2YQ4A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
b'TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus
molecule tags Oxidoreductase
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A01
1SEPA 1SOWA 1GDHA 4PZEA 1EUCA 3JQFA 3ANMA 1MP0A 2X9NA 3ITKA 1X1TA 4IIVA 3DTYA 2VQ3A 3C7AA 4A2CA 2X8LA 3FTNA 1ISGA 1LSJA 3F9IA 3FHLA 3COSA 3MEQA 4D43A 2DT5A 2O3SA 4WEQA 3T4XA 3AWDA 2NUAA 3JQGA 1HSZA 4I9HA 4L4SA 5BNFA 5KJ6A 3ZV6A 5JY1A 2E82A 3WGIA 2YW9A 2NQTA 1Q7BA 4CMJA 4O59O 3FN4A 3UKOA 3EC7A 4UVGA 1QMGA 3GDOA 3LK7A 5A06A 2ZYAA 2J5KA 2GN8A 1DC6A 3RASA 3RI3A 3JQ6A 1GCOA 1WP4A 3W4KA 3WNVA 3JQEA 4JP3A 5BSGA 2O7QA 2VWGA 3Q2KA 1GQQA 1DFIA 1ADBA 3H9UA 3ONFA 4M89A 3EVNA 4IMPA 1RYEA 2A4KA 4E12A 2DLDA 4GX5A 2H9IA 5C5IA 2CDBA 4PGFA 2EP5A 1MB4A 3OQBA 1EVJA 3ZI0A 4P4GA 4ZQBA 2C20A 1VL8A 4NDNE 4A10A 1HEUA 3AY7A 4FS3A 4BNUA 4CMIA 1QYWA 2VRBA 3HQ4O 4XJSA 3NEPX 1BW9A 1KVUA 4YB8A 4CMEA 2O2YA 2P5UA 5KIAA 3CE6A 2EW2A 3LT4A 3UAGA 4DUPA 4JP2A 1B2LA 4AVYA 3DAPA 5L7TA 4BGUA 2VNAA 3CH6A 3JQGB 1IY8A 5KJCA 3DZGA 2VYND 1QP8A 5DF1A 1I5RA 2B5VA 2X5KO 1E77A 3WICA 4ROSA 3ZWBA 1HF3A 3K6JA 4YYZA 1HT0A 5KOIA 3DBLB 4D3FA 3K9QO 3E82A 2O50A 2IZ0A 1R16A 3GNSA 1GL3A 4DBZA 1NXQA 1A71A 1CJCA 3ZWMA 2UUPA 4GX2A 1T2AA 3UW3A 1GPDG 3PPIA 4Q3CA 3WMWA 2OORA 3LVFO 3PZBA 2NQ8A 3C7CB 3ADPA 3C1AA 3GPDG 4HFMA 4OAQA 2OL4A 3AM5A 4A5OA 1EE2A 4CR6A 2Z95A 3B1FA 4Q3NA 3DZHA 1IZ0A 1YDEA 4JBHA 2GNAA 3GPIA 1EEHA 2HRZA 3KRTA 4FQ8A 1P0FA 1YL7A 1ZEMA 2HJSA 1AUPA 1XQ6A 1FK8A 4PRLA 4D42A 2V65A 3OFSA 3ZWAA 3EY4A 4ZA2A 2EERA 4JNKA 1G6KA 4RVGA 4JJIA 4NFHA 3DBRA 4WECA 3PWSA 4QX6A 5TIIA 4HV4A 3KZVA 1NPTO 4IDAA 5FEUA 1E6EA 3VH2A 1PEDA 2GCGA 4S3MA 3W6UA 7MDHA 1GZ3A 3OETA 2QW8A 4RDHA 3WB9A 2O3RA 3LC1O 3QY9A 3RROA 4XQGA 2UUOA 1JTVA 4PG8A 1TT7A 1GZ4A 2YQ5A 4FN4A 1YE3A 1BSVA 5IZCC 2AEJA 1LXCA 4J3FA 5EINA 1FDTA 2WEKA 3W1VA 1CDOA 4F45A 3E8XA 3BMNB 4I5GA 4RPGA 1I2CA 5I7FA 4D46A 4CV1A 5CAEA 2ZTLA 1N8KA 3A06A 4KWIA 1W0CA 1YBVA 3GVHA 4RZIA 4M1QA 3JD1A 1YBAA 1IB6A 4EDFA 4RJTA 4U8GA 1F8GA 3SLGA 4Z6KA 5HM8A 1YB5A 3P2OA 2J3JA 2JCVA 4FJ0A 4JQCA 2UVDA 4MVJF 4UEJA 4B8ZA 1R37A 1F06A 3KYBA 3DEYX 3PVZA 2ZB3A 3QWBA 5CEFA 3PYLA 2GLXA 4DYVA 1SPXA 2EWMA 5AXCA 3RC7A 3WYBA 2HMSA 3WJAA 3HFSA 4R1UA 4P4LA 1HRDA 1W73A 4FD3A 4J9UE 1N1EA 4EJ6A 1Y8QB 2WE7A 3RU7A 3BMQA 3QE3A 1QSGA 5IJZA 5HWSA 4L4XA 1Y5RA 1VRWA 2C7VA 1VL0A 1S6YA 1N5DA 4Y6SA 2QZ9A 3GUCA 1IUKA 2E4AA 1YL6A 5KWEA 2EKQA 3DXFA 3H9GA 4GKBA 1QV6A 3R3SA 3KSZO 1PR3A 4WLVA 4YRDA 3PRJA 4NK5A 1UJMA 2V6GA 2FRDA 2RHCA 2YQ4A 5BSEA 1JA9A 2HAEA 4B7UA 1UUFA 2EIHA 4BNXA 1NVGA 5A03A 4YJHA 3G0OA 4J1TA 3SXPA 4BO1A 5L4SA 3JCZA 4NH4A 3RD5A 1U5CA 4IMRA 3GOHA 3HJAA 4XB1A 2BF7A 2GZ3A 4Q3AA 1YXMA 4R16A 3Q1LA 3U4HA 3GH3A 3QJ5A 2NU7A 3K31A 4D7AA 2Q45A 4ALKA 4I8XA 2Q99A 3HWRA 3QVTA 1X0VA 1KETA 4TRJA 3SEFA 1LEHA 1U3VA 3G3EA 2Q1WA 3IUSA 1LU9A 3NT2A 1LLUA 4KQWA 3OBBA 2DM6A 1KY5A 4GVXA 4OH1A 4A0SA 2EJWA 3GR6A 4GKVA 5GZ6A 4NFSA 1BHSA 5KKAA 4BIIA 1GY8A 4FOSA 4ZD6A 4GAEA 3JQ8B 1B3RA 1KEPA 3MWEB 4ZVVA 2DPGA 1O6ZA 5ILGA 2ZTUA 3GC6A 4HKTA 1YBMA 1LSOA 3EDMA 2JAHA 4YAEA 1HDGO 2IYOA 2OMEA 2EXXA 1PJLA 4R5MA 2G17A 4PG4A 3QVXA 2AA3A 4WJZA 1LQTA 2Z1MA 2PD6A 2W8ZA 4MPDA 3ANNA 1T26A 3FD8A 5A4DA 1K6JA 5HBRA 3KV3O 2RH4A 2E48A 4XQCA 1SAYA 4E21A 5CDUA 3QIVA 3L6DA 1B15A 2ZB7A 5A02A 4YJHB 3LQFA 4EI2A 1R66A 4J0EA 4YJGA 4EUFA 1I0ZA 1X7GA 3ITDA 1XSEA 4FFRA 3IKTA 3QHAA 1NQTA 5EESA 3TRIA 1YVEI 3KLMX 4L75A 3WQQA 4FR5A 3STHA 5JLAA 4YT4A 5H83A 4LK3A 1L7EA 1E1MA 5EN4A 3FSRA 4KUEA 3ROKA 1KVSA 1QRRA 2VOEA 1DC4A 1WVGA 3ZNNA 4E2XA 4NQZA 1KVRA 2IODA 1Y9EA 2QHXA 3OQ6A 3ANLA 3NUGA 4B4WA 5JXWA 2C2YA 2PGJA 1PL6A 5F1PA 1NQ5A 3DMTC 4ZU3A 4DBVO 2VYVD 4XDZA 1F0YA 4FSHA 4E6PA 3NAQA 5EQDA 1PSDA 4N18A 3ASUA 4RV9A 4S1VA 1ENOA 3DR3A 2NU6A 2YDXA 1KC1A 1FJHA 1V3UA 3TFOA 4IQ0A 4RF5A 1HE4A 1PGQA 4FW8A 2I67A 5B4TA 1SCUA 3KUXA 3NTRA 4CM3A 1GD1O 3V1YA 4E5PA 1DFHA 1DB3A 2Y0DA 3DAGA 5L45A 1XU7A 3ZN2A 3HFGA 1LDBA 1DC3A 4Y6PA 1YL5A 3WDSA 4EZBA 3S2GA 4JGBA 1I36A 2X9VA 3RBZA 4BMNA 4MKRA 2VRCA 1MUUA 2PKQO 4ONEA 4MDHA 2PFGA 2ZTMA 1DJNA 3H2SA 2WDZA 3H9JA 1ZMOA 4OIMA 1PS9A 2BFMA 4MVJM 6ADHA 1DIHA 2P4QA 4CR8A 1R0KA 5A5FA 1R0SA 3WFJA 4RL6A 4WLUA 4GLOA 2ZB4A 3G17A 4PN3A 3W4JA 3QV1A 1MLDA 4DC1A 1AN9A 3O4RA 2Q1SA 4RCVA 1GTMA 3ZW9A 5COBA 3GF4A 4L0QA 1WDKA 2IYPA 4AJPA 1B7GO 2O3TA 4E4YA 1DPGA 1WLYA 3U0BA 4XQEA 3AOEA 4CUZA 3QW2A 1BDBA 1JKFA 3LU1A 3DONA 2BGLA 3DDNA 3TZ6A 4XRGA 3BHJA 1U7HA 4WCFA 1UXHA 3ZDFA 1E3JA 2QG4A 2B37A 2GSDA 1PIWA 2ZCVA 4R3NA 4B4UA 1M66A 2X0JA 1AE1A 5HA5A 1LRKA 5L9AA 1J0XO 1UP6A 2E6UX 2YV1A 3UUWA 1QV7A 3OH8A 2VUTA 4NBVA 2AEFA 3GGOA 4PZDA 2Q49A 4IXTA 3BXXA 3GVXA 4ZN6A 5L51A 1H93A 4PLGA 5GY7A 5JMWA 1J4AA 3ZH2A 2YZ7A 4MVJH 4NBRA 3FI9A 1ONNA 1WWKA 1CQJA 5COAA 3BTSA 3MJCA 4MVJA 4XKJA 3VC7A 1K5HA 5IXSA 3HDHA 1PJ4A 2GZ2A 3UVEA 4JX8A 4YT8A 3TZQA 1HDZA 3E9QA 3WGGA 3AM3A 1FDSA 1OMOA 1E5QA 1FDVA 3H2ZA 2HDHA 3NDJA 2BLLA 4N5NA 4CM9A 2X86A 2DKNA 2WMDA 3SC6A 4BKOA 5K9ZA 1YGYA 3G1UA 3E1KA 4PZCA 1ISIA 1IYZA 2JJYA 1VKOA 1Y8RA 