2YQ3A

Structure of bvdv1 envelope glycoprotein e2, ph5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
273
structure length
243
Chain Sequence
CTRETQKQGDTVEMDDDFEFGLCPCDAKPIVRGKYNTTLLNGPAFQMVCPIGWTGTVSCMLANRDTLDTAVVRTYRRSRPFPYRQGCITQKVLGEDLYDCILGGNWTCVTGDQLQYSGGSIESCKWCGFKFQRSEGLPHYPIGKCRLKNETGYRLVDNTSCNREGVAIVPQGTVKCKIGDTTVQVIALDTKLGPMPCKPYEIISSACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Pestivirus Envelope Glycoprotein E2 Clarifies its Role in Cell Entry.
pubmed doi rcsb
source organism Bovine viral diarrhea virus 1
molecule tags Viral protein
molecule keywords BVDV1 E2
total genus 39
structure length 243
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yq3A01
3.30.70.2550 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yq3A03
4ILDA 2YQ3A 2YQ2A
chains in the Genus database with same CATH superfamily
3FVYA 3K0WA 3RWCA 4M62H 4PEEA 4X64F 3CUPA 4LSRL 2XWZA 1HARA 1T6VN 2FHKA 1TVBA 2ZOOA 4M6NL 4NQCB 5EZIH 3ZGIA 1P27B 2XUWA 3GSUB 3MYJB 1UEVA 4WFGD 2ABYA 1BF5A 2P45B 5HP1B 1MFBL 2JXMA 3OQ2A 1FSKB 2AXFA 5TE7H 3C6EA 5DJ0A 1XGYL 3ME0A 4KZDH 2Z30B 1OAYH 1XIWC 4LGRB 4RGNC 1M56B 3NCBB 4WI2A 4LRAA 2XTJB 2D0GA 1HINL 2JKNA 1ZPUA 3G6AA 4HJJH 1CQMA 4TOYL 4WKZB 4CLLA 1A4JB 3SDCB 4XNXL 5LBSL 1HOCA 2OH2A 4K5PA 3TBSA 2HFEA 4UOHA 3D6FB 1CGUA 1N64L 3BEVA 4FYRA 4RMTA 4XHJD 3ZL2A 5IGXH 4MQXC 3BZEA 4JDTL 4L4VE 4OYWA 3VGVA 3SQOH 4O23A 2ZAGA 2YXFA 2XN2A 3CD4A 3LMJH 3VV2B 2MMXA 3HB3B 2E1CA 3ARQA 4FL4B 5TFSL 1LW0A 5LAXB 4U8YA 3H7BB 2WYIA 1GGIL 4JI8J 3NGKA 3N9GH 5F8GA 2HHUA 3GSIA 2EXWD 1TKTB 3M1VB 3GJEB 4GBXA 3P4LA 3DOIA 4HXBL 3ABMB 1A3QA 1HT6A 1BWMA 1H38A 2FRGP 2WWKO 4XMLH 1BF2A 2YA1A 4WFHE 3WU1A 2HFZA 1HEHC 4TNGA 1AXSB 1A8ZA 4X4RA 4OKVB 4Q6IA 1Z66A 4K0OA 4UMGA 2LP4A 4JW3A 5JXSA 4FYDA 4FXKB 4MBRA 4IQHA 4DWHA 1ASPA 4NO3A 1VQNS 3MCNA 3V4PA 3K8VA 2MKKA 5GGUB 3D39E 1E6JH 1HKLH 1WVZA 1FXLA 5I6PA 1ZAWA 3CJ2A 1MN9A 1I3GL 5CD4H 5HBMA 1GW0A 3PIOQ 3E01B 1IGTA 2ZWKA 2WIMA 4UT6L 5A8WA 3OR6B 2DNGA 4A55A 5GGSA 4Y2MA 4FZEL 2A1WH 5AW7B 3KWWB 4R5VA 2MHAB 3WEOA 5KSBF 2OEJA 4CO3A 1JYWA 2BIIA 1UVMA 3DSFH 5GIRA 2EH8H 1A5FH 1WZLA 4GVBB 4ONGL 3LQZA 3CHQA 1S1UA 4MMYB 3UBGA 5TF1H 1QE1A 2GVZB 2HPOA 3NRPA 4GMSL 1SLUA 4H13C 4X4ME 2OD4A 1GIGL 4KTEL 4I7ZC 3Q1SL 4ZYKB 1H3GA 1TQCB 2YEQA 3QJHB 1IBHA 4LDCA 4Q9QL 2PA3A 4JI8F 3UEQA 4I9WD 3IBCB 1ZYQA 4V1DA 4FCAA 4UM9B 4HVZA 4KYZA 5B0CA 1B4RA 4XDDA 2Z8QA 2DHGA 1HKFA 2KO1A 5I23A 1HNXJ 3G71S 1CWVA 1RP8A 2LAAA 1P69B 3C9NB 3BM7A 3W11C 2IH1B 2VRAA 4QRRA 5AB9A 1AHWA 2FIRT 3II3A 4PLJD 4DKEL 1K44A 1CDCA 5IQLA 2BQ3A 3BXNB 2AI0H 1GZQA 4HEME 2B43A 3GIJA 4DSIA 3BBCA 4KJWD 4Y5VC 2H5JB 2AXWA 5CINL 4A2EA 1TR0A 3FB5B 2LQ8A 2YMXL 2VBXA 1R27B 1TDQA 2L0DA 4P2AA 4YFUA 1DZ5A 2VDPH 3ZMEA 3BIKB 4OX8A 4H5SA 3MROA 3QWPA 4F7PA 3P0VL 3LEYH 2WZAA 2KFYA 1KTLA 2DR5A 2E7WA 1ZH5A 2P44B 1BVKA 5IHZB 3CZUB 3SXLA 4PJCB 3VI3F 5IW6A 1UACL 4JKWA 2Z56B 3PYGA 4P23A 2QMWA 1MREH 5E4EB 1CYWA 1FORL 3NCMA 3IDJB 4HJGA 3OKOA 5A0YA 1U8IB 2GHWB 3IGUA 4LHUD 4UOJA 1CSJA 3IKCA 3A8KA 2IH3B 1X4HA 4QKXB 3CCQS 2D7QA 4OFVA 3ZYJA 2RVJA 3NSFA 4KV5F 2DH8A 3J80U 4U6XB 3KPLA 3KOAA 4B3TJ 2OAUA 1B0RB 2Y1ZA 4JRYB 3LRMA 3RBXA 4ACPA 3L7FA 3LN4B 5CHNA 5GZOC 1OY9A 4KTYA 2VKZG 1YUHB 3EOYG 4MSWB 5H35B 2ASLA 2KZ1B 2ZWNA 4R7XA 3HP6A 5SX4I 3RNQB 1O8BA 4HAFA 1AE6H 1A02N 2YNHB 1JF1A 1A6LA 4JFEA 4PJEB 2ZX7A 4PJCF 4TUOA 3VI3B 1VI7A 1QSFA 2DH7A 4IH5A 3ILOA 2I2YA 5IWAF 1IQTA 4BCZA 2GAZB 5T14A 1CDHA 2ED8A 4XP5H 5HDQL 5A8RB 4WTYA 4PRIA 1UGKA 4D0BB 2QMUB 1GX5A 4R9HA 4OLVL 3LNIA 1LWCB 1ZANH 3ATEA 2XZWA 3V5HA 1K8IA 2H6OA 5FYLL 2ZC3A 4Z7WB 2J1KA 1NDGB 3PWJB 3TYGL 5C0RH 5JTWA 5A76A 1SJRA 5CYMA 3BGUA 1U0SA 3ML8A 4XO9A 5FGBA 5D1XA 3ZZZA 2EUZA 1S9WB 4PVMA 1G6RL 2O72A 5C0IA 4B3RJ 1MHCB 2CCLA 3JTNA 2Y4SA 1T9XA 3IMRA 2B2XL 4HHGA 3PHTA 4M5JA 2LU5A 1C0UB 1U1RA 2A3JA 5BS0E 1MFDL 2N7YA 1RJYA 3T77A 3KUEA 3QATA 1OK0A 3FCUB 2VE6A 4WAFA 2Q6CA 5I42A 1NU4A 1AGCB 1SV5A 5JXEA 1GT8A 2NQPA 2VLJA 5L4MA 1UVJA 1BFVL 4USWA 3NQKA 4Z5RA 4GKKJ 2V63A 4QIFA 1VQ7S 5KT6A 1AVAA 3PQYB 3VUAA 4MJ6A 2AGOA 4WFFD 1R0AL 2V8HA 3ERXA 3ZSTA 1J0HA 2QV6A 3FFDA 3IDNA 1MU2A 1NM2A 5EBGA 1T4KB 2JNJA 5DLLA 3T6VA 4L1DA 4QHMB 2IJRA 5KFZA 4DUXA 3F44A 4CLSA 4KKLD 1E3ZA 3PDOA 2IC3A 4B6ZA 3S37H 3UAJD 1S78C 1NUGA 5GMDA 1ZJBA 3HUJB 1CL7L 1YJUA 1HHGA 4D0DA 1AOHA 3G6JE 1MWZA 1TJIH 3D48R 1NJ9B 4UTBL 5I6LA 4KQ0A 3Q0AA 3SOTA 3ZZOA 1QLNA 4M6OH 3FW6A 3AT1B 3D25B 3JV6A 4BELD 3QRQA 3B3IB 4LBAA 5DK0A 2W01A 2MKIA 4ZUTA 1KEKA 3GXPA 2IDLA 1PZUB 1Q5YA 3F04A 4OD1H 1O9WA 3NIFE 3QSKB 3VWKB 2CPXA 4JFTA 3DOHA 2D4FA 4R90H 3MNDA 1A3RL 3KPLB 4L76A 5F0WA 1FHTA 2F8HA 3U9UA 4U7CA 1BLUA 1KTJA 4DV1J 1NKRA 2Z4QA 3HE6A 4RFNB 3Q1SH 1BYOA 2CDEA 3IBEA 1CFSA 3MECA 3EFDH 3W60A 2Y2WA 3V4UL 5KFOA 4FGMA 4G6ML 1OAXL 2GW5A 4Y16D 1UPMB 2UV8A 2KDGA 1EX8A 4NLYA 4XDCA 1KYDA 2E74C 2MQCA 4HWEL 4JL1A 3O44A 3DLLQ 4PQUB 1RZ7H 1F41A 1KDNA 3EZUA 1IGCL 2C3WA 3CXFA 2FLMA 3VQMA 4KJQD 1HINH 5J2PB 4P5MA 1JS4A 2EC8A 3WD5L 2A4EA 1RL1A 3O6FA 5IWAJ 1MQ8A 2J8UA 3L5HA 1LWCA 1ERNA 1NPUA 1UWYA 4XVSL 2ZEJA 1ZXKA 2P5EE 3DECA 3GRWH 3HKZA 3QFJA 4L3ED 4Y4FD 