2YQ4A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus
molecule tags Oxidoreductase
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A01
4FJ0A 3F1LA 3OEWA 2Z1MA 4R41A 5AXDA 4MKXA 4OO3A 1T1SA 3LK7A 3OMLA 3PWKA 3L0DA 2XOXA 2IXAA 4ROSA 3MJEA 4D0SA 1YO6A 5L95A 1JW9B 3DMTC 4XDYA 3LT2A 3ZWOA 4AG3A 5DP2A 3KHUA 4XB1A 4MJLA 3F4BA 4DMLA 3BMCB 4I9UA 5DOVA 1GD1O 3IS3A 3QA9A 1U9JA 3AY6A 1ZSYA 4IJKA 4KUGA 4RDHA 4CLRA 3OQ6A 4FSHA 4KWIA 3BTOA 3MCVA 4M49A 3EUWA 1LDYA 1PIWA 4YRAA 1OI7A 3ICCA 2PFGA 1ISFA 2Q2WA 1T1RA 1PQPA 4QTZA 1RWBA 5TT0A 1R0LA 5IDQA 3GA0A 3LT1A 1IY8A 1NVMB 1W0CA 1TT5A 2Q1SA 3PYXA 1ISMA 3K8ZA 1QMGA 2C7GA 3DOJA 4LRTB 4WCFB 1B8UA 4DIBA 3JYLA 4CMEA 1VL8A 4BV8A 4C4OA 2PZLA 2C20A 4BO7A 4BUCA 2X0IA 5L4NA 5IZCC 3MEQA 4BNFA 1N1EA 5IF3A 3QW2A 3TWOA 5GZ3A 1ENZA 2D2IA 4FCCA 3RBVA 2DBVO 4I8XA 1QG6A 4BO6A 1D8AA 1NPDA 1AXGA 2I67A 2IDZA 2GZ3A 4IMRA 2R6JA 4XZ3A 4JK3A 4W82A 3LT0A 3WR5A 3GGPA 3OHSX 1X7DA 2I66A 3IJRA 1B2LA 1C0PA 1NQ5A 1SOVA 1Y7TA 4E4YA 3U3XA 2GPTA 4CLOA 3DL2A 2E37A 5IG2A 1V0JA 3RUAA 5JDCA 3JD2A 3ETEA 4BNGA 2PKQP 5JFOA 1PS0A 2W2KA 3DONA 1JKJA 4M54A 5A4DA 4PLZA 4CMGA 4CMEC 3AI3A 5HWSA 4JN6B 3ZWBA 3UW3A 3H6KA 5TSDA 1DOHA 1LSUA 1XEAA 1DFHA 1FDUA 2ZYGA 1LC3A 4XYGA 2NTJA 3H65A 3NT5A 3MJ4A 1QLJA 1U2GA 1D4FA 4TSKA 1KIFA 2P91A 5EJ2A 4NK4A 3H3JA 5KOIA 4BGUA 2Y1OA 1EUDA 3OF2A 2YW9A 3WYCA 1T4BA 3ZHBA 1M6HA 3F3SA 3O4RA 4MIOA 4UVHA 3WSWA 2QRLA 3H8VA 2Y99A 1KOLA 5I9MA 1LQTA 3N7UA 4A5OA 3OIGA 4CL3A 1BDMA 3ASUA 4MPDA 5K0ZA 3PEFA 4M8SA 5LDHA 5U9CA 4FFMA 4AJOA 4EJMA 3EAGA 4PGFA 5JDCC 3OECA 5T67A 3VDRA 3GUCA 5G4KA 5KVVA 3PWZA 2OO5A 2WDZA 1U2DA 2Q4BA 4NFSA 1LRJA 1PL8A 2HRZA 3LLSA 3M2PA 1DLJA 4PFJA 1I0ZA 4DXHA 1EDZA 4B3HA 1N5DA 5FEUA 2HO5A 4DIFA 2RH4A 3PIIA 3ZH2A 4JP3A 3E9MA 2VUSA 1KVRA 1P1JA 1YH3A 1GFSA 2FPIA 3QP9A 1NM5A 4QFCA 4G5HA 1R0KA 3QVTA 1F12A 3CZMA 3I9KA 1VPDA 5JYEA 4UUOA 1R15A 1DIRA 1U1IA 2HKIA 1ORRA 3WIDA 3BMNB 4AJIA 4NFHA 2AEMA 3RAJA 2X5OA 4ZQBA 5L3ZA 3AJRA 2E49A 4GMFA 4XDZA 1IPFA 5DT9A 1I36A 4KZPA 4J16A 4D3SA 3UHAA 4CQLB 4R51A 1JU9A 2IZ0A 2PR2A 3P7MA 4J9UE 5BSHA 3WNVA 3VOSA 3N58A 3L4SO 2Y0DA 4AL4A 4BNZA 1T2FA 4L76A 4H3VA 3WJ7A 4UVGA 1Y1PA 2C0CA 1X7GA 2BGLA 4GSLA 4YAEA 4PG5A 1AUPA 3ZV6A 1GEGA 4I5FA 5I7FA 1TEHA 1A7AA 1AHIA 2O3TA 1HKUA 3MWEB 3P5SA 4N7RA 4RO0A 1UXKA 2FZWA 2GZ2A 4OJNA 4WKGA 5H82A 5ILGA 3GF4A 4B7UA 4E6PA 1MC5A 3A9WA 2UYYA 2NV6A 1Z74A 4MVJE 3VPGA 3QJ5A 5AOVA 1Z75A 1WMAA 4R1SA 4CMIA 2PV7A 2Y1DA 1C1DB 5GZ1A 3WGGA 4CM4B 4FN4A 4KMSA 3D4NA 2B4QA 2OL4A 1WWKA 2VCYA 5B4TA 4YWJA 1C0KA 4J1TA 4LMRA 4QO7A 1NHWA 4PLHA 3RFTA 4BO1A 3UICA 4IJWA 4P4LA 3UF0A 2D1YA 2I99A 5TX7A 1WP4A 4JJIA 1RM5A 2D0IA 4GLLA 1YB5A 2DC1A 5KWEA 4PLGA 4RVGA 3BMNA 3E1KA 3COSA 4XWYA 4DC0A 3GFBA 5TGDA 5F5NA 3RUEA 5ICMA 5HM8A 2G82A 4DUPA 3PIDA 2OGUA 4IIUA 4BQPA 3LF2A 1Y5MA 2O50A 3GAZA 3KTDA 3AFMA 5C7LO 1YBMA 4CR8A 4RQUA 3AUAA 3L6OO 2RBEA 4U0JA 4NHEA 4A10A 2VOJA 4Z0HO 4WECA 2PA3A 1XKQA 2C59A 4U0KA 2X22A 1ZW1A 4QO8A 1SPXA 4FBGA 5CPBA 3P19A 4J1NA 1BXGA 4CUKA 4URFA 3Q3CA 2P2SA 2EEZA 1H9AA 3DHNA 4UEJA 5F1KA 4CLHA 1LJ8A 1ZUD1 2SCUA 3K5PA 5FF9A 2NADA 4I5GA 1LLQA 2DUUA 3MTGA 3Q2KA 1U4OA 2O48X 2J5QA 5IJZA 5L45A 1VKNA 2ZCVA 2PK3A 1ZCJA 1M66A 2GGSA 4I08A 2X9NA 4BKOA 2DPHA 1VSUA 2CF6A 1UAGA 2G5CA 2VRCD 4R5MA 3QSGA 1HYEA 1PWZA 4L8VA 2Q49A 5T57A 3GAFA 3AWDA 1SB9A 1EDOA 1R4NA 3CZRA 1IHXA 1Q2XA 1Q7BA 2HCTA 2YV1A 5EPOA 5LCXA 1GQYA 3KLMX 1T2CA 1SB8A 5B4UA 5KCZA 2OBYA 3HHPA 3RFXA 2YFQA 1GADO 3AY7A 4BB6A 4YBZA 1QV7A 4NG5A 2UVDA 4JX8A 1BXKA 1XDWA 1ZXBA 3C7CB 3KV3O 3LF1A 1I01A 4GX1A 2O7QA 3OETA 4N5LA 4BGIA 4BO0A 1YJQA 4D3FA 3K73O 3OBBA 4WNCA 1NR1A 2NQTA 2AQHA 1ADCA 2ZB3A 3WXBA 1E7MA 4YQZA 1E6EA 2Z1NA 4XX0A 4NPCA 1UZNA 2Q4EA 2EERA 2FWMX 4ND1A 3ON5A 4B8WA 3WB9A 3K31A 5TC4A 4RF5A 1B16A 1X1TA 3WNQA 1BG6A 3B6ZA 1GTMA 1T2AA 4WUVA 1NHGA 5IN5A 4DVJA 1Q0QA 4RZIA 2Q45A 2AEFA 2EKPA 3NX4A 3JQDA 1NASA 3TRIA 1ZK4A 3KYBA 1I10A 4NBVA 3GN1A 3VKVA 4CR7A 5ENDA 1TVEA 3TN7A 4ESOA 4BS9A 1HSOA 4ALNA 4EW6A 2WJPA 3WYEA 1GR0A 3BHMA 3L9XA 4HKTA 4UUPA 3Q9UA 2BGKA 1NQTA 3OSUA 4WLEA 2ZATA 2BKAA 5G0TA 1RJWA 3SBOA 3GZNA 3Q11A 4NU5A 4JBGA 1LSOA 1BGVA 3SLGA 2BFMA 3QHAA 1NP3A 4OYRA 1MB4A 3DZKA 4Z0TA 3WYBA 4ZRNA 3FRJA 1LQUA 2BELA 4XYMA 1D1TA 1JA9A 2H9IA 1JVBA 1ISGA 5K9ZA 2Q1WA 2VHZA 1O94A 4M1QA 4PRKA 5ER6A 4YRDA 2B37A 3U9LA 1I3KA 2GDZA 4XJTA 1Y8RB 3NGXA 4YAKA 1E5LA 1NWHA 3ZWPA 4CV2A 3E9NA 3FNHA 1MXFA 2YY7A 3WGQA 4B8ZA 1NVGA 3M1AA 4E0BA 2WM3A 1NX6A 4MP6A 4MVJP 5TLSA 5C7OO 1U5CA 7ADHA 1IL0A 2EW2A 3T4XA 3S2GA 2NQ8A 1UR5A 4L9RA 3KUXA 3BHIA 2B69A 3GG2A 4YT2A 3ZZNA 3LC7O 5DCUA 4JP2A 5KKAA 1VJTA 2DKNA 4GAEA 4Z9FA 4Q3CA 2G1UA 1ONOA 1B3RA 3D0OA 3HFSA 4IUYA 1XCBA 1ULUA 2CF5A 3W4KA 4E30A 2FPGA 1LEHA 1DDOA 1LXCA 1JAXA 2P9EA 3GGOA 2JD2A 3KYCA 4BIIA 3KSZO 4N54A 4OM8A 2BLLA 2VHVA 4AICA 3M2TA 3DBHA 1DEHA 3FTNA 1PGNA 2AG5A 3I5MA 4W6ZA 3WWYA 1A4IA 1AE1A 1CQIA 1OC4A 1O95A 2Z5LA 4CPDA 4BQRA 4RLSA 1J49A 3IOYA 4RPHA 5A9TA 1R16A 3WQRA 4DLAA 1LRLA 4W7HA 2GERA 4I1IA 4JBHA 3H9QA 2VN8A 2GNAA 