4NI5A 5IDWA 3I9MA 1Y1PA 4HXYA 1NAHA 3O03A 2PWZA 2OHXA 4R1NA 1ISFA 2B5WA 3H5AA 1E7MA 1LC3A 2FMUA 3MWDB 5B12A 5JY6A 3K8ZA 4J0FA 4O5OA 4J6FA 1FDWA 5JAZA 4FJ1A 5JMPA 4YXFA 2R6JA 3PDJA 3DZKA 4XGKA 2HMUA 2G1UA 3DOOA 3EGOA 3OQ1A 4IDDA 4NHEA 1E7RA 2QYSA 1YRLA 4ZQFA 3ZHXA 4FFPA 1NR7A 4JJFA 1UDAA 3D4NA 1SB9A 3UHAA 3WGQA 4CM4A 3C8MA 3PWZA 5ICMA 9LDBA 1W4ZA 3PQDA 3PGXA 4J90A 3FCOA 1GYPA 3GEDA 1Y6JA 3ABIA 4DL9A 4BUCA 4PVCA 1LLDA 2AHRA 2QRKA 3IQDB 4AJJA 1DXYA 3AUTA 1NPDA 3RUIA 3KYCB 4MP6A 1V3TA 2X0NA 2WJPA 1HZZA 3AUSA 5G2OA 4DIFA 4PLPA 3EVTA 4BO9A 2QRLA 4RO0A 4AJKA 1Z74A 2I6TA 3Q0EA 4XZ3A 5IZ4A 4K6FA 1RWBA 1YOVA 2GPTA 4DQXA 1Y8RB 2PZJA 5JYDA 4BB5A 3KM0A 2ZK7A 4RVHA 2AE1A 3DOCA 1JDJA 5DULA 2QRJA 4RVSA 2BGKA 3I4CA 3GVIA 4CQLB 2DTDA 3NDRA 2BHLA 4R01A 5A5EA 2YFHA 3NYWA 4M8SA 2VWHA 2DTXA 3CMMA 1KEVA 1EUDA 1U8XX 2W2LD 3IAHA 3MOGA 5T6BA 2CDCA 2YHUA 4N5MA 5IDYA 4YPOA 5EERA 3PHLA 4BOYA 1NHGA 3WLFA 1LUAA 3JQ7A 2Q3EA 3PFFA 1DAOA 2V6FA 1HETA 2C29D 1T25A 2JCXA 3C24A 2PZKA 3GRPA 3DWFA 1M75A 5JDIA 1O0SA 2O23A 1V0JA 3BMOA 1PJTA 4LVUA 1ZXBA 3OSUA 3KEOA 4Z9YA 4Q3BA 2EJVA 1B8PA 2Z5LA 2OFPA 3AFMA 5THQA 3WS7A 2X6TA 3I23A 5TLSA 3SX2A 2OUIA 3FR8A 3GZNB 3ZU5A 2PLAA 1H9BA 4PG7A 1YH3A 3EZYA 4CMKA 4YAIA 1EQ2A 4A26A 3ZWPA 4FFLA 4BKPA 4TZTA 3DMYA 4K26A 4KTTE 4J7UA 3NT5A 4XQ9A 4PLHA 5KKCA 1OOEA 1RKXA 3ETEA 4J4BA 4UVDA 3LSYA 1DBVO 5B4VA 3VVCA 3KB6A 3GG9A 1UAYA 4GBJA 1ISMA 1E3WB 1P0CA 3HDQA 4GVLA 1ZUD1 5JDCC 1ZKMA 5IF3A 1EK5A 4R1TA 1PJ2A 3B20A 1QLHA 5JCJA 1CEQA 4J9VA 4QO7A 2F1KA 3W8EA 3RFVA 1N2SA 3JQ7B 1C1DA 4IINA 4TMFA 2D0IA 2GYYA 4XWYA 4E5YA 2VUUA 2HU2A 1ZSVA 2HO5A 1M6HA 4RZHA 1ZFNA 1E0DA 3N58A 1V35A 4IJVA 1QORA 1SO8A 5CG2A 3BA1A 1WMBA 3RIHA 3I9LA 3VPSA 2POQX 3QP9A 5T8KA 2P4HX 4YJDA 4L73A 3CKYA 1DHRA 4Q3EA 3SC4A 1VPDA 4M87A 4HADA 1JKIA 4PCVA 2GN6A 4NZ9A 2UV8A 1P44A 3PIIA 4C7KA 4CM5A 1P1HA 4BO2A 3HZZA 1L1FA 5KVCA 5F21A 1EFKA 4XYMA 4E5KA 4YTEA 1E3IA 1PX0A 3JQFC 1QLJA 2XOXA 1IHXA 3JQCA 3CEAA 4G5HA 1EBFA 2FN7A 5T5QA 1Z7EA 3MCVA 1UP7A 2RCYA 4GMFA 5B1YA 1CF2O 4JBGA 4O1MA 1LDEA 1ZSYA 3DBVO 1KC3A 4G2NA 2RHRA 3UF0A 1SZJG 4XJTA 5A1TA 2VHWA 2W4QA 5IXYA 3JYQA 4D44A 3INRA 5I9MA 2ZYDA 4KZPA 3W4IA 4MO2A 3R1IA 3LF2A 3TPCA 5C7LO 1UH5A 3C3XA 3D7LA 3MJSA 4GWKA 4UVIA 2IE0A 5LDGA 2VZ9A 1N7HA 3C85A 3RU9A 1SB8A 3VPXA 4D41A 4NBUA 2AG8A 2O2SA 3RQSA 2G82A 4OYRA 5A9SA 5FFFA 1NQOA 4LSWA 1ZJZA 3QVOA 3FNFA 1LA2A 5G4KA 4CQMD 3RC9A 1NFQA 1VJ0A 3ICCA 4XYBA 3NRCA 2CMDA 1LRJA 3NX4A 4IUYA 3TWOA 3L9WA 3ROMA 2D5CA 4EITA 4J7CA 3SVTA 4I08A 3RBVA 2GO1A 3DQPA 2BH9A 2JHFA 2ZJ0A 3HNPA 1ULUA 4XYGA 1BG6A 1H5QA 1RM3A 1X13A 2D59A 4ZGWA 2D4AA 4UEKA 1WW8A 3E5MA 2I9PA 1D8AA 3CINA 3TF5A 1JLLA 3JQBA 3FTPA 1ZK1A 4AJ4A 1EZ4A 3QRWA 3A28A 3AUUA 3MZ0A 1P74A 4YAJA 1KEUA 4DPMA 1G0NA 2OP0A 2X23A 4AJHA 2PKQP 1EDZA 1RPNA 2ZB8A 4A27A 1O8CA 3IP3A 1LRLA 4CV3A 4YQZA 3GUYA 1IZ9A 4R41A 1PS8A 1KIFA 1VJ1A 3QSGA 1O95A 3NJ8A 4MVJG 4K28A 5EIOA 4UREA 2FZWA 5G0SA 4BV9A 3RCBA 3WYCA 1NR1A 1V3VA 1LDGA 5A9SB 5I7VA 3S55A 1XHLA 2G76A 2GZ1A 2Z1NA 2JFFA 4ZQGA 1NWHA 4J4HA 4DMLA 4DLLA 1RM0A 3V5NA 1P1FA 5BNTA 4LW8A 2C59A 1CIVA 2B4QA 2TMDA 4ND5A 1XKQA 1B0AA 1CRWG 3QLJA 4XGIA 1K0UA 3GK3A 2DVMA 2JKVA 3BTOA 4L8VA 4GSLA 4INAA 4QTZA 3V1UA 3D4OA 1ISHA 4BB6A 4WUVA 4BNMA 3AOGA 1WNTA 3BTVA 3DFUA 4J1SA 3DBHA 3VZSA 2B35A 1E1NA 4HX5A 5TNXA 4CMIB 1E1LA 1HZJA 3W8DA 4FDAA 4A73A 5DOVA 5L53A 2HQ1A 5JE8A 1JAXA 4CM6A 4FGWA 1BW9B 2BI8A 2I65A 4XRRA 1ORRA 3UN1A 3RAJA 5IDQA 5KVVA 3GVPA 4R69A 1AHHA 1IHYA 3D3EA 4IGFA 3AM4A 1UXJA 5T64A 1DIRA 3ONEA 1U2DA 5CEEA 4CPDA 1LDNA 1Q0HA 4YRAA 4NPCA 2AE2A 1PQWA 1EMDA 2JFGA 4OMUA 4AJOA 2RAFA 2QZZA 3AFNA 2JAPA 4Z0PA 3ADOA 1I30A 4PLFA 5TX7A 3T7EA 4U6QA 1EDOA 5AXAA 1ZK3A 3OIDA 1WAMA 4CLRA 1Q0QA 4IY1A 4KMSA 4U7WA 5TSDA 3ZW8A 2YY7A 1X0XA 1PU2A 2VUSA 5DBFA 4BO7A 3KEQA 4Z9FA 5CDGA 3HDYA 1XELA 2X58A 5TJHA 1NP3A 3PHHA 4PLVA 4P38A 1D1TA 4BNYA 3F4LA 3P2YA 1T4DA 3KO8A 3L6EA 5JO0A 1GV0A 2YUTA 3ZNQA 4OOFA 2CSUA 1P77A 3UICA 3VPHA 4DQUA 1Q1NA 3AJRA 3RVDA 4WKGA 3ZHBA 3HE3A 5CP8A 3OEYA 2AEMA 5LC1A 1A9ZA 1VC2A 1MX3A 1O5IA 4J7XA 1BVUA 2D5AA 3KBOA 2HMVA 4CLDA 2VWQA 5IZCA 4RQTA 3DBRB 1YB1A 4H15A 3TL2A 1Z75A 2IZ1A 2Y1OA 4FBGA 2NTJA 1R6DA 3O38A 3UCFA 1BVRA 2IXBA 2ZQZA 1WDMA 2FR0A 3E6AA 1XG5A 3TZKA 1SBYA 1QXSA 3NT4A 3F1KA 2DBVO 4DIBA 3FPLA 4XX0A 3VOSA 3MJ4A 3D5QA 1P9LA 1ML3A 2FPGA 3ON5A 3DOJA 1E5LA 4HY3A 2HK7A 4JXKA 3P19A 3NTQA 4FCCA 1U4SA 2BRUA 2UDPA 3H65A 1U8FO 5TRTA 3GG2A 1CWUA 2ILTA 1R0LA 1ADGA 3LC7O 5AVOA 4NJMA 2PA3A 3KOUA 2J5QA 5I8WA 4FGSA 3LDHA 3BZUA 1GPJA 5JO9A 4OXYA 4EJMA 5JS6A 3D3WA 3JQAA 4IGEA 3VAZA 4H3VA 4CR7A 3Q9NA 2EP7A 4E5NA 3IL2A 5U4QA 1E3EA 1P1KA 1O94A 5C3MA 2NLOA 2HRBA 3BMCA 3KLPX 3ROPA 2VN8A 3V2GA 5B37A 4J1QA 2E37A 3BYZA 4C7JA 5L7YA 3BMQB 3WSWA 5ITVA 3L9XA 3T4EA 4MIOA 2EGGA 1PJ3A 1ZVMA 4BNTA 5EJ2A 4BNZA 1U3WA 5A9TA 3EK2A 1PZHA 5DBIA 2P9CA 1BTOA 5CPBA 3PIDA 4L74A 3AUAA 4RVFA 4ALMA 3PTZA 2X7HA 4Y8VA 4QO8A 2DTEA 4I1IA 5I9LA 4DC0A 3WXBA 3TFQA 5IG2A 2GGSA 2IZZA 1V6AA 4NK4A 5T67A 4RORA 3E9NA 3IMFA 3OF2A 2G0TA 