q9LA 3CX5K 4CBZA 5L1LA 3CZJA 4HIHB 3QORA 1C5DA 2X1PA 3NCEB 3EHBC 4N0UE 3RGVC 4AC2A 2E76C 5JPNB 1EQ0A 2JLLA 1NGXA 3ULUF 5LCVH 1KIUA 3V0WL 3MLTB 3MMEB 4LGPB 1HXYA 2IBGA 1U8NB 5FS5A 2YNHA 3B8SA 4Y5VB 3UTTE 2K8QA 4HXBH 4LREA 3ARBC 3P9LA 4DUZF 1F6AB 4R8UA 1RI8A 2WXOA 4NXSA 1H2VZ 1K1SA 3PS6A 5C92A 3SJVD 4ELME 4D0CA 2NXNA 4ORGB 3VYOA 4PJ7F 2WZPD 1SH3A 4Z2XA 1MXDA 4POYA 2OEMA 4TUOB 4DQRA 3OTTA 2F9BT 1H73A 4OV6F 1YLXA 1SXCA 1PG7H 1KONA 4DR4J 2FUQA 2R9LA 1U8SA 5DJCA 1MREL 1PY0A 5EULV 5GS0L 2BX6A 2P9CA 4ZVSB 4WFFE 5F21B 4KO0B 3F2LA 4X83A 2VW6A 5GRUH 4EOWL 1RVFL 1TJHH 5KFXA 5A76A 2BJML 1A8JH 2FWLB 2YRZA 3HHSA 5DYOB 3T6QC 4NP4L 5T1KD 2E9RX 2Q6BA 3MRNB 1I7ZB 1INQB 5E99H 1YECL 4F24A 2BX5A 2CDGA 3J8F7 3U6RA 2BANB 5F0WA 5DXWA 2BACA 4IK7A 5HSPA 2W5PA 2V8MA 2OULB 3MLUH 3VVTA 4FYQA 4UMGA 1GGBH 1FVQA 2B0GA 1L3TA 5FCUL 4CADB 3AJDA 1P2CA 1J8HA 1UT1A 1V3LA 1WZ1H 4NPKA 2EIKB 3SO3B 3NP3A 5I0DA 4MKAA 3ZSTA 4P2RA 4X5PA 3K8MA 1RWUA 3FRYA 4IKIA 1W72L 5E08L 1YRTA 3CFBB 2EDWA 3NGBC 4G43A 2NY5H 3SPCA 2BDNH 2HJFB 5A6PA 2Y6SC 1RULL 4ZVHA 3W81A 3MRRA 4ODUB 4XXDA 1T4WA 3V0JA 5F9JB 4MD0B 1PU0A 3SDEA 2YNFB 1OM3H 3NFPB 3VWKC 1D2PA 4P59H 3VDBA 1RZIA 4OH2A 4NN7B 1NFAA 1OCWL 4HIEA 5ADOH 1GXEA 1CQKA 3EVMA 2EE9A 4POZC 5KJ4A 4AITA 5JQHC 3QYCA 5CNHA 2DM2A 3ERXA 4A7VA 2GVZB 5E33A 5KFCA 4LFAF 4CO1A 3T6WA 1EANA 2EDFA 5GRVK 3GCWP 4CYUB 3KJ4B 1G7JA 4DX6A 5T5NF 4F33B 1XEDA 2XMJA 3C87A 5CCJA 5F7MC 3OB0K 2CU9A 4XPAL 3VMOA 5J8OA 1CI5A 1NHKL 2ZC3A 5DVKA 3EWGA 4LBIA 2C2DA 3ZZQA 1M9WA 4HUUA 5T1KB 1S9YB 3WTUA 4UZSA 1FX4A 1CR9L 4Y1AE 4ZLPA 2PCPA 2Z31D 4NQDA 3WFHB 4M3HA 3MCKA 3MRLB 3QYYA 2PDAA 2CBTA 2GJ6E 2FL5B 2EXYD 3CFJA 1TL1B 2NPIA 2WTFA 5ALBH 4RNRA 2VGLM 3T1HJ 4OCXH 2CMRL 4PJ6A 4QO1A 3D0LB 4ZODA 4X6CB 2J0WA 1R24B 4K5RA 3S37X 3RL1A 4PRAB 1W26A 2DL9A 1AUDA 2BY2A 3MEDB 2ZJRQ 1JGIA 1WA1X 4P23A 2ZOLB 4WJG3 1S78D 4Z9KB 3T2LA 3WJMA 5A3IC 5ETSA 2BY0A 4DUYJ 2VAAB 2FCBA 4IOFD 5HHQA 1L0PA 1RZKL 4DSJA 3MCLL 5H8DA 4IU3B 3EBIA 1MJ7L 5AVYB 4FVCA 3TBSB 3JYTB 1T66D 4OLUL 1ZHNA 3U9PL 4F8OA 5E2WH 3AGWA 4RUBA 2XICA 5F9DC 1WC5A 3FK4A 4QYOB 1DQML 2RDDA 1DEEB 4MJ6A 1XWLA 1JI2A 3OQ2A 4J3UA 2H3XC 3ZYOA 1OTSD 5LMNJ 1IV8A 1IAIM 1WC6A 2ADIB 3ARBA 2D31A 2EG1A 1RUMH 4UQEA 4HJSA 1J1XL 4Y7OC 4NO5A 3QFJD 5T1MB 3T09A 1EHLL 2K3KA 3IRCA 1T22A 4ZPTB 2KT5A 4LF9J 4K9EL 4WW2B 5FYLH 5I1KL 3B82A 3R2DJ 3X1FA 2BVZA 2OL3A 2H3NA 3IAS9 3HE7D 4OZIE 3L8QA 3CCWA 3KVPA 5L9DL 4QIEA 3L6FB 1YX2A 2NNAB 4KOBA 2HQCA 4N6QA 3SDXE 2B8QA 3VCLA 2Y3YA 1JJ2R 3SD2A 4DQQA 3T6JA 1H8OA 2I5YL 2I1RA 3KKFA 3SO3C 1T9WA 3MGOA 1I9RH 1I1FB 3JTTB 4OUOA 1F4WL 5CCMA 4ZBJA 1O6SB 2J2ZA 2XZQL 4U1MA 3ATFA 4D0BA 3WU1A 5DHDA 5LNGA 3L3DB 3V9CA 5A8KA 2ZNWA 1WJ3A 2JTDA 1AMXA 1QNIA 5AAMA 2YOCA 4K4UA 4NN7C 1I7TB 1YY8A 2X70B 3QFJB 3QJFB 5THWA 3FFIA 3CZEA 2AV1B 4NLOA 3H5YA 3L81A 4QR1A 2CUAA 4NC0B 1NANI 1R3KB 4OLPA 2V2KA 4HUKB 4GAJH 4D9LL 1I3GH 2BERA 4RMSA 4F2FA 4XCYA 4PJCE 1X4AA 1IQWL 1I51B 4IR9A 3MRJA 4DPBX 2H4WB 3V81B 4Y2DB 1HCZA 3GBNH 5IF0B 1YNLL 1CL7I 2PR9A 1F58L 1K72A 3KCPA 4C4KT 3I6LE 1RJZA 2NZ4A 3FSIA 1U4FA 1H19A 1JZIA 4OGQC 1S1TA 2CXEA 3AT9A 3FJTA 4LSPH 4L5FL 4NLQA 1RTJA 3LVEA 3U4EA 4FF1A 1OHQA 2JWYA 1G84A 1IX2A 3CE1A 2HNZB 3LQZA 4MKTA 3BEVB 4XMKH 3QQ9C 4FPIA 4RGND 3TT3L 3FMBA 3I2CH 4FQ1L 4DUVA 5HJYA 2BBEA 3W56A 5I6PA 4KO6A 3VD9A 1FEHA 1BYOA 1UH2A 4ED3A 1EXUA 2EDMA 1EMTL 5F88B 3GMPA 4AL5A 2JXMA 3DXSX 3LMJH 3HLAB 3T3PF 4HIHA 2PFFB 4K3DL 4NEYA 5JPNA 1IM3D 5AKVA 4OFZA 1Z7JA 4NBXB 3TTYA 4CLFA 1MCRA 3QRLA 4ES2A 2PPAA 2ROXA 1QHPA 1MN9A 1NGQL 3MLTA 3MMEA 1N34F 1OGTB 2YGNA 1GS8A 3O8XC 1KTLB 4LCWD 1U8NA 4P46D 2M26A 4Y5VA 2Y7LA 4G9FE 1JLFA 3ASNB 4X4RA 2QVFB 1F6AA 1BREA 3PWLB 