1H9BA 3NT4A 2CZCA 4BNYA 2X5KO 4MINA 1DJNA 4MKRA 1RYDA 2AQ8A 4ZQHA 1AGNA 2B4TO 1QKIA 2O7SA 3FI9A 1J0XO 3ICPA 1NQAO 3PTZA 5JCJA 1W8DA 3ZW9A 3GHYA 5KKCA 1VI2A 4G81A 3O26A 4P4GA 1R0SA 4NFYA 1E3EA 1XQ1A 1E3JA 3VPSA 4RQTA 1V35A 3ZWVA 2GRAA 3QWFA 1ZIDA 1YBAA 1DBVO 4MKZA 2AQKA 2PD4A 5KTKA 2DUWA 4WPGA 1VE9A 1RM3A 1T2DA 2W8ZA 4J0EA 4XB2A 3INRA 1NYTA 2JKVA 4ZQFA 1I3MA 3KSDO 1IZ9A 3ZHZA 3VZQA 4D44A 1XYGA 2IZ1A 4NZ9A 2O3UA 2V7PA 3ORFA 4RF3A 1A9ZA 4RVDA 1FDWA 5JS6A 1BVRA 2E4AA 3OJLA 3CMMA 5C37A 4RPJA 3I4FA 2Y0EA 3I1JA 4CV1A 4NJMB 3X2FA 1E77A 1QP8A 5B37A 5I9NA 1KC3A 4FPXA 5T8KA 4B4VA 4YAGA 1I5RA 3TJRA 5DOZA 3DBRA 2O3RA 1HDZA 2NTVA 2ZTLA 4J49A 4ALLA 1ZO8A 3KYDA 3PQDA 4FC7A 4FD3A 3A1NA 4PLYA 1IPEA 2IEBA 1PJQA 2UUPA 2OP1A 4MVJA 3CH6A 3R3JA 5A5FA 2CFCA 3D3EA 3FPCA 3IIEA 1YVEI 3LYLA 4HUJA 5T64A 4G2NA 4AJEA 1JKFA 2FR8A 5KVSA 2AEJA 4Q3DA 3HE3A 1LDNA 3W4IA 1LA2A 2VRBA 1ADGA 4J3FA 2P4QA 4A03A 2Q2VA 1A5ZA 4YT5A 1N9GB 2WYUA 3CEAA 3CIFA 5MDHA 1I2BA 1LUAA 4U8GA 3ZWCA 3TPCA 3A4VA 2YHIB 2B4RO 1GV1A 1Y8QB 2YYYA 2VUTA 2NWQA 1ADBA 1XR3A 6LDHA 2NVBA 5T8KC 1HDRA 4D42A 1A9YA 3RC7A 3WTBA 1YL7A 2FSSA 2R00C 3AM4A 4KUHA 3W8EA 4UVEA 4CV0A 2TMDA 3DZIA 1PZGA 3S2EA 1PWXA 5AXAA 3WGZA 2NVUB 2PZMA 4YQYA 1E6UA 1G6KA 4FJ1A 5TF4A 5G4LA 4J2OA 4B4WA 3EC7A 3PHJA 2Y93A 3NTRA 2ZJ0A 4PIVA 1H6CA 1XHLA 2YUTA 1X13A 1YOVA 4NBWA 5CEFA 3GNSA 2OHXA 4UREA 3W1VA 2VWHA 3F9IA 5IXYA 2A94A 4UEKA 2ET6A 2ZTUA 1CF2O 4IGEA 5LDGA 3ADPA 1P1RA 3LSYA 5TQVA 3HFGA 4D43A 3KLPX 1U28A 4FFPA 1O6ZA 4OSPA 4A26A 2EJVA 4BVAA 2HK8A 2VRCA 5I7VA 3WOHA 3EY4A 1SZJG 4U5QA 2VZ8A 2HSDA 3OIDA 3H5AA 1S6YA 5AVOA 2HJRA 1CERA 2W98A 4JJGA 4ZN6A 5U4QA 3IL2A 1XLTA 3GLQA 3SJUA 4NBUA 2I9PA 5TRTA 4LCJA 3IDSA 4B3IA 1CEQA 3DBLB 4W99A 4E31A 5DBFA 3UVEA 4GGPA 1SC6A 3D3WB 4XIYA 1K89A 4NJOA 1MLDA 1WAMA 3CPSA 1PU2A 1DFGA 4A2CA 4INAA 2B35A 1HL3A 4TRRA 2LDXA 2GUGA 3B1JA 3KZVA 1E1LA 3IJPA 1F17A 1EBUA 5BNFA 2LDBA 3T4EA 5ITVA 1GZ3A 2UDPA 2GO1A 3EZYA 3C3XA 3JQ7A 3KB6A 2VNSA 3AOEC 3RC2A 4RPLA 1ULSA 1T24A 1WDLA 2J3IA 1E1KA 1M6WA 4JJFA 2HRBA 1M67A 3JQEA 3QQPA 3S8MA 3ITDA 1YQGA 1HE5A 4FFRA 1PGOA 1V3UA 1DAOA 3D5QA 4DBVO 1EVZA 3GVHA 1H0KA 1PGJA 2ZQZA 5KIAA 1T4DA 2WD7A 4FC6A 2BMAA 4OQZA 4Y6SA 3A06A 1MG0A 5EINA 1SEVA 4NBRA 5ER9A 2Q50A 3U62A 3EYWA 4NQZA 1HDOA 2I65A 4MDHA 5B1YA 4LN1A 3C1TA 4AJNA 1PR9A 1ZSVA 4BNKA 1MFZA 1E6WA 1P44A 2IE0A 2PH5A 5HBRA 2GLXA 2QQ5A 2HMVA 1NFRA 1W4ZA 3G79A 3EK2A 3G3EA 4O6VA 1JWBB 1N1GA 2CDCA 5ILOA 1NPYA 2NM0A 2VZ0A 4DQUA 2YV2A 5EQFA 4L4SA 5L7YA 3JYNA 1MFPA 3TL2A 3WGTA 3ONFA 2ZQYA 3H3FA 4Q3EA 4TMFA 4E5YA 4UUNA 2P9CA 1H6BA 1DJQA 3QWBA 3VTZA 3A28A 3GMSA 2H5LA 2GN8A 4BNTA 5BSEA 3PHGA 1BW9B 1PL6A 3K9QO 3ZCXA 1JWAB 4B79A 1DIHA 1ENYA 2FPPA 1PZEA 2QHXA 2V6GA 4K9DA 5DCWA 1VJ0A 4YAIA 3HN2A 1YDWA 2OZPA 4XEHA 3BMOA 3ULKA 4D46A 3VAZA 3UKOA 9LDBA 4O0LA 2NACA 5IDYA 1EZ4A 4CMHA 4IDEA 4BO4A 4E12A 3L07A 3OJOA 3C7DB 1UZLA 4DYDA 3W6ZA 4L4XA 4K26A 2DBRA 4TZKA 5I9LA 4YXFA 1J5PA 1GEEA 2IYPA 1IYZA 3GNQA 5B4VA 3JD3A 1P0FA 4IPTA 1RM4A 4Z3KA 2POQX 1LC0A 3BMCA 2HQ1A 2EWMA 1V3TA 3GR6A 1Z7EA 5B12A 1E7YA 1E92A 3RSHA 3M1LA 1YE3A 3PDUA 5CDTA 3VPXA 1KEWA 2A35A 3IQDB 1VKOA 3BXXA 3VTFA 1YQDA 2CSUA 5FWNA 5EIOA 4FOOA 3RFVA 4J2HA 1LNQA 4OKIA 3TOZA 4CM3A 1U4SA 6ADHA 2BF7A 4R01A 2YZ7A 4MIEA 4CQMB 1HDCA 3GHHA 2DT5A 5BT9A 4KQXA 4DC1A 1PX0A 3QVXA 4L0QA 5L53A 2FN7A 1KVQA 4FB5A 1H94A 1R4MB 1GQ2A 2W4QA 3EGOA 3OJFA 4H16A 4BNLA 5KJFA 4IQGA 1HXHA 3GQVA 4WLVA 5L4LA 1I2ZA 4QECA 1QYDA 4WCFA 3D7LA 3PQFA 3ROMA 4NI5A 3KSUA 4U6QA 3RU9A 5IDXA 1LX6A 5ENVA 3UCFA 3FR7A 3FHLA 1PJ4A 1YS4A 1YDEA 5A04A 4RL6A 3GK3A 3U09A 4LRSB 3JQAB 3F47A 3SX2A 4XYLA 2DBQA 1WPQA 4N5MA 2J3HA 3E8XA 1OFGA 5THQA 3RC1A 4R1TA 3F6YA 4XA8A 5BR7A 3O9ZA 3V1TC 2WSBA 3L4BA 1VRWA 2BRUA 1Z82A 2B5WA 2GF2A 1U7HA 1QV6A 3PJEA 1SO8A 3RUDA 4DLBA 5COQA 2AQIA 1ZBQA 4J9VA 2WMDA 4FDAA 3DZFA 3G0OA 1NAHA 1LTHR 3GNTA 1EEHA 1GPDG 3WX0A 3OQBA 4FR5A 4OH1A 3B70A 5DP1A 2VWQA 2ZB4A 5JCJD 5EERA 2HMTA 4IDCA 2VWGA 4CJXA 5JW6A 3GRPA 2O4UX 3VVCA 2XXJA 1XU9A 5DNAA 3C24A 3ZGYA 4GH5A 4WCFC 2CD9A 1HETA 3E82A 3HDYA 1Y81A 4GGOA 3A14A 2HMUA 4I5DA 4J6FA 3WSVA 1Q0LA 2X86A 3MJTA 1E3WB 1CQJA 2NNLD 4RPKA 4EUHA 1I33A 5CHEA 4B7XA 4Z3DA 2I76A 4YJGB 2WEKA 3H4VA 2A4KA 1C14A 4FFNA 2BH9A 2X5JO 3WQQA 2FRDA 1FJHA 3PFFA 5C7IO 2OXIA 3CKYA 3PRJA 3KETA 1QYXA 3L77A 4B7CA 3I23A 1R12A 2Y1CA 3B1KA 1MP0A 1L1FA 3CMCO 1QRRA 5H81A 1GYRA 2QIOA 4KUEA 3VHRA 3W6UA 3ZWWA 3TFOA 1F0YA 3IKVA 3ZU3A 4OOEA 3DBVO 4IY1A 3WBBA 1O0SA 3DR3A 2NU7A 4GI2A 3WMWA 5CAEA 1NFQA 3GZ4A 1V6AA 3DZBA 2IZZA 5L51A 2G0TA 2Z95A 2FY8A 1JTVA 3E5RA 2O2YA 5ADHA 4MVJD 3ZU2A 1M2WA 4J4TA 4PG4A 3DC2A 3PGXA 3OQ1A 2V6FA 3AFNA 4RF2A 1P1FA 1BTOA 1HE3A 3RBZA 1WLYA 1U7TA 4C7JA 2P4HX 1UP6A 1QSGA 5KJEA 5COBA 3C1AA 4ILKA 1LLDA 4IXTA 2D4AA 1E0DA 3FWNA 3DB2A 3P2YA 3OP4A 1NXQA 4RLHA 5CDGA 3QWAA 4LSWA 4BKRA 4CQLA 1EVJA 3GDGA 3GMDA 4LVUA 3W4JA 3ONEA 1E1NA 2VHYA 1ZSNA 2ILTA 1XIVA 2O2SA 2CVOA 3NDJA 2W2LA 1MG5A 1T26A 3PJGA 3PHLA 4BKQA 3ZV4A 2P9GA 4TRJA 2JD1A 4WEQA 3EZLA 3TZCA 1Q7CA 