3DZBA 1BXZA 1I01A 1H6AA 4QEDA 3RBXA 2AG5A 3ZWNA 1Q2XA 5A05A 1XWFA 2B0JA 1H9AA 1V9LA 1V8BA 4J2OA 1TB4A 1G0OA 1VI2A 3EZLA 4GI2A 4W9NA 5AYVA 1B26A 4C4OA 3D3WB 3IKVA 4DQVA 3JQAB 3JYNA 4BGEA 1UP4A 3WGZA 1I10A 1UZMA 4B3IA 1LBEA 3AI2A 3D64A 3VTZA 4IDFA 2VTDA 1DLIA 2Y1CA 1YS4A 1ZNQO 4ZQHA 3BMCB 4K6CA 4BO6A 2PTGA 4XIJA 3F3SA 3S8MA 5KNLA 1YWGO 3KYDA 4CLHA 1U2GA 3VZPA 2HMWA 1RM4A 1E7QA 4KUHA 1BDMA 1FF9A 2YFQA 1HE3A 3VKUA 3F4BA 1DFGA 4DWVA 1C1XA 3AU9A 2Y1FA 2PY6A 3CPSA 2P5YA 1A5ZA 3ZCXA 4R1SA 4HFRA 1M6WA 3RJ5A 3D5TA 5DBGA 3IP1A 3NV9A 5U1PA 3WJ7A 2EHDA 2O48X 2WYVA 3WLEA 1IE3A 4OSPA 2XPCA 3OIFA 4WGGA 3WMXA 3Q2IA 4JN6B 2UYYA 2EG9A 1ZK2A 3I83A 1PJBA 5DZSA 3M6IA 1LDYA 2O4CA 1JN0A 1RYDA 3JYPA 4J1NA 3ZWXA 4YJGB 4Q3DA 5JFOA 1T2DA 3N74A 4PLTA 2A35A 5ES3A 3G49A 4LMPA 1ZK4A 3F5QA 1TVEA 1I8TA 3VH3A 1QYVA 4Y9DA 3ST7A 1ZCJA 2BGMA 2P9EA 4ZRMA 1PGPA 3HG7A 4M49A 1X7DA 2QX7A 4ZRNA 4BO0A 1PQUA 1YQGA 4PG6A 5TJ9A 1NNUA 3L4BC 3B70A 5TC4A 4GSKA 2LDXA 1QYDA 3PLNA 3L4SO 4DVJA 9LDTA 5KVSA 3PQFA 5DCWA 3AOEC 5IDXA 4KUGA 3OHSX 4RDIA 1YONA 3HB4X 4DREA 1B3BA 4HWKA 1HDOA 4YACA 3TOXA 4TKMA 1OC2A 1SMKA 3PHJA 4IXWA 1NHWA 3F6YA 4CJXA 3C1TA 1C0KA 5JAIA 5JCXA 3K96A 5HRUA 2I76A 1NWCA 3DC2A 1HYHA 4UEOA 5H81A 1Q7GA 4MKXA 3PQEA 5CFZA 4WPGA 3EHEA 2VTEA 4J91A 3QWFA 1E1KA 1G1AA 1GAEO 2WD7A 3V2UA 4IS3A 4I9UA 2SCUA 4OQYA 1ADCA 2RIRA 1MFPA 2JD0A 3E48A 3U4DA 3VDQA 1LNQA 5IAAA 2YHIA 3PYMA 4Z0TA 4XA8A 3GGGA 1UXGA 3IC5A 1QKIA 2GASA 4QFDA 4MINA 5BSFA 4MKZA 3VPGA 5JC1A 1YJ8A 2H5LA 1KEWA 3P7MA 4R5HA 2PGLA 2FPPA 3IJRA 4CUJA 1P31A 1U9JA 5KVQA 4ND4A 1S7CA 3GY0A 3H5NA 3FRJA 4BHTA 2FSVA 1I33A 5CDSA 5JW6A 1Q7CA 4N7RA 4ND2A 5CHEA 1T2EA 5A9RA 3M2TA 2W98A 1ZMTA 4MVJE 1E7SA 4OGWA 2A92A 4RLSA 3IDSA 5DDIP 3RWBA 3AY3A 4L9RA 2NVUA 4QECA 4TRNA 1TT5A 3H7AA 3ZU2A 3OJFA 2P68A 4IM7A 1DC5A 3ICPA 4IDCA 2WWRA 4F3YA 1IOLA 1LTHR 1MXHA 5F5NA 5FI3A 4EW6A 2WTBA 4NU6A 4J43A 5KJFA 1NX6A 2ZJ1A 1EVZA 1R4NA 4WCFB 3UH1A 2PKRA 3AW9A 3FNGA 3S2FA 1ZSNA 1GU7A 1K6XA 1KERA 1PZEA 1BRMA 4FC6A 3RJ9A 4QUKA 1UXIA 2C2XA 1H0KA 4II2A 5KCZA 3EMKA 2VRCD 5L7WA 4D79A 4BNLA 4D0SA 1D1SA 2FWMX 2GD1O 4IJUA 2C07A 4FJ2A 4KOAA 3R0IA 5TQVA 4RVUA 3WIEA 3E03A 1GCUA 3PK0A 2ZKLA 3ULKA 4W4TA 3ONDA 4FFNA 1X1EA 4KTVE 4FFOA 2DUUA 1D3AA 2EKPA 3Q6IA 4RLHA 3FR7A 4R54A 2C5EA 1E6WA 1JW9B 3GMDA 4W7IA 4WOKA 2Q2VA 1NVMB 1Z7BA 1E7YA 1F12A 4B4VA 4YJFA 4BNIA 3IUPA 2PD4A 2NVUB 4LCEA 5C7IO 1MC4A 4JROA 4B8WA 2YDYA 1NFRA 2Y05A 3U49A 4GX0A 2V6BA 3LT1A 3OJEA 3B1KA 3UGKA 3VH1A 5IN4A 5DCUA 4Z0HO 1HDYA 3V8BA 1U7TA 5K6AA 2HCTA 1QYXA 1ZBQA 4JK3A 4Q9NA 4XYEA 1H6BA 3O8QA 5F1OA 2NVBA 4WNIA 5EL0A 2HK9A 1GUFA 1VM6A 1SC6A 3ETGA 1M67A 2I66A 3GVCA 4H16A 4E31A 1GUZA 1ADFA 3FWNA 5JDIC 5G0WA 1DRVA 1I3NA 5L4NA 1ENZA 4EYEA 4CV0A 3R3JA 2O3QA 4PLYA 3KSUA 3GZ4A 4W99A 3QWHA 4MVJD 2QQ5A 3V1TC 3GHHA 1PGNA 4CM4B 3FWZA 1BWSA 4F6CA 1UZNA 1PZFA 4E2YA 1ONPA 1TA4A 3GAZA 3PP8A 4MJLA 4O0LA 3ZWVA 4A03A 4NJOA 3GNQA 4TKLA 5AXDA 3JQDA 4GPD1 4CM9D 2X1HA 2CF6A 4OO3A 2PD3A 1SOVA 4ND3A 5AQ1A 1B14A 2X5JO 1HDXA 2PZMA 1I3LA 3GDFA 5JAQA 3BAZA 4IZHA 3U4IA 4Q39A 2Y66A 1DSSG 1YOVB 1Y7TA 3PFWO 3FPCA 5ER6A 1DRWA 2I5PO 3ZV4A 3M1LA 2DBQA 3JD3A 3QA9A 4TSKA 4AJ2A 5JC8A 3I5MA 5F1KA 3ZWWA 3NGLA 3JQ9C 3I6IA 3H9QA 1EK6A 3OM9A 1ZEJA 4DTIA 1ENYA 2YJZA 3QQPA 3RUEA 2A9FA 1GUYA 2NV6A 1GYQA 3MTJA 4XIYA 4XD2A 2GN4A 2DC1A 5BSHA 2HMTA 2X9GA 1GQ2A 3VTFA 3QWAA 1EVIA 2X5OA 3HHPA 5CDTA 2B69A 3JSAA 4EUHA 1I32A 4IJKA 3K5PA 3Q11A 4RF3A 4CM8A 2GUGA 2FY8A 4DPKA 5I8ZA 1U3TA 5T8KC 1FXSA 1H6CA 3TSCA 5JAMA 4UULA 4DLAA 4CMAA 1ARZA 3BMOB 1P1RA 3GA0A 5LCXA 2VHZA 4BS9A 4OOEA 2R00A 3MJTA 4ALJA 5J23A 3GHYA 3I9KA 3X2FA 3RC2A 5FWNA 3QVSA 1Z6ZA 4X54A 2NTNA 3HADA 1PL7A 1MC5A 4NFYA 2P2SA 3ENKA 5F5LA 2AQHA 3VVBA 1XQ1A 1MG0A 4J16A 4A7PA 2XXBA 1EE9A 1P3DA 2WYWA 1L7DA 2I99A 3BHMA 3H3JA 4B4OA 1DIAA 2FSSA 1DRUA 2AW5A 4MIYA 1BXKA 2QIOA 4Y98A 3H8VA 1XDWA 3RFTA 2CVZA 5EPOA 1I24A 4WLNA 1HTBA 3KTDA 5A3JA 2VYNA 2JD2A 4WASA 1WPQA 1LLCA 3VDRA 5DCYA 3WR5A 4AG3A 1HYGA 4YA6A 3WGYA 5CDYA 4BNWA 3B1JA 4B3JA 2Q2WA 1DJQA 4DMMA 1C1DB 4CL8A 4MP3A 4NG5A 4WOJA 4UUOA 1LJ8A 2VHYA 2Y1EA 3LC2O 1WZEA 5HTOA 4QXMA 4E2WA 2GF2A 3OECA 4GX1A 4GQAA 3CXRA 2C5AA 3ZZNA 1A7AA 1KYQA 4IS2A 1WXDA 4B7XA 2CD9A 4U0JA 2GDZA 1GADO 1HDCA 2D2IA 4P4NA 4RQUA 1PL8A 4YDRA 5G0UA 3GLQA 2X0IA 4P22A 3EW7A 1VJTA 2LDBA 1R12A 4BNVA 3L0DA 1MFZA 2G5CA 5ENVA 4KDFA 4U0KA 2VOJA 3OMLA 1J6UA 3JQBC 2HK8A 3RUAA 3PJFA 4GL4A 1WDLA 3B6ZA 4D45A 3OICA 1HWYA 1ID1A 3SJ7A 4F6LA 5ITWA 4BGIA 5AXBA 1PGJA 5DT9A 4EEXA 1XIVA 2C82A 1K3TA 2PR2A 3L6OO 3PEFA 3X2EA 3ZWOA 4TROA 5G0TA 4AJNA 4GMGA 1OC4A 4CMEC 3RSHA 1T24A 5FI5A 1U4OA 3C1OA 5JCJD 1W8DA 3DBLA 3PWKA 1Z45A 4KQXA 3EUWA 2AQIA 1VE9A 2J5RA 3INTA 1BMDA 4UUMA 1DLJA 4DRYA 4ILKA 5BQFA 1JVSA 4QQRA 2NSDA 1I2ZA 3I1JA 4BNHA 3GDGA 1SNYA 4GGOA 4RPLA 4WLEA 3VH4A 4BNGA 4PLZA 4WEOA 4AICA 3WG9A 4CLEA 2DFVA 1EFLA 5CPFA 2NTVA 1KVTA 1LQUA 4R3WA 4DIOA 3DZIA 3U9LA 3PJEA 2EKLA 1I3MA 4CV2A 4BGVA 4YAGA 1N9GA 2D1YA 5G4KB 3L07A 3LF1A 4JIGA 2DAPA 3DZFA 3NJ4A 4YEDA 1Y9AA 1P33A 