2I7SA 4OLWL 1BQLL 2VMFA 1IAMA 2WUCH 1QEWB 5DD3L 1S0NA 5EEXA 5EC2B 2DYSB 3DHPA 2MY8A 2CYYA 1NKCA 2DNMA 4TQ8A 4WW2C 1U8KB 4DV2J 3AXMA 4TUOA 1CE6B 4M1GL 4I0WA 4OCSL 5CKAA 1BEYL 1JPSL 1ZANH 3MDFA 5F70A 1WQVT 1CYGA 4IRJC 3EDFA 2MFNA 3IT8D 5E7BA 4A1RA 3EXYA 3FEYB 4ZLNA 5F8NA 5GGRA 3OKKB 3AADB 4GQ9L 4J1UB 4B9ZA 4NWUL 1EZLA 2UZXB 4AQYF 5DYOA 2J7UA 2E1PA 3IS1X 1I7ZA 1INQA 3MRNA 5A2FA 4QXUL 4K4VA 2UZYB 2BANA 2BE7D 1S3RA 1TZAA 2Y2YA 1HEJC 4K4YA 1RZ7H 3Q48A 1PZ5B 4N8VA 3FCTB 4KUZH 4ODHH 4RDQF 3FTXA 4CADA 4UTAH 1Z6JT 2DNPA 2ZPKL 3AXKA 4NKMB 1CLFA 4G8AC 1HL9A 4HHUA 3MMJA 3MACL 2WVEA 5E4EC 5IW3A 1N8ZB 4KPHL 3U36B 1LWHA 5ADPH 3CFBA 3OSKA 2R2HB 4HC1L 1JPFB 1KELH 2A77H 2HJFA 4W4OA 5HI3D 1E30A 1TVHB 4LCWB 1K73T 3NG8A 3VGBA 5M94B 1AQKH 5F9JA 1JLCB 4LVEA 3D30A 4MD0A 2AC0A 2K1RB 2YNFA 5B0CA 3NFPA 5GZOD 1BVKB 1RCOB 4X4UA 1ZTXL 2KHDA 4D8OA 5LUMA 2CHNA 1KLGB 1OT1A 2WZPA 4UBDD 4CN6A 4JKPH 4XO5A 3IDIB 3PHEA 5DQDL 5IB5B 2GVZA 1D5BB 4FP8L 3GBEA 4CYUA 3ZTJH 4KH0B 2YKLL 4FXGB 2BXJA 2XG4B 1QVFR 2JQMA 3EOTL 1T04B 2VNCA 4F26A 4Y2DC 5DMGD 3N41F 4WE1B 1MPAH 7FDRA 2VQEJ 1NDPA 3MODH 1FCCA 1DDTA 2K3HA 3HTLX 3MR2A 5AENA 3CCVS 5T1KA 1OSZB 1S9YA 2DJSA 2EXTA 3CZKA 1FD8A 2D3UA 1D7DA 3LW5C 4M63A 1S1VB 2ORBH 3RQ3A 3MRLA 2BRLA 4MLSA 1GZQB 2FL5A 3SDYH 4MXWH 1TL1A 1CD9B 3E2HB 5ITBL 1DQDL 2G2YA 3D0LA 4WK3A 4X6CA 1SJVA 4HJUA 4LPWA 3S4SA 1R24A 3AWGA 1RAAB 1RQ0A 4MK7A 5DR5L 3MGTB 1VFBB 4PRAA 4DV7F 4EBCA 4B3TJ 5FGRA 5TE7H 3AACA 1RP5A 3BPLB 1MW2A 4P2RE 1TELA 4EYIB 1HI0P 2YXLA 4HF5L 4YDZA 4JG9A 2GQCA 4PWWA 4BWWA 4OB5H 4Y19B 3D51A 4OGYL 1NC2D 1BX2A 3GSQB 3INUL 3A3NB 4KHRA 4C7QA 3TEGA 3JYTA 3TBSA 3SB3A 1LL1A 3HN3A 4GG8A 1BBJB 4ED0A 2E3VA 4QYOA 1RUQH 2D2OA 3E8UL 5DCCA 1DEEA 3HE6C 3VXSD 1CTMA 3GR0A 1RIUH 4C0OC 5H1SV 1FPTH 2ADIA 3RUGF 4XN5A 2PC6A 4E0RB 2MPUA 3QHZL 5DG9A 4HUWB 1FJ1B 1I9IH 1W6WA 4RBPK 5T1MA 1OARH 1M57B 4RA0C 4ZPTA 2Z31A 3VI4F 4WW2A 3FQXB 4ONGH 4BSJA 1OAYL 4W1TA 2PMWA 3EOBB 3C19A 2ASJA 4CU7A 2F8OA 1A7NH 1O5PA 2FQFA 5DD1H 4U6VH 1VISA 4NQDE 3TESA 4WFAQ 3PHSA 4XP1H 3Q5OA 5E8OB 1BJMA 3DDKA 4TUUA 4NZTL 5IBLC 3DDIA 1SEBB 1F6LL 2QKIA 4KR0B 2NNAA 1A2YB 1H9DA 1PCXA 2J9DA 4C2MA 2W0PA 1S2EA 3MJ9H 1NC4D 3DX6B 1UD8A 3BUPA 1FNAA 1YMMD 3L2MA 1HFEL 2DB1A 1NC2B 3Q8RB 2F63A 4HT1L 4QRQB 3K1KC 5CZRA 4A2HA 2MZJA 3FO0L 2E5LF 1MW1A 2IG2L 1I1FA 3JTTA 3HNSH 2G5BB 3FSOA 4R8WL 1O6SA 2AI0H 2MTAA 4LARH 4EDXB 1AOZA 1FE4A 4ANDA 5KVEH 5J2PA 3VXSB 2KL6A 3A0OA 1LO4H 3L3DA 4AW7A 1WFNA 2LEPA 3VG0H 1NUEA 3RX7A 1MCFA 2E7BA 2E1CA 5D1ZB 2Y3NA 1I7TA 2X70A 3QFJA 3K80A 3QJFA 1JG9A 5E8PB 2AV1A 4M6NH 4HG4J 3SGKA 3NSXA 1MW7A 3N04A 1R3KA 4ZPTR 3VYPA 4A7GF 3MOJB 3D06A 5HHVH 1Q86T 3ZKSD 4FXGC 5DFWH 3N2JA 4YB7A 2E56A 5D2NB 2KMWA 3QZWG 4HIJB 2OJEB 3V81A 1YJDL 2X6BA 4OZ1A 4Y2DA 5E9DD 3AXIA 5J89A 4ZJ9A 3AJ7A 5IF0A 5DO8A 1XEZA 2C3UA 3MWBA 2KPWA 4U7UK 4DF4A 1F56A 5E2VL 4DEUA 1NC4B 1NCNA 3ET9F 3P0YH 1CJKB 1TKTB 1YMMB 4HK0B 4KK6C 4PJ7B 3KLLA 5EZIL 2JVUA 1BFTA 3RHWF 4BFOA 1X5TA 3VD5A 2O30A 4FNLH 2CDQA 2WVVB 3BEVA 3C46A 3GSRB 1DQVA 4M7KL 3UTOA 3EMTA 3L5XH 2Z92B 1WWHA 1RXLA 2XI2A 1OANA 3BPLC 4ED1A 2E75C 1T7VA 2J8UF 4DX7A 2NYYD 2JLGA 2G4EA 3AQOA 2V9RA 5GZOC 5I1HH 1CS4A 1QBBA 1WT5C 1TUPA 1IGTB 3HLAA 1GAFH 4LSVH 2HH0L 3F6JA 4JLRB 4P3CL 9PCYA 4KQ4H 2EIEA 6FABL 5J13B 4AFFA 1BOYA 1NBQA 1XIWD 3WKMH 1WAAE 1JPEA 3ARVA 3GRGA 3WJJC 4AYEC 1CXLA 2QQNH 3TX4A 3W8PA 5D8HB 1OGTA 4J3XA 3D4ZA 3FQYA 4N2CA 1KTLA 5LDUA 5D15A 4HPYH 2FHOB 4ODTH 1MWOA 2FGZA 4HWUA 1LO5B 5DJ0B 5DMGC 2NRDA 5E9DB 3PWLA 1VFOA 3UX9B 1T02A 1QEWA 2HSIA 2IBOA 1ZSDA 2VZVA 3ZY7A 4BZ1H 3E9UA 4P10A 1U8KA 3ECUA 3N9GH 1E90A 4O58H 1CE6A 1QFWH 3IXAB 3WDJA 2FLRT 4J9PA 3MCG1 4U1JB 4UINL 3V4UH 1G94A 