2YQ4A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus
molecule tags Oxidoreductase
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq4A01
4J16A 4OH1A 5EN4A 5IN4A 4GBJA 1LLQA 3KHUA 1DFHA 3E03A 3F3SA 1JA9A 1N8KA 4J6FA 4LSWA 4MP6A 4O5OA 5BT9A 5BSHA 3KYDB 1B3RA 1YDWA 3DO5A 3QVWA 4INAA 5DCWA 3ZWXA 4EEZA 1BXGB 3I9OA 1Q2XA 2GO1A 1PZHA 4XZ3A 2GZ1A 3GR6A 3ZH2A 3S2FA 1GV0A 1MP0A 3WBBA 4D46A 5DT9A 5THQA 4NFHA 4CQLB 5BR7A 1Y8RA 4FFRA 3GDOA 3LT4A 3ZWPA 3M2TA 1W8DA 3G49A 3DZIA 5ILOA 1NPDA 2QYTA 3C1AA 5F21A 5G0UA 1I3KA 2B5WA 3QHAA 4XDZA 3FTNA 1AE1A 1KS9A 2GN6A 1LNQA 3VPSA 3PZBA 3F4BA 3VZQA 4DREA 4F46A 3QWAA 1XA0A 4HNHA 4UAGA 1X7HA 4N54A 4PG8A 4HBGA 4OOEA 1ZXBA 2HRZA 2JFHA 3CPSA 3FNEA 3IIEA 4B4WA 4OYRA 2Q2WA 1EUCA 1SZJG 3AI3A 2JHGA 3U0BA 2I67A 1N7GA 3OIDA 3OHSX 3ADOA 2Y0CA 5K0ZA 1P3DA 2HMSA 2JD2A 3R3SA 1E0DA 3JQAA 1E3LA 1FK8A 1P0CA 3D3WA 5C3MA 3R6DA 3KYDA 4BO7A 2C07A 2X0NA 1FMCA 5DF1A 5TLSA 3LT1A 2FHSA 4UREA 4UVEA 3A4VA 3PJDA 4RVGA 4XYGA 2YDYA 3WIDA 5DNAA 4F6LA 1U8XX 3HQ4O 4GQAA 4XJTA 2ZTVA 2P4QA 4EZBA 3L0DA 4IDFA 1RYEA 1BW9A 2FR8A 4JIGA 3PIDA 2G1UA 1W4ZA 4BNNA 2AA3A 3PPIA 1WP4A 3R0IA 1J5PA 3UCFA 1F17A 1D4FA 3QLJA 3TN7A 3QVOA 1DAPA 1VSUA 4BKQA 4R69A 4W99A 2OGUA 2J3KA 4S3MA 4DIOA 1GZ4A 3CKYA 2GCGA 1O6ZA 2PFGA 5HM8A 3HB4X 5L3ZA 3TFOA 4I8XA 5JMWA 1E3IA 4D0SA 1A4UA 1NFFA 3W8DA 5C7IO 4YRAA 5AYVA 5T57A 1ISJA 1DIRA 1FDVA 5A02A 3DL2A 3AU9A 4TMFA 2GRAA 1FDUA 1UDAA 2X5OA 3MWDB 2IEDA 4A26A 1M66A 1X13A 1CDOA 5FI3A 4GVXA 1DIBA 1ORRA 3W4KA 4L4XA 2AEJA 4FSHA 4W4TA 5ER6A 4BO3A 2UAGA 2C59A 4U0KA 2AQKA 4FOOA 1U7TA 2VUSA 3KRTA 3CMMA 4P4NA 4OSOA 3VH3A 1ENOA 4R1NA 4E12A 3TRIA 1Z7EA 2YHIA 5DCYA 1WPQA 4RQUA 5L95A 5HRUA 3WX0A 2Q1WA 3SLGA 1H6DA 2E82A 5CDTA 3MJTA 3PZRA 1CWUA 3I5MA 4BKRA 2RH8A 4M1QA 3WBFA 4WNIA 4PLWA 4CM6A 2QYSA 5JDIA 3D4OA 2OO5A 3E5RA 2HLPA 5DDIP 4TRJA 1P44A 4I08A 