1TKXB 2HTLD 3P30L 4AV4A 1Q1JH 2EKYA 3HNTL 5D1XB 4ZX5A 2FJVA 4S0MA 4RAVA 4WK3A 4KKOB 2VW7A 3LP0A 3PNWA 1MHCA 4KDTC 4AQAB 5J6HB 1MCOL 3MOZA 1P5UC 2BHFA 3HC3L 4J8QA 3FUJA 1BMZA 1WAAF 4DFIA 4M8UA 3FUIA 4LLUA 5EA0H 1ITBB 4JFFA 4YHZH 4K3JH 1IKWA 4WF7A 1Y00A 1NUEA 2WGXA 2VLJB 4LLQA 2RH3A 4TSCL 5GRJL 4GW1A 2MTPA 5D4NA 1P1ZA 3IETB 5GGRA 4WIQA 3UR3C 1KIQA 1FRXA 2A18A 2V3DA 1GW6A 4WE1A 3ULVH 3LZQA 2YPVH 5DHXB 5CLYA 3RU0A 3UWTA 1OT2A 1WFNA 4JFQB 3FTGA 1DL7L 2Z7ZA 1F45A 3WN5C 3RVVD 5K9OA 1R31A 2GFFA 4A8MP 4KOBA 3L3GA 4IGBA 2R59A 4D0DB 4PG8A 3UD3P 2C1OB 1QSEE 3N40P 3HHLA 3MM7A 5GZOD 2YLKA 5F0LB 4AMXA 5CS7A 3K1KC 1RI8A 4GKLA 4LNRB 1B9ZA 1FVCA 1KVIA 3D0VB 2QKIA 3DGVA 1Z5HA 2IOIA 4DKDC 2GIXA 3E6FB 4G70B 1S1XA 1X5TA 5T3ZL 4ZJLA 4RU2A 2HGLA 4KI5E 2OTPA 3C14B 3M2VB 2WXFA 2ICEC 4OZ5A 4K07A 4P2QA 3EH3B 1LL1A 2IJ0C 2DLFL 1QEWB 1Y7VA 2DMGA 1MCFA 3T5JA 35C8L 4LARH 2NYIA 3EXLA 4FFYA 4OJFH 3C60D 3C6LB 1HC1A 1EEUA 2C3MA 1TQVA 1HNFA 4G6JH 4JQXC 5IHUL 1E5AA 3FQWA 4H8PA 4QXUH 4ADIA 4Z8FH 2VOTA 1SLVA 3EVWA 1WHPA 3LRSA 4FNRA 5LSOA 4WI0B 4C56E 4RQQB 4B9VA 2FY8A 1CICB 5KYNA 1KIPA 2IDSA 2EC9U 5B7FA 3UDVA 3D0HE 1XH0A 4UV4L 4ZVTB 4B3EA 1BIIA 1Q81T 2BRKA 1L3UA 4GLRI 1I4FA 5CCLA 5H37H 4DG1A 2CDQA 1NK0A 1OP9A 2BSEA 2LHAA 1RH8A 1OSPH 2EIZB 2H1LM 1U42A 1HFEL 4MLSA 2NY2B 4HT1H 4YDNA 5C24A 2W0LA 2HNZA 3SE8L 4M7JH 2OYKA 2XKSA 4UNIA 4AKOA 1AS8A 4DF9A 1MFNA 2UZXB 3RJMB 3FSZA 1S6UA 1XSOA 2DEIA 4ZO7A 3TANA 1AR2A 4U1HA 4YC2C 2XM3A 1J1XL 4HMEA 2ZDOA 4M5SA 3QA3A 4NCC2 1DQLH 4AX3A 1M7XA 4EKXA 1FNOA 4ALZA 4JM2C 4DN4L 4QYRA 5IFMA 3ZR5A 3KS0J 1RJCA 3RI5F 3UDWA 4JQVC 2IXQA 1FVQA 1HK6A 1UKTA 2IDCA 2V5YA 4Z2XA 4DV0J 5T1MB 3OKKB 3WQPA 3THTA 4QRSA 3SZ2A 1T2XA 3WNLA 2RQMA 1KIQB 4DH2A 1H6EA 3VCLA 1EQ0A 2CA4A 5A6LA 6FABH 5I24A 2XKNB 4JV5F 2F19H 1KCSL 3DXAD 3NCWA 2JH2A 3WMQA 1FH5L 3NIFB 2DTJA 4P9HH 1KDIA 1R3JA 5HN0A 3PEHA 3U4AA 1U8KA 2FYYA 5I66B 2B5JA 4L6V3 2PTTB 5F9JA 4GKOA 5FYJD 4KHPJ 3C5JB 2Y36L 1AG0A 2XFGB 4QZVB 4Z1PA 3PWNA 4HAGA 2ZH5A 2IQ9L 1RADB 3VCDA 1KC8T 5I6XB 2VR9A 5CP3H 5IM7B 2A83A 5F7DA 4L9LA 3FUYA 4WXOA 4NZRL 3M2UA 3ZQWA 2Q3AA 5DJYB 3RG1C 2TSAA 5EO0A 1Z3RA 1M9WA 5HDLA 1WA0X 1GJWA 1KTKE 2HLFD 5DS8B 3KJVA 3CGIA 1HDMB 1UD3A 2VXQL 4FXVA 4X62F 3LKNA 3BSGA 3RFRA 4AMKH 4E42B 1P84K 5T3XL 2VYRE 4K9EC 1ZEAH 3O45B 4QCIA 1NFDB 4QRTA 3WFHB 4UQBA 1NIBA 4K7PL 1KTQA 1LFWA 2EH7L 1OE1A 1YEGH 2PETA 3DDGA 1AB8A 3QGIA 4FKKA 3VXSD 2JEJA 2ZZUT 5IR1B 1IUZA 4OCNC 2ADFL 4OQTA 3H2VE 1N34J 1JGEB 2BFVH 2E27L 3Q5OA 4HIQA 5ESQB 1NIFA 1ETA1 4FL4C 2F8OA 2XNAA 3MNWB 3V4UH 4P7TA 3UIZA 4HUUA 1NA8A 4NC1E 2ASYA 1PLGL 2D74B 4HZLB 4G1QB 3V0VB 3QZPA 3I3DA 4BH8B 4XWGL 1FLRL 3D4ZA 3LS4H 5I8KL 2R8GA 1BEYL 4L37B 3LRLA 4FJZA 3O4OB 4OUUB 3SKOB 4YE4L 2J1ZA 4F92B 4NM4H 2GHPA 1RAGB 1OIOA 3EGDA 4WTZA 3K0JA 2EKSB 2VFUA 1VPOH 3AU1A 3WIVA 1U49A 1Q1PA 1JK9B 1WZ1H 3MLXL 1M2OA 3AA8A 1KGIA 3PGDA 3ZTQA 3C08L 2NY1B 4G65A 2VITB 4OGZA 2J5AA 1IL1A 1BDYA 3WS3A 2DWSA 4RNRA 4I1RA 2O61B 4U1HB 3FRPA 3ZTEA 1F3DJ 1S9VA 15C8H 4UM8A 2XWCA 3QJVB 5AYUL 2AEQL 2FZ3A 4H88H 2B59B 4L0YA 2MJNA 3OAUL 2ADIB 3VI3E 1XGPB 3WTYA 4XC3L 2IWEA 1E4HA 4WSKA 5TE6H 2OMVB 2IXQB 1UTDA 2ILYA 4JI2F 4CO5A 5GAGU 4G1IA 4EI5B 3M45A 2WZPD 2WZ6A 3JSMA 3UBXI 3IDIA 3TJEH 1LNQA 3BKTA 4BV1A 4IKLA 2LA4A 3Q6FA 3UCZP 4KY1L 2WB1A 3QDGE 3FQ1A 2HHWA 4GRLA 2WAHA 3HMWH 3A4EA 3I5BA 1BBDH 4XXWC 4YXLL 4HIEA 4MS6A 5CUSL 4JN1H 4XN7A 3ETBF 4KROC 5HHQB 1DANU 2WINA 4JCMA 3C5JA 4UTBH 3UP6A 4LF8F 1SHMA 4CN4A 2IRXA 2NY5H 1XNRF 1KLGB 2A6OA 3I50H 4JKPH 3DURB 4Q74A 3MLTA 4OI1A 5I1JH 2V2WB 1MFEL 1OAYL 1TLMA 1ZVSB 3IPFA 1I94J 2HHTA 4WO4C 1INQA 1ET8A 4X5PA 5T33H 1FJ7A 5FUZH 4F2SA 1GC1H 4Y00A 3QUXC 1EERB 4QO1B 1OSPL 2G2PA 5I0VA 4K59A 5D4JA 2BACA 3N9UC 5DM6Q 1NGXA 2JKTM 4Y4HC 4H2AA 4PXCA 4RNHA 4B9IA 1T05B 1C1EH 3VWJB 5EWGA 2GIMA 1D3CA 1FDDA 3HSGA 4P2OC 3UAAA 4IR9A 4FYXB 4YN3B 4R8WL 1JGEA 3QZWA 3FFCD 4I2XB 2VLRA 3W9EB 5DEGB 1TO4A 2P9RA 5F3ZA 4TPRH 4U1IA 4FF9A 2GMHA 2JQZA 4DGYL 4B0MM 4KH9A 5EF3A 4I0WA 4ZIVA 1RTIB 2Q10A 4GPVA 3P40A 3WDOA 2IH9A 2P42B 3PACA 3R0MA 1NMBL 3PL6C 4D9QD 3MGJA 1R9FA 1L0XA 2WLIA 1KGCD 3KWTA 4DN9A 5IV2A 4PW9A 3K6SB 3CXCR 2BY3A 4EVNB 3IDMB 1LWJA 2G2RA 3LSOB 4OI6A 2X1WL 5DHDA 2FJUB 3RVTD 4URKA 2UUBJ 3QORB 3RTQD 4K3GA 2NY2C 4PN6A 4MFBB 4BWUA 1R8HA 3UTTE 2GV1A 4I64A 4AEHH 4KUZH 3QQ4B 4N5ED 2F5AL 1CVJA 3PGDB 1E3FA 4PS8A 3THML 2VPWB 4LEXH 4JI2J 1ETJA 4R8UA 1K2DB 2Z8SA 3QUMA 4IMKA 3C6UA 1DO6A 3MNMA 3W57A 4L8DA 4K7QA 2ZCKL 5HYQA 4OQTL 1JV5B 4WU2A 3O3UN 4P49A 4YUDA 4JI6F 4FD0A 2B9WA 2B59A 4PTUA 5DS1A 2FIUA 5D70L 4LCCC 5JHDE 1VBKA 1IBMF 1ZLUK 2FX7L 2MEJB 2OMVA 2F6AA 2NZ1A 4ZMWA 2RQ8A 3CXHK 4HKBA 4L1TA 4MCYB 2AF6A 4A2DA 3MFHA 2V34A 4KKPA 4V19J 5HP5A 3EH2A 2YPVL 5H1SV 4I3SL 3G86A 4FF1A 1RZPA 2DMKA 4GRWF 3MM5A 2OTWA 4DPYA 3CF5Q 2ZNXA 4YHHF 5CP3A 1M7IB 2XMKA 2HUEA 1CTNA 1RACB 3EJYC 4WK2B 4JI4F 1PEWA 1R89A 3NSDA 4DV0F 4ECNA 4NEHB 5GZND 5K59E 2Q86B 4MFHA 4PP2A 5FHBL 4RNOA 4J9SA 3MI6A 3QHZH 1C0TA 5C8JA 3P1VA 4J12A 3MAHA 1SMAA 5E0OA 5E3QA 2OR9L 3UDEA 5LJ5Y 3NACL 1U1QA 1KPUB 2VDPL 3FOMA 1VB9A 3NSXA 4D8PA 1KT2B 3KXFB 2XX1A 3JYCA 1K4CB 