4WHYH 3Q1SH 5L88H 2E9ZA 3CFCL 2MPVA 3JV4B 3OKKA 4DLGA 4N1HB 4J1UA 1F00I 2UZXA 1S5ZA 1K9MT 2YOAA 3LGNA 1F2XK 2BOPA 4B53A 4CNYA 2UZYA 1IKOP 3EGZA 3GB0A 4LQ3A 2I60H 1RIHH 2YD9A 1PZ5A 3CNKA 4E5XG 5CZVL 5CIPB 4NKMA 2LDYA 2NY1C 2DNGA 4HUCA 5DETA 2WWNA 1U1PA 1N8ZA 3KG5A 3C6EA 3DC2A 1DARA 2R2HA 1JPFA 1CICD 3K6IA 3QEGL 3CJRA 4I0CC 4LCWA 2K4AA 3BSZH 1Q81T 1JLCA 3CGTA 2K1RA 3RPBA 1BVKA 1RZQA 1T5XB 4X9FA 5D1ZC 3ZQXA 5EBWB 1GC1H 1REGX 1KLGA 2AERT 4TYAA 3IDIA 3EF7A 3A5VA 3U7WL 1LP9F 4WV1C 5IB5A 1D5BA 2DGTA 1SL1A 4PI2A 1SL2A 2DBLL 3ULUC 3CDZB 1U24A 4FXGA 2QC3A 3F6LA 3JWOH 5D2NC 5FK9B 1AYOA 1E27B 2XG4A 4J23A 5IWAJ 2LU4A 1T04A 4WE1A 1AY1H 4HYTB 1RWVB 3NUKA 4M00A 2Q7NA 4U49A 3KG0A 3C6LD 1OSZA 2HLFD 4TSBL 3QULB 3LVTA 5DJDB 1S1VA 3J7HA 3RFRA 1BSIA 1E4WH 2XG5B 4OKVB 4ILMA 1GZQA 1JZ6A 3K0JA 1GPOH 4JKKA 3JT2A 4ABQA 2P9RA 1GOHA 2CCWA 3GNML 3V4PH 4PW4A 3CMAS 5A2IH 2F4FA 1MIEH 5GGSB 3MGTA 1VFBA 5FHAH 1VQMS 1CICB 1INDH 5I15H 4ZX4A 5A2KH 1TV6A 5CN2A 3DYMA 1YYMH 1MEXL 2QGCA 2VR8A 4NKIH 5C8JB 4JV5J 5GZOA 3WIHA 3AG4B 2BVOA 3J27A 1KTVA 1CWVA 4Y28C 1AGEB 2HT3C 3K46A 5JXAL 4ENOA 4P9MH 1HHIB 3RWJB 4V2CB 3GSQA 2EVGA 4AGOA 1MSWD 5J13C 2QBWA 3MV01 4PMEA 1BBJA 4DV6J 1KMGA 1DJZA 3T3MF 3GRWH 4XWOD 3RFZB 3M2VB 2GC7C 1L9MA 1SLXA 3TV8A 3U4BH 4ILRA 1NBVL 1U8MB 4LSNA 1O6TA 5SUHA 4U0RC 4E0RA 3O3AB 4CSZA 3C60C 4HUWA 1FJ1A 2CDFB 3QUMH 1IEHA 4HI1A 2BNQD 3KDMA 2NXZB 3WFBL 1C9SA 5DS1A 3STZB 2XZDB 3HHLD 1DE4B 2CJ3A 3FQXA 1ZDQA 5DHEA 4BZ2H 4HLBA 3EOBA 4KROB 2XYPB 1UTDA 4KJPC 1S7RB 1JD9A 4WUKL 3RNQB 2HPOA 1JCKA 3B3IB 5E8OA 1F8TL 1HKAA 1U7LA 1TTCA 2A73B 5TE4H 3PEHA 1SEBA 3ELHA 5AXNA 3V9EA 4D7BA 2YEZB 4YXKH 1F6TA 3NNHA 3CIQA 5IHUL 4JI0J 4YSAA 4GC7A 4Q9BA 1A2YA 4QU6A 2NYYC 3VNYA 1KFAH 4NC1C 4ZPCA 4Z3HA 3IJYB 1NK8A 4O4YL 3DX6A 3QP3A 5HGBB 1FL3B 1KQKA 3QJJA 5PAZA 2HT4C 3QZ8A 1NC2A 3I5CA 1MCPH 1TTUA 4I9XA 4QRQA 1RT6B 3W2VB 5F1SA 2GO9A 3S37H 5I1AB 5EX0A 3RW6A 5DGBA 2G5BA 4EZMA 1YEJL 4EDXA 2IH8A 5I23A 3RWEA 1MFBH 3VXSA 7FABL 5CEZH 1M7DB 5FW8A 1LWCB 4L1BA 3DUHA 2HMID 4GXVH 3K2IA 3W5MA 3RGIA 2IVMA 2MMXA 5D1ZA 4G9DB 1B7YB 1SJ3P 2AJSL 1OAZL 2CK0H 4NN6B 5E8PA 2BNQB 3HHLB 1U1KA 4ALZA 2RJZA 2FVCA 3T3PB 3T2OA 5DMKB 4G72B 2C9XA 3I9GH 3SSGA 3KYNB 3OKNB 2E1MC 3U4KA 4ZA1A 5HY9B 4FYRA 1TEFA 1RWKB 4ED7A 2RBLA 5D2NA 3VMPA 4RSVA 2EKJA 5HBBA 2EZ0D 4HIJA 4USUA 1QTSA 2C7FA 2UYLB 2K9FB 2WQWA 1HDMB 3K6OA 5J0BA 3VCDA 5FCSH 4CT8A 3QSKB 3OTOF 4AVHA 1WWWX 4WTWA 4M5YL 1NC4A 3OJDB 2WXIA 1CJKA 1TKTA 2DHXA 1YMMA 3OC5A 2J21A 4HK0A 4PJ7A 2JNJA 3T1YF 1S4FA 5ISZD 2B43A 2L3MA 3V7MA 1RAFB 4OZ4B 1TFWA 1M1KT 1SHMA 1QI3A 5AG9A 4OV6A 2P7TB 1OAUH 1A9EB 2WVVA 1M9SA 1F60B 2DQDH 1E8YA 3GSRA 4HQQH 3F8UB 4U2ZA 5KFFA 2Z92A 1FCAA 1WZAA 2EIMB 4XMTA 3UR3C 1N36J 4OVVA 4TN2A 2Z91B 3E51A 2EFVA 5BUGA 5I76B 1QMUA 2C9UA 1M5SA 1H2TZ 1ZV9A 3RZCB 2FJBB 1IGTA 2MZ1A 5DC2A 5IVXF 4JLRA 4BUQA 4RR5A 5KUKA 3N43F 1ADQH 5ILTL 4UQ3B 1RU2A 3RFZC 3KLQA 1J1PH 4OI8A 4N90D 3ETSA 5DJ0A 2EVJA 3S6EA 4M6OL 5E9DA 1P5VB 4WEEA 5BQ7B 4K7PH 4ZMQA 2HLFC 1LK5A 3KHLA 2NXZC 1UM6H 4ILDA 1Q5VA 5E1AB 5CYQB 4KROC 4XNXL 2J0SD 1YAIA 1R0AL 1MHHB 3IXAA 5ISZB 4A38A 3DRSA 1XCWA 4U1JA 2QJ3A 4XP6H 3FS9A 5CGBA 4PVMA 5F0PB 1OK8A 3JV4A 4L76A 3CDCA 3DYAB 4PR6A 1O6XA 3N41B 3ZLQC 2EIDA 3H4DA 4DP1X 3ENEA 4NYZA 2ZBIA 4LHUB 4B9VA 4HUNB 1J18A 2BMKB 1TFHA 5CIPA 4ZVRB 4KQ0A 3BZ5A 5DUML 5F1OB 4ZCMA 4YDLC 1ACCA 5J12B 1K1QA 3OXFA 2O1AA 2QELA 1ASOA 4Q0XL 3IDXL 4MNQD 3PV7A 4I1TA 1TTHB 3TVKA 4YFLF 1T5XA 1T03L 3F0NA 2YHGA 4NN6C 5EBWA 4PY7B 1RZFL 1HNWJ 1XMOF 5FF6A 3ATAA 4L1HA 3KLDA 4Q4IA 2X3BA 1V5JA 4XBEH 5E5MA 4BRJA 4PSPA 4DV4F 5F1KC 4OM1H 3CDZA 4PRHB 4BLGA 3BDYH 1KR4A 5FK9A 1RJJA 1E27A 2OMNA 4RRPA 3DM2B 