1ZZEA 3I52A 1CETA 2RH8A 2WYUA 3LT0A 4MP8A 3WTBA 2ET6A 3A14A 1HE5A 3SLKA 1PQPA 4RF4A 3VKVA 2J8ZA 3ASVA 2W90A 3PJDA 3TJRA 5L4LA 2JCYA 3NDIA 4CUKA 2E49A 3I9JA 1ZJYA 4BO8A 2ZTVA 3LZ6A 3GEMA 4L76A 3NTOA 2VZ8A 2HJRA 5DNAA 1MG5A 4M55A 3LLVA 2VHVA 2OGUA 4MVJP 3BMNA 1UZLA 4JBIA 5DOZA 4JCOA 4MIEA 3E9MA 4PIVA 2BFPA 1GZ6A 2HKIA 3TZCA 2J3KA 3ZWCA 2BI7A 2P91A 1QG6A 3M2PA 1XYGA 2CFCA 3S2EA 4R51A 4FB5A 3KVOA 1UXKA 1T2FA 2ZCUA 2Y0EA 2ZATA 1TLTA 4ESOA 3K92A 4XB2A 1KS9A 4W82A 4CL3A 1MV8A 3W6ZA 1NVTA 1J49A 3U3XA 2IDZA 5KJ1A 1JWAB 1N9GB 2H63A 4QSMA 1B8UA 1Y8QA 5IN5A 5L3ZA 1LX6A 1PJQA 3GNTA 4L4RA 1TI7A 2AMFA 3WIDA 3JD4A 3CSDA 1H2BA 2VNSA 1AHIA 1XU9A 4XDYA 2DPHA 4UVHA 5I7SA 3MJEA 3ZHZA 3LLSA 5TS3A 1CERA 4BO5A 3WFIA 3WSVA 1B8VA 1EQUA 4YAKA 1ZW1A 1XLTA 1KBZA 2DBZA 2QYTA 1C3VA 1U28A 4BMVA 3UOGA 1ONOA 3DBHB 3AI3A 3K73O 4LRTB 2OZPA 1PWXA 3PGJA 3BIOA 1AGNA 2Y68A 2A94A 1DOHA 4Z9XA 4WK6A 2JD1A 4HBGA 5TF4A 4CMGA 5CEJA 2VWPA 2WD8A 5JNLA 3Q3CA 5U9CA 4ZHSA 5KJEA 5MDHA 4OM8A 4TRMA 2FHSA 4CM7A 4HNHA 4CLOA 5B4UA 2H1SA 3DTTA 2NM0A 3NKLA 4CM1A 2GRAA 4XYLA 4O63O 4BQRA 1XR3A 4CLXA 3D0OA 3O9ZA 2VYVA 3JQ8A 3MJVA 4NU5A 1U3UA 2CDAA 1C0IA 4CLRB 2JFHA 2WSBA 3EYWA 1IPEA 1HXHA 1E6UA 4DLBA 2DBRA 1FDUA 4TZKA 4BNFA 4ALNA 4WCDA 1HE2A 1K2WA 1LLQA 2BMAA 4LSMA 4U5QA 1OZAA 4BNNA 3WWZA 1P1JA 2NNLD 1UDBA 3OJ0A 4LMRA 1PR9A 3T7CA 3FBGA 1UDCA 1QR6A 1W6UA 3PZRA 2JHGA 4NBTA 1H6DA 4ALIA 3CZRA 1Q0LA 2V6MA 1PJCA 1NQAO 4BO3A 4GWGA 4I9NA 1OFGA 4M86A 4WLFA 3GN2A 4N5LA 4IJWA 2VHXA 3HN7A 5T57A 4HP8A 1C14A 5BNIA 3I4FA 1I2BA 3GRKA 2VCYA 2XAAA 3HUDA 3OEWA 4BKUA 2YV3A 1UR5A 4TVOA 3MTGA 1E3LA 4H7PA 4CLOB 4BNKA 2X22A 2NU8A 5MGBA 1GQYA 1DDOA 2Y99A 4IQ8A 1HSOA 2J3IA 4B79A 4RF2A 1XCBA 3IS3A 3JD0A 3N7UA 1HLPA 4W9NC 4YWJA 1D7OA 2Q50A 3TDKA 5ILOA 4KWHA 4E3ZA 4J2HA 1PGOA 3GEGA 1R4MA 2W2KA 1GEGA 2ZYGA 5H82A 2ZIZA 4I5EA 1YDWA 1MXFA 4W6ZA 4AJLA 1KVQA 4FC7A 4NJMB 5EMHA 3ETDA 3HSKA 1VL6A 1Y81A 4FPXA 4NR0A 3U09A 1T2CA 3A9WA 4G81A 3WBFA 4DA9A 2Q4BA 3CTMA 7ADHA 1F14A 3A4VA 3PI7A 2EEZA 4ZQEA 2CZCA 4HUJA 3GT0A 4D0RA 5A04A 3L77A 4EUEA 5FYDA 1I3KA 5AOVA 4EEZA 5KTKA 1XA0A 1NM5A 3R6DA 3D4PA 4HFJA 4F46A 1Y5MA 1CQIA 2VT3A 4P8RA 8ADHA 1OAAA 2BD0A 3K2EA 1OI7A 2Y1DA 4R4JA 3WGHA 4FFMA 2ZQYA 3OIGA 2EW8A 4BO4A 3DHYA 1VKNA 1J5PA 1GFSA 1VLLA 3FNEA 1JKJA 2DQ4A 5I7EA 1DIBA 4Z3DA 2OP1A 3ZV3A 2VZ0A 4NNJA 1T4BA 2H6EA 3DB2A 4NBWA 2FR1A 2EGHA 4E5MA 2FPIA 5F3RA 4FIZA 3F46A 1HLDA 1NYTA 3ZV5A 3FNHA 4JLWA 4IDEA 4IBOA 4OXKA 1R4MB 2W2KB 4LGVA 4QFCA 1LSUA 4IDBA 4ITUA 2BELA 4I5FA 2XF8A 1YJQA 3TNLA 2B83A 1ZO8A 3DMTA 4OKNA 4YCAA 1TEHA 4TVBA 4AFNA 4IZIA 3KHUA 3WGOA 3JQAD 4OKIA 5K0ZA 3GN1A 1PTJA 2D8AA 4O6VA 2F00A 1O9BA 4URFA 1LSSA 1T1SA 4D3SA 3ZGYA 1DAPA 1FMCA 5COQA 5G0VA 1X15A 3WYEA 1KOLA 2HSDA 4KDEA 4DXHA 2PGDA 1XEAA 3I6QA 3RUDA 2PK3A 3KYDB 1YB4A 1AXGA 1NPYA 3QVWA 3WGTA 5LDHA 4WCFC 4GH5A 1JVBA 4ALLA 1C1XB 3UCEA 3WX0A 3RUCA 3TOZA 3Q9UA 1ENPA 2OOSA 1K6IA 2C54A 4LISA 2PV7A 4IPTA 3PYXA 1JAYA 2AXQA 1MA0A 2IXAA 1WZIA 3RUHA 4UUPA 2Q2QA 1NFFA 3ORFA 3TQHA 4I5DA 3L4BA 4WLOA 5JBIA 2AQ8A 1ULSA 5TT1A 1Z73A 2Q1UA 4Y6RA 1HYEA 3I9OA 3KSDO 5FF9A 3S2IA 4W7HA 2O4UX 1YQXA 4YR9A 1YQDA 3DFZA 2YV2A 2CY0A 4GGPA 4EBFA 1NASA 5GMOA 2Y93A 1E3SA 2Q46A 4R9RA 3WOHA 2B4TO 1F8FA 2NWQA 3UFXA 3OJLA 4D3DA 2P9GA 3JTMA 3U62A 4YRBA 3H9EO 1A27A 3I3OA 5THKA 3TL3A 2W2LA 1QYCA 3C7DB 4K1LA 4RVDA 4B7CA 1PWZA 5ENDA 5EQFA 4BKRA 4WE3A 4J4TA 2O7SA 1A4IA 2R2GA 2UAGA 4UAGA 4YQYA 3WTCA 1AXEA 1DIGA 1B16A 1U5AA 3PXXA 4LCJA 1R15A 1IULA 2IEBA 4HFNA 1P1IA 1A72A 1N7GA 3OP4A 1A4UA 1DEHA 4WNCA 3UXYA 1ISJA 4DPLA 3F1LA 3VHRA 3PLRA 3FF4A 1MGOA 2I3AA 3KYCA 4XCVA 5TT0A 4BKQA 3IJPA 2WD7B 3H3FA 2CVQA 3LYLA 4KP7A 4N54A 3CUKA 4PRKA 4AJEA 3WWYA 3KETA 1KY4A 1M2WA 2D3TA 1VSUA 3U5TA 2YHIB 1ZH8A 1DHTA 1SEVA 2PZLA 2NADA 3U4CA 3S1LA 4RGBA 4PLCA 4OL9A 2I3GA 3AK4A 4E0BA 4E32A 3AY6A 4CQLA 4R68A 5ER9A 3WNQA 4LVCA 1P45A 2HUNA 2WM3A 4CMCA 4OJNA 1T1RA 3ZHYA 1GEEA 3BHIA 3TZHA 4E2ZA 3DZJA 5JPIA 3F47A 2OBNA 3H4VA 1LDMA 1TXGA 1ZXLA 3JD2A 5TGDA 2CF5A 5DP2A 3JV7A 4OSOA 3ZWYA 4BV8A 5HS4A 2B4RO 5CG1A 5JSFA 4XGNA 3RC1A 1TT5B 5K6AC 3PDUA 1RJWA 2YYYA 4PFJA 1JU9A 4Z3KA 4Y67A 2BKAA 4FOOA 2X0RA 4LRSB 1M76A 5L95A 1GR0A 3DHEA 1JWBB 3LT2A 4RPJA 1A7KA 1R4NB 1C0LA 3MOIA 3ZNPA 3G1TA 1K89A 3ZU4A 5L40A 2GR9A 3EAGA 3RUFA 4E30A 3GZNA 4UUNA 4XR4A 4ZJUA 4YBZA 5G4LA 3SBOA 3G79A 4TWRA 1ZIDA 4IQGA 1HDRA 4PVDA 3AI1A 1BXGA 1F17A 4AJIA 2BFAA 2Q1TA 4PG5A 3VZQA 1LC0A 1IL0A 2PNFA 2J3HA 5C7OO 3SJUA 2FOIA 1N1GA 3ENNA 4TQGA 3WQRA 4TRRA 2CUKA 2B36A 3UCXA 1E3WA 4NIMA 4IDGA 4AJ1A 3BTUA 3OA0A 4YJFB 2AQKA 1A9YA 1PZGA 1YO6A 4R9SA 4YT5A 1RM5A 3NGXA 1Z82A 3E5RA 3H6KA 2PH3A 4NMHA 4RPKA 4E13A 6LDHA 3OA2A 5C37A 3K2BA 5DP1A 2CNBA 3V2HA 3FBTA 4EJ0A 1GV1A 4DGSA 1H94A 1NAIA 4HNGA 4MOWA 2RBEA 2IEDA 4ZICA 2O3JA 4E33A 3I9NA 4JJGA 5IFLA 3DO5A 3IIEA 2TMGA 5GZ3A 1ZK0A 3VPFA 2FZEA 3D1LA 2FP4A 3CMCO 3GFBA 1WMAA 3GMSA 1UAGA 4LN1A 1PJSA 3A1NA 3E18A 4BVAA 3GQVA 4YVFA 4GLLA 3HDJA 4G65A 3O8QB 4CQMA 4BL5A 1VSVA 5HS6A 2FR8A 4UVEA 2HLPA 1U1IA 3GAFA 4QT0A 