2JAPA 4LCEA 4AVYA 1EQUA 3L9WA 1KY5A 2QG4A 5BNTA 1H6AA 2GCGA 2GYYA 1FDVA 1O5IA 4FGWA 5AXCA 4R68A 4TQGA 4ZQGA 4EDFA 3WWZA 5FYDA 3GVCA 2RH8A 2X23A 1I30A 1E7QA 2E6UX 1IULA 2XPCA 4H15A 1PR3A 1IZ0A 4R4JA 4YJHB 3V1YA 2CMDA 3U4CA 1C1DA 3IUSA 5COAA 5EESA 4GQAA 4CM4A 1UXJA 1NQOA 3NT2A 2GR9A 2BFPA 4ITUA 1PTJA 2B36A 1PJLA 1Z73A 3LT4A 2NTNA 2X9GA 1NBOA 4FJ2A 4XRRA 3JD0A 1ZXLA 3AI2A 3LDHA 3TSCA 3WGOA 1V8BA 2O3QA 3JTMA 2BI7A 2JHGA 1HF3A 4R16A 4IINA 2O4CA 2WYWA 3VVBA 5K6AA 3E03A 4WK6A 5KJ1A 2VT3A 2E82A 1MUUA 3RC9A 4YRBA 3PLRA 1DB3A 1JDJA 3T7EA 1K2WA 2WYVA 3BHJA 3OJEA 4DPMA 5JO0A 2HU2A 2IEDA 2EV9A 3H9EO 4EJ0A 3D64A 1HTBA 1ZK1A 3FNFA 3RKRA 1U3UA 3ZU5A 5KNLA 1OBFO 1ML3A 3FBGA 1D7OA 1ZK2A 3ENNA 1ONNA 3ETDA 5JPIA 4RVSA 4XCVA 2CUKA 3DHYA 4LMPA 4O1MA 4CM1A 3V2HA 4ZHSA 1M76A 3SC6A 4DA9A 2VYNA 5CP8A 3VC7A 3DDNA 4HFRA 3ITKA 1EMDA 1GZ6A 2GSDA 3RUCA 5G0VA 1X0XA 3F5QA 4MP3A 1JKIA 1L7EA 1SMKA 1UXGA 4RPGA 4EBFA 3RUIA 1NTOA 3OIFA 2AE1A 4J4BA 2VUUA 1E7RA 4ND2A 2DTDA 4OIMA 3SVTA 5C3MA 1Z6ZA 2OP0A 1U8XX 3U0BA 1SBYA 4K6CA 4CM5A 3ADOA 3DQPA 1PS8A 1I24A 4L74A 4QT0A 1ZNQO 4YJFB 3LQFA 1ISHA 4AJKA 5BNIA 3VH1A 1DIAA 4CLEA 1P77A 3AM5A 3BTUA 3E9QA 4D41A 4YYZA 5J23A 2EGGA 2C82A 1CIVA 4WOJA 4EJ6A 2YJZA 1U3TA 8ADHA 1HRDA 2YQ4A 3RVDA 1ZVMA 4WEOA 3RUFA 2P68A 1MV8A 1NWCA 3ROKA 1D1SA 4DL9A 1HYHA 1CYDA 4UVIA 3WLFA 3DTTA 1LSSA 3ENKA 3NEPX 2O3JA 3PHHA 5CPFA 4WGGA 5T6BA 3ROQA 1FK8A 4NBTA 4D3DA 4BB5A 4OXKA 2FR1A 4IGFA 4IS3A 1NPTO 3C8MA 3IKTA 2UUOA 4ZICA 4Z6KA 4BNIA 3JQFA 4E3ZA 3TZ6A 1W73A 3OFSA 3TQHA 3ZNPA 4FW8A 3ASVA 5I8WA 4MO2A 3HUDA 2RIRA 3H9UA 1N7HA 2Q2QA 4XGIA 5KJ6A 4ZA2A 4BO5A 3M6IA 1VL0A 4HWKA 3NTOA 4R9RA 3HWRA 4GL4A 4TKMA 2PGLA 4E2WA 3HQ4O 4PLCA 4TRNA 5AQ1A 5IZ4A 1X7HA 4PRLA 4DMMA 4P4NA 1GQQA 2PZJA 3DZHA 4LSMA 4XQEA 3FTPA 4NDNE 2C29D 3C85A 3LC2O 1DPGA 2QZZA 4E5MA 2WTBA 3HSKA 3VZSA 3OJ0A 1IOLA 5DDIP 4DREA 3QVSA 4DBZA 4A0SA 1YWGO 3GDFA 2HK9A 4PLFA 5FI3A 4FOSA 1CWUA 1F8GA 3QVOA 4H7PA 3HZZA 2PKRA 3KEOA 3K2EA 2ZIZA 3V2UA 4MVJG 1PQWA 2EKLA 5HTOA 4ZRMA 4YA6A 2H6EA 3PHIA 4E2YA 1Y8RA 3ZDFA 4ONEA 3JQ8B 4YT8A 2IXBA 3RIHA 5A9SB 1VJ1A 4IQ0A 2DAPA 2X0NA 2FP4A 3GVPA 4E13A 2EP7A 4HV4A 5G2OA 1UDCA 4EYEA 3UN1A 2CVQA 5A02A 5MGBA 4CLDA 4DWVA 1YJ8A 1FMCA 2VQ3A 2JFFA 3ZHXA 1T2EA 4HY3A 4JXKA 1KEVA 1BXZA 1OAAA 3NJ8A 4E33A 5F1OA 3K96A 3EMKA 3EHEA 4BNUA 3UH1A 4C7KA 1LRKA 3DTYA 3IUPA 5DULA 5HS4A 1F06A 1UUFA 3PPIA 3O03A 3ZNNA 4F45A 3BMQB 1ZH8A 3WGHA 4WASA 4S1VA 1C1XB 4TVOA 3INTA 4Y8VA 2HAEA 3PJDA 2AG8A 3O8QB 3PI7A 5IFLA 1I32A 4MOWA 4DLLA 3FPLA 1HEUA 1U3WA 3K2BA 3RASA 2EJWA 4FGSA 1H2BA 5L7TA 2BHLA 3EW7A 2PTGA 1DFIA 2D8AA 1AHHA 2V6MA 2GN4A 4NK5A 4BNJA 5JY6A 3PP8A 3Q9NA 2VHWA 3HN7A 3JD1A 1LSJA 1OOEA 3JYOA 4JQCA 1HE4A 1I3LA 4RF4A 1H6DA 2VTEA 1R37A 1X15A 2DU8A 1KVUA 1MGOA 5JAIA 4XR9A 2DQ4A 5JY1A 4IZHA 4NH4A 2C54A 4G65A 3X2EA 4CM8B 1H2HA 4CM9A 3GEDA 1P3DA 4JGBA 4J4HA 4M89A 5A05A 3DHEA 2I3AA 2NSDA 2I3GA 3GC6A 3SC4A 3PDJA 4BNHA 3NGLA 4CMJA 3IP3A 2ZKLA 4AJ4A 1ARZA 1OC2A 2Q3EA 3TOXA 1X1EA 3PZBA 4IXWA 4WLOA 1DC6A 3WLEA 1X14A 3L6DA 1H93A 3NKLA 3AUTA 3W8FA 4NMHA 4E5PA 1E7WA 2HMSA 4TKLA 1AXEA 1ZK0A 3N74A 4PG6A 4IDDA 4RVHA 2Q1TA 1YGYA 2HMWA 3ZV3A 4WLUA 1F14A 1EUCA 3BAZA 1E1MA 4FQ8A 4IZIA 1BHSA 2ZTVA 4NJMA 1HDXA 5F5LA 1E3LA 4E5KA 1EUZA 5JCXA 5CDUA 3RJ5A 2EP5A 3BYZA 5DBIA 3ZNOA 1RPNA 1KC1A 2DM6A 3GY0A 3FNGA 1I8TA 4HX5A 1PJCA 1GDHA 1VM6A 2YDYA 4A73A 4XIJA 1KERA 1KETA 1KVSA 1CJCA 1PS9A 2VWPA 5A03A 4I5EA 4AFNA 2W2LD 1P74A 5KVQA 2RAFA 5CDYA 5G0WA 3IMFA 3MTJA 4HADA 1SNYA 4HNHA 4I9HA 4YDRA 5TJ9A 1RKXA 1LU9A 1J4AA 3ZWXA 5BQFA 4ZVVA 1N9GA 2CVZA 1ZEJA 1QYWA 1R6DA 4TVBA 4XR4A 3WDSA 3WJAA 3C1OA 2EF1A 2YHIA 3VZRA 1Y8QA 2X9VA 2DFVA 4N18A 4CLRB 2GD1O 2GN9A 2VYVA 1A27A 5I7EA 3O38A 1YB1A 4L75A 2VNAA 2J3KA 2YFHA 2F1KA 3GDOA 3H5NA 4M87A 4D0RA 2NVUA 2WE7A 4BNWA 2X58A 2NU8A 1TT5B 2DVMA 2E48A 2NU9A 3PGJA 4RCVA 4BNMA 3VPHA 1E5QA 4TROA 3MJSA 1NR7A 4I9NA 4M55A 4IM7A 4EZBA 4OHUA 2FZEA 3CINA 1UXHA 1ZJZA 2OOSA 1LLUA 4F6CA 1LDEA 1GL3A 2O23A 2X1HA 4CM7A 1XQ6A 3ZW8A 2R2GA 1UDAA 3HB4X 1U8FO 4XYEA 4DQVA 4O63O 4UEOA 4BL5A 4YEDA 4ZU3A 4YTEA 5GY7A 4RV9A 3AM3A 1FDTA 4CLOB 2QW8A 3QRWA 2Y67A 5HS6A 1DIGA 2VYND 4ND3A 5I8ZA 1QXSA 5ICSA 5IAAA 4GSKA 5IZCA 2W2KB 3K92A 3H9JA 3DBLA 1HLPA 3I52A 1SAYA 1X0VA 3LZ6A 4KQWA 1C0LA 3D3WA 3NUGA 2QX7A 4B4OA 1ZEMA 3U5TA 3ABIA 4O59O 1VL6A 3VKUA 2JD0A 5JYDA 4JNKA 1WDKA 3QVWA 1W6UA 4IDAA 4J0FA 5FI5A 4F3YA 3AW9A 1GU7A 4WCDA 1CETA 3IC5A 1DRWA 4CUJA 1LBEA 1FDSA 1PZFA 1SCUA 2X6TA 5I7SA 4R1NA 5L7WA 1NNUA 4CR6A 4UVDA 3JV7A 3WICA 2J6IA 1DC3A 4HFNA 3JD4A 3NRCA 4IMPA 4CMAA 5EMHA 3MJVA 4GWKA 1UXIA 4YPOA 3E48A 5G4KB 2EHDA 1B8VA 5DCYA 1DXYA 2A92A 5AXBA 3VH2A 3S55A 3VPFA 1VLLA 4R69A 1MA0A 3SXPA 3MZ0A 5EN4A 1T25A 4PLWA 5EQDA 3TL3A 3DAFA 2D59A 4ALKA 1GUFA 4RGBA 2J3JA 2AW5A 2QYSA 1Z7BA 3NDIA 1QR6A 3RKUA 5JMWA 3V1UA 3QWIA 3F4LA 4UUMA 4BGEA 4BOYA 1XELA 2JCYA 3EVNA 3KOUA 1WZIA 4J7UA 2X0JA 2FOIA 4Y9DA 1P45A 2PKQO 3ZWAA 3WS7A 5F1PA 1Y9EA 3TZKA 2RHCA 3I9LA 4DTIA 4PVDA 3WG9A 1P1IA 4XQCA 4PZEA 1K0UA 