4LRCA 1KENH 5ETOA 5KEZA 2C4FT 2WQ8A 1S5HB 2IC2A 4JQXC 4XCCH 3KLAB 3GLJA 1RSFA 5E3PA 3OLBA 4M02A 3Q89A 2HHSA 2MGZB 4EDWH 3RUGB 3OXRB 4IDJL 3CCJS 3KOAA 3QT8A 3CFMA 3O41B 3QULA 3FQWB 4HSCX 5DJDA 3PP4L 3ZL4L 2MLZA 1WORA 2Q79A 2QN6B 2XG5A 5DZLA 4OKVA 4W98A 3HC3H 3VI4B 2FJSA 3BEWB 5F7FA 2DXDA 3B54A 1OY8A 1C2PA 3CLEH 3DIFB 4UNVA 3MUUA 1UZ6E 2L3BA 2F7PA 4OI9A 1MJ8L 3R7QA 2GZOA 4NWBA 1UPMB 3PFUA 5GGSA 3HNVL 1CICA 2DR6A 4HCRA 2E74C 3SQOL 3SQBB 4CIOA 3PY8A 4OCNC 5E4OA 4DQIA 5T3ZD 2DM3A 4MNQB 3HNTL 3VTMA 2X2JA 5HDWA 3ZTEA 5C8JA 4PXDA 4OBSA 4URGA 3RZCC 2FAUA 3LH9A 3PNIA 4RCAA 1PZSA 1HHIA 3RWJA 1AS7A 4CH1A 4FX5A 4FFWD 2X1BA 1N6QB 1CXEA 1EQWA 5KYYA 1UMJA 2DWXA 1YYLH 4AQ8C 1E3FA 4A8WA 4ZKAA 5JQ6H 3WYRA 3SEPA 2IOOA 2XXMB 4TYUA 1BVNP 3M2VA 1FRHA 4DV6F 1JHKL 4YXLH 3QB7C 5E94A 4WCYH 3O3AA 4HXAL 3Q8AA 3UXFA 5SX5K 4CU8A 1Q38A 4KRLB 2F8IA 4C8XA 1B0TA 5ALCL 3QJUB 5KSUB 5LVEA 3STZA 3BM7A 5B09A 1DE4A 4P0DA 1Q4NX 1SQMA 4NI3A 3CC4S 3HG0A 1KCUL 1JB0C 3RNQA 1U8CB 2L08A 1CXKA 3X1GA 1ZLEA 3X12B 2KG1A 3HZMB 4ECZA 3B3IA 5DQJB 4EU0A 3EO9L 4A2FA 3TX8A 1AHKA 3BGFB 3MBXL 4JI1F 2N4DA 1ZAXA 2YEZA 5LAPA 3N5AA 1JGLH 1R89A 2WTRB 4FHKA 1N0UA 4FLHA 4H44C 4ABWA 3Q2VA 4QWEA 1SDDB 2NYIA 2JHEA 2VG6B 3BKUA 4LF5J 3QXDB 3KLHB 5HGBA 1FL3A 3BWSA 4G8GD 2JFCA 2NNFA 1XMEB 1RT6A 3W2VA 2QA4G 3W2DH 2GG1A 2J8SA 3EM1A 1YNKH 4ZOCA 5I1AA 2X1AA 3JQOB 4OYIA 1PX8A 1P0SE 3QCVH 4Y19E 1RB0A 3GJRB 4PLKC 4PG7A 2HFSA 5J12C 2F58L 2X4QB 1SJ4P 1T9VA 5T5FH 1KYAA 1M7DA 4KTDH 4I9WD 5DK3A 1TMJA 4ZFGL 1LWCA 3VRLF 1V8HA 4OYXA 2J8UB 3GYNA 3DROB 2O6CA 5HYJD 1J0HA 2R23B 4ECYA 4JVPA 3AQXA 4G9DA 4ECUA 4P49A 2BNQA 3HHLA 1VF5C 1YYCA 1ZJBA 5GGVH 3FEZA 4IJ3C 5DMKA 3Q8BA 4OFYA 3LPWA 4ONFH 4ETQB 3KYNA 4J8RB 1WG4A 4LSZB 5AWNL 5AYQA 4X4OA 5HY9A 2XVBA 4P04A 5IGXL 5IVNA 1VCBC 3CJQA 1BPLB 4DL5A 3EGXB 5D7EA 3KXDA 2R4FA 4JQXA 1RT2B 2EKYA 1RACB 2UYLA 3GPAA 5K9FA 4QJVA 1HDMA 2P8PB 2DKOB 1N0XH 3ESPA 4OCMC 2V4JA 1JZGA 4HACB 4NPYB 2GFBB 4LQFH 4ER8A 3P9MB 3OJDA 1U26A 5JZ7D 3OTEA 2E4TA 3T5WA 2PKDA 3LZPA 2MQLA 2IJ0C 2HQIA 5IT9Y 4UTBH 2MQGA 1U02A 3OW2R 1GL4B 4OI7A 4OZ4A 3IO1A 3K74B 1Q9KB 4PTTB 2P7TA 1A9EA 1NCUA 5D1QB 1BYNA 2G3XA 3ZUCA 5LXGL 1I8IB 2FZ3A 4RMTA 1RK8A 4WU5B 2A2CA 4WFBQ 4YC2C 1E5BA 4WTZG 2A2DA 1QZ1A 3EZOA 1WS8A 2MCG1 2M1KA 2Z91A 1VGEL 3DRXA 2M88A 5I76A 3VFSB 3JTPA 3VXSE 4MRBA 1BQHG 5HYJB 4MWFB 3MHZA 3RZCA 2PWEA 3ZZ1A 3MI6A 3GJSB 2J1XA 4GPVA 3F05A 1TL3B 2QSCL 5KG3A 4FQIL 4NOBA 1CC3A 1PKOA 5CLWA 1I94F 4Z7NF 2A74B 2ZKWA 3D18B 4MA1B 3V10A 1P7BA 5LGHL 1T3FB 1JZ2A 4AQ8A 4N8OA 3LCYA 2D2CC 4FQPA 4UQ3A 4Y8DC 4L8DB 5DK2B 3OZLA 2HQ3A 3FMWA 2PABA 5CEXB 2IV8A 1FNEB 2AHOB 2FVRA 4C57C 1TKWB 1FNXH 2HFGH 1WIUA 3HN5A 1FRXA 3OTBA 2P2CB 2HRPL 3ULUE 4Q0BB 2W92A 1P5VA 2NY7L 2WZ1A 5D2NE 4HH9B 5BQ7A 2E7MA 5HJ3A 1PNDA 1CBJA 1A7RL 2QPUA 3EDKA 2CZ9A 2OJ1A 3HFVA 4ATWA 3WC0A 1T7XA 2HLUA 2K6ZA 3NOIA 5E3CA 1OB0A 5E1AA 5T3XL 4U1HB 4KX9A 3SE4A 4AGQA 5CYQA 5J1NA 5K5MA 4CGTA 1MHHA 5ISZA 2PI5A 1LP9B 4QHUA 4NXKA 2DI8A 1VZIA 1YMME 1Z0NA 4PJ7E 4ZMTA 5TFSH 3LZQA 5JA9A 4UQAA 5JYLA 3BGFC 4FQJH 4XTTA 2DLFL 2D3JA 3OSNA 3NPSB 2XGQA 4Z3JA 1F5CA 1E4XL 3DYAA 3PW7A 1RT1B 2XSKA 3BOVA 1VSCA 2AZ3A 2FLPA 5BXIA 4FEIA 4M62H 3W11C 1Y11A 1FJEB 5AB0A 4FQ2L 3HSJA 3N6MA 3KLHC 3IN2A 3D0VB 1T05B 4WHCA 2H65B 4XVTL 4ZJLA 2BMKA 1UWEH 2WVSA 3UP6A 1OYDA 1ZJAA 5I0ZA 3DMMD 3FB8B 5DWUL 3UCRA 1WA0X 4PSRA 4DPUA 4JFTA 3WKPA 3PX4A 3H55A 2VERN 1FHGA 4M93C 5FUCE 2GBAA 3X1NA 2F3JA 2R4SL 3M46A 4PJ9B 3G86A 4NUQA 1AFJA 1RZJC 3R18A 3ECBB 3ISWA 5CP3A 4XPHL 1BGXT 2XA8H 1VOMA 5A2CA 3HZVB 4QHLB 1PD0A 3K6DA 1BIIB 4PY7A 1Q1JH 4UNUA 3GHBL 2WLMA 3V6ZB 2M2BA 1RU9H 2PR4L 1P9MC 2YUZA 1TZHB 1D7BA 3DJZA 3TUIC 3EXLA 