5JW3H 3F83A 4X6DF 4BWMA 1NGXB 2DEJA 4Z7UA 2PCYA 2NY6D 5DD0H 5C0JA 1DQKA 1A1OA 3IJHA 2ZQKA 3R2DJ 1MRFL 4DOHB 3GO1H 3J7Z5 15C8L 1ZDSA 4LSUL 3AJ1A 3DRSA 5KYUA 2EDFA 1UOKA 3A3PB 2VL5A 1SKUB 1ZT4B 1U8OA 2HS3A 1G7JA 1F0XA 2QHRL 1MFVA 4ZS6C 5F7EH 3VI4A 1KJ2B 3FTVA 1ZLVH 4QHUA 5FHAH 2R4SL 3PIQA 4Y6IA 4L18A 4O51A 4I18A 3QIPB 1T0MA 2NSQA 5F7NC 4YE4H 1GAOA 2UY7B 1CGTA 4Q9BA 1A8JH 5E3PA 5CSZA 3QORA 3DRPB 2HWHA 4DCOB 1IRAY 2F18A 1X5LA 2C3UA 3MZTA 1XF1A 4AJ0A 3KJVB 1G7HB 5DLML 4OCYH 3HHLD 4OF0A 2BVTA 1CD1A 1P2CB 3QUXD 4NLVA 2Q8BL 2XYBA 3TYFB 5DJXA 4X9BA 1ZLSL 1NK8A 3TVMC 4P3WA 1TZIA 3DO7A 2RD0A 5U47A 3QDGB 5FDWB 2WQSA 2MQLA 1HYSC 4HEA9 4I48A 4DUYF 3GXNA 4AZ8B 1IQWH 1EHWA 5IIEB 3QWQB 3B8HA 3NCJL 1ZIAA 4KKZA 1RQ5A 3D39B 3NDYE 2G9HB 4PD4K 2YAMA 3TBTB 1F6FB 2LT9A 1AYRA 2QQNH 4KTEH 1FFOB 4ECRA 1ZS8B 1LE5B 1CFQA 4E9TA 2IJNA 2VMCA 2HLUA 4RX4D 3H4BA 1JPST 4DQPA 2UVVA 4ILDA 2CQ3A 5CHCB 1WHOA 4JREB 4O2EA 3I4PA 3M1CA 5DUBB 2G2ZA 1KJVB 1WTGT 3JUYA 1DVTA 3TA3C 4I1TA 1O7DE 4DL3A 1BZQK 4L2YA 4JM2F 1HWGB 2FJFA 4KRPB 5DHYB 5GSRA 1EHXA 2AANA 3CFNA 3MRHA 4WI6A 2B4UA 1TK8A 1SHSA 5GMEA 2R2RA 1VJSA 5KJ4A 4HSQA 2DK2A 1LILA 3WXWH 5I6OA 3ILJA 3UTTD 1NAQA 2LYVA 3DTUB 3QQ3A 4B60A 3N42B 3V7MA 2H3NB 3FUEA 1QPKA 5D1XD 5FYJL 2LMIA 32C2B 4JFYA 5HY9A 5MENE 1FRIA 1S10A 4Z7OF 3PGCB 2PO6C 3TC9A 3X12B 4LREA 5KG5A 4GUOA 4EU0A 4UTCA 5ANME 5DRXB 1LQ9A 2PF6A 5F89B 5JPMA 3I0RA 3DPDA 5KOMC 3IS0X 3AGWA 2WUCL 2WXIA 1RURL 2VLJD 1N32J 2QSCH 3V4VL 1YEDB 1J8HD 4MAYB 1S7HA 1A6VL 2ZCKH 2WO2B 2WZ0A 1WF0A 5IB1A 4RW7A 2VKRA 1Y0HA 2ZH4A 3KPRA 4MKMA 1MJJB 4EI5C 5BVPH 2AAAA 4NN6B 1QDUB 3O2DA 1LGVA 5I30L 2O5ZL 5JIQA 2GGPB 3W61A 3CSTA 1MKFA 4W70A 2FIKA 4YDLC 5EN2A 3BUQA 3TIDB 2YFNA 2AD9A 3DOMB 1TQWA 4OZIA 5D9SB 3QUXA 3S97C 1B7YB 4O0IA 3L4YA 4Z7VF 1PQZA 3CCLS 4FXGB 3QXVA 4UQIM 3DX8B 4RIRB 2QX0A 3MMBB 1UKQA 5HQLA 5HI5D 4DSEA 2DWDB 2R1YB 5TDOB 1WEJL 1QQDA 4MMOA 3BDPA 4X5WA 3LN9A 3NPSB 1HL5A 2H6PB 3DOSB 4ZMTA 3QO9A 3EJCA 3ULSA 1TTBA 3QIUA 4KNSA 3ZE2F 2LQBA 1HWHB 3MSPA 2K45A 4KGVB 2YQBA 2WXNA 1VACA 4TN9A 5FDWA 3MR3A 4TY8B 2BSBA 4LVEA 4MA8L 4OCRL 4C54A 4IH6A 4U1NB 1F4YL 3VDAA 4JO4H 1HQUA 1BVOA 3G2XA 2A6MA 3CTRA 5IIEA 8FABA 2H3EB 2QPFA 3LEYL 4ODHL 1FKPA 1BQUA 3OGCA 2BIQA 3BGRA 1A1NB 5D93B 1P4BH 4FN5A 2HTKC 5AG9A 3SIPB 2QQQA 2XWXA 2ZBRA 2W9EH 2GVYA 1QLRA 3B9DA 3FAWA 5D0HA 1HOEA 3HC0A 1SY6A 4WW1A 4ENEC 2BNUB 3PPSA 2RSQA 4F7VA 1U92A 5FPIA 5GAGI 3P3YA 1Q0NA 5HGBA 5I75C 2CGRH 2FZKB 3CDZB 1JF6A 4RUAA 3V6ZA 1LP9B 3QEHA 4KTDH 1JHLL 2CNOB 3DARA 3ULAB 5BV7B 5D2NB 3V0IA 1VQKS 2FJFB 4AD6A 2BW5A 3H0TB 3LYRA 1OK8A 2H51B 2XN9D 2J9CA 1MG7A 1T03B 1ADQA 1X7QA 2APOA 1SM3H 2BP5M 3CDCA 3MEDB 1GGCH 3HUJE 2E9RX 4DLEA 1RCYA 4WW2C 4LT6A 2H54B 1VC6A 4K5SA 2BQRA 2BP8B 2VDPB 2UXCF 2H8PA 3X11A 1JXKA 2YJQA 1YVFA 4WWKB 3HSDA 1T5KA 2EXSA 2BP0A 2BWQA 1DDHB 5C0AE 2H32A 2QLXA 5FA4B 3I9IA 3S6CA 4GXVH 3OXGA 3QXAA 2J6EA 3LZFH 4M5ZH 3MEKA 4KHPF 1JE6A 4KHMA 3KVQA 2YK1H 2X6CA 5HYSB 3K72B 5I1IL 1XF5A 3KL0A 2RALA 4G5ZL 3HZMB 4H1LG 4HZ1A 4USUA 2KXHA 5I1EL 2YNFA 1EAPB 2FAUA 1RIUH 2PCFA 4NS0A 3RLSA 3V6FA 5I6KA 3VXSE 1NAMH 3NCJH 2GC4C 3U1PA 5FC9A 1HLWA 3EXCX 3AS2A 1XZWA 5JQHC 3NKYA 4OTXH 5HI7A 1U3HA 1HH6B 5IMMA 2YQ3A 5HATA 2FIKB 3TIDA 3WAJA 3JQKA 4Z7QB 4MNQD 1DQTA 5T5FL 1ADQH 3K8WA 1BQRA 3QNXA 4L73A 1S9GA 1VRQC 1S4IA 3KPSD 3J7AN 1OCOB 1ID2A 1Q7YT 5JOFB 2BZCA 3CDWA 3MMBA 2DM7A 4WUUE 5ISZA 1X9SA 4HACA 3TO2A 3CHOA 2NY7H 1WBXA 2Z6FA 4LQFH 4OM0H 3Q6GH 5E4OA 1KYUA 1NIAA 1UB6B 4BFIB 4GKJF 2C3GA 4UQ2B 1XR5A 5AFAA 4NZTL 3BN4A 3QDJE 5FO2A 2XYPB 4NQXB 1EHLH 1CJTB 3IEAA 5IK3A 3SPCA 1OGSA 2G5UA 2ZX8A 4F1SA 1U02A 4TY8A 2IOOA 3QPQC 4U1NA 4Y0GA 2IFXA 4ZVPB 4DX6A 4IEFB 3CCES 3R1GH 3ATBA 1G6RA 3PE9A 2EVIA 4Y5YB 4N6RA 4CYUA 3MV7D 1QAYA 3GXTA 1E65A 2D3OR 2R7EB 1N2RB 3LS5H 3VXUE 2E5HA 1C7SA 3NXZA 1RYSA 4E36A 1HX0A 2AQ1A 2CR0A 3GO1L 1ZWIA 1YBTA 2WTPA 1U92B 3I9GL 3TO4D 5ADOL 2N0MA 1FEEA 5MLCV 4BD4A 4DQOL 3F58L 3FHAA 1LVEA 4CO2A 1M4KA 3Q01A 5KSAD 5IM0B 1C12A 3J81U 4Y19E 2HHXA 1V7NL 1S49A 2MPVA 3ARFD 4UQEA 4LFCF 3L4ZA 3BAIA 4ZDHA 2KYIA 2WCSA 3TP4A 4OAWB 3R5CA 1H6KX 3QT2A 4LSNB 4P2SA 4NA2A 2UUDH 3NNHA 4KGXB 1KPRA 3SE3A 3FTUA 3FT2A 5EU7E 3QRFM 3CVIH 4LPVA 2IV9A 4OHYA 1ONQB 3RAXA 6FABL 1USQA 5KSVA 4DR1J 3BDYH 3BOVA 3WKMH 2FB0A 2WZ1A 5AZ2L 3SDAB 3LQAH 3Q5TA 5JVHQ 4CTAA 4K7FB 2ZUQC 3DK0A 3AS0A 3OXSA 4OY9A 2OULB 5IVNA 1XO8A 3C66A 2HYIB 1W80A 4HV8A 5HO4A 3HZMA 1MUJB 4XPFH 2RU3A 4P2XA 3IWVA 4G42B 4UBDC 3OLDA 1TZOA 3TN0D 3UH8A 4N5SA 3EGXA 3QYMA 4URGA 5T3ZE 4ECQA 2P6SA 3OL6A 3FH5A 4M93B 4IH7A 4NYOA 2CNYA 4GRMB 4PJAB 3JS9A 2XETA 5KFAA 2X1GA 5D77A 1YY8A 2WLLA 1A6WL 1NGZB 4U1KB 4ODHH 4Y7MA 3KZ8A 2VPYB 4M7JL 2E5EA 2ILZA 3S5LB 4C56B 3A4TA 2X1AA 2AGJL 3SKMB 1RDRA 1SL0A 2LKZA 2KLSA 3ZJAA 2EE3A 3RZCA 4PGDB 1WAPA 4G43A 1KOHA 3M4XA 1A6PA 2BNQB 1P7KB 1I1RA 4LGSB 4UQ3A 5AUMA 3W1YC 1JZHA 2L04A 4PW3A 3OB8A 3TARA 1XD1A 3CCHB 5C09B 2NXZD 2AV7A 2FECI 3A4DA 5I15H 4ZP7A 4BZ2A 4I3RL 2Z8RA 3SODB 4YSCA 4NSKB 1RU9L 1EEZB 2HZVA 4QTIH 4IRKA 2B20A 3NGTA 2BR0A 1CD9B 4H8HA 5D4QA 5D7LA 1XNQJ 5H37G 4NM8H 1UP1A 4C0OC 4NLXA 4J4PD 4JFPA 1M7DA 5DQJA 