1U5CA 4UULA 5IJZA 2QQ5A 3NDJA 4B7UA 4TRRA 1PSDA 2A9FA 3HDQA 2CVZA 3KM0A 3TQHA 4QFCA 1UZLA 4OO3A 2OHXA 5FEUA 3GEGA 3V1TC 4YTEA 4ALJA 3DBHB 4XQCA 1YBVA 5TSDA 4CMJA 3H65A 3RFVA 1QORA 3F5SA 3FF4A 3PQEA 1J6UA 4CMEC 2PGDA 3FTPA 3MZ0A 1W6UA 4I9HA 2P2SA 5ENVA 4ALIA 1XLTA 1K6IA 2A94A 3BYZA 1DC6A 3INTA 3KOUA 4CLHA 1W0CA 2O7QA 3VHRA 3GDGA 4RJTA 1M67A 4YT2A 2CVQA 2Q4EA 2YW9A 4FDAA 4JP3A 4R41A 3GPIA 4XYMA 3AI2A 2P9GA 3GFBA 1Q1NA 1F14A 1E92A 4IQ8A 3PGXA 1LLUA 4J1NA 3NX4A 5JE8A 4II2A 2VZ0A 1NX6A 1HSZA 1LSUA 3EY4A 3PQDA 2WEKA 4NJMB 3V5NA 3ZU3A 3BIOA 1LC3A 1KEPA 3ETDA 1IHXA 4MVJD 5EPOA 5TT0A 2UUPA 2EKLA 3B6ZA 2VZ8A 5JDCA 5JDIC 2WJPA 5ITVA 1ZVMA 1ZCJA 4WCFC 1MFZA 5A9RA 2YHIB 4L0QA 3ZNPA 1V3UA 2IEBA 1H6AA 1L7DA 4DPKA 1ZFNA 3V2GA 1B2LA 2Q1TA 3PLNA 3GN2A 4FJ1A 1P74A 4RPKA 2ZJ0A 1Y9EA 3OJEA 4KZPA 3I9KA 2GASA 1HE2A 4BNUA 3ANLA 1UR5A 3KVOA 1NP3A 4RVSA 1U2GA 3PHHA 4BNLA 1RM5A 3GLQA 3AFMA 4CMEA 2VTEA 4FS3A 3VPFA 3JV7A 1HF3A 3KYBA 3T4XA 1HDCA 2YJZA 4C7JA 5GZ3A 4XQ9A 1O5IA 4XRRA 1NWCA 1GV1A 3NJ4A 3M1AA 4KTVE 3SC6A 4XJSA 3FPCA 4ILKA 4TZKA 3SJUA 1EVIA 2CF5A 3DFUA 3BHIA 5GY7A 1J49A 4RZHA 1P0FA 1PGQA 3NGLA 4J4BA 3TJRA 2LDXA 3ASVA 4G5HA 5JSFA 5DBFA 5COBA 4ALNA 3TZKA 1FJHA 3ZCXA 2X0RA 4MP3A 3PHLA 5JAIA 4WEQA 3RASA 4MVJE 4MVJA 5L4LA 1E3JA 4JGBA 4YAGA 4YA6A 4NR0A 1LC0A 3E18A 4WJZA 1ML3A 3DZKA 1ISFA 4DUPA 3AY3A 1B7GO 4PCVA 3ZI0A 4AJ1A 1H0KA 3GNSA 2VWHA 1XU9A 2DM6A 3PJFA 3ZNOA 2X8LA 3HNPA 1ZZEA 1PJ4A 3WGOA 1T2AA 4ZRMA 1AN9A 2W8ZA 2HSDA 3WMXA 2HU2A 3I6IA 5DP1A 5FF9A 1IHYA 5CDYA 2WMDA 1G6KA 2AEMA 1HKUA 2Y05A 2JKVA 3WTCA 2WD7B 1MXHA 1NBOA 3DAFA 4GH5A 4CLDA 1MX3A 1U5AA 4HWKA 5K6AC 4NDNE 2O3JA 3JQ8A 2R00A 1J0XO 1R4NB 1W73A 3FRJA 5C7LO 3FCOA 4E5MA 2VHVA 5KJ6A 4YBZA 1WVGA 3HN7A 3FWZA 4GMGA 4UUOA 3VDRA 3ZZNA 4ROSA 1U28A 3QVXA 2WSBA 1SCUA 1V0JA 4DQUA 4FGWA 4YJDA 2E4AA 1Q7BA 4PLYA 4E4YA 4L9RA 3CH6A 