5HGHB 2VJ0A 2IM0A 5DZNA 1ZRUA 1WOSA 1JS4A 4PRHA 5FA4B 1SIWB 3QIWD 3T3MB 1AROP 1B70B 1UYWL 1LO3L 3QAZB 4ZZKA 1S5HA 3DM2A 3KLAA 4HWZA 1PJ6A 4TQHA 3WAJA 2R51A 3BP7B 5KG5A 2MGZA 2CQ2A 3RUGA 3OXRA 2XWYA 3IWXA 4ZK7M 3O41A 3FQWA 2OEKA 1PBYA 4LF4J 2HUEA 4U9RA 4OJYA 2LQJA 1MW3A 5I82A 4NM8L 5LO7A 4EI6B 3V0GA 3BEWA 5CEYB 1A9NB 4AEIH 4NKQB 1Z9PA 4XN7A 1SOXA 3DMMB 5FYJD 3DIFA 3QBTB 5EH1A 1U8IB 3R19A 2X09A 2HLEB 1REIA 5D1QC 1N56A 2X53A 4PWIA 5LXYA 2K0RA 3ELQA 3U0TB 3WAKA 4BEIA 2ZP0T 4X6BB 1TL7B 4OIIL 4UB0H 5GJTH 3SQBA 4BQ9A 3BHBB 2IFGA 4FFZA 5FM8A 1DVUA 1ZA6B 3OAWA 4MNQA 3SYAA 3LN5B 5CJXC 3DO3A 2ZSWA 2BP3A 2CHDA 2EE0A 2ATLA 1KJ2B 1ZLVH 2R3VA 1N6QA 2A74C 4MA1C 4X5WB 1RJLB 2BWIA 4AE1A 2V69A 2XIIA 4AE0A 3HFMH 2AJFE 4QXWA 2R0LL 2ZJSL 4AL8H 1Q79A 3KYLA 4YSUA 3QIWB 5C0BD 4LPTA 5KG9B 1K0TA 3TC9A 1FDNA 1HWHB 3QFGA 2JKJA 1XGTB 2IGFH 3FHEA 1DL7H 1IO4C 3OPUA 3P02A 1VQ9S 1DFBH 4LL1A 3HUJA 4L3CB 2GW8A 1U8CA 2C5DC 1KPVA 4QHPA 3HZMA 1MLAA 1FNSH 1YEKL 5DQJA 4A7GA 2FSEB 4KY2A 1AHWB 2A4CA 3BGFA 3RJMB 3NPSC 2BKPA 2I6WA 1P4BL 1YK9A 4J5VA 1J9QA 3P9WB 2WTRA 4X4TA 2KDOA 1SDDA 2VG6A 2B5IC 2H5JB 1J0KA 3QXDA 4NI2B 5B8CB 4F8PA 2AJYL 3VTAA 5IFAH 5F3HB 2FDNA 3Q8SB 4BKTC 4MKBA 2AJUH 1J5EJ 1XHHA 2XVKA 5IY5B 4C8NA 2FJHB 3DLGB 2WXLA 2YBRB 5D96B 5FV1L 2FB4H 2V5RA 2IQ9L 4OLVL 4U2YA 1R3LA 2MKIA 1CTOA 5KVDH 1VPOH 4GQRA 1MHEB 2X4QA 4FG4A 3RU0A 4PJ9C 5C0BB 1GYCA 3K7UA 3QWNA 4K8RD 2J8UA 2OCCB 3DROA 3GKZA 2R23A 1UCBL 1ACXA 1BXVA 4X64J 4MQXC 4LP4A 4CVZB 2BW5A 5IVXB 4B3RF 2QMWA 1INEH 4HA1A 2V2WB 5K1VA 4J8RA 4ETQA 3WCYA 5JQIB 3N43B 2CJ9A 2IEPA 5FW6A 2WW8A 4BFJA 4LRFA 4O3QA 3PYDA 3EGXA 3W3BA 4TNOA 3CVCA 2KZWA 3KNBB 4XO4A 5I1EL 3U1MA 4YB6A 3VAHA 5KFVA 4DX8H 3D39D 1BBDL 1NCDL 4LPVA 2P8PA 2WVCA 1XSOA 4JCLA 1NM4A 3W1ZA 2A9ML 3E0GA 4HACA 4NPYA 1TJIH 2GFBA 2MQPA 4R4NC 4TQEH 1NFIA 4WGWB 4AV0A 5J3HD 1N6VA 1L7TH 3FMGL 5ECGA 3VSQA 4OHVA 5F3TA 4DV5J 3JVFC 1S9EB 1DQKA 4FNHA 4YLBA 1Q9KA 4WAFA 4PTTA 3LXAA 1AFIA 3HJVA 1FZOB 1I8IA 2DZEA 4HGKC 5HP1B 4WU5A 2X3CA 2DIBA 2Q8AL 3FUNA 1LE9B 4DUZJ 8RUCA 2WLLB 4QRPD 5T1DL 4KC5A 3VFSA 4JY5L 1J8KA 4EK2A 3KCWA 1S5IL 2X44D 5CJXA 1BQKA 4MWFA 5HYJA 4NA1A 4I0KA 1TL3A 2A74A 4NZ8A 5J7CC 4IBVA 4PRNB 3G4SS 1Y7VA 3NDZE 2JKTM 1BA9A 4WU2A 2BNQE 2BZDA 3LNHA 4XCNB 3RA7H 3O44A 4OZNA 4K7FB 5DK2A 2XTLA 3QNXB 2FBOJ 4G8EB 4L8DA 1MHCB 3T3PE 3UYOD 5CEXA 1M0SA 1FNEA 2H1PH 1SQEA 2O66A 1TKWA 2YD5A 3BWZA 1LGVA 3HG1D 4QJ4B 2BMBA 3LHAA 4Q0BA 3BVNB 1MFDH 2QVTA 3CQQA 4HH9A 3CQPA 2GJ2A 3RB0A 3QHTC 1HAWA 3ARSA 5DDOC 3QRGH 3MFHA 4JFYB 2DIEA 3BF4A 2X9YA 2EEFA 4L2YA 1V7NL 4M5ZH 2AT1B 1S46A 5JNYB 1DCLA 2WD0A 1LP9A 5IV2B 3MLSH 3AUWB 2XNRA 5D7SH 2JEFA 1MVYA 4JE0A 2B4CH 4RA3A 3IEAA 4ACPA 5IV4A 5TQ0L 3C3LA 4U1IB 3F62A 2BRRL 2FQDA 3AZUA 1HHKB 1RT1A 3WX4A 2WXHA 5DGQA 3HVTB 1P5UC 1Q1PA 1A21A 2FVPA 3A6BL 4PS8A 3K7RA 1VERA 2OPSB 3D0VA 3TO8A 2FHJD 3MMCB 1T05A 2ZH4A 1FL6B 1N5VA 3OHMB 4LFAJ 1CDCA 3AREC 3FB8A 4MDJB 2LECA 3ESUF 2WIMA 5H94B 2K3TA 1JDDA 2BA9A 2X10A 5D96C 2NY0D 2QQKH 2CIIB 1TZIB 2GK0B 1J5OH 2HFTA 4AXIA 5KT5A 3DX2A 5D4HA 4JRXD 3W9JA 4GFXA 5B3NA 4PJ9A 3FU0A 3CFKB 3ECBA 3HG1B 4ENEC 4L74A 4I0PC 2OPCA 3FTZA 4PJFF 4U1LB 1Q8IA 1QAXA 3U6XS 1EZVY 5F8JA 3HZVA 4QHLA 2HNYB 1BIIA 1SXBA 2KM8B 4GUOA 2O61B 4AL7A 3I55S 3V6ZA 2FY8A 3R6LB 3JT0A 4OCWL 3IVKB 2VR9A 3PWJB 4LRBA 2WWKO 1TZHA 1M7IB 4ISVA 4ODVL 3GMRB 5HGHA 4KGKA 5FA4A 1G43A 2ZSVA 2PTUA 3QVAA 3MZIA 4K5LA 2LFVA 2HB0A 4FXLA 1HZKA 4DZDA 5ISZE 4ANXA 1YRKA 2WBJD 1IEAB 3BP7A 1I3VA 1BM3L 1TAUA 1G9NC 3LQAH 4Y4KD 3WS6C 1HESA 1TTRA 2JRSA 1JD7A 3JWNG 1IJEB 4EI6A 4JKNA 5CEYA 1U45A 1Y10A 3DMMA 3H20A 1U8IA 4OTXH 2NY0B 1N5YH 3NTCH 5LCVL 1UA0A 4KBPA 1B9KA 3U0TA 4D0DB 4MBOA 