3PHIA 2DU8A 1BXGB 4J49A 3RKUA 2CVOA 3DAFA 1PS0A 3OJOA 2EF1A 4RPHA 2R00C 2Y1GA 3QWIA 1JQBA 1HL3A 2IRWA 3WBBA 4OHUA 4OXNA 4CODB 4EGFA 5BT9A 2VT2A 4XR9A 1N92A 1GYRA 1X14A 4PLWA 2GERA 2O3UA 3GFGA 3JQ9A 5A3VA 3IOYA 2BFOA 1YKFA 2C0CA 3DHNA 3PHGA 4IIUA 4CMBA 1IPFA 3ROQA 3WQSB 3KXDA 5JDCA 3JYLA 3H5RA 5DN9A 1CYDA 2J6IA 2Y67A 3TN7A 1H2HA 3INGA 5BR7A 8LDHA 1E92A 3CZMA 2C7GA 2DFDA 1EUZA 2WE8A 3O26A 4MVJI 1C0PA 4ND1A 2OXIA 5GZ1A 3W8FA 4II3A 2JL1A 2X4GA 5I9NA 3HN2A 1OBFO 2NVWA 2OO5A 3M1AA 3RFXA 2XXJA 1XGKA 2DUWA 3CIFA 4K9DA 1O89A 4AL4A 5ICSA 4ID9A 2OBYA 5JYEA 1NBOA 4BQPA 2Q4EA 4BMSA 4CQMB 1BGVA 4U6SA 2Y0CA 3AU8A 2NACA 2EV9A 3GGPA 3RKRA 3K30A 3VZRA 3PJGA 3JYOA 4CMHA 5ADHA 1HKUA 1D4FA 4XEHA 4CM8B 1EBUA 3P5SA 4YT2A 3ZNOA 2GN9A 1LI4A 1X7HA 4DYDA 4BNJA 2PH5A 2V7PA 3F5SA 4OQZA 1NTOA 3ZU3A 3DL2A 1EVYA 1DO8A 4B3HA 4M54A 2NU9A 1E7WA 3HB5X
chains in the Genus database with same CATH superfamily
1GDHA 5EHQA 2B1JA 5AJYA 2MSNA 1L5YA 3JQFA 3RVLA 1G20A 2R5NA 4QGBA 1T2NA 3C8DA 4HD8A 5CA1B 2IP1A 1K8QA 1K92A 1Z6AA 2YS7A 1BU5A 2MHCA 4GRIA 1PEAA 5FPHA 3VSDA 4EPTA 1V6CA 1YD7A 2UZ1A 1Z18A 1GILA 1N5IA 1A96A 3N8GA 4AZ0A 2CWDA 2FZ4A 1MH1A 2WJHA 1E79A 2J3LA 3FHLA 2X0FA 2H5IA 2QMZA 3AWDA 3FM9A 2NUAA 3IJEB 4H4CA 4Y2PA 1OLUA 4FW9A 3TIFA 3PTAA 1U0HC 2C0QA 4I9HA 2IUFA 5BNFA 3UWOA 1NW9B 4C4AA 3HB7A 3ADBA 4RV4A 1AM4D 1XRMA 3FN4A 2HX1A 2O2IA 1WCYA 2HFKA 1DQRA 1X8XA 1QMGA 2PG3A 3LK7A 1ZM9A 2ZYAA 5AUOB 1BQEA 2GN8A 3UHOA 4RE5A 2H7YA 3QLEA 5ALZA 1L4UA 1ZCZA 2XRMA 1GCOA 2Q7XA 2X2OA 5EZYF 3R9KA 5AUQA 3WNVA 3JQEA 1O57A 2XZPA 2ZQ5A 3E3OA 3Q2KA 1GQQA 2W2OA 4DTCA 5KQMA 3TNYA 3E53A 1OWMA 4FX2A 3VO9A 2A4KA 4E12A 3WGKA 4NCHA 1Z26A 2QV7A 3ADKA 1H2EA 5TE9A 1ZRHA 3IFSA 1VE3A 4PGFA 3T5MA 2NXEA 1SZPA 4AJ9A 2GHQA 4ZQBA 1S89A 4A10A 4NDNE 1V1RA 3CW8X 4MRPA 1ETHA 4RWEA 1ESZA 5CW1A 4IX1A 3CKKA 4C5CA 1JH9A 4ZQCB 5DLPA 3I64A 3L06A 3NVMB 3V33A 4OHOA 1M1UA 4G4SO 3KQUA 4K8OA 4YREA 2YN4A 3HQ4O 3MMXA 5E95A 5I9TA 1BW9A 1PN3A 3SBDA 4YB8A 2PLFA 1UAAA 1V1JA 2HZBA 4CMEA 3AF4A 4CVNA 1QHHB 2IP2A 2P5UA 1L5VA 5KIAA 3GFOA 2OMKA 3CE6A 3LT4A 3K0KA 2H1OA 5EIHA 4ZWNA 4JP2A 1B2LA 4MNTA 3V8MA 2GK3A 5L7TA 1UL1X 5AESA 1J0BA 1CKEA 1J2JA 4PX3A 3KX2A 4D9MA 2N75A 2AG6A 3GUZA 4Z99A 1M74A 2G6BA 3E9EA 4O4LB 1XRJA 1ZJJA 1B41A 2X5KO 3C6BA 1M2VA 3ZWBA 3P20A 1SQSA 2BE7A 2ODAA 4QPCA 4FFVA 2P6NA 1G6HA 4YCDA 1OV6A 2Y8EA 3RO7A 2JVJA 2WTAA 1LK0A 3VR4D 1HT0A 3FOBA 1FFBA 4P1ZA 3OU7A 3TTWA 4HLUA 3MRSA 1L3BA 1WEHA 2O50A 4RJ2A 3SVZA 2IZ0A 3FAZA 2FPWA 2XYQA 4YUZA 2OZEA 1NXQA 2JI7A 1HG0A 4XM1A 2JFOA 1U8AA 2ST1A 1WCIA 3QM1A 1T2AA 1GPDG 3HEBA 3H3XA 2ZYRA 1PT9A 2FG5A 2E18A 1QR2A 3LX6A 3C7CB 1R74A 2WIGA 3C1AA 3D6UA 3F96A 4GRAA 3T3PB 4A5OA 4RENA 5EJEA 2HOQA 3FTEA 4H6PA 2EATA 2Z95A 5CURA 4Q3NA 4R2IA 4BX8A 5C35A 1YS2X 3RRZA 4UDNA 5ADUS 2GNAA 3AKEA 2HZ7A 4KXWA 1C3JA 3G82C 3NEYA 1B6TA 1P0FA 4Y9RA 4BX0A 1H2AS 3HMKA 4QTTB 3ZZTA 2Q3DA 3FCXA 3GCWA 4JQZA 4CNQA 2EERA 1P4SA 2AEEA 3AHEA 3NC0C 3PWSA 4RK4A 3HGQA 1FFWA 3KZVA 1E6EA 3AX6A 4KX3A 3K1YA 9ATCA 2XBMA 1J23A 1XQYA 1E1QD 2INGX 3N28A 4K05A 4RIGA 2IGTA 4S3MA 4YGYA 1GKIA 7MDHA 5K6RA 1PDWA 4M1TA 1U0FA 2TSYB 3OETA 4GOJA 1ZGZA 3W79A 4KPEC 4P98A 1X6VA 4RSHA 5FBHA 3NEAA 3HCDA 5EWJB 3RROA 1IQ0A 1JTVA 3KUCA 5LU8A 4PG8A 2YQ5A 2BMWA 1BSVA 5AK0A 1YA8A 4R2JA 4RHUA 3W2TA 2AEJA 5BOSB 5IZCC 5EINA 4KREA 1E2KA 5KTRA 3D2BA 5LQJA 3SX4A 1VSTA 2NXJA 3D3QA 2KJQA 4F45A 2C04A 5I7FA 4RPGA 1I2CA 3L7MA 1NRJB 1J25A 1O6GA 3HFRA 4CV1A 3OFND 5CAEA 4BE7B 3A06A 4PRYA 3GIDA 4KWIA 3GVHA 3KB2A 2W42A 2R4TA 3ELBA 1YBAA 2C5FA 5TPZD 4CIDA 4EDFA 2VXBA 3D4IA 4GZ3A 4JLDA 2GPSA 4RJTA 1L4LA 2DCMA 4MVJF 1VL2A 4YASA 4UEJA 4M0UA 5AK6A 4TYWA 1R37A 1F06A 4XGQA 4ZYXA 3CX7A 4CF4A 5CBPA 4OVKA 3BAFA 4PTZA 1SPXA 1JXMA 2HMSA 4RK0A 1CZHA 3T0GA 3TEMA 3LGAA 1FDOA 4Y2XA 2JH8A 3RSFA 2QPAA 3CCCA 1NVKA 3T7SA 1AN0A 3FJOA 2W6PA 4LJLA 5AM5A 4DE5A 2YY6A 1Y8QB 2AJ8A 2WE7A 1JJVA 3BMQA 3T1HB 4U2DA 4QQ8A 2MCFA 2W6NA 3ZD9A 1Y5RA 4LGYA 1PR1A 1OCEA 2JZCA 3MIZA 3NOQA 3R8XA 5PGMA 5JZVA 5FPYA 4NRDA 1QB7A 5K2OA 1EFRA 4S1WA 1QC5A 4TWAA 1T9CA 4G8DA 2REQB 4ZYVA 5BW6B 3GP3A 1O94C 3ZGNA 1IUKA 5JQGF 1YL6A 2MJLA 2VP3A 2G80A 4XTCS 2EKQA 5KWEA 4YI5A 4CEIA 3KJQA 1DIOB 3OKFA 1K3UB 3KSZO 4OQMA 1PR3A 5F2KA 3D31A 4YRDA 1UPAA 3ZXIA 2VHTA 3PRJA 4PAQA 4Y9SA 4ZT4A 2RHCA 2IVZA 1XRLA 4C2TA 5KYYA 4B7UA 2BC9A 5JVDF 1A9RA 5A03A 2AYYA 2CJPA 1P17A 3G0OA 3GT7A 3SXPA 4DB2A 1EYZA 4Q03A 2CLCX 4GMHA 2R2AA 2XNCA 1NLUA 1S4MA 3NXKA 4DV3B 4OF4A 3HJAA 3MK31 4Q3AA 3CNOA 1YXMA 2JGKA 1Y42X 3D6JA 4R31A 3S2UA 4D81A 5FX2A 2BYTA 3AEKA 1VA4A 2VPIA 4I2NA 3ZLUA 3GH3A 3QJ5A 2NU7A 2WZDA 3F7MA 4D7AA 1WPRA 1J0CA 221PA 2Q45A 3OKCA 1KZ6A 3TM4A 4PHGA 1CRQA 3BXZA 3I2FA 3I6YA 1X0VA 4M3NA 2H1RA 2OTCA 4TRJA 5KNDD 4YIHA 1JHVA 3ELYA 4AO7A 4B3MB 1NLMA 3G3EA 2FX2A 1S2IA 2YBEA 1LU9A 3EBPA 4G97A 4KHZA 4ROTA 4UU7A 4C78A 5BWCA 3U4QB 3CURA 4GD3Q 2IY7A 5JHHB 4LRUA 4G1FA 4RIEA 3TW4A 1PZMA 3ILSA 4YCNA 4PXAA 3IVGA 4TUYA 2DGDA 3AVTA 2Q21A 3MWEB 4QG7A 1X7WA 1PVOA 1KS2A 1XFAA 1EXMA 1W59A 3HRHA 1IXSB 2D54A 