1B0PA 3HEIB 1KHWA 5HSPA 5DC2A 3FCGA 2OMXA 1XCWA 1TQCC 4FNHA 1OW0A 3TH3T 1RWPB 4LJMA 4ZVSB 4NLAA 3VHQA 1HSAA 1KEGL 2WTFA 1FUNA 4TVPH 4GYBA 3VQSA 2ETWA 4QF1A 3MBXH 2YR3A 4JZNB 3HT0A 1SJEB 3II2A 4TS6A 2F74B 5C0AB 2XLKA 5CJ5A 4Q56A 3NABH 5HI3C 4AC2A 3I2CH 1KV7A 1RERA 2H2SD 5BRZA 1IT9H 1UD4A 2R2HA 3EJUA 1X5FA 1F00I 4JRXB 3HRZC 4NQSA 5CEYA 2V7NB 1FJEB 5C9KA 4UF4A 4XMVA 2JKSA 3PV8A 4K50A 2H0JA 4Z7YA 3UNGC 4JFOB 1KPRB 5CJXC 2AW0A 1HH9B 1ZTXH 4ZFGL 3KPRE 4P59H 3JVFC 5IROC 3EX7B 2V8DA 1N8OE 1P6AB 5KSVB 4ABQA 3MRMA 4DCQB 1C8PA 4Y16C 4IG0B 4OIXA 2BVPB 1BBDL 4JG1L 1WICA 1WWWX 1JMXA 2LU2A 4RUBA 4N0UB 3HE7B 3T3ME 3WJMB 3KUGA 1KJMB 5HHNA 3ROOA 3BUDA 1DLFH 1YEKH 2AEPL 4QHPA 4KJQC 4OI8A 3P5BP 3O3BA 3DMMC 5DUJA 1BMWA 2KRBA 4LSTL 3VXRD 4F0MA 2WRMA 2ADGA 1E4JA 4I8DA 4ELKB 3PXGa 1OHQA 2VB5A 4JPIB 1TL1A 2EDNA 4BFNA 1YRTA 2BSCA 1FBIH 1G7CB 2LLGA 4B9MA 2EXYC 1MLAA 4APQA 5F72S 4J5OA 3G04B 3WXVH 4QJ3B 3FCVA 1NANI 1MH5A 3MJ6A 3P02A 2G3MA 3K74B 3QK0A 4PBDA 3VFUB 5AOZA 3D67A 3R9LA 5LWYL 5B39A 1WIPA 3QPQD 5CSBA 1F1BB 2WVVA 3DIDA 3MUTP 2AV7B 3BN9D 3S34L 3RWEA 2DM3A 2CQ4A 2IADB 4C6AA 3FFCB 3OHMB 3WFDL 3R3TA 3UTTA 2L3MA 5DJCB 5I1KH 5IB5A 4N8PA 4ZVQB 4LLDA 3TJEL 3DRXA 2JB6A 1XGRB 3GMOA 4YSUA 2PI5A 3CSPA 1A3LL 2AYGA 1KB9J 3M1BB 1LM8V 4MYUA 1V27A 1NSPA 5C92A 2WMPA 4ABUA 3QO1A 4J9OA 4KMQA 2A9NL 4OJDH 1WI8A 2OPSB 1CK0L 2MQ8A 2ZUWA 5J1EB 2HJFB 4DO5A 1XGUA 3H2LA 3Q89A 3Q8AA 4EGLA 4OLPA 1DCLA 3UYRL 1Z2LA 2AJ0A 1BD2A 4PGBB 2B15A 3QQ9C 3BQ2A 1T1ZB 4R5TA 2TRYA 5CJOH 4F2ME 4PGEA 1UURA 1VFBA 5AZEL 3BSZA 1AHWC 1B2WL 3PCOB 1A66A 4JFDB 4EIZC 2D3O1 3S4SB 1P1LA 2E9ZA 4G9FE 4LPYA 2JKXA 1LNUB 1U8NB 1LK3L 2UXVA 4WDIB 1FXDA 3HVWA 4F04B 2IDFA 3BZEB 3G6VA 3NIGF 1R3LA 2PE8A 3UO0A 4GOSA 3L9BA 2GIRA 3TVKA 1KPVB 3PR4A 3BZ4B 4ZPVA 1CB4A 3H7BA 1UM5H 2J0XA 1P4LB 4O3PA 1EXUA 1N18A 4O4RA 2XMAA 2XIDA 5A2CA 2JIXD 3UTZA 4KHRA 2NXCA 4J9MA 2OELA 1KN6A 4DK5A 4ZK7M 1U3ZA 4K0KJ 1SVDA 4P3CL 2XN1A 4P46B 4J91A 4D3CH 5ILTL 3FSOA 4JLRA 2HSIA 1HD0A 3FKBA 3PRZA 4KRPC 5A2QY 5JHLL 2ERJC 4F91B 3WJMA 1CF8H 3T0WA 1KTRL 5JNYA 3G08A 3E3QC 2YSSA 3CZKA 4K8RA 3BVNA 2B5IB 3HNVH 3VWKC 1QVGR 2P5VA 3NOGA 1K3IA 1ORQA 4F3QA 4KXCA 4MKYA 3MNVB 1URZA 2ADGB 3CVHH 4KO7A 1LXJA 3RBZA 2Y8YA 5B39G 5I71B 2XN0A 2JFKA 2B8PA 2X4TA 3B37A 5HAOA 4QPXA 3K6NA 3OJVC 4GAAA 5A6IA 3W9HA 5IXUA 4FA7B 4QIRA 2CO7B 4WFYA 5HMYA 1GOHA 5E8DH 5KFEA 3M7OA 5F3HA 3FT4B 4Y5XB 5ICUA 5J8OA 2D9OA 3CUPB 2R29L 5D55A 1PILA 4IKJA 2BA9A 3RW7A 4A47A 1NAKH 1Y6NR 1A6AA 2RB8A 4KHTL 4LEBA 2DQIL 3TA3D 4LHUG 4I68A 1MVFA 4Z0XB 4AL8L 5KVDE 4WV1B 2WLHA 1OT4A 3C09B 3RG6A 1VZIA 3AXLB 5E6ZA 1A25A 1JKHB 2U1AA 3GDCA 5B7WA 2VZVA 3ECVA 3TF7C 4GI8A 5DD5L 3ELQA 1NGPL 4OR1A 2IYGA 3GIZL 3HFVA 3R5DA 5IHWA 4WK1A 3KPRD 4ER8A 5CCHE 3T6JA 3OJ2C 3N0PB 2WXMA 4H26B 2X42A 1MHPL 3A67H 2X87A 4P07A 3I3BA 4HJSA 1Z1ZA 4X62J 1HOCB 1MI5B 4HMCA 4PJ9D 3HC2A 5CJ8A 1ZM3A 5DUML 4HIJA 4Y19A 4ZFZA 4U6YA 2YWGA 1B0VA 4P59L 3W62A 4QOTA 3AQZA 4EBCA 1IQDA 2ITCB 3H9SB 5KS9A 4FVMA 3F73A 2XVKA 3UD5A 1OAQH 3QE5A 3TN0B 3BXNA 2WBJA 1N70A 4E41A 5KFNA 4YDKL 2DTSA 5A2FA 1Y5NB 4S10A 1J9SA 4DNLA 4PGEB 2ZYRA 3RIFK 1E27A 3WELA 4EMZA 5IS2A 1I8MB 1OYDA 4PRHD 5EHFA 5E6IC 2BPBA 3ULUF 3MCKB 3BW9A 5GS2D 2MKWA 5F71A 4IG3B 2K9FB 4WZ9A 1KJ2L 3OL2A 2DTML 5B4MC 1B64A 1BVKB 2JV6A 3CK0H 3GLZA 4YLBA 4WGVB 3T8VA 5IHZA 2KHCA 1W0VB 1XL4A 4M5MA 5DDPC 3NTCH 4FXKA 3TM6A 3MRCB 3ROLA 1D9KD 1M6OA 4USJC 3QHFL 1WF1A 5GGUA 2NY1D 1BFTA 1EXUB 5GJSH 3GFHA 5HQ8A 5FGCB 2VH5H 1N48A 2AJVL 4R2GC 5EBLB 1H2TZ 3CDYA 3OHXC 4H1LA 3SPGA 2DNOA 3VVUA 4LRDA 2YMOA 1OLZA 2ZH2A 1U8PB 4PWDB 3FQUA 4Q0BB 1EGJL 4YNYB 4Q6KA 1B0RA 1RWNB 4M00A 5KFPA 4TNEA 4DVBA 1C16B 2YKLH 3VRJB 2Z1KA 3MV7E 4FOMA 5JZ7D 5GIRB 1ZANL 3S3CB 3MNVA 3US0A 1S7IA 1OWRM 3GTTA 4LSDA 2R9LA 6PCYA 2EIJB 1MRDL 3FJ2A 3TXAA 2AKWB 5J57B 4HFUH 2XZDB 4AIXA 2FLLA 2ARJB 4TL5A 3VAIA 5F0MB 3LAKA 2X6UA 4LF2A 1W72H 1Z3GH 3WFZA 2BP3A 3MLZL 5J1AB 2DIEA 2V9RA 2GI7A 2DY2A 1R5VA 4X6FB 5EIIA 4PTTB 3VQLA 5KVMC 4I2PB 4NKIL 5JXED 6FDRA 2ERJB 1KTDB 4QRPE 1ED3B 1UFGA 5SV4A 1T11A 1NJWA 3CBJB 4FQIL 5E8NB 5EF0A 4IDKB 5DI8B 5LCVL 1RK7A 5FYKD 3TX4A 3ZR6A 1GA2A 3A22A 1N88A 3T6BA 3EIFA 5IBTH 2N1TE 2EPIA 4NCGB 3VNYA 4YWGH 3FB5A 3SPIA 5B8CA 3HOGA 3OKLB 2EABA 4H5SB 4APQC 5HLFA 4FPRA 4PR6A 1E67A 1QACA 3V0WL 2CMRH 5CEZH 4X4PA 3KYNB 3DX1A 5AAWC 1I1CA 5K39B 1EO8H 4WJ5B 2NCKL 4XP1H 4X65J 5IBLD 4HSAC 3ARBA 3QIBD 4HJGB 4DR2J 1IJ9A 3UVJA 1C7TA 1XXFC 3MPCA 3EOTL 3POCA 2QADB 4NN7C 4AIZA 3NCRA 3HPJB 1YN6A 4UY85 2Y5EA 2XQBH 1T0PB 1HILB 2FUTA 3DWTA 5DZJA 4AL7A 4PUBL 3LXAA 4D0CB 3ZDWA 2CDRB 2E1MC 5ACZA 2J43A 4OYXA 3BWUF 5CHNB 3ZTJH 4D8OA 3ISWA 4G83A 2AZ1A 3THPA 1TIUA 4F8LA 3ZKMD 2ICWB 5KFDA 5HHMD 2P9CA 3HZKB 2ISDA 4QT5B 4KVPA 3ROLB 5DK3A 3BEGB 2FJEB 1PNCA 3GFZA 1HEJC 4BDPA 1M2VA 1S7XA 3PJ9A 3T0AA 5IW1B 4OVUA 4L4TD 1FN4B 2Z7WA 4QGYA 4XOCA 5HTSA 3M7FB 4ECXA 2A74A 4Z7UE 4LVHC 4YS2A 3H2UB 2ROGA 4WK0B 1UWEH 3U9UB 1JNLH 5B21A 2Q8AH 3PW7A 3CNKA 1KP6A 4EN2A 3CCJS 3ECBB 3BKYH 2PNDA 5DMJB 3TVZA 3FU5A 2HEKA 5KG7A 1MW0A 2XICA 4MNQE 5CN1A 4Q2ZA 5EU5A 3VAKA 1E5BA 5KN5B 4PJBF 1L0QA 2FT6A 4P2FA 