4X6BA 4Y1SA 3Q3GB 4JFQB 1NEPA 1TL7A 4C0HA 3S1TA 3BHBA 1KBPA 2GA7A 4HXBL 1ZA6A 4DF8A 4FKEA 2LEBA 1TETH 2C1PB 4JFVA 2LYVA 4CVWA 3JAMU 3ECVA 5EU7E 2CGYA 4DOHB 2E5EA 3GJFH 1KJ2A 1JLGB 5D9SB 4HVZA 3VGTA 4X5WA 3RVXC 5JXEC 4JL1A 2H32B 1IBLF 1RJLA 2K4WA 3Q8PB 2AYEA 5EOCH 4OYMA 1M53A 4HHAB 1PG7L 2CJUH 2OZ4A 5I73C 2H1XA 1AD9A 1TCRA 1M5VC 3QIWA 5KG9A 2HTLC 2F1EA 2YQ3A 4WSJA 2VWEC 5GRUL 2MYFA 4PRHE 4NO0D 1TJHL 4DR3J 3UIZA 1G6RH 3BT2H 2ODIA 4Y4KB 5E99L 3T5LA 1XGTA 4NX9A 2DY9A 1GKEA 4H1LH 4XOAA 4BZYA 1S7HA 3MLUL 3RUGE 3WEBA 2BCKB 5KVFE 2NQDA 5L7XH 1GGBL 4L3CA 3MREB 3M6UA 3POTB 3QCUH 2B3TB 3GV7B 5LBGA 3OQRA 2M70A 1WZ1L 2FSEA 1C0UB 3NMEA 1AHWA 1F2QA 3VI4E 5CYJA 4I2XB 3BQ0A 2PP7A 2FX9H 3S8WA 3ILLA 3R0NA 2NY5L 2AXHA 2BDNL 4X4MA 2WHOA 2DGXA 5KW9L 1RERA 3OHBA 2E9GA 2TSAA 3CVHB 1HLWA 4TNEA 4DZ8B 3AGVA 2WBMA 3QGGA 2E7HA 1NEZG 3TEWA 4X84A 5HHMD 1KDJA 4HMEA 1OM3L 5B8CA 1JV5B 2IGTA 4NI2A 4P59L 5CGYC 4B9FA 3VF0B 5GRWA 1DP0A 1SMAA 4NOFA 5F3HA 4F20A 3RB3A 1HR0F 1HEHC 3KYOB 3CBKB 4MNQE 1UOLA 4DTGH 4FG6D 3HPOA 2V5HG 5GS0D 4J9KA 2FJHA 4MS6A 3DLGA 3OXGA 2YBRA 4U3HA 5JOPD 3Q5YA 3Q83A 4P2QD 2E27H 3ZO0A 1FZJB 3KMQA 3FZUC 3CK0H 1MHEA 1S10A 2R9HD 5C0BA 1BE4A 2D3ZA 2MHAB 1H72C 2XWJB 4U8VA 1X7TA 3C5ZB 5TTRA 3VFTB 2NNRA 4NO0B 4UQIM 2AJ3B 5IUSA 3BI9X 3BP5B 4YSPA 1C12B 1IBBA 5C0JA 5JOEA 1BXAA 1N0VC 2D7SA 2AJZB 2J1KA 4H4KC 2AQ1A 2MNJB 3GMQB 4CVZA 4QJ5B 5IVXA 2V2WA 4I8DA 1TQBC 1BP3B 2ZOWA 4JY6B 1BV8A 4UT7H 2EE2A 3ZO9A 5ALBL 1FFGB 2RSQA 1F3FA 2DY2A 5CR1A 4OCXL 5KVGE 2GX8A 3KNBA 4ZJOA 2AEPH 1R3NA 3S3BB 2Y7MA 2V9QA 2MKHA 5C42B 4LXFA 2WINA 3OAYK 4JQIA 3GPSA 1T21B 5IQ7H 1A02N 1DQ8A 2FZGB 4QYZK 2WKOF 5KYWB 3W82A 4R0LB 1DQTA 4DN4H 4HGWB 2OMOA 4IOBA 2FHFA 2ZOOA 1S9EA 1W0WB 3W61A 2VH7A 2WBRA 3G6AB 4NN5B 4LF7J 4QZVB 1FZOA 3KGTA 2F7VA 3DHMA 1IKYA 5E2WL 1G9EA 1Q0NA 3TP2A 4A8SA 5HP1A 3N50A 5I71B 1KTQA 2XBTA 3QQ3B 2DJMA 2XY1A 3WTWA 3U0WH 1LE9A 4M5JA 2WLLA 5LSRA 2CPJA 3OFFA 4K8RA 2CBQA 2FD6H 3ATDA 3L3HB 3VM5A 4EPSA 3D9BA 3RW7A 1X5OA 1J87A 5BW7C 2IDEA 4EN3C 3DVIA 2O6FA 4XP9H 5I1CH 2J8UE 5I66A 4PAZA 4OU3A 5FYLL 5JXEA 4PRNA 1W72B 4ZPWR 4C56D 4X98B 3FU9A 1UW4A 3WXWH 5D3GB 4XCNA 4QY8B 4K7FA 2KLRA 2BSDA 2X4NA 3PJLA 1MHCA 3MC0A 3QNXA 4G8EA 3TVMB 2VFSA 3ARDD 2ZYIA 3CN2A 4KHMA 5C3IA 4AQYJ 4JI7F 1F9HA 3D39A 1Q8LA 3HI1B 3FTUA 3BVNA 2KH9A 4HJ0C 2E86A 2XBPA 1DSWA 4PGCB 2YXFA 3JV0A 2VOPA 2KQNA 1KCBA 2V4RA 4JFYA 3N6NA 4ECQA 1I1RA 4LBHA 4ETZA 1KT2B 4HISA 4ERSH 4YP3A 2RS2A 2EDTA 5JNYA 5IV2A 2MJUA 4B08A 5GADI 1PZDA 3UBFA 3IBOA 3IMQJ 1I9RL 2VFRA 4DLEA 1MCOH 5SWSD 3UD5A 4U1IA 1TU2B 1HHKA 2FK9A 2NY6D 4PWEA 1RFDH 4K4ZA 1KQGB 5D1QE 3L09A 1IARB 1A9BB 1LWJA 3NQIA 4AQZA 1RCXB 1T11A 3BMVA 3TVZA 3QS2A 3UCUP 4PM1A 1WI6A 2SXLA 2PI4A 2UXCJ 4TSCH 3UH8A 3MMCA 2YAOA 1FL6A 4U6XB 4N7TA 2HVDA 5IK3A 1IWAA 2Q0ZX 5HYJE 5A8RB 1AZCA 5H94A 5AW0B 2BSSB 1UA1A 4KTYA 4C56B 1J7VR 4GAJL 3DV4B 2CIIA 1I3GL 1TZIA 2GK0A 3QXUA 4H40A 4R4FH 1AO7D 2G0CA 2YFOA 3CFUA 2JJSC 5KYXB 2GHPA 2VL4A 4N6RB 4HU2A 4GUPB 3QGVA 1BMWA 3ARDB 3CFKA 1EVUA 3C5ZC 3HG1A 2EP6A 3ZT6A 4U1LA 3UJJH 4DUWA 3GBNL 2X1XR 1HBNB 2HNYA 5DVPA 2Z30B 4KJIA 2O61A 4ECWA 3UDLA 4EI2A 4ZUUB 2LKZA 3PWJA 5ESVB 2O3DA 1G9HA 3GMRA 4LSPL 1Q1KA 4HAGA 4K7PY 1ZS8B 2MEWA 2QLXA 4KK5D 4DV7J 1JIHA 3L2NA 4JDEA 2EXSA 2P9GA 2YPZA 3FYIB 2FLMA 4XMKL 5SWSB 3S34H 2NLWA 1LP9E 4IIQB 1IEAA 2QQLH 3NGUA 2NY6B 2XEXA 1JF5A 2NR0A 2DYRB 3VX0A 2XYGB 5SWQB 1IAII 3K57A 2FHJA 3UYPB 5AXMA 2CWRA 3LMJL 3QDME 5AAWC 2VDKB 5IJKC 4QEGA 2FO8A 3O1LA 1MVFA 1GJIA 4F9LA 4NN5C 2VXTH 5TH2B 3RPKA 5I8KH 1EUUA 3L3JB 3OVBA 1T3NA 5I71C 1AO7B 5F96L 2APVA 4D0DA 4W70A 3Q3GA 4JFQA 4G1QB 4B9TA 3PJXA 4WO4D 6PCYA 4YH6A 5F1IB 3U7JA 4LNVA 2C1PA 2WUCL 