2Z5FA 3BFXA 3M6VA 1R9JA 4NENB 1LSOA 2G8NA 1L8OA 4YAEA 1EQAA 2EZ4A 2IYOA 2IPXA 1N6HA 2EXXA 5TVKA 3ABQB 5CIWA 3F6PA 5T4HA 1TEXA 3EQ6A 2FN4A 1NM5C 3HY3A 2W8ZA 1J8FA 3ED1A 3HYSA 1DEXA 3L8MA 3LY5A 4MZXA 5BN4B 2IV2X 4TLEA 5HBRA 1GA6A 1NUPA 4M7RA 3K1AA 3DTNA 4B17A 3L6DA 1B15A 1N3BA 2FW6A 4JC8A 1EIZA 1HKHA 4GEGA 4QBGB 2WNIA 4PANA 1T5OA 3LQFA 1L2TA 4E08A 1OI4A 2BZ1A 3O4IA 4J0EA 5FRDA 3IPAA 3VKFA 1ZJ5A 2GI4A 3DKVA 3W06A 4AU1A 5FPQA 1GRRA 2HA6A 4LE1A 4FFRA 4KPGA 4B35A 1VTKA 4YHBA 4G26A 3DJYA 2WQ6A 1U5BB 2IXFA 1JR2A 3QKRB 2BFDA 3K6KA 1XF9A 1L7EA 3FSRA 1PJAA 4KUEA 1QRRA 1RSZA 3R5JA 1MABB 1UK6A 4HAWA 4GEKA 3ZNNA 1C80A 4NQZA 3NDPA 2BEWA 2IPNA 2I55A 5K8LA 3Q15C 1P0PA 2XOKA 5DWVA 5LPNA 4F84A 3N8IA 1VXRA 2NU8B 1Q20A 2DPMA 1C7QA 2PJZA 1T5HX 3ANLA 4B4WA 5JXWA 5LUAA 4G0UA 1N8TA 2NP6A 1C7EA 1XB2A 4DBVO 3VSAA 2QT0A 3E22A 3MMPA 1KDPA 4XDZA 2VF4X 5AW1A 4E6PA 2C3OA 3NAQA 4ZKEA 1LPPA 3AFOA 4ZEWA 3AHIA 4PAOA 3LBYA 4Y0VA 5K3AA 1K7CA 1ENOA 2EDAA 3BCHA 2NU6A 2ZSFA 3DR3A 3GFSA 4QAQA 5FBKA 2DRIA 3TFOA 3I2JA 1HE4A 2VSXA 1PGQA 2J4DA 4U8HA 2IS2A 1S0UA 1E69A 3CLSC 4TLBA 3KUXA 4MAMA 4CM3A 4DG8A 1GD1O 3KS9A 4M0DA 3UC5A 4B3GA 4F2GA 1R8YA 2Y0DA 3B8EA 3K9WA 1T3ZA 2JRLA 3HFGA 1LDBA 3P9CA 4H7JA 4MCHA 5D87A 1DC3A 3VNSA 4NONA 2HA4A 3AL2A 2F9FA 3MG9A 1JIIA 4JGBA 2WIJA 2X9VA 1LQ2A 2P62A 2AKAB 2EARA 3GGDA 1GPWB 3R6GA 4KN8A 2XNDD 3RBZA 3ROXA 4MKRA 4EBBA 3HA3A 4CTKA 5BMVF 1MUUA 1SN7A 1U2PA 2PYZA 1AGXA 2VXOA 3DS8A 3PC3A 4LDZA 4NJEA 1C9NA 3SQOA 1JEJA 4MUNA 1CQIB 3I34X 1M33A 1TO6A 5IC5A 3AQ4A 1D5CA 1PHRA 3KD3A 1IIBA 2R5FA 2ZTMA 1DJNA 1PKEA 3H2SA 4DXDA 1Z5PA 4ZZ1A 1G38A 3LHKA 2G9VA 5GJBA 2BFMA 4Y2HA 3UAZA 4OQDA 4PF1A 6ADHA 2FW8A 2QWXA 3IO3A 5A5FA 5J1SB 1U3DA 2FQQA 3GAAA 3L92A 4MS1B 4UZFA 3AV0B 1I80A 4RL6A 2ZSKA 2ZITA 4K3UA 2ALJA 4W1SA 5G3ZA 3I92A 4MV1A 3VXKA 1NMEA 3WMFA 3MCZA 4ZCIA 1C5KA 4TWIA 2M6LA 1N2CA 3G17A 4PN3A 2CMGA 2FPIB 2DKFA 4H7KA 4F4IA 1TM7E 1RPJA 4WZBE 3QV1A 1PG2A 4L9WA 3JQQA 3MS2A 4HBZA 2FFAA 2N42A 2FPOA 2H08A 1GTMA 2JH3A 3GF4A 4L0QA 1OAKA 1T8WA 2GSWA 1PFKA 2OILA 1BDIA 1B7GO 2BFWA 3FB1A 3MS7A 3PR1A 1FPQA 4GOXA 1P2GA 1DPGA 2YRWA 4L15A 2V54A 3AEUB 4OXXA 1VCIA 3O3NB 4WKBA 2X40A 3DONA 2BGLA 3VHXA 2QXUA 4H27A 4ARZB 1S1MA 1D1PA 4M8NE 1A4RA 1UXHA 4D8TA 4DMCA 2PANA 4ECEA 4YDQA 2B37A 2YZMA 2ZCVA 2B9EA 5B3JA 1KKLA 2IZ6A 4GI5A 1ZM3A 1DQNA 2QD5A 5HA5A 5GONF 4YRPA 3DLHA 4ZAGA 1CSEE 2ZYWX 1X87A 4KPYA 3EFBA 5DYYA 2H54A 2VUTA 2ZWOA 2E2WA 3GGOA 5E7QA 4PZDA 4IXTA 4OB7A 2Z2KA 4OHMA 1UBTS 4MR9A 2FPRA 5LP6C 2I4IA 3ET5A 3LA6A 4DJJA 3M5PA 3EA5A 5HG0A 4XWWA 1ONNA 2N47A 2ZWPA 5COAA 2ESRA 4O2LA 1IEVA 1ECBA 1TK3A 1K5HA 2AR9A 4WZ6A 4XE5A 5FBWB 1J90A 4J2TA 2N1MA 4PGGA 3R7FA 4U7TB 3U31A 3BEDA 1PJ4A 2GZ2A 5IXSA 4YCJA 3TZQA 4DIMA 4YT8A 1MNQA 4NOMA 4CM4B 4ARAA 4C4ZA 3DL4A 3PUKA 4CCAA 4EYSA 1K5DA 3LWZA 4IQ4A 5ESRA 1E5QA 3P2JA 4F97A 2VDUE 3NQ41 1FDVA 3H2ZA 1U1GA 4CGZA 3T0IA 5DMXA 2BLLA 4CM9A 4YMUA 1TOAA 5HSGA 2DKNA 3KKEA 3OTGA 1F4LA 1KK1A 4EOGA 3TW0A 1Z8DA 1YGYA 2WJAA 4CI9A 5JTTA 1OBCA 2A59A 4TQAA 1TCAA 4LWOA 3C3JA 4K1XA 5BORA 4FP9A 4RMJA 1EX1A 1OKKA 2IL1A 2YCLA 3ELUA 4PYMA 3DAHA 2X5XA 5I47A 4X64B 2BKLA 1CUVA 4ZTUB 2PWZA 4EO7A 4KQCA 3KB8A 1SH7A 1M73E 5LFAA 2B5WA 1WIWA 3KCQA 3MWDB 4X41A 4F9TA 5ALXA 4RYLA 2II6A 5FQOA 3UAVA 1KH2A 1G9SA 4OHVA 5JAZA 1QHXA 2PGIA 2FMTA 3VYUB 4YXFA 1LZKA 3A04A 2A7XA 4FBLA 4XGKA 3JALB 5AVTA 1L5MA 1LPOA 4R1PA 2I8CA 3EGOA 4NHEA 1KSGA 2WFLB 2QYSA 1N0VC 2GJSA 3EGCA 1NR7A 1QNFA 1SJ9A 2D1RA 3LUHA 3PC6A 1UDAA 2PZEA 1Q3HA 2ZUTA 1SB9A 3V4RA 1IRIA 1TRHA 3C8MA 3D3KA 1X92A 3WGQA 4FDLA 5LUBA 4EJSA 5ICMA 4GL2A 1W4ZA 5A71A 4E09A 1DAKA 4LDRA 5K01A 3SF8A 4MXDA 1OWPA 5EXPA 3PGXA 2IYVA 1GYPA 4DOMA 1ABBA 5JBNA 3RFCA 1U3FA 1Y6JA 4NKRA 4C6HA 1GU1A 4AJJA 3K05A 3IQDB 4DL9A 1QDLB 4ERNA 1DXYA 2GJAA 2ZJ7A 3FOWA 1FY2A 4FFWA 5AK4A 3NHAA 4AKHA 5DM60 3JWHA 1FS4A 2EEPA 2MINB 2WJPA 5G2OA 1KYTA 4DIFA 3GRUA 1PEYA 4KRGA 4K9PA 4TTJA 1KPIA 4BO9A 4GOOD 1UKCA 2FYTA 1X7XA 2VL7A 1Z74A 3Q0EA 2R48A 5IDVA 1GRVA 1ZU4A 2IYAA 1S2GA 5LOVA 1RWBA 2PT9A 2DULA 2GPTA 3KUDA 4MPJA 4RLFA 5D00A 5F9MA 4QE3A 4X9XA 3A6EA 3VYRB 2ZK7A 2JBAB 2QU7A 4RVHA 5DW0A 4ZVQA 3TCKA 2V7EA 2HA5A 1GL6A 3HUUA 4OBEA 5KSPA 1HBJA 2R5WA 1RZRA 4V1CI 3R5KA 2DTDA 4RTJA 2UYHA 1RI1A 5B1IA 3KZCA 1A1SA 2FFHA 3UV3A 3NCTA 2BHLA 4DIDA 5A5EA 5JJBA 3RRMA 1YMUA 3F6SA 4M8SA 2RHOA 3QENA 4Z0NA 2NYVA 2P30A 3VR5H 4YPOA 3SQDA 3SHVA 1YR1A 2C77A 3QIAA 4N6NA 2VQEB 2IZ7A 3T7IA 3C5HA 1S2DA 3BGVA 1ABFA 3RIEA 2DP4E 3I1YA 3WLFA 4B09A 4DDKA 3NHLA 3PFFA 5TY0A 16PKA 2B7CA 4FMCF 2OBBA 1TZBA 3DP7A 3V34A 8ADHA 2UZ4A 1I14A 3GRPA 1G8KA 2JLXA 4FMDB 2E1PA 2PQ6A 2VZEA 1P7PA 1ITZA 4EX7A 2P0AA 1JJFA 4NICA 4QTYA 3VVMA 2FNAA 2R4QA 2HHCA 1OI3A 1M10A 3CF6R 3CGGA 2V7VA 3OSUA 3U7EB 1N5JA 1XZFA 4HT3B 4ZDKA 5B1HA 2VI5A 5JAOA 2OFPA 2BOVA 5K4HA 4N48A 1UMDA 3FUXA 3PKIA 3PCXA 3A6JA 5K3CA 5KYWA 2HBRA 3GZNB 3ZU5A 2PLAA 3V1KA 1P5FA 1SD1A 3AUFA 3EZYA 2O5EA 1W93A 1KYIA 1EQ2A 2WIAA 3B78A 4H1HA 3ZWPA 1NOKA 3RYCB 3GXBA 4TZTA 3UPDA 3LQQA 4OB8A 1UWVA 4NE9A 3VDXA 3NT5A 4XQ9A 