4PZDA 2RCYA 3HDJA 3FBTA 1WDMA 5KVCA 5BSFA 3AY3A 3MOGA 4HXYA 1EK6A 3JQGB 2JCXA 3F5SA 3DAGA 4CV3A 1BW9A 1JN0A 4RDIA 3MWDB 4GLOA 4KOAA 4IDFA 4R3NA 2WWRA 4B3JA 1DIBA 4AJLA 1BVUA 1Y9AA 1BDBA 2QZ9A 1YKFA 4K6FA 4ALIA 2AMFA 3B20A 1PEDA 5KJCA 5JXWA 2XXBA 4YJDA 4ZQEA 4F46A 4BMNA 3F1KA 1GCUA 3UAGA 3Q0EA 3UOGA 3U4DA 1HWYA 3FCOA 1HT0A 3DZJA 2P5UA 3NDRA 3PWSA 2X7HA 3LLVA 4WOKA 4M86A 4FIZA 1U3VA 2YDXA 2Q99A 4Z0PA 2B83A 4CMIB 4AJHA 4IIVA 3SLKA 1O89A 3JQCA 3I4CA 1ENOA 5IN4A 1DRVA 1ZZEA 4OXNA 1CDOA 1FXSA 4GVXA 4IS2A 3ONDA 1R66A 1JAYA 3I6QA 2EW8A 2X0RA 3QIVA 4DPKA 1V3VA 1PSDA 2EG9A 4AJ2A 4FFLA 1EQ2A 1O8CA 3GN2A 3AOGA 3L4BC 4CQMA 4PLVA 4BO2A 1ZK3A 1ENPA 1P1KA 1R4MA 1ZJYA 4ID9A 2EXXA 4P38A 3UFXA 2DPGA 2OUIA 3UCXA 2PZKA 1GYQA 5CFZA 4XYBA 3R3SA 1U5AA 3PVZA 1A72A 1XWFA 5JO9A 2QYTA 3JQGA 3WGIA 1MXHA 2EKQA 4R9SA 2CNBA 4WE3A 5CEJA 4RJTA 4OXYA 4YACA 4GKVA 3JQAA 4IJVA 1ZMOA 5C5IA 2NVWA 1KBZA 3D1LA 4E5NA 3AI1A 5A9RA 1TI7A 1B26A 1Q0HA 2O3SA 3R6DA 4ZD6A 3LU1A 3OEYA 4Z9XA 4PG8A 2OMEA 5L4SA 1BXGB 1XU7A 5ITWA 2NUAA 3MJCA 4PLTA 1JLLA 4DGSA 5CG2A 4CM6A 4GX0A 3D4PA 1H5QA 4BMSA 4ZGWA 2EGHA 3JSAA 3G17A 2VT2A 4IJUA 4PZCA 2D3TA 1PGPA 4L73A 4AJ1A 3L6EA 4N5NA 1UZMA 1BSVA 4HBGA 2HLPA 4CMBA 3FWZA 2YV3A 1F8FA 3DFZA 1E7SA 1LDMA 4GMGA 4JROA 1AN9A 1GUZA 3ZWMA 4CM9D 4DPLA 4ALMA 3WIEA 4PLPA 5ES3A 1HE2A 1BRMA 1N8KA 1K3TA 1Q7GA 3ZU4A 1ID1A 4OMUA 1R4NB 1E3WA 1NFFA 4WLNA 1GV0A 3EDMA 1S7CA 4OAQA 4YVFA 2YHUA 1YXMA 5A06A 1PQUA 4CL8A 2NU6A 1GCOA 2BGMA 4TWRA 2BD0A 4U6SA 1IHYA 2P5YA 2IODA 4J91A 4YJGA 2Q1UA 1HDGO 2D5AA 2NLOA 3NJ4A 4DYVA 2H63A 2PD6A 1RM0A 3DEYX 1SEPA 4J90A 4TZTA 4K28A 2ZJ1A 3I9MA 3ZI0A 2GN6A 4XQGA 3ETGA 3RJ9A 3LC1O 4RVFA 3F46A 3S2IA 4GWGA 3UXYA 4PCVA 1O9BA 5JE8A 1DHTA 4BNVA 1B3BA 1YL5A 4CUZA 5TT1A 1P33A 1JQBA 4XGNA 1EFLA 1MC4A 1WMBA 2DBZA 2JFGA 2UV8A 5HA5A 2VZ9A 3U4IA 5CDSA 4JBIA 3VDQA 5EL0A 3TZHA 4DRYA 3I83A 2J5KA 4IDBA 1KEPA 1V9LA 1VC2A 4NU6A 3TZQA 3JCZA 5CG1A 5T5QA 2C5EA 5CEEA 4D7AA 3CSDA 1XA0A 1DHRA 1FF9A 1G1AA 4EI2A 4E32A 5IDWA 3AUSA 4KDEA 4B4UA 1A7KA 4J7CA 2A9FA 3JQ6A 4KTTE 2ZYAA 4QUKA 1ADFA 3GZNB 3ST7A 4JLWA 3I3OA 4MIYA 5JAZA 3Q6IA 5JAQA 1TXGA 3GVXA 2TMGA 3GPDG 4MVJF 3HDQA 4OSOA 2C7VA 8LDHA 3OA2A 1YBVA 3NAQA 4XJSA 2OORA 1EVYA 3DO5A 1UH5A 3FN4A 5A3VA 4LVCA 4BKUA 4E21A 1UJMA 2BFAA 1NVTA 1HDYA 1IE3A 4WNIA 4BNXA 2VYVD 4RORA 4GKBA 3D4OA 3ZNQA 4Q39A 3AUUA 4KTVE 2ZB7A 4Q9NA 2AXQA 4U7WA 3HG7A 3ZV5A 2AHRA 4NIMA 3BIOA 5G0SA 3TFQA 1SOWA 3R0IA 3IP1A 1EVIA 2ZK7A 3KRTA 3B1FA 4EEXA 3Q2IA 3UUWA 4GPD1 1QYCA 5L9AA 1ISJA 3AK4A 5K6AC 1GY8A 3HDHA 5G0UA 1DC4A 3G49A 4CMKA 4EUEA 4MVJM 3RQSA 3ZWNA 4Z9YA 2H1SA 4MVJI 4W7IA 4EUFA 2FMUA 3GUYA 4YJHA 2D5CA 4R5HA 3FSRA 4QSMA 3BTVA 3I9JA 4BO8A 4OKNA 3KYCB 1PJBA 3DFUA 1PL7A 3EVTA 3DBHB 2WD8A 3PYLA 2AE2A 3BA1A 1WZEA 4Y6PA 3RROA 3QY9A 3OM9A 4GBJA 1KEUA 4YCAA 3UGKA 1B14A 3OA0A 3NV9A 1NAIA 2C2XA 3CE6A 3FF4A 4PN3A 1E3IA 4PG7A 3K6JA 4KDFA 4IBOA 3WFIA 1HYGA 4UAGA 2WE8A 2Y68A 1E3SA 4KP7A 1BWSA 2Y66A 2HUNA 2PWZA 1HZJA 3WBFA 5TS3A 4J7XA 4QEDA 1DSSG 1LLCA 3HADA 4YR9A 3GVIA 3GPIA 3H9GA 5A3JA 2YQ5A 2PH3A 2IRWA 4GX5A 2VTDA 4HP8A 5AYVA 1CRWG 3DXFA 3GH3A 3HB5X 3AU8A 5LC1A 3V2GA 1L7DA 2ZB8A 2BFOA 3RU7A 1KVTA 2JJYA 3HJAA 2V6BA 4CMCA 4X54A 1YRLA 1ZKMA 4BO3A 4D79A 2I6TA 5TNXA 3W8DA 1N92A 1EK5A 1PJSA 3QE3A 4IQ8A 3WFJA 4FS3A 5JLAA 4QX6A 1G0OA 4KWHA 1GAEO 2BI8A 3QV1A 4XD2A 3BZUA 4GVLA 4XKJA 2PGDA 4TRMA 4ZJUA 4OQYA 2Y05A 3GOHA 3FD8A 5L40A 1D3AA 2VOEA 1KYQA 2J5RA 2ZCUA 3RUHA 4YJFA 5F21A 1P0CA 3KVOA 1KY4A 3KM0A 3JQFC 4A27A 3DWFA 3E18A 3KBOA 4MVJH 3DZGA 4D45A 4R3WA 3WQSB 5IXSA 5TJHA 2QRJA 3PXXA 4ALJA 2XAAA 7MDHA 3DOCA 4WJZA 4MP8A 3NTQA 5H83A 1C0IA 3SJ7A 2OBNA 1WXDA 1B7GO 4CODB 3DBRB 3KO8A 3QLJA 3PJFA 4W4TA 1Y5RA 4R54A 3KYDB 1UP4A 2X4GA 4ND4A 4YT4A 3V8BA 4EITA 3U4HA 9LDTA 2DTXA 3ANMA 4S3MA 1TLTA 1QLHA 2HJSA 4QFDA 1LI4A 3H2SA 3QWHA 2C2YA 5DBGA 1PJTA 3JYQA 3ROPA 1P9LA 4FFOA 1RYEA 1OZAA 4HFJA 1I2CA 2JHFA 3UCEA 1K6JA 3GT0A 5TIIA 1PGQA 4PVCA 3MOIA 2CDBA 5JMPA 4A7PA 4Q3AA 1P1HA 4QQRA 5JC8A 2FSVA 4YAJA 4JIGA 3CTMA 3H2ZA 2G76A 1DLIA 3WMXA 1GPJA 5JNLA 3E5MA 3FNEA 2C07A 2QRKA 5GZ6A 2DLDA 1GUYA 4Q3NA 1B15A 4II3A 3I9NA 3GFGA 4AJPA 1N7GA 3OICA 1K6IA 1ONPA 3OH8A 4AJJA 4F6LA 5HRUA 5DN9A 3U49A 2PD3A 1PJ2A 1MX3A 2X8LA 2HDHA 1YOVB 4P22A 4R1UA 1K6XA 2CY0A 4LW8A 5JDIA 3VH4A 2I5PO 2IYOA 3K30A 3RI3A 4NNJA 3DAPA 3INGA 3BTSA 4CQMD 1DRUA 2V65A 1N2SA 1ZFNA 4XRGA 2CDAA 1IB6A 4ND5A 4RVUA 3VH3A 2DTEA 2JCVA 1J6UA 2R00A 3E6AA 3JQ9A 2Y1EA 3GRKA 3JQBA 3DMYA 3JQ8A 1TT7A 4OGWA 3V5NA 4DQXA 5A9SA 4LGVA 3PYMA 4BV9A 4HFMA 3WTCA 1Y6JA 2ZYDA 4BMVA 4Y67A 5DF1A 1OMOA 1K5HA 1A4UA 2Y0CA 1YL6A 3ANLA 2AA3A 3PFWO 3ZHYA 1TA4A 4BNNA 3TF5A 2W90A 5A5EA 2J8ZA 3JQAD 3C7AA 4RZHA 5DZSA 3HNPA 5FFFA 4CLXA 4BO9A 4BKPA 2JFHA 2PY6A 4K1LA 2F00A 2GZ1A 4J1QA 1VSVA 1QYVA 1WVGA 1WNTA 2PNFA 1EE2A 2PGJA 3Q1LA 1HZZA 1Z45A 4Y6RA 1YB4A 5BSGA 5JDIC 1DO8A 4EGFA 1LDGA 3S1LA 1YONA 4E2XA 2C5AA 3GEGA 3I6IA 3I9OA 4Y98A 3VZPA 3BMQA 3H7AA 4O5OA 1Q1NA 1C1XA 5THKA 3G1UA 1XGKA 4W9NA 1ZMTA 5F3RA 1EFKA 