1I1AA 2ZE0A 3MFFA 3WIIH 5LNGA 4LIWA 4XMZA 5J13C 1JQGA 3BF4A 3MN8A 3DBXA 1Z9OA 1Q8KA 5GGRY 3RL2B 4AI7A 3UJJL 4YSRA 1P84J 3H4FA 3R5GA 1OWWA 5DZOA 3T41A 2CDGB 2PC6A 3KG1A 3DUHA 2XA8H 3QIWA 1MVUB 3MPWA 3KNBB 1IFGA 5EUOE 1M6UA 4I9XA 3MV9D 2ZFHA 2J8UB 1ED3A 1YPZB 2XULA 4MT1A 4LSSH 3TWCL 3S34H 2XPGA 1RIUL 2VDKB 2DD8S 1QVFR 2ORBL 4K8RC 3WNKA 4YHIB 3LGHA 3F5WB 3BQUC 4GQ9L 3SYZA 3O6ML 3REWB 4F57H 4K23L 3RW6A 1IE4A 2A7BA 1JTOA 2HNDB 4LDEB 2ROEA 4H4OA 3CGTA 4N2OA 2IAJA 4X6DB 4HF5L 3S48A 1E5CA 1EPFA 5KFLA 5C07B 3GG1A 2IVYA 3KE0A 3PW2A 3X1GA 1PJ7A 4ZMYA 2XZCL 1T04A 3GXDA 2NTSP 4NUJA 2FH8A 3L08A 2FLOA 2NREA 5I1HH 2CNLB 2CRIA 4F1ZA 4WE1B 5KFXA 2ZD1A 1Q0XH 3H7HB 2W38A 2GIFA 3HPJA 4AYDC 2KT3A 5E95B 1RHQB 2LXFA 3KMQA 2AYEA 3D5OF 3B34A 3MA7A 1YEEH 2DMHA 1FIEA 1TR7A 5ETPA 4OD2B 3W9JA 3EUDA 5E8DL 3LJ3A 5INCB 3UZEA 1NEUA 2ZUXA 4F37K 3KGTA 4NKDA 4NI2B 4YZFF 2BRRH 4LF5F 1U95B 3NSCA 5G55A 3TOQA 4Q6YA 1AZCA 1A3ZA 3MRDA 4MXWH 1FVCB 4I0PB 3P2BA 3IDYC 3EJMA 3D4CA 1WC0A 3GIZH 4UANA 4C3LA 5JHLH 1D9KA 3RE0A 1H0HB 1PC5A 3EG9A 4LO9A 1QSEB 3QJRB 3RDTD 3SYQA 3NFPA 2J7KA 1EKRA 3IMQJ 4J4PC 1WS7A 4RH4A 5E6IA 5ID1B 1Y5IB 2G3XA 4U6VH 5IFHH 1MY5A 1JLEB 3ZTNL 4XNMA 4PJHF 4YLQT 5B0FA 3KYLA 4C11B 1VQ5S 4HW6A 4FQLL 4JFDE 5M2UA 1Q72L 5AW4B 1CXHA 4F26A 4JAMB 4NO2A 3TCTA 3QDHA 4R4BB 4XRCA 3VJ6B 4KKOA 3LP0B 4GT0A 4BQBA 4PRHE 5I8CA 4DR1F 4JM2B 5J2MB 2XV0A 3J7A1 1N5AA 2AKRA 2HKFH 4PWHA 1K4DB 2DJMA 3EJPA 2YGVA 3QIWB 5DVLA 5LB1A 4A66A 3O4LD 3AG1B 2NXEA 3KNBA 2X4PA 1T83A 4UB0L 1UVNA 2UWEF 1MIEL 4QYOB 3U48A 4BUGA 1F8TH 1S3KL 4FQ2H 1AH1A 4X9GA 3DMMB 5F93C 2V6AA 1NDMA 4ZZFA 2ODHA 2FGOA 2E5LF 4HIIA 2OYMA 2XFXA 3HG1D 5GRVL 3KEDA 3WIHA 1B7FA 1Q1KA 1BECA 2RAMA 1CDBA 3WOVA 4E0DA 1WBYA 1WZKA 3WUWG 1CXEA 1FFTB 5K9KB 4H4OB 4EK2A 5C2CA 5B0AA 4WNQB 1WFJA 2E27H 4JFQA 1KYOK 4JRYD 4HU2A 5C07A 5E8OB 1KYFA 1GMWD 1RAEB 3O81A 3KBEA 3KHQA 4R0LB 3SDXF 4BKLA 3M2RB 1QW8A 3W2VA 5E0FA 4KXDA 3V8OA 1VCTA 3RVXC 1PZCA 2FGZA 1FFQA 1JNJA 3UTPD 2OTUA 2QPEB 1FF5A 2E9TA 4G1EA 4JN2B 1RHMB 4MNHB 4TTDD 5I1CL 1E30A 2W7PA 3ZNJ1 4MJIB 3UYOD 3LQVA 5DFVC 3LP1A 3MA7B 1AGDB 2OMTA 4GSQA 2J8AA 2OZNA 4OD2A 2DN7A 4RX4A 3EUNA 3MLZH 5GGSY 1RUSA 4U7SA 1W72L 2YD7A 5JW4N 2WSKA 5E8EA 1FRGH 5TQ0L 1NK9A 2L8AA 4MRBA 4AVIA 2B51A 1F90H 3DLBA 4KBPA 3MRDB 1JGVH 3KPTA 4LPWA 1TYJA 2Y1IA 4GAGH 1C4AA 2IDUA 3M2UB 4N2CA 4URQU 2DKMA 1ZTMA 3ARBC 4RFOH 4J9NA 3IDGA 1F9HA 3MOBH 3LRKA 4IU3B 1MWAL 5D1QA 2NW3B 2HFVA 5EZOL 1MWQA 1COBA 3C8DA 3ASOB 3GT6A 4ELMA 1ZRUA 4PJIE 1TELA 3AU0A 3Q13A 3G3LA 4KTGA 3X14B 3VGUA 3P77A 3QNYB 4KZEL 4ZPWR 4LOFA 4IYQA 1H0DB 4J6RL 3GWCA 3T9ZA 4JAMA 2WY3B 4UAHA 4EWTA 2VXUL 2ZOGA 2MNUA 5B3JE 1DHMA 3HS9A 1ZV9A 4BH8A 3PY9A 4JFVA 5I8CB 1RWMB 1QUNA 1VQYA 2CVEA 3E3XA 4QWEA 2WN2A 1EHLL 3WV0A 2FHJA 1VQMS 3ZHLA 2XT1B 3VG9B 5JIPA 4QMEA 3C16B 1NJXA 2G75A 3FQXA 4NQCD 4OX6A 1OAUH 4FLOA 1YC7A 4P74A 4ENOA 4CGTA 2KI6A 2A73B 2ZP8A 4MKVA 4YDJA 5KFQA 3OTOF 1HBUA 1WC1A 3D85A 3LIUA 3MV9A 4LLVA 1F0LA 2B4CC 2W94A 2VITA 3MXWH 3ZLQC 4YAQB 2JLGA 5I1DA 1LO4L 1UTAA 3B5GA 3P54A 4NQDB 4W93A 1TJIL 1RBLA 3W3SA 5CU9A 3UERA 3B4MA 2VXSL 5E8OA 3IMBA 4P5TC 3APFA 3D4GA 3FMGL 3BPOC 1HFUA 3ATAA 1MZZA 1VQSA 2PMZA 2WXPA 1WEXA 5GAEI 1HYSB 1IT9L 1T1WB 3FTXA 2EDLA 2OMBA 4RW6B 2XCMC 5DHVB 3ESOA 2NRDA 1MFMA 2HVJA 3A21A 2H4YB 4HYKA 1WSRA 2F65A 3O0LA 3L3OA 4JL2A 4X99B 3T0XA 2C3HA 3NCYS 1NBYB 4QXVA 3AT8A 5ETTA 3LZNA 4Z7QF 3TS8A 5IJVB 3UTSB 3U02A 3RY6C 1BZ9A 3FCTA 5KZCD 2KQMA 3STBA 4I0KA 1B6UA 3Q43A 3B2VL 4ZG1A 4QLRA 4KO6A 2WWMC 2Y7NA 4PV1C 1S7UA 1VCBC 3N6YA 3WY2A 1VRUA 2CJUH 4HUWA 1WD9A 3OQRA 4O9HL 3Q0HA 2GJ2A 3KMSA 2KVIA 2JJTA 4ERDA 1IKNC 4HZLA 5FYLD 3V4PL 4EXKA 3R4RA 4IU3A 1V3RA 3PDNA 1RU1A 3TPKA 2FLNA 3UGUA 3TASA 4M5GA 4TQRA 1FDLL 2J2ZA 5BRQA 4P4KA 1C5CH 3K91A 3ESMA 4CVZA 5ITBH 2POKA 3RR8A 3LNDA 3NZUA 1M05A 1QNZH 3X14A 1XMWA 1ZAGA 2FGWL 2GEEA 4I2XA 5I1GH 3VXMB 4OI4A 5GAEU 5LGJA 4WWNA 2MGZA 5ADPL 4DKFH 5F21B 4WLCA 4M7KL 3QIWD 4B17A 1N67A 4HK0A 4MAYC 4ZXBC 2C9XA 3IJSB 1F58L 1S9VB 1WZAA 4UM8B 1JLGA 2DNNA 3D9AH 3EGSA 3I6LD 3IXAA 3O6KH 3IDMA 1PAUB 1DVYA 1DZBA 4QTFA 5EEUA 3BS9A 1U9KA 5C0EB 5B1BB 3CVHB 4EUPB 4XMPH 4DTGL 1T20A 1R0AB 2VJXA 3CC4S 1UD6A 3OL9A 4X64J 1JXVA 2X40A 4XCEB 3AQXA 1J9TA 3AREB 2Z3FA 3GSQB 4LPCA 3LEVL 3VZHA 2Z0GA 4MJIE 2OJ1A 4NQDA 2FCBA 3PGFH 1JGVL 5EOQH 1MMNA 3F6JA 1KBPA 4CO4A 4HVBA 1X5MA 2DCUB 4U95A 1U6AL 2FJSA 3VXUD 1RJZA 3FB7B 4LVHB 4QWCA 3PX0A 5ABDE 2VN7A 4M4RA 2QHRH 1MFUA 3SBPA 4G6AC 3FH7A 2R23B 2K3HA 2A2QT 4EEYA 2DDQH 2X3AA 4XBGB 1VRTB 3BGFC 2RACA 1ZLEA 4WW2F 2CSPA 3T4YB 4NQTA 3PEJA 4X9YA 3GQFA 5BRZD 5TJWK 2NX5E 2AMGA 1WHXA 1XSJA 2FT8A 4MJJA 4QXGH 5ERWB 1TVRA 4Y88A 3BH6B 3OXRA 2DVIA 1KB5B 1SF3A 4KX7A 5E2UL 3DROA 2I25N 4Y1AE 1LWFB 4XCYB 4O5LH 4AE5A 5JW3L 3FCTB 4ENZA 3TJPA 3BPLC 4MRCA 1T89A 2UZYA 2PIIA 4L8BB 3HJEA 1PJWA 2V33A 2X1FA 1QBMH 1AXTL 4MCZB 5J3HC 2EE0A 1KLNA 1CF8L 2OX5B 2VR5A 3OJDA 1RAJA 5CP7A 1CBKA 3L9ZA 2YD2A 2YEVB 1UADC 5T1KA 4KRLB 1VRUB 3EOAA 4C47A 3VWSA 4ECYA 5E5RB 4BK8A 1EFQA 1UT9A 4QNPF 4J5VA 3VAEA 4DV7J 1HHHA 1CE1H 1JPFA 3U7YH 1UH2A 5DRWA 3T1YJ 4L5FL 4P3DB 4OLOA 4XX1G 3HIZA 