2WW8A 1OOEA 2Q3MA 3PICA 1ZIPA 2EFGA 3OZGA 4J4BA 4EKDA 1PWHA 2YX1A 3B1ZA 4BASA 3PDIA 4WV3A 2BGJA 1I2DA 3KB6A 4ZEOA 1UAYA 2WIFA 1ISMA 1KNXA 1NF8A 1P0CA 1SUBA 4GBJA 2Q28A 4I4TA 4IJQA 3THRA 5H8WA 3UWDA 1OXKB 3EXHB 1XZPA 4MJXA 2VF5X 3SZLA 4AIIA 2N0SA 3E4CA 2C3PA 4MAFA 5JCJA 1TVCA 1CEQA 1OWLA 2C5SA 3M33A 5F73A 4RVNA 4GXTA 3W8EA 4R2HA 2O20A 3TGWA 4AUEA 1N2SA 3L8GA 3JQ7B 4G2TA 4ENWA 1WV1A 2YIMA 3M83A 2DEUA 1NYLA 5CITA 4BU0A 5AP9A 3V7YA 2FKAA 1ZSVA 4B85A 5EJ6A 1HUQA 1DBWA 4RZHA 2QUAA 1E0DA 2A3NA 4IJVA 6Q21A 2NT3A 3Q3GE 4M9ZA 2C2WA 1RW4A 3ND6A 4HQKA 4URYR 3BA1A 5ALLA 5TC4A 1WMBA 2FP4B 3AH8A 3W1WA 4F4JA 3ZY2A 4ENRA 2XXAA 5DXJA 1RJEA 3AB7A 3VPSA 4DDVA 3DV9A 2QIPA 4DV5B 5T8KA 1ESMA 4B47A 1X7ZB 4NLLA 1MJGM 1PJZA 2XD9A 3B9PA 4RHEA 1WTCA 3OPMA 3QU2A 1CQZA 3GB9A 4DR1B 2EFYA 1GRCA 3LXUX 3CEPB 1BXRB 1JXOA 4LHSA 3AF5A 1EXDA 4G0OA 4X45A 1E1DA 1XQVA 1I7PA 1J09A 2GN6A 2UV8A 1AGRA 3FZGA 1P44A 3LE8A 3CUYA 7GPBA 2ETXA 1IH8A 1H2FA 2SBTA 3DEIA 3WBBA 1D07A 4IZOA 5KVCA 1JDZA 1VCMA 2BWJA 4WBSA 3T7RA 4XYMA 2HPVA 3G9UA 3WL7A 1E3IA 2JGFA 4HGQA 1J1IA 1PX0A 1QLJA 2WWTA 4REQA 2KQUA 5KOHB 1NKVA 2G1AA 2HLNA 2JJQA 1OXUA 4TTAA 1EBFA 2NO9A 1CZLA 3D59A 2VHJA 4AMGA 2IHUA 1Z7EA 4DDWA 1B42A 2VJMA 4GMFA 1PUJA 4RHYA 3AKDA 1EK2A 1JA0A 2O1WA 3WE7A 1ZD5A 3KR0A 1M9NA 4N3BA 1ZSYA 1U99A 2QAGB 1KC3A 2JRCA 2QRQA 2RHRA 3EVAA 1SZJG 4G2NA 4H7EA 4MIKA 5I51A 3NV7A 3UT5B 3EG9A 4X0EA 3WAKA 2NSHA 2B2NA 1WMEA 3W05A 4D44A 5IM4A 5LP1A 3OAAD 1YS1X 4TUYF 5FHRA 5I9MA 4I1SA 2R8RA 2WPDD 4Q4JA 3W4IA 3R1IA 2PXXA 5EQJB 5IT4A 4KDRA 3NHFA 2E4VA 4YLYA 5C7LO 1AHNA 3ZCQA 3D7LA 3MJSA 4UVIA 5LDGA 3H4TA 1N7HA 3C85A 4FHEA 1R8XA 3RIYA 1XALA 3OQOA 5HUJA 1DT3A 1E63A 4MUMA 3KQYA 3RQSA 1C7FA 2G82A 3IEXA 1JEQA 1QAOA 2HTFA 3K0FB 5FFFA 4ER3A 2ZS9A 5A9SA 4MJ3A 3ZVKA 1Q11A 3ZLJA 1XJ0A 4ME6A 5IYZA 5LLDA 3GRVA 5LM3A 4MKGA 2D5BA 4OQLA 1QRTA 2CMDA 1G2IA 3L9WA 3ROMA 5FLXA 1GCGA 4EITA 3SVTA 3TLAA 5GJVC 4AXBA 1R5OA 2BH9A 3OY7A 4DR2B 5JJLA 3HNPA 4XYGA 1BG6A 3W9UA 4W5RA 1PI3A 2C57A 3L2OB 4ZGWA 4OUDB 4RD4A 3AZQA 4Q3LA 4UEKA 5EIXA 2ZI4A 2WB4A 1XTVA 4R8RA 4U63A 4U9UA 1CUYA 5AJZA 2X42A 1WSWA 5CTJA 1JLLA 1EDBA 3FTPA 2V8BA 3CH7A 4CEJB 5JCPA 3KDPA 3A28A 1PZNA 1J39A 3AUUA 3DDOA 3EEFA 4ARUA 2EW1A 2J31A 1P74A 3O3MB 4N0QA 4YAJA 3UBMA 4BV2A 3QEAZ 4GF5A 2OP0A 2NQ2C 1EUCB 2ZB8A 3JR3A 2JAUA 1UFKA 1XDZA 1UOPA 2JGDA 1Z4MA 3KXIA 3S1AA 1QVRA 3VR3D 3AIOA 2UUBB 3WJ2A 5CFPA 4HZIA 4OSEA 2OM2A 1PK8A 3L1KA 1Q16A 5F51A 4MJ7A 3T3GA 1IZ9A 4JLJA 3AYZB 5TGZA 4AQ7A 3BWMA 4RTLA 3QSGA 5LB4A 3CLUD 2ACEA 4D4IA 1A4XA 2RHGB 3L6CA 5LA6A 4QDJA 5IWAB 1GGFA 1UKAA 1DBPA 3GYBA 2XGGA 5BXYA 3IIIA 3W2IA 4BV9A 1Z47A 3WYCA 1ESCA 1SCNE 3RYFA 4AF8A 1V3VA 1Y1TA 1LDGA 2J46A 3FB4A 1DO0A 1MZPA 4EH1A 2XVMA 3MGBA 1J8MF 1XHLA 2GZ1A 3RSCA 4JYCA 4BVEA 1D0SA 4ZQGA 4EKIA 2Z09A 4DMLA 4DLLA 4Y6QA 5E6RA 1YCFA 3W04A 2XITA 1U0EA 4HNAA 2JGIA 1PW5A 2Z2IA 4B1FA 2CNWD 3T1YB 2R3SA 4B3XA 1XZJA 3LIPA 1OV4A 3A2MA 3ZQJA 2P2YA 1YTUA 1IUNA 1XCPA 1B1CA 3I73A 1B0AA 1CJUC 2I4NA 3TQTA 4YUWA 4MUAA 3C3AA 1IM8A 1K0UA 2AD5A 3GK3A 5AW9A 1SUWA 3BTOA 4RGQA 4B6PA 5LWHA 4GSLA 3L0CA 1TADA 4INAA 5JSUA 1ETUA 2QP3A 3ZX5A 2VXCA 4BNMA 4ZEVA 2B35A 4K2HA 3DVSX 2VCHA 4HX5A 4R7ZA 1NYRA 4LV5B 2WB2A 1ODLA 4MV6A 4A73A 4YV0A 5L53A 1N5KA 2OLEA 2ZUEA 1UF9A 2RHJA 5JE8A 4A8JA 3G8BA 2BI8A 3GQBB 5M04A 1QHGA 2LUOA 1KAMA 1ORRA 2C03A 2YFKA 4P5PA 2CXSA 3E70C 2VP9A 4H77A 4K88A 4R6WA 5ITZB 1E79D 4R69A 1ZN8A 3HL4A 3T38A 2RGYA 3PD7A 4LMAA 4PNZA 3DEZA 2EF0A 1DIRA 5KNDH 1SIOA 1NMYA 3GRZA 5CEEA 4AYTA 1Z2OX 3I8SA 2ZRLA 1ZLYA 4K0RA 5DGCA 4YRAA 2BGWA 4TZ6A 1EMDA 1UBGA 3AW8A 5EMLA 4ZHQF 3DD1A 1OH5A 1Z4OA 3IOCA 1JU4A 1WR8A 1EJ6A 1TJYA 3DAYA 1AY0A 1Q7EA 1EDOA 2Q2OA 3Q3JB 5KQLA 1F6WA 5DYWA 1G17A 3FPSA 4O4IA 5JQWA 1AK1A 1EP3B 3OIDA 1Q57A 3OSZA 4I5IA 1SUIA 1SCJA 1OX6A 1Q0QA 2FEPA 2QW1A 1YZYA 4NY1A 1U9IA 2PT7A 2FJ0A 2YY7A 2B82A 3DGFC 4NBNA 1X0XA 3R0VA 5D86A 5FTNA 2GM3A 2VUSA 2Z8XA 1JKXA 4JHXA 1EGMB 2BE9A 5LIRA 3Q10A 2X58A 3BICA 5KHLB 4F93B 1NP3A 3PHHA 4O2BA 4PLVA 4Q1VA 2DOKA 2BVNA 1D1TA 1E5DA 4P38A 5DHUA 3JARB 3F4LA 4CKBB 4AZWA 2FA9A 3TIXB 3OCZA 5JO0A 1RS0A 4NYMR 1J9EA 2CSUA 1P77A 4F7WA 4IDQA 3VPHA 4BIMA 2ZT6A 5BR1A 3GI1A 5J47A 4CLEA 3AJRA 1JQAA 1KQ3A 2OQ2A 1ZA2A 2IQIA 1ZH0A 1BE1A 4JOCA 1RXSA 3OEYA 5CP8A 2W6ZA 3FXAA 3P0JA 1MX3A 2YWXA 2YJ5A 3EISA 4YRLA 4D3XA 2VWQA 5GQSA 3V1MA 1ONBA 2NVOA 3ONNA 3DBRB 1YB1A 1CRLA 1OILA 1UDXA 2Y1OA 4FBGA 3KQTA 3VISA 2NZXA 5IABA 1R6DA 1IN8A 4EG1A 4UTRA 4NDAA 4QDUA 2QQEA 4HNTA 1WDMA 3E6AA 4E03A 3U48A 4HUTA 3A0RB 1XG5A 5K8CA 1GFWA 3JVVA 4NZOA 3TZKA 3VR6H 2ATEA 4EVIA 2F8SA 5JATA 4OHFA 1OA1A 2I1VB 3FPLA 4IMIB 1XLVA 4OHCA 3MJ4A 4XX0A 1WDWB 2VAXA 3MCWA 4JP5A 5BP7A 1WF3A 2QLBA 1ML3A 5FA6A 1E5LA 2UVPB 5K0SA 3LUGA 1UT6A 4TLCA 5IX8A 1XRNA 1W4LA 2XX3A 4EUSA 4PYKA 3G89A 4N3GA 4RVOA 4IHAA 3KV1A 4DLRA 5HVNA 4MVWA 2ILTA 1R0LA 2QYHA 4HDRB 4UM5A 2CKDA 1TW2A 1Y8CA 4JP1A 5GM1A 1H42A 5AICA 5CT5A 2P5TB 3ND9A 1C2TA 3P52A 1E2UA 4EJMA 3D3WA 3I0ZA 3QMWA 3DULA 3FROA 1ST3A 4I66A 3UATA 4YRIA 2NYAA 2WTNA 2EP7A 