4GPD1 1XSEA 4JNKA 4E5NA 2J5RA 4KUGA 3WIEA 4WECA 4UUMA 4WLOA 2NUAA 2P91A 4BKUA 1EE9A 2HAEA 4IDGA 3H2SA 2B0JA 5J23A 4U7WA 3KUXA 2VYND 4LVCA 3ON5A 1KVTA 3KV3O 4P8RA 3UHAA 4R01A 4NMHA 1JU9A 1LA2A 3DBHA 3Q6IA 4U0JA 2EG9A 3WS7A 3ZWAA 4IBOA 5I7SA 1QLHA 2J3JA 2WYUA 3SLKA 1YJ8A 4AJJA 3JYQA 4BO4A 2AE1A 4R3NA 3RU9A 2Q45A 3TOXA 4WNCA 3STHA 4Z0HO 3OJFA 1QV7A 2EJWA 2GZ2A 2J5KA 4GL4A 4IDEA 1MV8A 1NQAO 4XB2A 3OM9A 3FBGA 1NPYA 4KP7A 4Z0PA 3C3XA 1X14A 4IJWA 4BMVA 3C24A 4LRTB 4BIIA 4RORA 4W7HA 9LDTA 1ISMA 4CR7A 4Q3BA 2R00C 4CV2A 1E3SA 2R2GA 3QVTA 4CM4A 1A9YA 1YB1A 3H5RA 2D5CA 4ITUA 4PFJA 1VKNA 4GX0A 1DAOA 5A4DA 1Z6ZA 5CEEA 4PLZA 2AG8A 2WWRA 5IZCA 4B4VA 1ISIA 1V9LA 2X58A 2EKQA 2YV3A 4NBRA 1UXHA 3F1KA 2XXJA 3F6YA 5G4KB 5LC1A 4BGUA 3BAZA 2BRUA 1E7QA 2CFCA 5AQ1A 2DTDA 2HUNA 4E0BA 1VJ0A 3NDIA 4TVBA 3VOSA 3JQ8B 2VUTA 4UVDA 4WUVA 1E7MA 3WWZA 4B79A 4JK3A 1E1LA 4YJGA 3ENNA 4RF3A 5T8KC 2Q2VA 4OIMA 9LDBA 2O3SA 4AL4A 3NRCA 3PQFA 3RUFA 3HUDA 4CLOA 4J3FA 4MVJM 3LC2O 2ZB7A 1NHWA 4NBUA 3H2ZA 3GAZA 3IOYA 3ROKA 1NQTA 1UP6A 4WCFB 5JC8A 3GT0A 3VVBA 2X0JA 1P33A 3PWZA 5LDGA 2ZYGA 5HTOA 3RFTA 1BVRA 4D3DA 4J7CA 2RCYA 4MIOA 5BNTA 2CDCA 2OBNA 5C37A 1SMKA 2OP1A 1DLJA 1PS8A 2QHXA 1LDBA 3VZRA 1U8FO 1YBAA 5T5QA 3SEFA 1HXHA 1AGNA 5JS6A 1R37A 4FOSA 4NH4A 1XIVA 2DKNA 3VZSA 1TXGA 4MJLA 4YQZA 5KWEA 1O89A 1YOVA 2IZ0A 5COQA 4XDYA 2DT5A 1PZFA 2JD0A 1C3VA 3R3JA 4KWHA 4U8GA 5U4QA 1KOLA 1D7OA 2EXXA 4WK6A 1XG5A 4BHTA 1EVYA 4ZVVA 3WSWA 2AG5A 2VNAA 3WGYA 1E3WB 1HL3A 4QFDA 3VH4A 1GCOA 2ZATA 1E6UA 2P5UA 3ZU2A 4IDCA 1DOHA 4QEDA 3HJAA 3GAFA 5T67A 4AFNA 3CINA 1OMOA 5G2OA 1A72A 4R5HA 3DMTC 2C54A 3HWRA 4IS2A 3T7EA 2PGLA 3K6JA 2AXQA 2XPCA 1Y9AA 2VHXA 1WLYA 1HZZA 1KETA 1Y8QB 1Z82A 2BMAA 1EE2A 4QECA 4XRGA 1KC3A 2O2YA 2QIOA 3GY0A 3H5AA 4A27A 1C0IA 3GK3A 2XOXA 5B1YA 3P19A 5JCXA 2JCXA 4B3HA 4ZN6A 1U3WA 1AUPA 3GDFA 1PJLA 2W4QA 