5J5EA 2YRBA 3FTVA 4G65A 1FNHA 4LFBF 5GJSH 4IRZA 3ARXA 1AVAA 4CAGA 1JLGA 5D9SA 3ZMEA 1MLCB 4XWGH 2H32A 3IMTA 1JFHA 2GCYB 1UC6A 3A3OB 2W01A 2X87A 2P4AB 3L9BA 3NT0A 4HHAA 1U8HB 3HB3D 3UCQA 2XMUA 1X5XA 3TVMC 3VSVA 4E36A 3NS5A 5KT4A 1ZANL 3GLEA 2BV3A 4LSLB 5AW7B 1IXKA 5J1EB 3KH4A 2CGZA 2AABH 4JX0A 4OLZL 3T3ME 5GS1B 3A3YB 4Y4KA 1H3DA 1FA4A 1PSKH 1T7WA 3TANA 1H2UX 2WGNB 2E5LJ 1LMIA 2BCKA 5BOJA 1A1NB 4Y88A 3MREA 3DV6B 4KUZL 4ODHL 1EEQA 3DX0A 4CZCA 1PPIA 4XP5H 4DK3A 1C0UA 4I2XA 3BIBX 1IZJA 5ADPL 1ZV2A 5CSGA 4ZMXA 1DY3A 1U0HB 3W63A 2A77L 1KELL 2AQSA 1QKZH 1VZHA 3M17B 3QI9C 3T0XA 2FC9A 3MM9B 4LOFA 2FLNA 3CVHA 1HINH 3FT1A 3LQMA 4WO4B 3SKJH 1AQKL 4DZ8A 1HC1A 4JPIB 2AAVA 1OF2B 2UXVA 2YN5A 3CLFH 1AW0A 1JV5A 3PPSA 5DQ9B 1WFOA 2YD4A 4I3GA 3O8WA 4NLYA 5KG7A 3KYOA 3DLJA 4JKPL 1G6VK 3ZE0F 4FYVB 2V7HB 4J7RA 4G3YH 5HL7Q 1A6AB 3EOAB 3BPNB 4JFFD 3CFNA 4JBSA 1FZJA 3U1PA 3HB3B 3FCSB 4IFYB 2JJSA 3I6GB 3GXDA 5IB4B 5HHPA 3I0SB 2XWJA 3FFOA 2E6JA 4HETA 4MX7B 3VFTA 5EX3A 5CD5C 1MPAL 4NO0A 2AJ3A 2RU3A 3IMWA 1ZE3C 3MODL 5HGDB 4UQTA 2NZIA 3BP5A 3MM9A 2QHRL 1C12A 2EDEA 2VERA 5GRYA 1DVFD 1FUNA 2KZKA 2AJZA 1F9EB 1QJHA 5U47A 3U1LA 3GMQA 3LKOB 5EEVA 4GRWF 2ORBL 1X5YA 5AKRA 1C5BH 5DJ8B 2VODA 1JNNH 2PLTA 3HLUA 3SDYL 4MXWL 3R9LA 3PTWA 2ALZA 4UQ2B 4X4SA 2NR6C 3TV3H 4QTIH 4L23A 4U6YB 4PGJA 2ADCA 5EU3B 5HTSA 2XV6B 2ZUQB 3GV8B 3HC4H 3VXNB 4ZZFA 2ZUAA 4GRLD 4IIQC 4WFXA 5B0EA 1DLFH 2NY6C 5FYJE 5DHXB 2CADA 2HQFA 5TE7L 5C42A 5E6RB 4OGZA 1T21A 1K0VA 3V0IA 4CUCA 5KYWA 1S6UA 3VALA 2VZSA 5KN5B 1ZPWX 4R0LA 4X4ME 4HGWA 1UT2A 4GAYB 4OB5L 3ABGA 3B9KB 5AYTA 2A4EA 2B9AA 2RACA 5AAWA 3J81j 4GINA 3GGWB 3HSGA 3DTXB 4N28A 3G6AA 3AJ2A 1KDNA 1JNLH 4MAKA 2YA1A 3AG1B 4KRPD 4PJGE 4KKQA 1OCCB 2ZCZA 1RUQL 3QQ3A 4PN6A 2E1RA 4W6WB 3TOPA 5IQOA 1RIUL 3TCLB 4JG0H 1FPTL 2X89D 3CDUA 3ZZUA 1N32F 1HYSD 3P3UA 3SBPA 3MOBH 1BF5A 2CXGA 1G4CA 1R46A 2GO8A 2KL8A 2EIBA 3MLYH 4BGLA 1QG3A 1I9IL 1DVFB 2JLPA 3KJNB 5IFMA 5HYQB 1OARL 3BX7C 3MOAH 4RFNB 2VU5A 4ONGL 2CE6A 1N5SA 4LP8A 1W72A 4F58H 3KM2A 4X98A 5D3GA 3ZNJ1 5HQ8A 1A7NL 4QY8A 1VACA 4U6VL 2R2TA 2XVGA 5IVXE 4XP1L 3TVMA 5GGVY 1V3RA 2DWDB 1YEFH 4LBAA 3QEUB 4GRLB 4ZI8A 4UOW1 1Y6MR 3HI1A 2JLEA 1EJFA 1NZ8A 3FCUB 5A2BA 2ZBCA 4PGCA 5D93B 4PJFB 2WC7A 1JCVA 3MJ9L 4XNDA 4B9MA 1IKVB 1KT2A 3KBEA 5F89B 3HT3A 2ZKHH 5ACLA 3NAIA 5GMDA 3KWWB 4M7ZB 1FTCA 1XF5A 1ICEB 5I8CA 3HNSL 4KRPB 4V11A 4ZSOB 3IN0A 2AI0L 4LARL 1TU2A 4QHKJ 3WFEH 3OPZL 3T5KA 1WH0A 4KZDH 2OPRA 1HWGB 1A9BA 2MQ3A 4M95A 4JKWA 3MM5B 4N24A 1UM5L 2R7SA 3FT0A 2G0KA 5K14A 1FRLA 1UWFA 4U6XA 1ZCRA 3NACH 4NLXA 2PN6A 4M6NL 5A8RA 4PREB 2BSSA 4C56A 1SBSH 3DV4A 1A7QH 3BPNC 5HHVL 1ACZA 3HB3C 4YSCA 1QEXA 3VO0A 2LAAA 1UB5A 4N6RA 5DZAA 3ZRSA 3ARDA 3QNFA 4P5TB 2QA1A 2F4VF 1P6FA 1P7HL 3I6KA 5KBLA 1NSAA 2OP4H 1MY5A 3K81A 1FORH 5HI4D 3K0WA 1HBNA 3WNJA 1T5KA 3GZPA 4MFHA 2VWEE 1SUQB 1D2OA 5LSLA 2H6PB 1MWAB 4NQVB 1G3OA 2K7JA 3QJZA 5ESVA 5C6TH 4O2FB 3VWJD 1ZS8A 1S1UB 4FNLL 1WD6A 5IMOB 4PCKA 4A2EA 2ZF9A 2Y5QA 2ZUQC 3SE3A 5SWSA 4WU3A 2Q5BA 4IIQA 4MJID 1YJTA 3L5XL 3K8WA 1NIEA 2YH1A 1KYDA 2UUAF 4BM7A 4LVNB 1P1LA 5SWQA 4EIUA 1JVOA 1WCQA 2Z8WC 3FRUB 3QZNA 5EUKB 1T95A 1UA7A 5I18H 3B9KC 4LSVL 1GAFL 1MU2B 5HJGA 4LDOB 4G7VH 4OLXH 4XNYH 3RLSA 4ZN3A 3NFSH 5DQGA 2FJXA 4MQSB 5G55A 4RNOA 4KQ4L 4WKZB 2QGFB 5TH2A 3W9EB 1WFTA 4MAYD 3L3JA 4UIKH 3WKML 3BYYA 2I85A 2QQNL 3MUY1 5CP7B 4DSIA 1OPZA 4F2SA 1AO7A 3J7YU 4KDTC 2IDCA 4G1QA 2AX1A 1SOKA 4ZLLA 9CGTA 3TBBA 4QGTA 3NRBA 5I8EB 4ODTL 2AQ2A 2EADA 1RA6A 1XCXA 2F9DA 4R7LA 3C8YA 4GVLA 1RAEB 4Q8EA 4B9GA 1NINA 4GEIA 5L1IA 2H26B 3UO0A 2XVLA 4B3MJ 1DVFC 1NNDA 4BZ1L 3ZR6A 2A1WH 4LEXH 3H8YA 4RFNC 1NAMB 3GLDA 1MLCA 5MP6H 4N0CD 