2FR0A 3O8QA 4J1SA 4JCOA 3JQ9C 4OL9A 4OOFA 5GMOA 2Q46A 3JQBC 2B5VA 3CUKA 2B0JA 1IUKA 4II2A 2JAHA 4E2ZA 5A1TA 5JBIA 2EIHA 1UDBA 1DAPA 3ANNA 3FR8A 1PZHA 3R1IA 2Y1FA 2PLAA 4UULA 4BGVA 5JAMA 3GG9A 1C3VA 1I3NA 3JQ7B 4DIOA 3GEMA 5JC1A 1ISIA 1YQXA 4LISA 5U1PA 3D5TA 1A71A 3LVFO 1EE9A 1P31A 4XQ9A 3TDKA 1GZ4A 2WD7B 3RD5A 2VHXA 3P2OA 1WW8A 1XSEA 3ZN2A 4L4RA 3JYPA 1M75A 3WGYA 3PZRA 3ZWYA 4BHTA 1DC5A 3KEQA 1HLDA 4HNGA 2JL1A 1UAYA 4CM8A 4QXMA 3RBXA 2GASA 3S2FA 3IAHA 1UP7A 4WLFA 2FHSA 2OFPA 1KS9A 4W9NC 4EEZA 3SEFA 3AOEA 1PJ3A 4YB8A 3RCBA 4J43A 1G0NA 4P8RA 1JVSA 3GGGA 1QORA 2G17A 2HK7A 2XF8A 1B8PA 3DMTA 4IDGA 2UAGA 2Y1GA 1EBFA 2RHRA 4NR0A 3STHA 5JSFA 1BMDA 3H5RA 3T7CA 1LDBA 2ZTMA 3PK0A 3PLNA 1B0AA 2DFDA 3TNLA 1GYPA 3G1TA 3KXDA 1XG5A 4GX2A 4XGKA 3CXRA 1TB4A 3RWBA 3PQEA 4LK3A 3BMOB 1HSZA 4Q3BA 3DOOA 3NYWA 3AU9A
chains in the Genus database with same CATH superfamily
1Y9DA 5CCXA 3TGLA 1T1SA 3PKJA 4TLBA 3ZGOA 1ZD2P 4I36A 2CE2X 3PWKA 2RE8A 4JUFA 3UMFA 4KFUA 3S99A 3MJEA 1M2HA 3EIWA 5FTKA 3V8VA 4DA9A 3CO0S 3I39X 3AYXB 1GKKA 4DZTA 1A77A 1D6JA 1JW9B 2CK3A 2WKWA 4W5WA 4UPEA 1IOVA 3F4BA 4G5QA 3KELA 5L3SB 2ZE7A 5AI4A 1OFTA 1K7XB 1X9GA 3NP9A 2IYQA 3IPXA 4UFNA 2X2EA 3N0VA 4PZ9A 4BLPA 4TKVA 3D02A 3NATA 2E1PA 5LBIA 1ZSYA 3OEEA 4BZQA 2QN9A 1G3MA 4AJLA 4IJKA 4QFBA 1Q21A 1U65A 1PFUA 4KUGA 4CKWA 2DERA 1W9HA 4KWIA 1VHJA 4DCUA 4O4JA 3EQZA 3KU1A 1RWPA 3NOQA 3EUWA 3W90A 5CTJA 5L3RA 2PFGA 4XM2A 4UW9A 3BD9A 3VFDA 3O8RA 2ATCA 4EYOA 3I73A 1T1RA 1LY1A 4DEXA 1EE1A 3O8BA 4O08A 3IGFA 3JAWB 4DSOA 4DUGD 5BRAA 1KEEA 4I1YA 1DGQA 4Y2JA 5J2TA 1IY8A 2PH1A 3HKBA 4KN8A 1F2UA 1LX7A 3Q7PA 4YPVA 3EXEA 4HNUA 3IVCA 4LRTB 2IEAA 2ZI4A 3T3IA 1A4RA 4G8BA 4CMEA 1Z2OX 3Q15C 2M6KA 2YXLA 2G9NA 3WV4A 3GL9A 4IUBS 4BUCA 4AROA 5IZCC 3MEQA 2AFIB 1JDVA 2AK3A 1DELA 1H0SA 1V5FA 2D06A 2ONKA 1IXSB 3NCTA 4HOYA 4OQPA 4ZDWA 1L4LA 1X7ZB 2GESA 3QXGA 2P75A 2D2IA 4FCCA 4U7HA 5FUYA 1WSAA 4CFZA 4I8XA 2HSZA 4DT1A 1D8AA 5MHTA 4V0KA 2WV9A 2A3NA 5CVUA 5AW3A 1H0HA 4I1SA 3W5VA 2GZ3A 4IMRA 2R6JA 4JK3A 5DJ5A 2E4XA 3WR5A 1W0KD 1FVHA 5KWSA 5KYNA 2R9VA 2BKVA 1X7DA 3BIJA 2O6LA 3OHSX 3GGJA 3H6GA 4HLDA 1I14A 4A91A 3E9CA 2I87A 1Y7TA 4E4YA 3U3XA 3ND5A 2QF7A 5GPBA 1U81A 1V0JA 3WZ2A 4BNGA 5JDCA 2QTGA 3A1VA 1A7UA 4B6EA 1RLUA 4PCLA 1TJNA 1PS0A 1JKJA 4PN7A 5A4DA 4KXVA 4PLZA 2FSPA 3O4HA 1N2CB 3UA3A 5C4GB 3VPBA 1QPBA 4KL8S 1Z4QA 3IELA 4UARA 1UJ5A 1YE8A 4UHEA 1CQJB 3A6PC 1UMDA 2QTZA 2WMOB 1N6PA 1N2GA 4YP1A 4RANA 1UPFA 4JJ6A 1LC3A 3DKKA 4G4SP 2AOUA 4LYGA 3MJ4A 1QLJA 1XMOB 1GGHA 2YWGA 3H3JA 5DX8A 2DWCA 4BGUA 1DKUA 2Y1OA 3AB7A 4DADA 5JCOC 3TG2A 2IH2A 3D2BA 3M81A 3TNJA 4DLKA 1JR2A 3ZS8A 1M6HA 3F3SA 2VJMA 1J56A 1L1RA 2AWNA 4MIOA 1F6DA 2QL9A 4ZVTA 4YP6A 3WO1A 3C74A 3WSWA 1G291 2OGWA 4DB4A 1BGXT 4MDYA 1LQTA 3N7UA 1UOEA 2FJ0A 1VG9B 1BDMA 3ASUA 1KZ1A 1KOFA 4JQZA 4MPDA 5SY9A 3PEFA 4EG4A 1R4AA 4X71A 3EAGA 2J7PD 5CAEB 3O0DA 3GLGA 2ZI9A 4TTJA 5CU7A 5EKSA 3NKVA 1SOMA 4HN2A 2O2DA 5H5JA 1HR0B 1WTAA 2AFIA 1F0PA 3PWZA 1Z0FA 5H70A 3NHWA 3O2QB 4ZARA 3QVGB 2WDZA 1OI3A 2XKAA 2Q4BA 4WH0A 4RACA 1LRJA 4M98A 3Q85A 1DLJA 5BOSA 4OU5A 2EOAA 3K9LA 4JDUA 2AN3A 4PFJA 3RAEC 4ZYXA 1N5DA 1GXSB 1UPUA 3VYRB 4K0RA 4LC1A 3U4QB 3PIIA 2H51A 3HU3A 3MQ4A 3E9MA 5ENZA 1E0JA 2VUSA 3AEUB 3KUCA 1GFSA 2ZRJA 1JLKA 3D6JA 2AV6A 1L5OA 3S4YA 4J75A 2ID9A 4HLCA 1SBZA 1F12A 4NQRA 2JGEA 1VPDA 4UKDA 5JYEA 4ARCA 5LBTA 1DIRA 3B82A 4ZEVA 1TIKA 5G41A 3ABQB 3JAKB 3BMNB 3WIDA 4X41A 5EZ5A 2NV2B 4G0QA 4G0VA 5KQSA 1Q12A 2C8LA 1UQRA 2IYEA 1QZXA 3PNOA 3I9V1 4FCWA 4GI5A 4GMFA 4S12A 5H4HA 3HFJA 4J16A 1XVTA 3K32A 1YFJA 2HCBA 1SBCA 4R51A 4HWSA 4QDTA 2OECA 1TGYA 1JU9A 4B82A 4NFLA 5IJAA 3IMEA 4TGLA 1JDUA 3KU4A 3UGJA 1PZMA 4BNZA 1IJBA 3ZPXA 4ZDIA 1Y1RA 2FLVA 3S40A 3EOAI 4DANA 1YZTA 4H3VA 2QLJA 4KMOA 3W6PA 2C0CA 4P7GA 1MPXA 1X7GA 2B8JA 4GSLA 3D7KA 4FFDA 4I3HA 2B2NA 4PC6A 5JH7B 1OTYA 1QO0A 4I5FA 5JD5A 2Q5HA 3DW1X 2O3TA 3I53A 2HHJA 4P5DA 2I6SA 4QULA 4WKGA 1UXKA 2UVPA 3G0GA 3QMPA 5H82A 5ILGA 2ZU0C 4Z4GA 1TQ8A 3A9WA 2I78A 3QHPA 4O4IB 4IOKA 3QUSA 4P81A 2NV6A 2FK8A 1Y3FE 2YOHA 4ZAYA 3QE0A 3QJ5A 3ZXUB 2C2MA 1WMAA 2ZBFA 5EFOA 4K9RA 4B83A 5GZ1A 1C1DB 3WGGA 1UBTS 4MRRA 2FWJA 1KJIA 1CUUA 3OTWA 3D4NA 2B4QA 4WNAB 1S4MA 3MBKA 2VP3A 4A0RA 1JJVA 1C0KA 4I55A 3SIRA 4HAWA 4MYRA 1L5KA 1A97A 1DWUA 2G6BA 4RJ2A 4N8SA 2IV3A 3GIDA 2XGMA 3UF0A 1XEWY 2NUTB 4FMCB 2HU5A 1K8YB 3UJ7A 1M0TA 4JJIA 2D0IA 3NUQA 3N7TA 4G5SA 4KACA 3KEFA 4KXQA 2J3DA 1RC8A 4C0KA 4CIAA 3EGWA 4QARA 4KU4A 4V24A 3FFBA 3BMNA 3LYHA 3DMRA 3UHOA 3BPSA 3COSA 1K7SN 5DIZA 1DMSA 1CCWA 1RAIA 4UVEA 1JDZA 5HM8A 2G82A 4B6JA 2EU8A 3E84A 2OGUA 1TYBE 4K87A 4BQPA 3LF2A 3OPYI 5AHXA 2O50A 5B6JA 2YVUA 3AFMA 3UMRA 5CNMA 4BVLA 2GSWA 5BT8A 5C7LO 5IHXA 3SIXA 3IAS6 4EHAA 2FLKA 1AUXA 4DLPA 1RLOA 1QHXA 1N6OA 4JR0A 4EKIA 3C6MA 1W88A 1QGAA 2VOJA 4NHEA 5BYAA 3AR5A 4RS3A 1FRQA 4M0UA 4AXXA 1W8IA 4DAOA 4U0KA 1NE7A 2QUZA 1M3SA 2X22A 4Y2YA 2JFVA 3NHRA 4CUKA 2FPSA 1OWLA 2W83A 1SM4A 3P9PA 1MAUA 3TRFA 1QZUA 4FSDA 2REQB 4IF6A 1ZNZA 3RWOA 4CLHA 2DEUA 1KI9A 2HL6A 