4K8RH 4X5RA 3CFJB 5EUOF 1TJXA 1U8MA 2PW2A 1HBOB 3FDSA 3TWZA 2B3IA 3K5MA 1RT6A 2VXQA 3GKWH 7FABL 4ZVOB 4PJIA 4KVNH 5B1AB 3B7RL 3KWMA 4M5DB 4BWJA 4BHUA 1ROWA 5MP6H 4U1MB 2XWRA 1QZ1A 3T9NA 1JZDC 4K15A 2NR0A 3I02B 2WVDA 2KFZA 3GXUB 2FJHA 3PJXA 3KLHD 4HOWA 1CT8A 5GRJH 1ZA3B 5FXCH 5D6DA 3S96A 1RT2B 1TFWA 2E7CA 1KJ2A 1NKOA 3IJSA 4XHJC 3JZYA 1JLQA 3K6DA 3V9EA 5DM7Q 2AITA 2HGNA 2QFJA 1XGQB 2K6WA 9ATCB 4HD9A 4FCHA 3TTYA 2CHXA 4Z3GA 4PGCB 5C7ZA 1Y4ZB 4P8QA 4OHWA 4OZFG 2BVUA 2FNBA 1X5AA 3WUWB 5DS7A 2OL3B 1YJTA 1T20B 1YCSA 2EXWC 1FH5H 4M4PA 1R0AA 3H3BC 3ZZLA 4JV0A 4RW4A 1CD1B 2PR4L 3TEHB 4EZLA 2JJUA 2VOOA 2P46B 1HBNB 3LV3A 4NHCL 5GGVY 3TIEA 3PO5A 5EDWA 1ZHLB 2VERA 4Y2DB 3MM5B 3IM9A 2P28B 1Z3GL 1DJ0A 3UZQB 3UTSE 3BYRA 3GCWP 3OC8A 4KHXH 4WJBA 3HMXA 2B39A 2Z34A 2KZBA 1G4MA 4XOEA 1J8RA 1F3DH 5AVYB 1TAUA 1RJZB 3FB7A 4O9HH 4HFWA 4D7PA 4FTVB 3G6AB 5C7PA 3TCXA 2YD9A 4XCFH 3ZK0A 2FNWA 4ID8A 3D39A 2ATLA 4F9LC 4CDGC 5JIIA 5IMLA 2C2EA 4M8VA 2WN3A 5E08H 2GMJA 4UT9A 4O44A 3SIKA 5GGQL 5L0QC 2L7UA 2PN6A 2ESVB 3DGDA 1AQ8A 5TE4L 3REVA 2ZP9A 3NZ8B 3O5TB 2M88A 3QLHB 2P5ED 3R7QA 1HBMA 2IEPA 4JM4H 1KPUA 4LF5J 2A6JA 2D31A 1QFUH 1KB5A 1KJVA 2AJ1A 2XSFA 2IA6A 5LGYA 1XIQA 2FGWH 4P9HL 5I1GL 3KEHA 4NPYB 4PW4A 5LAXA 2CZ4A 2NY3B 3FTWA 4XCYA 2E5GA 3N4WA 1EMTH 2NCEA 2C4FU 3UBXB 2PFDA 4YR3A 1WC7B 2L7JA 1URIA 3FQNA 1MCDA 3VFWB 2AJZA 4JBCA 4UT7L 3BZQA 3MO1B 1QRNA 2G4EA 1VESA 3IFOB 4H2CA 4JO4L 4F8TA 5A2JH 2BSDA 5E00B 2OMLA 1KSPA 1AXSA 4G9DA 4Q6IB 3EHBB 1KCKA 4RGOL 4TVUA 4KKQA 1AR1B 5KFYA 1JPFB 3DVNB 3RWDB 2WWKT 4E9WA 3PYEA 5IREA 5DGRA 4EZMA 1BP3B 1S7WA 3NAIA 2ZSWB 1FRKA 5GXBB 5HBMB 2RMLA 1ITPA 5I2IA 2ZH6A 3BGOP 4B9TA 3OR6A 1HHKB 4M5YH 2JC1A 1RD6A 4CSPA 3V5KA 1HI0P 1PX3A 2CQ0A 2FVPA 2D3JA 1SJFA 3QC6X 5FLUA 1AXQA 2PTVA 1HI8A 2FR4A 2HVZA 4ECTA 5DJXB 1QLEH 3M8OL 3OZKA 2KZWA 4F9PC 5DUPL 2XYHB 4XPCA 3RGVB 3SQGB 1OZTG 3TA2A 1FXRA 1QE1B 3UW1A 1QHOA 2BUNA 4AYEC 3ZZRA 5HI4C 2CK2A 4NOBA 2C9RA 2NY0B 1L9RA 5L2KB 4YDXA 1S79A 3PKMA 1N9PA 3MMEB 4IRJA 4WUUA 3WUWA 2ZITA 1QFWH 2HG5B 4E9LA 3GIIA 5EEYA 5D4OA 1AZSB 4N8VG 1WZ1L 2H6PA 3DOSA 2FATH 3MLXH 3MRQA 4OV1A 4LF6F 5JIDA 3NMRA 1CFQB 3PAZA 4MXVF 5FWRA 1ZLVK 1Q5VA 4QIWD 1AGEA 4C4BA 3FF7A 3SOBH 4DDFA 1EK3A 2CXKA 1GZQB 3CV5A 2BOBA 1XZ0A 2DL9A 3BPNB 3DVIA 4JX0A 1ZAVA 2CQCA 2QGFB 2RDIA 3ISNC 3OXFA 1TSRA 3LB6C 3AHPA 4PRNB 3BEWA 3G5WA 2XQ0A 3BWSA 1EA9C 2ARJQ 3ECWA 3PWVB 1E8YA 5GSRB 4FF3A 2HHPA 3KH4A 1BQHB 2DMCA 2YUZA 1KHVA 4U8VA 3C6SB 5I9QC 3BCDA 2DJUA 4OI2A 4NGHL 2VDNL 4HAKA 2HTKD 1YG9A 1DLOB 1NSAA 1G9MH 4PJCA 32C2A 4JFYB 2YAEA 3H9YA 3CBRA 3LD8B 2X1QA 4R4FL 5D7SL 5SWSD 4Y0FA 3GEFA 3KR3H 2DL2A 4KK6C 3RZWA 2F53E 2ZH7A 2CO3A 3L7UA 3JYTB 1RZJH 2IMWP 3D0LA 5H8DA 2HVIA 4LSZB 1LLAA 5DJDB 1Q53A 3D09A 2AJ4A 4UINL 4DKEH 1OE3A 1CLFA 2DF3A 3HJFA 2M7SA 1PIGA 2WBRA 4LHQB 2DYRB 3H2PA 5D8JL 4PEOA 4ZW3A 2EUWA 1RCOB 4C7QA 3AAZA 3D3VD 5IP4A 3BPSP 3UAJA 3L95B 4YMPA 5IB1B 4I6AA 5DJ8B 3W9IA 3LOUA 1AO7A 1N33F 5FV2A 5KVEE 4YHPA 3KBHE 4IIZA 2VG5B 2RRAA 1ND0B 3OZ9L 3SCMC 4OYZA 4Y8DC 5EU4A 4HLZG 2BVZA 2ZNYA 3W3BA 3HHLC 2R69H 3SYAA 1CC3A 4MA1C 1GIGH 2AQQA 2EP6A 3DOMA 1N32F 1EEYB 1JPTL 4FFZL 4MA3B 2HPTA 4X0KA 2QE5A 3P3SA 1ZHBA 4ONFH 3D6HB 1OCWH 4A48A 1YBAA 4BZ2L 4LFCJ 4WF9Q 4U9RA 3CSYB 5A40E 3PRDA 4LRCA 2YNFB 4WU5A 4N8OA 3UTPE 2EYRA 3T3PB 5JA9A 1VSCA 4PRIB 3INOA 1AI1H 4CKQA 2V17L 2YMTA 1TXKA 1E9PB 1Z9MA 2VM9A 4HJ0D 3NJVA 5AW9B 3OR1B 4USIA 1FGNL 4C98A 1E5UI 1UA1A 4M29A 2C3PA 3RHWF 4RBUA 3C87A 3HHSA 5AL8A 1AANA 1S9WA 5IUSA 3SGDI 2EK6A 2Z2ZA 1ZTXE 4HCIA 1EO5A 3SHSA 5IFHL 3ZE2E 5KG4A 2OK0H 1IBGH 4OLUL 2HKEA 3IR5B 4X66F 3DM2A 2V5RA 4TL4A 1D7DA 1DBJL 5FB8A 5ALCH 4MDRA 4DAGL 3QI9B 1UFLA 3CHSA 3NESA 3HZ3A 1S8DB 4XP5L 5DLMH 2NYKA 4MWFA 2XU9A 1FYTE 3AWEA 8CGTA 2KDOA 3ICLA 1FFPA 1CXFA 1WF2A 3MUHL 4OB5H 2JRSA 2YAFA 4PJDA 3QEHB 1Z1WA 3QHZL 4MJ6B 4IEFA 5D0GA 2CIIA 2CG9X 4JPVH 1F8TL 1S3KH 4FQ2L 4CJ1A 1GS6X 3LZOA 1Q8MA 3TV8A 3AH6A 4LF7F 1T94A 1T22A 2UYLB 2ZCHH 3QUKB 4OLWH 2DIUA 4QRFA 5HK4A 1NMEB 2KG0A 2R7UA 3MRBA 3MXVH 2BO0A 1NMAH 1FWPA 1YKWA 5IKCA 4DT2A 2X9ZA 2NXYB 4X4KA 3QNZA 5E2TH 2XZZA 2VJUA 4WWKA 4HUVA 3QR1A 3SGJC 5KVFL 5FA4A 4QXTA 4BEIA 1AYOA 5BV7H 4DXLA 1UG9A 3ZXAC 1M71A 1WHWA 3FBCA 5FGSA 4BCXA 4UZBA 5IT9U 3JV6B 3SE9L 4I3RH 4XPAH 4WVRA 3ARGA 5KSAC 1YLBB 5J9PA 2CXGA 3K72A 2FHBA 5IJCC 2HRUA 3V7AE 4UF7C 3OHXB 1BV8A 5FW8A 2QLYA 4B9LA 4V1DD 5D4IA 1IAKA 3EYUH 4HMDA 1JGLH 3WHXB 2E7DA 2HT4C 3NDZE 2Z8VC 3QWRD 1GS8A 4HBQA 1OQXA 4AEFA 5A7BA 4ZPTR 1RGVA 1YMMD 4NXKA 3B3BA 1ND0A 1KXVA 4YSEA 4DPTA 3WJLC 4J3OH 3OJSA 2JDJA 2YD8A 3FU9A 4E5XB 5HYJE 4K7FA 1VFJA 5AOMA 1H2VZ 1LWEA 2B7CB 3L3JB 4JGJA 4LIQH 2J55A 3SY0B 2X0WA 4KKAC 3EMTA 4DV6F 4HV8B 4W9LC 2GS8A 1NEZA 1SBSH 3ECUA 4ZVEA 3DYMA 4G42A 1K3ZA 4OIFA 3IXTA 3PXLA 3OKMB 2CA9A 2EYRB 4UBDD 2GTZB 3TN0C 2L48A 5L6YH 3H3PL 1ZE3H 1MLBB 3ULVE 5JIMA 2RF2A 1M9SA 3O4LE 3QFJB 4L4VD 1NCHA 1XT5A 3MLWH 5SWZE 3OVAA 3S5LA 3T5WA 4C56A 4NM8L 1S7SB 2O4EA 5IT2H 2NY0C 3ZE0E 2JTYA 3GBDA 35C8H 4LARL 3H53A 5A3ID 1XR7A 2NSCA 2BHYA 1G94A 2XTJE 3CHXA 4Y5YA 1NBEB 4CYUB 2EVFA 2YBGA 3NYKA 2P8LB 3QAQA 4EKJA 2E56A 4PG4A 