4YR7A 1GGVA 5KX5B 2JGNA 2IYYA 3ZDRA 2VQDA 3NM4A 4J0DA 1PT5A 3U80A 1V71A 3LYUA 1TKBA 1OBOA 1S02A 1TCBA 1RYMA 4DJTA 1WUTA 3V2GA 4C0WA 1RMYA 4U2KA 1USGA 1YB6A 2E37A 1G6OA 3OX2A 4G9BA 4HDMB 1WB4A 3T0FA 2HHAA 3WSWA 4C7JA 3K70B 3HKEA 1I7NA 1ZDMA 3L9XA 3T4EA 4E46A 2B5OA 4LTMA 5CLQA 1U3WA 5EJ2A 2ZIAA 4G4JA 5A9TA 5LOVF 5HHTA 2DUMA 2WJIA 4WJKB 1JL3A 5DBIA 4YONB 2QUJA 2GCOA 4WD3A 1UK8A 3G0BA 5D8DA 4FYMA 3GWZA 4ALMA 4QL3A 1E62A 4PCAA 5C4IA 4ZVUA 3KWFA 5IULC 2N9UA 1L4EA 5J43A 3RLFA 3UUEA 1ORVA 2KHZA 4DCVA 2ZYIA 1QH0A 5AKJA 4RFVA 1XEXA 2A1TR 1OJLA 3X3HA 5K2MA 3ZVNA 2GUWA 4M21A 3N1UA 4KC0A 4BBPA 3Q3HA 4DR3B 1EZZA 3K9NA 5F35A 2PWPA 2GGSA 4WVFA 5IT5A 2V1UA 1V6AA 4HDQB 3JAWA 4RORA 1DZ3A 3FRHA 3IMFA 3OF2A 1EKXA 2JARA 5EP4A 4Q48A 5AI5A 2IF0A 3R6WA 3OKPA 4NMLA 5C31A 3RBXA 1EHCA 1QFSA 3RS4A 1KNQA 2D13A 1XWFA 3V4ZA 4J2OA 3PL1A 1FP4A 1QPZA 1G0OA 1VI2A 3E3AA 2WFZA 4OHYA 3AWIA 1VKHA 4GLFA 4L78A 2Q3JA 3IKVA 3JQAB 2IEGA 1SKYB 2P6MA 3WGZA 4LC0A 2PIDA 4B3IA 2QBYA 5BSWA 1L8AA 1W0JA 1ZC4A 1ZRSA 1RRKA 1JTFA 4C4XA 1WU8A 4Z2AA 2C2GA 3D4LA 3GX1A 2ZRKA 3L18A 3DBOB 3DWEX 4P6VF 3BL5A 3E58A 4XIJA 2B21A 5KNLA 3L79A 4L6AA 1VPEA 4M8LA 5J2UB 4CLHA 3EBLA 1U2GA 4F9GA 3VNVA 2HMWA 3KUKA 2YFQA 4WESB 1HE3A 5BYBA 3T7JA 1XDBA 3VKUA 1TF5A 5LZ7A 2HQRA 1EFRD 1VG9B 2FSUA 4OGGA 2Q4RA 4QBFA 4HFRA 3QUAA 4ETNA 4MV0A 3D5TA 1F60A 1T4CB 4BVGA 4C07A 5AHOA 5U1PA 3WJ7A 5JNVA 3E3NA 1EZ1A 2JGLA 3HYRA 4BLVA 1RDFA 3TLJA 3WMXA 4IIJA 1XXHE 2VPYA 4OAOA 1ZK2A 1IZYA 2JI9A 4I4TF 2NXCA 1PJBA 4MQ4A 2CYCA 5AW8A 1RHKA 3S5JA 2O4CA 3ZGXA 3JYPA 1I4WA 3VU1A 1RLUA 1J7JA 4QATA 3PX7A 4Q3DA 3EIUA 2C1XA 4QYTA 5JFOA 4PLTA 1M8PA 3G49A 1RBZA 3VYVA 2OBMA 3A3PA 2FMXA 3KLOA 3NRJA 3HJCA 3F5QA 3REQA 3MXOA 3I76A 1U4NA 3PUWA 3S0JA 1LLFA 1OT5A 1OLSA 1PL0A 1ZYUA 1KFCB 1ZBDA 3UGTA 4BLOA 1VJRA 1QZXA 1TMKA 5EXXA 2ZWMA 1E20A 1PQUA 2GEFA 2Q9UA 2XUQA 3CRMA 1NNUA 3TR6A 5B1EA 2WRZA 4Z7OB 1QYDA 3L4SO 4UTVA 9LDTA 2WICA 1IEWA 1NV9A 1BVYF 3AOEC 4EPRA 2OO7A 4KUGA 3STYA 3UAXA 3D5EA 4DG5A 1DAFA 2DHDA 5CYFA 3TOXA 5EGSA 4TKMA 2V0CA 3PHJA 4H3KB 1VGQA 4QLOA 1WY5A 4AS2A 2O0HA 2WM9B 4YRBA 4WWHA 3AINA 3I45A 3Q12A 5HKKA 4OQXA 4HUQB 5HRUA 5E9WA 5IANA 1KRHA 2XMDA 3JS5A 3PPXA 2VTKA 3F7TA 4UEOA 4YK7A 4ZI7F 3K4PA 4WVLA 4S1TA 1DUIA 3T94A 1IBSA 4Z4HA 2YINC 2ZPUA 4QM6A 1U65A 3EZ6A 1GAEO 2WD7A 3FAKA 2JC3A 2I4RA 4TLAA 2QRNA 2CFIA 3OLYA 4G5QA 3PSAA 2SCUA 4DLUA 4I9UA 4PXYA 3I58A 2O19A 2A5JA 2RIRA 4FCTA 3ZDAA 1P80A 3VDQA 2NUTB 2IDMA 1U90A 2E1RA 3PYMA 4ZDWA 3LY8A 4BPRA 4DFDA 2HR1A 3BH0A 4Q9LA 4XA8A 1ZNYA 1UXGA 3B2NA 5CBKA 1ZM4A 1QKIA 2IY8A 2GASA 1LW6E 5IHPA 2UYQA 4GMDA 1TYEB 4EWLA 4MKZA 5BSFA 3RVSA 5JC1A 4IWYA 1XZMA 1A2OA 2AG0A 5F3DA 2QDKA 3WAGA 4CUJA 3IEIA 1P31A 5KVQA 1NXOA 2H52A 5LQSA 2CMKA 5BYAA 2GH1A 2XOKD 3GY0A 5KSOA 4BHTA 3CSSA 3L7BA 3N2IA 4JQSA 2I4TA 4LC9A 2D0OB 4EL0A 5CDSA 2J7PA 5FWXA 4TTSA 4WACA 4B3RB 3OM8A 3V7FA 4MVJE 1C81A 4OGWA 4EY8A 2A92A 2OSVA 4RLSA 1Z13A 3AY3A 3O92A 4RZ2A 3NBYC 5IYZF 3W7BA 1TT5A 2VDQB 4O5AA 3H7AA 4CBVA 1YAJA 1ZOLA 4JLUA 1NURA 4MQFA 3AL0C 1CZKA 5E3IA 3IO5A 3VGJA 3RRFA 1DC5A 3VV2A 1KHTA 3ICPA 3F6EX 4QPJC 1BYUA 1SXHA 4JYBA 4HAIA 2W2MA 4XVQA 1HH4A 1NI3A 5FI3A 5HIAA 3LPDA 4J43A 5KJFA 4PCLA 4H08A 1EVZA 3SM3A 1XZAA 4K2AA 3UH1A 2PKRA 3C39A 4Z2YA 3UKJA 5L6LB 3S2FA 2PX5A 4GOND 1O58A 4LF4B 4JDPA 2C7RA 2NOAA 3RJ9A 3A36A 4UNNA 2QTFA 1SBTA 1U9ZA 3A1FA 2C2XA 2IHYA 3H83A 1BGXT 4II2A 4P7JA 4UHKA 5B58T 3ER8A 1M0WA 4ZYUA 3SXJA 4C9BA 4D79A 1NF3A 3G9QA 4Y1GA 3RS5A 4OL0A 5BT8A 1JFRA 2C07A 3D0KA 3O4VA 1W48A 3ICWA 3IQHX 4QJBA 1DWQA 1M7BA 4LI0A 2PIAA 2ZKLA 3ULKA 3BUSA 5HXAA 4CODB 4G09A 1GGEA 3F7NA 3L7LA 2ONYA 5TVGA 1Y34E 2R7AA 2VJCA 4P3XA 2UUAB 2FPPB 3IX7A 2I1WA 3JRXA 4M1OA 1D3AA 4RLHA 1Y6QA 3DT8A 4LKOA 5CVVA 5CXSA 3AIMA 4FWTA 2XUPA 2XKKA 2Q2VA 1Z7BA 4Q3OA 2FQXA 4YJFA 3RABA 2R1ZA 3QE2A 1ICIA 1XVUA 2V3WA 1E99A 3TD2A 1Q14A 2YJGA 5C7IO 1KAEA 2C97A 4BTEA 2A88A 2AKYA 4JROA 2NSJA 3FGOA 3BS4A 2X0EA 5HQ3B 3FOZA 1NFRA 1FTQA 2HD4A 2QVZX 3DUFA 2V6BA 3OJEA 3OZFA 3SSAA 2ZSBA 3MD0A 3A11A 3X2SA 5IN4A 3V8BA 1HDYA 2AR0A 1RVV1 2HCTA 2VTBB 4ARSA 2JW5A 3R5TA 1BD4A 3IB3A 3SG0A 3LVRE 5FBRB 3UHPA 3AHDA 5KDDA 1PK7A 2VDVE 4FE3A 2Q0HA 5F1OA 4DCCA 4F6RA 3PG5A 4WNIA 2P35A 2HK9A 1MPXA 1T1JA 4IEIA 2K7FA 2ZFUA 3ETGA 3FCCA 1PO7A 1UMKA 5M34A 4CXMA 1ADFA 4AG5A 1KSHA 2XDAA 4IUBS 4YCSA 2FMIA 4HRAA 2FW7A 2RJ3A 1Z4NA 1HTWA 3HHEA 3R3JA 3FLAA 3GZ4A 3T41A 4TXMA 4D9KA 1MOZA 2QQ5A 2BHSA 1U8TA 4RQAA 3V1TC 1A76A 1UZNA 3DTVB 1VCNA 2P7IA 2QI9C 4DG9A 1ONPA 3ILXA 4TKZA 4A03A 5HJ5A 3VFDA 1I6MA 3NHBA 5ERYA 2OZLB 2VTBA 1DCKA 1ZGAA 1TMGE 2NSLA 3K9GA 4GPD1 4LPSA 4M9UA 3E81A 1Z68A 4O29A 4CM9D 3Q7TA 3NWOA 1B14A 2X5JO 2PZMA 1I3LA 2BEUA 5LN1A 5JAQA 2PCLA 3GUHA 1HRKA 4RH0A 4YNBA 4AKIA 3R9XB 3BXOA 3U4IA 4Q39A 1OKKD 2Y66A 4CDGA 1Y7TA 3PNBA 2GA9A 2C9MA 4RKQA 1JECA 1DAIA 4LDQA 5ER6A 5HDBB 1YFLA 3ZD7A 1WZNA 3HY4A 3OOHA 2C1ZA 3AERA 1XQWA 4I46A 2H4HA 4W8OA 3I6IA 1QLWA 4NOLA 4Q00A 1JYFA 3HVIA 3OM9A 4MV5A 1ZEJA 2F2TA 1VGRA 3TDNA 2WQZA 1VHLA 4ZCRA 3N7AA 1NBIA 2DECA 3Q87B 2OCAA