3DQQA 3WKAA 2GHRA 2NADA 3UW1A 3MTGA 2O48X 2J5QA 5KNCH 3TR0A 1UOOA 1L6RA 1VKNA 2ZCVA 4KRXA 3D1VA 1VDZA 1EFAA 2PK3A 4YMVA 3PL5A 2WDPA 1M66A 1IJEA 1SD1A 2GGSA 3MINB 4I08A 4YP7A 2DPHA 3IJEB 3S5UA 3T9DA 5CYGA 3MQFA 1XN4A 2VRCD 4OHVA 3TTSA 1HYEA 1OAKA 1PWZA 1XDSA 4HMOA 4I2NA 3CZQA 4I4IA 4L4YA 2E3JA 1R4NA 3CZRA 4EMSA 2K2WA 1Q7BA 3FWHA 3RPEA 3NDBB 2HA4A 4LGYA 3PUIA 4LI3X 3UMBA 4X6UA 1GQYA 2CJYA 1Y5NA 2WBLC 3E3MA 5LLDA 1BFDA 4BWGA 4R0MA 5DVZA 1SB8A 5KCZA 4TQAA 2X8WA 2YFQA 4IZ6A 4Z3OA 2COEA 2YIVX 3KQYA 2QD3A 2FUCA 2UVDA 4NG5A 3SQMA 1RJ9A 4JX8A 1ZVVA 2LP4Y 3ICWA 1XDWA 3R4CA 3C7CB 3KV3O 3N5CA 1UPTA 3EGEA 4AG6A 5I7WA 2AFHB 5FBWB 2YV4A 4W4TA 4GX1A 2O7QA 3OETA 4BO0A 1YJQA 4OATA 3G2HA 3N86A 3K73O 2CJPA 2GNPA 2D2EA 2GN0A 3WXMA 1Q7TA 1ADCA 1DCFA 1E7MA 3DD1A 2GHQA 2GXQA 2JIBA 2PANA 4NPCA 4PSAA 4UC0A 2P35A 3IOCA 2ZPAA 2Z43A 3MHPA 1ZLXA 3MS2A 1SQ5A 1UIMA 1N5IA 1YJBA 3O91A 3AF6A 1B16A 3AVUA 3VDNB 1TUBA 2OORC 3CLUC 5CBPB 5IW8A 1YR3A 2FZLA 3ME5A 4BV2A 1R9MA 2RGEA 3PGMA 3FWYA 1R7RA 2BGNA 3MRSA 1FRZA 1PR4A 2HA2A 2RGYA 3OJXA 1QFSA 3R9XA 2WJYA 3VUEA 3TN7A 1KNQA 2PU5A 4BS9A 4EW6A 2F3TA 3A7DA 1XU4A 4HKTA 2CK3D 1KE2A 1E63A 1S1CA 3AERA 2QY9A 1BKSB 1EIZA 3THYB 1FJ2A 1NQTA 1ATZA 4L8LA 3MTIA 2Q29A 3B5EA 4NABA 3SHOA 4GZ3A 2GM5A 3ZVMA 1VMIA 3DDOA 3JPYA 1X1RA 2BGJA 4MHSA 1U0FA 1JIXA 1WSDA 4FYKA 4HDNA 3MUEA 1Z4JA 1OLUB 4HLUC 4OYRA 3OEED 1IZ7A 1D1QA 5JAOA 1OXBB 4MUAA 2AVDA 5G02A 2BELA 3J81k 1UFVA 4TXLA 4ZO7A 3UWSA 3B1ZA 4ECAA 1JA9A 1C3OB 4NMLA 4EG6A 1SCNE 1U1DA 4J6EA 3BJZA 2Q1WA 1Y6ZA 4L07A 4H1VA 4JVNA 3MXTA 5AHKA 1U0BB 3TM4A 3HRHA 2B37A 5HIMA 4FGKA 2GDZA 1DKNA 4QDJA 1FP2A 1EVEA 3HCCA 4XJTA 1MC1A 1C30A 4HXGA 4MEAA 4YH1A 4YAKA 4JGGA 2OAEA 4B6QA 2JRCA 5DM70 3E9NA 3QLVA 3FNHA 4IJQA 2EGUA 3WGQA 3NO4A 2AFHA 5EP2A 5M3BA 1U2EA 5HUQA 2J3LA 1Q2UA 5KYWB 7ADHA 5JJKA 1IL0A 2X9LA 4G97A 1YRYE 1GGKA 3BHIA 2YVAA 1T1JA 4UTRA 4JZKA 1O57A 1YNSA 4IUDS 1XTSA 4B3BA 3AM1A 3Q2OA 3S5JA 3LC7O 2C7OA 3JVVA 4JP2A 1VJTA 2VUIB 2Z3VA 3TW8A 3DP9A 3TIVA 1B3RA 4ZV4A 2A0YA 1YRBA 1YCGA 3L1HA 1FFXA 1DDOA 1DRJA 1JXOA 2R6HA 3CWCA 2JD2A 3KYCA 4HJRA 3KSZO 5FXMA 4AU1A 5DO9A 3OC6A 3U7FB 4OM8A 2H4WA 3DBHA 3FHCB 4YUXA 1PGNA 2AG5A 1IZZA 1X2EA 1AE1A 1MRNA 2Z5LA 3ZCUA 1VIAA 4TUYF 2P78A 2GJKA 3O5AA 5CITA 3BJIC 1TOAA 4XPIA 3IEVA 1J49A 1PRYA 1CUSA 1Z33A 3N59A 3OPYA 2XNDA 2WAMA 4O3MA 4GP6A 2A59A 4ZTUB 1Z4MA 1LRLA 5IM4A 1GAQA 3WL4A 4W7HA 5GJWC 5IARA 1UBOS 5KOYA 4Z8YA 4OHPA 1GRRA 1GT91 1LBQA 2FXIA 3KZNA 2AYYA 4BNYA 4CL0A 1UBLS 1C80A 1D0SA 3MIIA 1TZBA 1C4WA 1D4ZA 1TU3A 1LPNA 3H0CA 3VR6H 3LT5A 4MKRA 1YRWA 2R2AA 4ZQHA 2AQ8A 2D54A 1AGNA 3W5DA 3C97A 5DIFA 2Z2YA 2O7SA 3HP1A 5F64A 1GQSA 5IAOA 3OOYA 4JIMA 2BBTA 4HDKB 1DTEA 1W8DA 5CK5A 3EPKA 3KJGA 1E2LA 1QRDA 1Z3IX 2NV0A 4S1TA 4XFJA 1A50B 1QOZA 2PL5A 3O26A 1EP3B 1R0SA 2WMYA 1AB5A 3AQ4A 3G13A 4NFYA 4ZC1A 1N4AA 2ONJA 2QW1A 1TJ4A 2H11A 1XQ1A 3DTVA 4PQGA 4JI6B 3ROGA 2UZAA 3M4NA 3PXUA 2FEAA 3TZEA 3X0DA 2GRAA 3BQMB 2XTZA 1ZIDA 1YBAA 3QWFA 4NATA 1K7FB 4EX7A 5CURA 2XWBF 1DBVO 1D9ZA 1XAIA 3AIOA 3NHSA 3OO1A 4XX1A 4TTAA 1JEQA 3OKAA 2IV7A 4BVJA 4ZYTA 5F12A 4QYMA 4NAUA 4CN8A 4NJEB 3X2SA 1T9KA 2QXTA 3INRA 4J0EA 3LXMA 1T36B 1NYTA 1AGXA 3LDAA 5EJGA 3WKCA 3HSSA 5K8UA 1U3GA 3DB1A 3B5IA 1X38A 3ZHZA 3S81A 3KIPA 2YHAA 4RVDA 2WSYB 1WVMA 4P3XA 1FW6A 1IG0A 1BVRA 3L4EA 1SGWA 3KXIA 5TDHA 1Y37A 5AESA 1P7WA 3ZGLA 1EUCB 4LGMA 4MEJA 4DC9A 2ZAMA 3AZQA 3EBPA 3OQVA 4TTIA 1R0YA 3X2FA 3QQ5A 5E7IA 4FPXA 2F3QA 1FS5A 4YAGA 1OZ0A 1ZI6A 2I29A 2WU1A 3DBRA 2P2ZA 3K1TA 5DOZA 3TJRA 4J49A 2H2AA 4ALLA 4ZK2A 1OIVA 1VMEA 1ZO8A 3KYDA 3PQDA 4FC7A 4D5EA 8AT1A 1USWA 1XV5A 4PLYA 4YJ2A 2ZZNA 3DPUA 2QLFA 4WOCA 4BVGA 3PE3A 1LJLA 5DW3A 3AF4A 5A5FA 3JRXA 5F73A 3KKKA 4W7SA 4M8IA 4MB6A 3PNKA 3FPCA 5EY5B 1JHXA 1ORDA 2FDRA 4HUJA 1G8KA 1F60A 3QVVA 2YRFA 4PQEA 1JKFA 2FR8A 3UY4A 3V1MA 5FO0A 4C14A 1RXVA 2UZ1B 2QENA 3HE3A 3SAJA 1FNNA 1LA2A 3WBKA 2VRBA 1ADGA 2B1GA 1G17A 3RAGA 4WK2B 2Q2VA 3PNLA 4U9IS 4YT5A 1C50A 1N9GB 1G7CA 3C2QA 2WYUA 6ABPA 5MDHA 2XGJA 3TTUA 4U8GA 4YS6A 1E5VA 3A4VA 5JT1A 2B4RO 4BMXA 1GV1A 3AVQA 1Y8QB 3FMVA 2HNAA 2V03A 4ZZ2A 4PX3A 4MUXA 1CBUA 2YYYA 5AKYA 1Z56C 4UXJA 3EYAA 3VR6A 1ADBA 6LDHA 4ZAGA 2GPYA 1IZYA 2DPMA 2NVBA 3C5VA 3O31A 5IEJA 1A9YA 3KWMA 4I50F 3WTBA 1HURA 4K6HA 3IO3A 4CV0A 4KPYA 1KFEB 1CUJA 2Q5QA 2WKRA 1CB0A 5AXAA 2C5BA 2BFDA 5I3ZA 4ARZA 2FW8A 1T36A 1CQWA 3OPMA 4OHCA 4PYIA 1V16B 2JJ2A 3GCDA 3B9RA 4KKVA 3H13A 2NU8B 2FFHA 1XTJA 4GXQA 3I62A 3EC7A 5LKAA 1GGJA 2PX2A 2P1DA 5F3DA 1H6CA 1XHLA 1FQKA 4W8HA 1UT8A 4ZKEA 1QHFA 4DV7B 2E5FA 1J1ZA 3F0TA 2NP6A 2HF9A 3U3OA 1L1EA 1N6LA 4RNDB 4ABTA 4Y2TA 2VWHA 1C3LA 3T99A 4H27A 3QTTA 4UEKA 2ET6A 1KDPA 5CM8B 2G80A 1GTRA 4B3XA 1OZHA 3JZDA 3AESA 1O9GA 4G8JA 3TLMA 3TXAA 4H3HB 2C95A 3LSYA 4QNMA 4XDHA 1F2TB 5CJ2A 4D43A 2F2TA 2GTIA 4MVXA 3L8HA 1WCYA 3WVNA 1TDJA 2EJVA 4K9LA 4CEJA 5SZHB 1NW5A 4RZUA 1P17A 3LY7A 2IEIA 4U5QA 3OZDA 2AXNA 2Z98A 4NCXA 2Z2KA 1ZWKA 3FTDA 3H5AA 3ZK7A 1S6YA 1W1WA 5A6SA 2J33A 3UC5A 5KYXA 4N65A 4LOKA 4EECA 1YASA 2PUFA 