1PKOA 4RRPM 3KL5A 4KZEH 4LLUB 5ILTH 1EEZA 1ZWIB 2E1RA 1I3RB 2KZZA 2NZ9C 5D1QE 3R6GB 1KLUA 1UVLA 3SBMA 4ZOCA 5F7BA 3CNQP 4AYMC 1AFVL 4G7YL 1WKLA 2GAGC 2ZUQB 1GEHA 5ID0A 2J9DE 4HTIA 2WVSA 4EBQH 5BCAA 5F96H 2EFOA 2B7DT 3D69A 1DEEA 4J3SA 1T2JA 1DANT 4PS7A 4PJ7A 2HRHA 1H3DA 4Q7DA 1R3NA 1WTFA 3FN0H 3VFRB 5A2LH 4QF1B 3TH4T 5D0RA 3UPFA 3DDFA 2LECA 3SJVD 1RUPH 1EJ8A 2NY5C 2F7QA 5F7WC 3EDJA 2UZIL 3IMVA 4ICXA 4MD5A 4ZAKB 3RAJH 4HUVB 5F6IB 2HQFA 1KR4A 1WG3A 3CZFA 3TFBA 4MIAA 4DSFA 2RBLA 3UG3A 4JRWA 4E9VA 2OO4A 2J5LB 5EZJA 2MKYA 2BNRE 4D3CL 2O01C 1P9QC 5EU6E 2EWHA 2JVOA 1UYWL 2AABH 2H2SC 2ZYHA 2FLRT 4WI7A 1N10A 5KFHA 4DR7F 4KU1A 2J6EH 3MOAL 1VISA 3TTSA 1O0VA 1JYVA 1WOOA 3EZOA 4I4WB 4CN6A 1QBLL 1J0ZA 2NW2B 5IQ7H 5MHSE 2VOPA 3AADB 3U1QA 2Y8WA 1SOKA 1K73T 3ZDYE 2AV1B 1CE6A 2I5YH 3AT9A 3BC9A 4NYLB 5D7IE 3UE2A 3VGSA 3HSJA 3J8F7 4B3TF 5DMGD 4B3MJ 3LTVA 1EAQA 3MREB 3PHEA 4N0UA 3BUIA 5SX5K 3JAMU 4E5XA 5EZLB 1RT4A 2Q7YA 1CEZA 3DLEB 2BNQA 3GHPA 5AUMB 1FNSL 4L8CB 3DGGB 3DUSB 5C6TL 3KLIA 3DLQR 4RRPA 3BO8B 4Z0BL 4ODXA 4F27A 4EF3A 1N3NA 5BW7A 3NS6A 1NB7A 2YWYA 5J1NA 3HI1A 1OP5K 4NN5B 4NZ6A 4L9DA 4RAUA 4P2QE 1SJ4P 2XG5A 1RZGA 1U8HB 5FLVA 4ZPTA 3L3DB 4HL9A 4G8EB 4OHZA 4L4TA 1DJYA 1G5AA 1KJ2H 1H9DA 2B9EA 4K2UL 3QEGL 4H25A 1EJFA 1SB6A 3ARDC 3VQ1C 5D5MA 1F42A 2DQFA 1KCSH 2UZXA 4JS7A 4UQAA 4H8WL 2C1EB 2D0FA 3HMXL 1W26A 3M9MB 4KY2A 3MUJA 3HAEA 3N01A 4KDVA 1JN6B 1CI3M 4YFDB 1N52B 1R5WA 3LKOB 5B08A 4E68A 4DKFL 2OEMA 2VKWA 1MHHB 3BN9C 3AAWB 3Q8YA 2X4SA 2GJPA 1RAIB 4EE2A 4HH0A 1D5ZA 1P9MA 2OXHB 2J8OA 3OMZA 5AL0A 4KZDL 2MOVA 2BRLA 1XGRA 1AIFA 2AVFA 1VMBA 1GGBH 3OFEA 2LU3A 5DO8A 4CVXA 4FVCA 4O0NA 2ZVIA 4GG6B 3C5SB 1Q79A 3W63A 4NM4L 3RWGB 3ZSSA 2CCVA 4OJEH 2HQDA 2VLLB 4UQ9A 3BMVA 5IB2B 5FYJU 1SPBP 1V5VA 1ZPVA 3FZ2A 2HJFA 4LKXA 5E5NA 3SE8H 3HMJG 1NGYB 1SLXA 4FA6A 2HZAA 2VXVL 1LEGB 2RB7A 4M5KA 4MB3A 3LEVH 3A23A 5IOPA 2OTJS 2NX5A 4A4JA 2PO6B 1XMBA 4OT1L 3OR7A 3FXIC 4FKHA 2RHSB 3E8OA 2OSXA 2C3VB 2D3ZA 1MCBA 5F7DB 1TQTA 4FMFA 1HWJA 2P7TA 3S4SA 3GZKA 5I19H 3WO3B 2WKOA 3GYXB 1VJWA 3CSFA 4TSBL 2VDQH 4FI7A 4L9LC 4PIBA 4WDIA 2E4FA 3Q2VA 3CDAA 2DM4A 3TRGA 4FHJA 1W8EA 3O3BB 4BC9A 5HPMB 4RMVA 4YSOA 3UMTA 1NH7A 1ZSDB 4PRAA 4HT5A 1N0UA 4F93B 1HNWJ 3O45A 3F7LA 4PJFA 3U6XA 4HSCX 1XQ4A 2P49B 4NNPH 1BEXA 3FZBA 3WKYA 2G1DA 1XSIA 5KTEH 1CGXA 1G9HA 3AXIA 4A38A 5ICYB 2OPCA 3U6RA 1OGTB 1N56A 1RISA 3BH8B 4E9YA 1ZT7A 4AITA 4XMXA 5EZPA 2ZHAA 3SDXB 3K0YA 2VN6A 4W9KC 2UUWA 3V0VA 1U45A 2AJSL 4TQEL 3BVNB 1YC8A 4S1QH 3IR7B 5L2JB 5D71L 3U2IA 2ASDA 2Q66A 1L0PA 3GBNL 4JJ5B 4L8SB 5F88A 2DQJH 3NRFA 5BS0B 3QPIA 1QYGH 5AAPA 5DJZA 2XC9A 2Q6BA 2VO5A 5DGBA 3CDBA 4G8FA 3QVAA 4FTVE 1TU2A 1HVXA 3FCBA 5IB5B 5MEND 1K47A 2F5BH 3PFOA 4J90A 4JFXA 4JYAJ 3CDEA 1RZGB 1WC6A 3TNVA 3T2NL 1RZKC 3P4MB 4L4TB 1FGVH 2DB8A 3NIFF 4RBPK 4BK5A 2SODB 1PSDA 3WEXA 1F3RB 6TAAA 1G7MA 3QJJA 2ZUSA 5ELIA 1E2ZA 4MNQA 2RD5C 2WP3O 1MVYA 1D2OA 1YJDL 4TVSa 2FZ3B 5D7JC 2Z57B 4UI2A 3RTQC 4RGNB 1R5WB 4GH7B 3RWJB 4M5HA 1XMOF 3DLHA 3KPNB 1CD0A 5C0AD 1JGLL 1FLRH 3F7KA 1ETB1 1YA5A 2XWBB 2OFHX 3U0PB 5E2VH 2FVNA 2OL3H 3ZN6A 1AY1L 3QJLA 1Q4RA 3ZTDC 2CNZA 4DN3L 1KY6A 5DMIH 4PCKA 4JMNA 1NBVL 3OKEB 3BUYA 1M1HA 3ZMNA 3EICA 4R0JA 2R1WB 3MRPB 4PJ9C 1J2VA 3TUPA 2VLLA 5F3FA 1GXTA 3S8SA 3QEQD 3OTEA 3BRGC 2R0ZH 3UXFA 3WKPA 2PCPA 2PYED 4PJ5D 5E24E 5JUEL 3SN6N 4I69A 2Y1RI 3VAGA 1EHKB 2BYCA 3N85H 4U1JA 4A8WA 2PWDA 4XXWA 3X3FH 1XCQB 4URSA 1JPSL 2XI2A 1LHZA 4JY5L 2H2PD 1SIZA 1E90A 1WT5A 1U1LA 3F7YA 1PY4A 4ATTA 3QZLA 4OD3L 3V6KA 1DBAH 1JBJA 3N2JA 2E47A 5FUCC 3D1QA 3HCVA 3KPSE 3LZRA 2IIJA 4HH9A 2I27N 3GR0A 1RA7A 2DWEB 2DBLL 3HNSH 4UDTA 4Z76B 5DRNB 1IU1A 3WIFB 2GUYA 3BKYL 4JO5A 1ZSDA 4PRAB 1FCAA 3T65B 3VXOB 1SHWA 1H15B 5GRUL 3T5KA 1E9QA 5I18L 2M8XA 1Y3JA 4JM4L 4DW2L 1F2XK 3IF1A 5EBLA 4IR1A 1D6VH 2F9DA 1QFWM 5ESAA 4ODTH 3WX8A 1H6TA 2EBEA 3SGEI 3O3AA 3MMAA 5DEGA 1VGYA 2ALZA 4TXSA 2E7MA 4PI2A 5T1LB 3FC9A 4HIHA 5I74B 3CJRA 1WJ9A 3HZYB 2F0CA 3DRRB 4E2FB 4WKXA 4WV1A 1ZVYA 2OP4H 2DLTA 3D39D 4P5KA 5SX4H 1I7ZA 3IGAA 3VXTA 2BE2B 3H40A 2FJAB 1WD8A 5DJZB 4PUBH 3VFNB 2KL6A 5DZ7A 3X1BA 2VWEC 3D3VA 1I9RL 4HC1L 3QCUH 3I82A 1S2EA 2PR4H 2Y5TB 4R0LC 4DV5F 4FXTA 3RBGA 1EO7A 1OTUC 3ARTA 2O6EA 3QEGH 1DQMH 3H7LA 1YEHH 4I0CC 1QUVA 1BHNA 3KLAB 1YAZA 3EBHA 1KTDA 3HHEA 4UU9B 5LNDA 3NABL 3DETD 5HP1A 1JV5A 2DWYA 4M5YL 4RWHA 4X8XA 2FHJD 1Q7LB 4ES2A 4JG0H 2VG7B 2VSCA 4AJVA 2M5YA 3FRUA 1GC1C 1HXYB 1UATA 4IMLA 1EXGA 3ME0B 3AXMA 1BFVH 3EFFB 4MMXB 3LH2H 3QWRA 5LVEA 1E27B 4FF2A 4HKBB 3QGPA 2L08A 4DL2A 4N90D 1XMOJ 3R06B 2YD4A 1HYSD 1TMMA 4N87A 4ZVGA 1PD1A 3DSNA 4H20L 4N2LA 4ANUA 5FEBA 2R7OA 5E4EC 1NSNH 1SYSA 3QUML 4TNVK 3GMRA 2YKMB 3FEXB 1KZQA 1IEHA 3M1OA 4GI9A 4L3EE 5KTQA 4OBSA 2J73A 3ARBB 3VD9A 1R4XA 5K8OA 3N44F 3UVJB 1RMFL 2FK9A 2XVGA 2DNHA 1CJKA 3LCYA 1TKTA 3M1VA 3UBXG 2B4CL 2MQ0A 3ESUF 4H1LB 3WNIA 4Z6AT 2P80D 2B9YA 2ZC4A 4CLYA 4WTXA 5AVXB 1MG3C 1OAZH 2Q79A 2LEAA 4D0CA 4X4YA 3QR0A 3B5TA 3QDJD 3MZGB 5CMAB 4DVBB 1HQ4B 4Z76A 2BEFA 3PXJA 4R90L 2C2ZB 2CZVC 4D8PB 2FWOB 1K4CA 1IAOA 1KZYA 2OQJB 1SC1B 4ZDNA 4RGND 2WYTA 3ZKMC 2ZCLH 4CC1A 