4XR4A 3I3OA 4GWGA 1UXGA 3NTOA 3ZWVA 1D1SA 3JQBA 2Y1FA 2POQX 3GEDA 3PDJA 1ZEJA 4NBWA 2WYWA 3FNHA 1I3LA 2CD9A 1HYGA 1EFLA 2OORA 3M1LA 2HMUA 5DULA 1YWGO 4GLLA 4BNJA 1JKIA 1H5QA 1YQDA 1DPGA 3COSA 4XKJA 4Y6PA 3WTBA 2AQ8A 2J6IA 2CNBA 4EJ0A 1DJQA 1EZ4A 3RSHA 1YOVB 2ZIZA 1BSVA 2WTBA 4QTZA 1E1KA 3EW7A 3OH8A 1GADO 3QE3A 3JQGA 5FI5A 1BXZA 1KVSA 4N5NA 3CUKA 4QSMA 4AJPA 3ZNNA 4LN1A 3H9QA 3E8XA 3W6UA 3I9LA 4DGSA 1BXGA 2X5JO 4WLFA 3NT4A 3OETA 3TFQA 1VRWA 4X54A 5JO9A 1Q7GA 3N74A 3OQ1A 1Y6JA 3I52A 5F5LA 2F00A 2YQ5A 4HUJA 4M49A 4R9SA 3EVTA 3PP8A 5A3VA 1DIAA 4YR9A 3G3EA 1VLLA 1GYPA 4U6QA 1CQJA 1QV6A 5TX7A 2BI8A 3DBVO 3AJRA 3DAPA 3WGGA 2NVUA 2Y1EA 3DZFA 3GMSA 4YAEA 1KYQA 3WNVA 1KEUA 1PWXA 4NPCA 4PZDA 5A9TA 4WLVA 1I3NA 3DHYA 4Z9FA 4UEJA 1AXEA 2Y0DA 2V6FA 2X1HA 3L4BC 4RLSA 4CLRA 2H9IA 3ZV4A 3ETGA 5ITWA 2HK9A 1AXGA 4KQWA 1VL6A 4GX1A 1D3AA 3Q2KA 4XQEA 1IE3A 4NNJA 4XEHA 3V2HA 4CODB 3G17A 4L73A 1DFGA 3D4NA 3DMYA 3QWIA 4J2HA 1P1HA 3I9NA 1DRVA 3PFFA 2V7PA 3U9LA 2ZYDA 5EL0A 3IC5A 2B4RO 1DO8A 3U4CA 4J1SA 1JTVA 3O8QB 4JJIA 2GD1O 2GN8A 1G1AA 1GZ6A 3TZHA 3UAGA 3FSRA 1R12A 4YQYA 4YT5A 2Y66A 2PKQO 5IFLA 1O95A 2D3TA 5H82A 3GF4A 2EWMA 4DPLA 3IKVA 3ZHZA 2VHWA 2IYOA 2O7SA 3UKOA 1JVBA 4I9NA 4IQGA 3H9UA 4A2CA 1HYEA 1RM3A 3EDMA 3RI3A 1UP4A 4CV0A 3BTUA 4N18A 2ZB3A 4EJMA 5JMPA 1K0UA 5EQFA 1ZK3A 1HDGO 5DP2A 4Z3DA 1PQPA 4DQXA 2NTNA 2NU8A 2ZTMA 1GUZA 3IAHA 1EEHA 2IODA 2JL1A 3IUSA 1GU7A 4RDHA 3A28A 4EDFA 2JAHA 1QP8A 1ONPA 1A7KA 1BW9B 1DC3A 4Y6RA 3ZU5A 2ZK7A 1E6WA 1U1IA 1WNTA 5K9ZA 4DQVA 4MOWA 3KYCB 1LRKA 4N5LA 4RVFA 4LMRA 4BNHA 3H6KA 3OSUA 4B3JA 1UXIA 2QZZA 3MEQA 4KDFA 4L4RA 2OOSA 2UV8A 1EUDA 3JYLA 1XGKA 4XGNA 3AOGA 1KERA 4PRLA 1WWKA 3UOGA 2NLOA 1ENZA 3DAGA 4IXTA 5KVCA 1RKXA 3NEPX 3LT0A 4N7RA 2DPGA 2IZ1A 2I6TA 3Q2IA 1LTHR 4CMBA 1QKIA 1HDOA 1MG5A 4A7PA 3DEYX 3IJRA 5I7EA 5ADHA 1JKJA 3UCXA 4BQRA 3ABIA 