3GLQA 5AW9A 5FOUA 2HO4A 4WBSA 1YI8A 5H16A 4MYSA 4OQXA 4W1QA 4D4IA 1QZTA 5LP6A 3UUGA 4B3IA 1DC7A 1FY2A 1G6Q1 1CEQA 4GUAA 4W99A 4CBVA 3ENZA 2WHPB 4XQ0A 1FP1D 3HCNA 3TZLA 1KYIA 2VJYA 4GGPA 5DHFA 1WBJB 3PUJA 4LNHA 4QU0A 4ZT7A 4D2IA 1C4KA 2CXUA 3L0CA 1TZMA 3F7OA 1P0PA 1P2GA 3LOQA 2ZBDA 4XIGS 3ZCPA 1N57A 1RFGE 4ZV7A 1C9JA 3QX3A 3UZUA 1SHJA 2NAPA 3B1JA 3B89A 3KZVA 4FEYA 3NWEA 1NVDA 1BOFA 1E1LA 1U28C 2MWMA 1W36D 1I7SB 1N6KA 1QNLA 1TPYA 1QTQA 1V16A 1T3GA 2GO1A 1ORVA 3RC2A 3IEXA 1SCUB 3H4MA 1FA9A 3OAAA 4K03A 4RPLA 2OXTA 2MYTA 2LWIA 4OGLA 2X0FA 5T6MA 3UPDA 1E1KA 4JJFA 2HRBA 5IASA 5JFTA 3S8MA 3QUAA 3LHIA 1YQGA 4ENVA 4FFRA 4Z4EA 4OFXA 4TQUS 1RYZA 1YR1A 5AJTA 5DNEA 4DBVO 3WWCA 2X5NA 3IE0A 1J5EB 1T4DA 4S24A 2BMAA 5ECDA 3B1VA 2OHJA 4V0SA 4XAQA 5ALQA 2HA3A 4L5JA 3U62A 5MF6A 2RGNA 1SVMA 1F2TA 1OA0A 2F8LA 2P0YA 2I65A 2C3PA 4NQZA 2JEOA 3C1TA 2N0SA 1KMHA 4ER5A 2QBYB 4JLNA 1FX0A 1RYNA 4CEIB 3U7HB 1MGPA 3EQ8A 5A71A 4UPDA 2HWKA 1IBLB 4B40A 1PR9A 1QGDA 3S28A 1EFPB 1OLSB 1Z2AA 4QBFA 4BQEA 4JMPA 2ZXFA 2H48A 2KLBA 1H2YA 2A1TS 3EK2A 2W9XA 1J2EA 4IX1A 5HGJA 4L57A 3RANA 5DRYA 1CR4A 1G5IA 4O6VA 3ZD7A 1FQWA 2D0PB 3DT6A 2VZ0A 4TTPA 2YV2A 1CP2A 3TL2A 1MFPA 4GM0A 2FN9A 2BC9A 3WGTA 4EVIA 2ZQYA 4E5YA 1QPZA 2PCLA 3A2LA 4ZT2A 3VV2A 3FTFA 1JHPA 3A4IA 3EJWA 3H5VA 3RR2A 1R00A 2OBXA 3R75A 2RGBA 1DJQA 3D0QA 3QG1A 4RELA 2HLDA 3VTZA 3MYRA 2A30A 2ZZKA 2WJ6A 1BDIA 1Z8HA 5BSEA 1PL6A 3K9QO 4MV8A 4IEEA 3O21A 4ZYLA 4URYR 1MO5A 4LZZA 5AW7A 2QIPA 2FPPA 4EH1A 4WACA 1PZEA 1FYDA 2A9JA 5DCWA 4C4AA 3HTXA 1V4NA 1BDJA 3T5MA 1YDWA 4Z7JA 1XMJA 2GX6A 2IITA 3BMOA 3KJQA 4OBBA 5ALMA 4ZT3A 3TOVA 3UKOA 3ULKA 3VAZA 3R7BA 4D0LB 3TI7A 9LDBA 1KZGB 4O0LA 3AKEA 1EZ4A 1QHSA 1N0WA 4X3OA 4AQDA 5AJYA 2BE7A 1BCRA 2CJWA 4XWOA 1XTIA 3P0RA 4NTZA 2XMRA 5DE3A 1IRXA 5FTJA 1HT2E 5KNCD 2W2XA 1IYZA 2JKZA 5B4VA 5K0JA 3JD3A 3BHNA 4IPTA 2R7LA 3BMCA 1N6NA 4B76A 3WL5A 1Z7EA 4D4GA 3L01A 3GARA 2WINI 1T9BA 4WADA 1YE3A 3QOXA 3SZOA 1KP3A 4MCAA 3KS9A 2A35A 1V4VA 2SKEA 3CX3A 3JALB 2XZLA 3TSYA 4M9ZA 2XUDA 1OB2A 1CLEA 4XUGB 1LNQA 4RTRA 1J97A 4OKIA 2C0PA 2RSLA 1OU0A 1KAMA 1RS0A 5CD1A 2BR4A 1PJZA 4AY6A 5KSZA 4MIEA 1HDCA 2DT5A 1K66A 4DC1A 1PX0A 2C57A 2XWJI 5BWOA 1S0UA 5L53A 4YDHB 2LIPA 5EIFA 1KVQA 3ETLA 2AR9A 3RRJA 4ID3A 1NG1A 3PXCX 3C4QA 4PNHA 4MW5A 2HEIA 3UFXB 4DJ5X 4Y2GA 1X1AA 3QMVA 1HXHA 2AI1A 1WQ1R 4KRGA 2QMYA 4WLVA 5E2AA 1I2ZA 1JU4A 2GAIA 3N2IA 2Y76A 4LGCA 4WW0A 4WCFA 3D7LA 3PQFA 1VGQA 2PWAA 1YC5A 5KYGA 5ENVA 3LZCA 2JLAA 1JI0A 1PJ4A 3A1WA 3GWZA 1YDEA 1JR4A 2ZSHA 3U09A 4Z4QA 4MB0A 1J8MF 3SQLA 1WPQA 2XNDD 3ORHA 2IUUA 1J9GA 5JXJA 4XA8A 1JPNA 3GBPA 3V1TC 1I7QB 3L4BA 1G8PA 2BRUA 4FR0A 2B5WA 5CTAA 3PJEA 5EZSA 4OI4A 1DJPA 2D0OB 4YRCA 2NUAB 1Z38A 2QQFA 2G5PA 3ZDBA 4BP8A 2O5RA 3IBSA 1NAHA 2HSWA 3AP3A 1MIOB 1LTHR 1VMKA 3BBPA 1WQ4A 3EQ7A 2PLFA 3KQSA 1SXIA 4N7JA 5KDLA 3WGUA 4QZVA 4BAZA 1Y1TA 4FR5A 1IPHA 5DP1A 3RFCA 4KFCA 1WM1A 2NSYA 1Z6XA 1Y80A 4KPFC 4D9IA 3ZHCA 2XXAA 4JI5B 5JW6A 2VWGA 3GRPA 3D7MA 4NBKA 13PKA 3HZHA 2PRSA 4JVSB 3V7FA 3OCZA 1P39A 2EYUA 3A14A 3DTVD 2BEWA 3B9PA 3E1SA 3QLUC 2WJ4A 2HY7A 2UZ0A 4J6FA 5EWLA 3LGSA 2X4LA 1EGVB 4EUHA 3HXMA 3VU9A 2I2AA 1ETHA 4WN9A 2NU6B 1UINA 1VYVA 3B13B 5CXXA 4IIJF 4Z3DA 2I76A 4EM6A 1U7XA 3HXTA 4U7FA 3H4VA 3T15A 2FI1A 4P4TA 2BH9A 4RFVA 3WQQA 1FJHA 3PEYA 1TO2E 1ZZGA 3JRWA 5CYPA 2LVBA 3MN1A 3SC3A 5FBKA 4ZOBA 5ALUA 1UK6A 1Z4LA 2HRCA 2OGZA 2I33A 4AUMA 2PUCA 1L1FA 1W93A 1LB1B 1V5GA 1M34B 2HZ7A 5H81A 3W6UA 2XQIA 3IKVA 3LP6A 4OOEA 2HCFA 1R74A 2RGXA 3E22B 3K0CA 4GGMX 3WBBA 2LBPA 4PZLA 3VR3D 4NVRA 3FX2A 3GZ4A 1V6AA 1W7AA 1LW6E 2C78A 5L51A 2YRXA 4RBNA 5AK4A 4AKIA 4GOMD 4A8JA 5JQGF 1BVYF 3SSNA 2IV2X 1FSFA 2FY8A 2ZWPA 3QYJA 3SZGA 3VISA 3ZDYB 2ORIA 1WIWA 2GPBA 4NENA 1DJMA 2EYQA 3V55A 2RBKA 2TECE 1CS0A 3EXG1 4PG4A 4PSDA 3U16A 2DSTA 4LF9B 3LP8A 2VIIA 3PGXA 1NXXA 5KTYA 5ISMA 3KEMA 5F35A 3HCBA 1HE3A 1ZM3A 3L8FA 5DBHX 3Q3IA 3RBZA 2NOAA 4FZ5A 2IW1A 2P4HX 4C7JA 1ODTC 1UP6A 2O2HA 2AC7A 2QUJA 1QSGA 1I2AA 2VLBA 3NONA 1TJPB 3C1AA 4FHZA 2Q1YA 4WZBB 2PBFA 2WKPA 3AF5A 4NL4H 3ZXSA 1LLDA 1PV1A 4IXTA 4OHZA 1JHRA 1JJBA 3E0QA 3FWNA 3GJRA 3I5YA 3ABOB 2Y1WA 4TMVA 2Q8PA 3DB2A 2R65A 1XMQB 5JSQA 1M2VB 4GE0A 4LSWA 4QLOA 4MPRA 4O2AB 2ZJFA 3SF8B 1AMOA 1Z12A 2O8FA 1EHIA 4CQLA 4LVUA 5FOVA 3VR6D 1TU0A 3OTIA 2CV2A 3NIFB 1OX4A 2VHYA 3K5IA 3FGNA 3KCQA 2O2SA 1JJIA 2XB4A 2OEPA 3KXKA 3QK7A 1G59A 3E35A 1E60A 4MV6A 4M7RA 4B3SB 1UM9A 4ZQCB 3NYRA 3WK6A 2P9GA 4YQFA 1KR5A 3BBLA 1MVLA 3ECAA 3KZXA 4JDPA 5CHYA 1TAHA 5B1HA 3GOQA 1JBQA 1Q7CA 2JAPA 2J4FA 1JZSA 1N2IA 3N3BC 4J1TC 5CNIA 4AVYA 5KYTA 2AJCA 5H02A 2H7VA 1KY5A 1L7AA 3KLOA 1H6AA 2PWYA 1MW9X 4M53A 1UOPA 3IODA 2QRVB 4D99A 2FZKA 3Q7TA 3RYTC 4EDFA 5FYDA 3GVCA 2QA5A 2RH8A 3HCFA 4IHAA 4NYMQ 2Q41A 3HH8A 5J1SB 3EAFA 4HAXA 1HYQA 4PBRA 4U3JB 2E6UX 2PKYX 1OGYA 1IULA 3WP0A 2QQEA 2G71A 3FLEA 3LPAA 2B1JA 1E1RA 1X1SA 2AKAB 2GUWA 3GUUA 1BU5A 3IP8A 4G0XA 4IFIA 5IT0A 4AAYA 1EFDN 1AM4D 1UXJA 5CX1A 1NQOA 4FQ7A 3NT2A 5JSKA 1XJ0A 2B36A 3DLTA 2X9GA 3N8DA 4FJ2A 2BDEA 2WHQA 