3SMZA 3UZEC 3H5SA 4ECUA 4RA0C 3N5FA 4YOEA 1TT6A 4BXVA 3MCLH 3QRPA 1JX4A 4K2XA 2ARJA 1YO4A 1X4YA 1VS3A 4KIAA 3RYLA 1XTMA 2Z31C 3CHPA 4MA7L 5D2NC 1PLBA 4Z3HA 1ACMB 2R56H 4NC2B 4JR9L 2CG4A 2CCWA 3GIVA 3NSJA 4X6FA 4BE6A 1GMWA 1SC4B 3VXTB 5DQGA 3IO1A 1G7IA 5KJRL 4GVBA 3KG5A 5DMIL 3QLHA 5D2LA 2OSWA 5I0DA 3HKFA 3Q83A 4YDZA 1NB2A 1P7QB 5FM8A 2K8MA 4I18C 4J8RB 3J81j 4GUPB 1URNA 3BKCH 4MXQC 2ZDPA 1J8HA 1T1YA 2CDGA 2B3RA 3NJXA 4HJ1A 1VDHA 4F0HA 2Z58B 3S88H 3I4HX 2OR7A 4QWBA 1TZIB 1O6TA 4DV2F 2MSPA 1MXGA 3U1SH 4OZ2A 4OYBA 1PD0A 1RVFH 4IBQA 5DRZA 3W5ZA 3DC0A 2QHLA 5K39A 3U2SA 4A7GF 2YPZA 5LT5A 2IH1A 2DOCA 2XACC 5F0PB 2DZEA 3IRZA 5TH2A 3HHNB 2VG7A 3S35H 2W4CA 2Y3NA 1KG0B 4ORGB 4DKTA 4ED2A 3REWA 2NZIA 1LXNA 1XNQF 4TSCH 4Z7WF 3NN8B 1E6VB 4G11A 1X4ZA 1FFOA 1S0MA 2XGPA 4NRYA 1BPVA 2MEWA 2B77A 1DFBL 2HWZL 4EJ1C 3VB9A 4KC3B 5E41A 3PX6A 1FPTH 4O2EB 3ZOAA 2OSQA 2WHVA 4P5RA 1MROB 2XPZA 1GL4B 4YC2B 4ZW5A 1SBRA 3RZCD 1QD0A 2JEGA 1RIVL 1KLFA 4HHAA 3W0WE 5J13B 4I89A 2YXVA 3Q44A 1NKGA 1NGQH 1UT1A 2QA2A 5FD1A 2BINA 5A16B 1SCJB 1S7XB 4UDUA 4M43H 3HF5A 3IKCB 3K2KA 4RL1A 3DMJB 3W1ZA 3GJSB 2LR4A 5HHOD 1Q94B 3EO0B 1N4XL 3GMPA 3QQ3B 4XNYH 3M46A 4P4KD 3TPUA 3IK2A 4OZJA 4AFFA 4BFEA 1X9WA 1Z2KA 1VENA 2YO3A 4NJ9H 4QGTA 3KK1A 3ATFA 2YTCA 1CBVH 1HNVA 4PPZA 3PGCA 4Q2ZB 1H3XA 3LPFA 4NKOA 4WEBH 3RNKA 3H20A 1ZIBA 3HRPA 2XY1A 3SCKE 5AE2A 1UZHA 2P8IA 1F5AA 4DW2H 3EZJB 5LN8A 1N6QL 1YSJA 3PDGA 1V5JA 3MI7X 1ETZA 3I75A 1EEQA 1E4WH 3VFTA 2AXHA 4PRBB 3TBBA 1GJIA 2LW3A 3ZRFC 4JPWL 1KGYE 2AK4B 1T7ZA 2MIZA 2YXMA 2JIXA 2DLHA 3G5YB 5E2VL 2VBZA 1AT1B 5H94A 3RIFF 2ICES 1NCUA 5F7LB 1RJLA 2N56A 1J5IA 1T0TV 2XDHA 2AK1L 4B9JA 4U0RC 5HVHC 3K8LA 3GI8H 4Z7IA 3DO4A 1NC4D 4LOUD 4K5OA 1E3XA 4AXWB 2DGSA 2NCMA 3DETC 3I84A 4JG5A 2OK0L 4NO2B 1DSFH 1RULL 2PW1B 1RK0A 1MCRA 2YGPA 4JJOA 4YSTA 5TDOA 3X3FL 4E9XA 2HNDA 3LKPA 3N85L 3CJ8A 4C48A 5H9EJ 1J5DA 2CR6A 3OLGA 2X4UB 3L2MA 4RMQA 1CS4A 5MI0C 4GO6B 4RFOL 3MV7A 4WYWA 3MNZA 3PQYE 5KT4A 5EA0L 4UQGA 3HSZA 1RZKL 2R8SH 2V17H 2L41A 4HIIB 5J6SA 3QDMA 3QUYA 4XMKL 5C3LD 1U8CA 1YJ7A 2CZ9A 4EZKA 1JHTB 1HHQA 2QL7B 2LXUA 3C15A 1S7QB 4AM0B 2ZD1B 9CGTA 3T5HA 4QWWC 1T4KA 1T9VA 4FLHA 4YHLL 4NRYB 1UGNA 2N3JA 4PJGB 1CFMA 4C58B 4R0LA 1QLFB 4L48A 3H9SD 4YIQA 5KVEL 3FNNA 2NLJA 4DR6F 4LMQI 4BZ1H 2CQGA 4U05A 4LXFA 1DURA 2K8GA 1B0TA 3ILIA 3B9AA 2ED9A 3WE6B 5FCUH 1T66D 2CMRL 2E9GA 2XHNA 3D87B 3UX9B 3AG4B 4AQOA 2K4AA 4FRWA 1S48A 5GJTH 1EETA 4XIUA 3LWLA 5I6XC 1I6JA 1XGTA 1T03A 2IQ9H 3KJ6L 4G1EB 1F58H 4JN2A 3M86A 5A16A 1EAYC 1TUGB 5JQIB 1KNZA 5F7HA 5CCJA 2K7JA 3TZVA 1OT1A 3QUHA 4FFYH 3MJ7A 3EG9B 2OV0A 3IYLW 2VSKB 2XHWA 3VXNA 3F41A 2CBQA 2Z4QB 3LAFA 5DZVA 4QRPD 1IVTA 1EBPA 4JZJC 3D18B 4WWSA 5HGAB 3PWUB 2BJ8A 4GRLD 3BDBA 1AR1D 1DUYB 3JVGC 3SI8A 3IRCA 1NLKL 1ODUA 1ZZFA 2LTQB 4N9OB 1R24A 3RAJL 5HYJD 4B02A 3KDPB 2Z31B 4DL0C 3VXSA 1XTLA 3FSVA 5KYWA 2GBTA 4GINA 1F1AA 5D7IA 5C0BB 3M8ZA 2AFNA 3F05A 5C2BH 3DO3A 4HWZB 1JXFA 3UG4A 4M6AA 4TOYH 1A9EA 1K8DA 3T0ED 1MJUL 2ZOWA 1M1SA 2QT7A 2ZJRQ 3BT0A 1R1CA 2WUBH 4BWWA 5ISZB 3IG1A 4P4KC 5AD0A 3C60A 4Q0XL 3SSGA 2IPTL 3I32A 3LKPB 5HHOB 1RZ8B 1FNGA 3NCPA 1FKAF 4FTVD 4LCUA 3ZHKA 3PUUA 1V05A 2HVEA 1I5OB 3SQBB 4HHJA 1UXLA 3GHBH 5E56A 2HN7A 3DSFL 3EOBA 3ARWA 2NDGA 3V4PH 2OPRA 2IJFA 2E29A 1AKJA 3KH3A 2FEDC 5LAPA 5FW7A 4Y5VA 3QUYB 4N0RA 1KMGA 2OTUB 1O5DT 3MLWL 1XH3B 4FDFA 3CJ4A 3HJ0A 5DC9B 4MMZA 1TMQA 4FG4A 4OLYH 4AM0A 1OGAE 2NT0A 1K5WA 4ZCMA 2VDKH 5CBEB 3BRDA 3PAVA 2D0HA 5THWA 5KVFH 3CN4A 3DX2A 3Q5YA 2UU9F 3EFOA 3CULA 3K1DA 4HCRL 3TCLA 4PJGA 1FZJB 3DX7B 1S6QA 2CUMA 3BSCA 1QTMA 3AMLA 1BA9A 4P23C 1CGSH 5E9DB 1Y7PA 4DGYH 1N4LA 4DGVH 4TPRL 5IM0A 1HIYA 1C12B 5DHVA 1DN0A 3MLUL 2IALA 5GS1B 5FKPA 2GB2A 2YAOA 2VC1A 3INUL 4S1RL 3ZTCC 4KNTA 4BSWA 4AGLA 1CZ8H 2BNRD 2X3BA 5DO2C 1ZK5A 4H8QA 4DOHE 4YHYC 3ETBJ 2LQ9A 1I8AA 3MTXA 3UTSA 2PO4A 4UIMB 1WKJA 3STZA 3LP2B 4NEZA 3DLJA 4XN5A 4XO3A 3H2WA 1QVOB 3QORD 1QEWA 4X8CA 2ICCA 5C25A 1I3UA 2Q6WB 2RGSA 4GG8A 4WJG3 1QI5A 3S36H 2VDIA 2YWEA 1B4SA 2ZWZA 2UV8G 2CHNA 2PYEA 1S5IL 5GSVA 3AITA 2JLPA 4ZUWA 5AYUH 4DGUA 4W92B 2LQRA 1L9MA 1I9JH 4G3YL 3FQWB 4UOW0 2F08A 3PRVA 4G6VB 4QKTA 4GJTB 1GTNA 4JO3L 4K3DH 3RUGA 3DX0A 3HULA 4YO0B 1GQEA 3BPCA 5CBAA 1BWEA 1H74A 3QO0A 1RV6X 5BUPA 5IBTL 1DBKL 1E6OL 2VJ8A 2R0WH 4GRMA 4XZUB 5C0BA 4GP8B 1BIIB 3U4BH 7TAAA 2HZCA 3C16A 1JFQL 1ZD6A 2VLMD 4HWZA 5CCGE 2VF3A 2HMID 4RX6A 4DG1B 1LP9E 3BN3B 2NPFA 3HT3A 2DWXA 2CO4A 2ZD0A 3QZNA 3HLUA 1J12A 5K93A 2P5WB 2JCCA 4GFXA 4DUVA 3DXBA 3WLBA 4PZVA 1X4GA 4DL7A 2WK4A 2EDJA 1VC0A 4ZNEE 4U31A 3MOJB 4NSKA 2UVUA 3I6GA 1XEZA 2MQMA 3SQBA 2A0LD 3U6XS 2E86A 4EBEA 4AVJA 3N0AA 1WV7T 3RAQA 5D6DC 5C0EA 1HW9A 3VU2A 4R3SA 3LUYA 4KFMA 1CLZL 3N1GC 3WFCH 3QZ8A 4HOMA 4JFPB 1AKJB 1IZKA 4TSAL 5T1MA 1T9UA 2R42A 4ZFFA 3APMA 2V0AA 4Y5VB 4NJ9L 4FC3E 2BE7D 2X3DA 2DGXA 2CFXA 1JMZA 5KW9H 3ARZA 4PCQA 4Y65A 1XCTB 4OZHF 3N43F 4OJHA 3GKWL 2AEJA 3KK2B 5D5ME 2ZAHA 5BO0D 1QSED 1NOLA 2AJYH 4NUQA 5AXMA 2D3NA 4F33A 2I07B 1WSST 5TPWH 2GSGB 3SBWA 1JHKH 1GAFL 5CWSB 3EXJA 2CR3A 1RIVH 3EUUA 3TESA 4UAOC 3TI0A 2WVUA 3T0EB 5DUPH 2ITEA 4UQDA 3IJYA