4FLOA 3N9GL 4N5EC 4O58L 4PGBB 1QFWL 1NZAA 1YRUA 2GCYA 1TO4A 2A38A 4ANUA 2Y7OA 4AV4A 5GZNC 2E7DA 5JLZB 1U8HA 2V2TB 4UTGA 2BCMA 1MRDH 3V4UL 3H54A 1TR0A 2E46A 2J6SA 3Q05A 5L88L 3Q1SL 43C9A 5JW3H 3D1QA 2HG0A 4LSLA 5J1EA 4GRLC 4U7MA 4RLEA 2HFEB 4N1CA 1JLAB 1LDPH 4PJHF 5GS1A 5AJ3F 1R4XA 1HIYA 5EWIH 2DR9A 1EGJH 4PJ8D 2FJFB 2VV5A 3QZWB 2I60L 1A1NA 1RIHL 3FH5A 3LNDA 1N4XH 3DV6A 1OTUC 1SFDA 4UF7C 3B2VH 1N5TA 3EUUA 2COLA 4U8YA 4M7ZC 4F0MA 1RAIB 1WG5A 4MAYB 2AW2A 4DV0F 4KRPC 2DD8H 1TPXB 4XB7A 3OLGA 1U0SA 4ZNEE 3DOSB 4OX9F 3M17A 1PKUA 4NRTA 1BF2A 2Z7UA 3GMNB 1U3HD 1Z66A 2MCMA 1SC4B 2G9OA 4WO4A 5E2UH 4QYRA 4DV2F 2FY1A 1WCBB 3FTGB 3GHEH 4JPIA 3N4WA 1OF2A 4B3SF 3CJ2A 1F90H 5DZVA 4EO6A 1Z5YD 3AMLA 1FAKT 5DQ9A 4DETA 1RURL 4U31A 4QWWC 1MHPH 2VE6B 4AIXA 1GW0A 2Y1AA 2VC0A 4H2AA 2JC0A 5DK0B 5KOWA 2V7HA 5HDBF 3F7QA 4YK4B 1A6AA 3EOAA 4DOHE 1R8AA 3BDPA 4IFYA 5L1KA 2G5RA 3FCSA 5IB4A 1VGKB 2YD2A 3I0SA 4P5TC 2PSZA 4MX7A 4UF4A 1AY1L 3OTOJ 2KXNB 4X4YB 1IVLA 2DQEL 5HGDA 1GIGH 4LDCA 4YBLB 1MJUL 3MUMP 3REVB 3LKOA 4WWKD 4JK0D 3VRLE 1E4WL 1KIPB 5DJ8A 3NBPB 3I84A 3GS7A 2XU9A 1GPOL 3DHXA 4URQU 2VHGA 3EO0B 1CGYA 2DICA 3MZTA 4MVBD 4UQ2A 4KTQA 1IUZA 4U6YA 3DO7B 4Y9GA 4GLRH 4JI4F 3V4PL 3TBCA 3B9DA 5E4AA 2V9UA 5EU3A 3BKFA 4DPWA 1MIEL 4KKLD 3VXNA 4FN5A 1U3HB 3GYGA 4I2XE 4IGBB 2Q1LA 1YYML 3B7SA 3GWJA 2ODHA 4NKIL 5KN5A 3RGHA 2XZWA 3MM8B 5CABA 4BGDA 3O3BA 4GAYA 4YHZH 3B9KA 5FYKE 3TBWA 4P9ML 5IKCB 2ROPA 3SFGA 2HVIA 3GGWA 1HQUB 1JE6A 5CWSB 1AIZA 2WHVA 5F71A 1ES0B 1CVJA 4QHKI 2Z1PA 1Q95G 2I9TA 4YJZL 4FOMA 4JFFA 3GRWL 1QABA 4KDTA 4OJ3A 3DPDA 3U4BL 4E5XB 2DTSA 2QZ5A 2X1OA 2MRYA 3H7BB 3GYXB 1JX4A 5BS0E 4WI8A 4DV3F 1BWWA 3ZHDA 1DVFA 3OG6B 3PJSB 3QUML 5GS3A 5HYQA 4DKFH 1NXIA 5FGSA 1Y1UA 4WWKB 4BZ2L 2RAQA 1A6ZB 3Q2SC 5F3BB 1J27A 1UM4H 3NZ8B 4P75A 4WKXA 4TNFA 4I3RL 1RTHB 4GI9A 4Z7NE 2DWDA 5TE4L 5D4OA 2ZZTA 3QEUA 4GRLA 5IROC 2XMWA 1OEZW 4YXKL 4DZBB 1KZQA 4M6MH 3A13A 3HR6A 4PJFA 4RMRA 1AACA 1KFAL 2P8LB 4FYWB 1D8ZA 2H0EA 1GJWA 1TYJA 4HJTA 3MJWA 1IKVA 3U82B 2M3DA 2W2MP 5CMAB 4Y2IA 2HFFA 4DP8X 1CF8L 4Q4EA 1FT8A 4JR9H 1MCPL 4LLYA 3TBVB 2R7WA 3KWWA 5I0WA 9ATCB 3Q8EA 1TPXC 1E8XA 4NNYB 4UQ9A 4ZSOA 2HLAB 4BFKA 1NOAA 2BJ9A 4FS0A 1MFBL 2G30A 2IM3A 2YKQA 3L7OA 5LMUF 4ZFOL 2XXFA 3CMQA 2JKLA 5CEZL 4A8OA 1DJHA 3OHAA 5JOPE 4LSSH 2X89A 4D94A 4KRMB 5KBPA 3MM5A 4ZVUB 5IR1B 4HLJA 5DRKA 1USZA 1XMOJ 3FXIC 5DD0H 3OKMB 4ZOAA 2CK0L 5EUHA 1WC7B 4KH2A 3NXZA 4DV4J 4CLYA 4PREA 3I9GL 1GC1C 4IRSD 3L3IA 4YK4C 1KB9K 4OJ1A 2VRKA 2VJXA 3H7LA 4M5MA 4TTGA 1SC3B 3S97C 3T6ZA 4PXEA 4R5XA 2CQ1A 4EO8A 4P5TA 5KG4A 1WHOA 5EEWA 1XH2A 3JWOC 2N1TE 1IIKA 2NNXA 4KY1L 3C2PA 1IBKJ 1YEHH 4E9SA 4XVOA 4YBLC 1WUNT 4YO0B 1MWAA 4NQVA 1ITBB 3KPLA 2HFVA 1CQNA 5F9OH 4O2FA 5AW6B 3GIMA 1S1UA 2WB4A 2AJQA 5IMOA 3JV5A 1DHMA 5EORH 2VSCA 3FC8A 3NH7H 1OAUL 2HA1A 3MX0B 4FQQB 5FLUA 3TASA 3VXRB 1F42A 2DQDL 4HQQL 2L48A 2R1XB 1Z5LA 3FT9A 5HPOA 3H56A 1SXNA 3WXVH 1U3HC 2OI9B 5HHXH 3KMSA 4IGBC 2XUWA 3VI3F 1UAWA 3C6TB 2IA6A 1JZ3A 1WGOA 4JFOB 4ED6A 3FRUA 1BG9A 3ZDZF 5EUKA 5C0EA 1AXIB 4DPXA 1V7MH 4WEBH 4DXLA 5KFAA 4OQTH 4K71B 2X4RB 4WKZA 4XBGB 3W9EA 1ADQL 1K9TA 4IRSB 2XKNA 3TF4A 1P7KB 2X40A 3MLWH 3QDGB 1FGNH 4XZUB 2IMNA 3QG6B 5AW3B 4ZDHB 1G7IB 3AD9C 1J1PL 3IJEB 3IR6B 4C56E 5I8EA 1NIAA 1XC9A 2IF7A 4C8OA 1DTTB 4HG4K 4WWID 1GH8A 2H26A 4K7PL 3D5MA 1X7QB 4P8QA 1VK8A 3PABB 4S0MA 1UM6L 1NFDF 1NPKA 1NAMA 1TQTA 2YAPA 4PGBA 3AJ1A 5HK4A 1BGXH 1Y18B 2G4GA 1DQLL 4M9OA 3ZE0B 5JLZA 2HWTA 3KPNB 3C14B 3M07A 3C9NB 4JI1J 1BHNA 4P3WA 2R2CA 1GR7A 4K94C 4XP6L 2J73A 4DHLA 3GXPA 1EKSA 4N5SA 2J0QD 2M83A 4J27A 4MJIA 5KS9F 2HFEA 1NBEB 1JLAA 3IYLW 1FYTD 4NA3A 3MCSA 2X38A 1HFUA 4OZFH 5SWSE<