3I09A 4UEWA 5LIRA 2W71A 3JD0A 1AMUA 4ZJZA 1PR6A 3KOXA 2GEFA 1ZXLA 4LRUA 3T5CA 2XHEA 4D5GA 3CHYA 4JKYA 1V8BA 2O3QA 2SHKA 3JTMA 1SZPA 4YGXB 1UKEA 4LJSA 5EEGA 4L5AA 1M8GA 5K6AA 1Z28A 3H5WA 3UWMA 5KJ1A 2I8AA 5MN6A 4JU8A 4BV3A 1MUUA 2Y92A 1ACLA 2WIFA 4YRBA 2Q5LA 1JALA 5FT9A 1TYAE 4ZVLA 5J40A 2OFFA 4BP1A 1VG0B 2VCEA 3OJEA 1VKHA 1WZ2A 3SF8A 2XTAA 1G20E 2PJUA 5JO0A 3KALA 3SVLA 3W5CA 1E6MA 2IEDA 2EV9A 3H9EO 1EK2A 5H1YA 3W5IA 2OV8A 1JL3A 1U3UA 1WDTA 2VKTA 4KPUA 2HSGA 3WK7A 4Y1EA 1D7OA 1E4EA 2EJBA 3AJAA 3DDZX 1CUXA 1MX9A 3ETDA 1I4LD 3EFOA 4JVLA 4RVSA 3TX6A 2PL9A 2ERYA 4CM1A 1LBIA 1VCNA 1P2FA 4ZHSA 2ZREA 1ZW6A 4MTLA 4HFRA 1FNBA 5LNK1 1GZ6A 3I2FA 1W87A 2GSDA 4EA8A 5G0VA 2J07A 3OAAD 4MP3A 2BUBA 1JKIA 1L7EA 1SMKA 1WU8A 4BXOA 2X3FA 1C8LA 3C3DA 1O7JA 3N0WA 4RPGA 2HPAA 4MRMB 3RUIA 4EBFA 3QU2A 3OE5A 2ZE8A 5CGZA 4J4BA 2VUUA 1E7RA 3BXEA 1H66A 2FWPA 2P9ZA 1W5TA 4X7MA 3HKDB 4O5AA 5HEKA 3SLRA 5C8DA 2YYSA 3I12A 4QPNA 1U8XX 2G5TA 1NYQA 3MRVA 1SBYA 2R84A 1GPUA 4RGYA 4U3JA 4F4FA 3W78A 1IJFA 3DQPA 3EG5A 3SDZA 2C1ZA 4L74A 5K05A 1H2EA 2RG7A 2PXAA 2XVZA 2RONA 3DFMA 4QT0A 3RUPA 3U0VA 5JYCA 1DIAA 2KI5A 1SCJA 4CLEA 1P77A 1NJ1A 3L2OB 1OXXK 3AM5A 3E9QA 1U3DA 2HSJA 2GK6A 3E3AA 3GLSA 3MFYA 2C82A 4CTJA 4WOJA 3D8SA 1K27A 3AILA 4G5GA 4EABA 3DYVA 1X80A 3FFXA 1U3TA 5K3SA 2PX8A 3C8ZA 1HRDA 2J9ZB 2YQ4A 5AVRA 4WEOA 5EVCA 3QOWA 2WIAA 2P68A 1NWCA 1Z4OA 2BTQA 3CX8A 2GOYA 2INGX 3EIQA 3IQZA 1JLSA 4MR9B 1RIIA 2K2QB 5IT9A 2B7CA 5E9WA 5JZMA 1HYHA 2D2XA 2Q2NA 3GGSA 4UNNA 4UVIA 3WB0A 4MS4A 1LSSA 1P7YA 2OM2A 2PLRA 1E0KA 3PHHA 3OBIA 3NEYA 1XKTA 2DB3A 2DE0X 2HH9A 3ROQA 3VRHA 3FCAA 3MRXA 4BB5A 2FR1A 4IGFA 1JIQA 2XB6A 3PPWA 4J03A 2PHZA 3DMGA 4MNTA 5A4MS 5HIKA 3UBTA 1QYIA 1YR2A 3EZGA 4HB2A 4HDOB 2BKUA 3JQFA 1QTIA 3TZ6A 1CY8A 1Z7WA 5JASA 1NP7A 2A67A 3EIHA 1XNHA 3U81A 2CBXA 4PHCA 4AWBA 5GAJA 2H06A 4K7JA 4MO2A 4JZYA 3UWPA 1UKYA 3IH5A 3H9UA 3IOEA 4B6OA 4OJMX 1MABA 1E2GA 1U8UA 4YRZA 1G5HA 3RSFA 3K0HA 1L5HB 2EKBA 2GD0A 3NTOA 2DQSA 1U0TA 5ITSA 1CJUC 3Q0IA 4GL4A 2OENG 4YUYA 1JIIA 2B6HA 4GI7A 4K1XA 1AQYA 4P08A 1QQAA 4E2WA 1GPWB 3HQ4O 2VJCA 3UAYA 3RVBA 5AQ1A 2L2QA 3K94A 4YUWA 2AFVA 3L7OA 3M83A 4P4NA 1K8RA 3K9BA 4XTCS 4EAQA 5JVDF 4UAJA 3WIVA 4L5CA 3FTPA 1FB5A 1QZ3A 4W5HA 2FPKA 2C29D 3OZFA 4F6CA 1S2GA 2QUIA 1V11B 3EVBA 4Q3KA 4Q16A 2QZZA 5U4XA 1IXZA 4OY3A 3HSKA 3VZSA 2HU7A 3OJ0A 5FA8A 1IOLA 3VJMA 3WBJA 4G37A 4X6LA 3A70A 5DDIP 3PQ2A 3DLBA 3K1YA 1RWOA 1MB9A 3CNLA 4GRDA 1Y5IA 4L50A 4EJSA 4PLFA 2PSDA 4ZZ3A 3P9ZA 4ZXPA 4KXXA 1Q0RA 4OK6A 3RIMA 4QEZA 1PFWA 2CWDA 5ALKA 2WQ6A 3FAKA 3SGLA 2R60A 2G25A 3OY7A 3ZWDA 5J5CA 3SICE 2EKLA 1LQ2A 3PJRA 3H0KA 4ZRMA 4YA6A 3STVA 2YMPA 1Y6RA 1Y8RA 3H1TA 4ONEA 5AR1A 4FIDA 2G04A 5C52B 2JGDA 1Z6AA 5FD8A 3RRYA 4CIXA 3RYCB 4F56A 4QUIA 3KE9A 3DV0B 1GU0A 2EP7A 4F4HA 4P80A 4G1UC 3N2EA 1BFKA 3EUFA 1YBHA 2ODPA 3AEQA 4LDAA 2CVQA 2NO0A 3A37A 1FXUA 2R5FA 4CLDA 1L5WA 1RRMA 5GONF 1U4NA 4TMTA 1K9VF 1WA5A 3P20A 3FM9A 4H7FA 1CX9B 3T7SA 2JFFA 1KP9A 1G2QA 2JIQA 3CC8A 4HY3A 4JXKA 4PR3A 1OAAA 2PR7A 1XRNA 3KTAA 2YN4A 2ZYUX 3EMKA 2QQ0A 5C8ZA 3UPUA 3UH1A 4AMZA 2G70A 1CP3A 1LRKA 2C2GA 1ML4A 2ZLBA 4Q9HA 4AKHA 1J33A 2A9OA 3CU5A 4M9CA 1KSHA 4IX9A 2HGZA 1UIRA 1X8XA 2D13A 1W2HA 2E4WA 3PI7A 1XDUA 5IFLA 3TKAA 5DGTA 1OPXA 4KH1A 2QN2A 4EYSA 5EIEA 5KQPA 2NYRA 3EGCA 5HRAA 4JBYA 1HEUA 4LWPA 2JGNA 3HVIA 1T8PA 3WA6A 4C01A 4FGSA 1VYHA 3DSRA 3SYKA 4BZZA 3FBWA 2VA8A 2D8AA 1JHOA 3FNIA 2EC5A 3N2KA 4FFVA 5E2BA 2RAUA 2P7IA 3G7UA 2ZJZA 3H1AA 5LXTB 3DD5A 2NMVA 3KWJA 3P0HA 5JZVA 2EFJA 2B61A 3Q9NA 1WUKS 3LRXA 3ABRB 5C7YA 4UM9D 3UYKA 1I3LA 4DUYB 3A3YA 1L4GA 1H6DA 3HUTA 3KSBC 1A1SA 3ESXA 3GRYA 3DJFA 2JBHA 4K05A 4G86A 3W2GA 3ZTWA 2AXPA 2JCBA 1KVUA 1MGOA 2VTBB 4FHCA 4HSEA 1U0RA 1R64A 2C54A 5HK8A 3UK1A 1D03A 4OTZA 4CM8B 5CA1F 3LQ1A 1T3LA 4QJIA 1P1CA 3AONB 5M7EA 4GKJB 2QZSA 4JGBA 5D1NA 3DHEA 5HF5A 5B3LA 4UTOA 3SC4A 4BNHA 2Z2IA 4EY5A 3NGLA 7MHTA 2REBA 1T2UA 3JVUA 2WVGA 4UMDA 5FOWA 2JGJA 5J5VA 2DULA 3TOXA 3H1EA 1VMDA 3EIXA 1FSZA 4RZ2A 1XTKA 4EVQA 2HR1A 3WLEA 1W4RA 1X14A 3Q87B 4MS1A 3U1TA 1MOSA 2R8RA 1E2UA 3GJ5A 1KARA 2ATXA 1YGYA 2HMWA 2XE4A 4Q19A 5EXDA 3S2SA 1TYEB 3CJQA 1O97D 1WW2A 3BAZA 3G2LA 3ZXYA 4FQ8A 5HOQA 3ZE6A 1U0LA 4M8NE 2VF2A 1JJAA 4I3GA 1FYVA 1KI6B 3JARA 2ZBGA 2BGTA 1SK8A 1V25A 2H1CA 4E5KA 4G0WA 2ODBA 4NMWA 4XUDA 3U7IA 3UEOA 2O2JA 5CDUA 3BYZA 5D85A 4KC0A 1FXWA 2NP7A 4N0QA 4TTQA 3W9UA 2Q4DA 1I8TA 3K1JA 3I64A 1XZAA 3LIPA 4HX5A 4QWMA 2VS1A 5AKKA 2VQFB 2ZJOA 1C4XA 4MWSA 5HFAA 2XBMA 1KVSA 4G4IA 1W5BA 3HJBA 1CIPA 4ESEA 1DMRA 5J4VA 5LOVF 3EZ7A 1P74A 5KVQA 1ZUHA 1XJQA 2RAFA 5CDYA 5G0WA 3IMFA 4JVMA 1A9XB 1W4LA 3LKBA 2ZSFA 3CM0A 4I9HA 4PZAA 5TJ9A 4AO8A 1YMQA 4HD8A 3DLAA 5BQFA 3FKSA 3LKZA 4C5AA 3JW8A 1XZCA 4DB2A 2ECQA 2CVZA 4MV3A 4WK0B 2A5JA 1QYWA 4IVPA 4MQEA 3LK6A 3Q3VA 2FWAA 4LJAA 5EQTA 2WSIA 3WJAA 3VZRA 4JY7A 2QRUA 1MVNA 4Z4IA 1TA0A 1CU1A 2H29A 2DFVA 1U1EA 3N2NA 4HPXB 1BAPA 1SKAA 1TUGA 5TQ2B 4CLRB 4PYJA 1XAGA 5E8RA 3DS8A 2CHUA 4P54A 5J2UF 1YI0A 4FE7A 3ZJTA 2HK6A 2J3MA 3WI7A 2AUNA