3RJ5A 1PGOA 3BZUA 3ZHYA 4BNIA 2E48A 3JD0A 4J1QA 3DFZA 4IPTA 3ITKA 3WYEA 2X9NA 1QYWA 2V6MA 4RF4A 1MC5A 3BHMA 3UUWA 1V6AA 4B4UA 4JXKA 1GAEO 3GHYA 5CDGA 4NBVA 1T25A 4D45A 5BQFA 4C4OA 3GGOA 4LCEA 3VTFA 3GGPA 2B4TO 4XCVA 1ZK2A 2TMGA 4J0EA 2VTDA 4IDDA 4AICA 1DC4A 3PYXA 4EI2A 5I9MA 1PIWA 3ROPA 1GUYA 3JD3A 5BNFA 3FNFA 1LLCA 4GSKA 4R54A 4E31A 4J90A 4XGKA 3LLVA 1N5DA 1NFQA 1PGNA 1FDTA 4UEKA 1VE9A 1HDXA 4R16A 3AU8A 2QW8A 3HDHA 1A5ZA 4BO6A 1KIFA 1YXMA 4N5MA 4I5GA 3H3JA 1B3BA 1GQQA 1NHGA 4FC7A 8LDHA 2D1YA 2ZJ1A 4PG6A 1RJWA 5DBIA 3TWOA 4IJVA 5L7TA 1QLJA 2DUUA 4YPOA 4J9UE 3MJSA 4TQGA 3VPHA 1EDZA 2ZCVA 3AM3A 3EMKA 3NGXA 4Q3CA 1N1GA 1E77A 2UVDA 3QV1A 2NADA 3OJOA 3C7AA 1WAMA 1YQGA 4OSPA 2X0IA 5HS4A 1NQ5A 2NWQA 3O38A 3NDRA 1E7SA 3QWFA 4YDRA 1V3VA 2UUOA 5B4VA 4HX5A 3BMNB 4XWYA 5LCXA 4AG3A 4IGFA 5DN9A 4UVIA 3ZWWA 5C7OO 3S2IA 1YGYA 3TPCA 3PJGA 4D3FA 1HWYA 3FD8A 3K8ZA 3PYLA 1YS4A 3WMWA 3DHEA 3M2PA 2TMDA 5FFFA 3U4DA 5CDUA 5KOIA 4IM7A 2OFPA 4OQZA 4GKBA 2O3QA 2G82A 4BGVA 5IDYA 2VRBA 2ZB8A 3PHGA 1RWBA 5IDQA 1X15A 2ILTA 4NJMA 2J3IA 5AXCA 4BQPA 2PKRA 3BHJA 1NPTO 3WGQA 4U6SA 2OXIA 5HBRA 2G0TA 1YL7A 4ALMA 5IDXA 3RAJA 1EMDA 2LDBA 3JQ6A 3N7UA 5TC4A 4CM7A 5IXSA 1ADFA 2BGMA 2EEZA 4BO8A 1NVMB 1WXDA 3MJVA 3WDSA 1O94A 1PEDA 1TT5B 4WCDA 3V2UA 1U7HA 4CV1A 4AJIA 1LX6A 3GH3A 3F46A 1QRRA 2BGLA 3I23A 1XQ1A 4ZQBA 2PY6A 3PLRA 1ARZA 1YONA 4WOKA 2ZQZA 3ENKA 4DLAA 2BHLA 2ET6A 3FWNA 5JAMA 2HK8A 3BXXA 1OFGA 3OJ0A 4IGEA 4W6ZA 4A5OA 3D0OA 3LYLA 1E7WA 1R66A 4Y9DA 2C20A 3RQSA 2HDHA 3L4SO 4DLLA 1ZSVA 5BSGA 5L4NA 1U4OA 1CERA 2NVWA 3DOOA 1U3VA 1VL0A 3OA2A 3NKLA 2UYYA 2XAAA 3U49A 1ZW1A 1YL5A 1UUFA 4KDEA 2C0CA 1IPFA 4RLHA 2P68A 1VL8A 2VWGA 3RKUA 1X7DA 5KJ1A 1P45A 1EDOA 4DIFA 1X1TA 1UAGA 3U3XA 1DHRA 3GUCA 3OQBA 1I33A 3SC4A 3ICPA 1YJQA 4GX5A 2FN7A 3FBTA 3JQGB 1JLLA 1WDMA 3PEFA 4CM5A 4YVFA 4ZQEA 2YY7A 2W2KB 2Q50A 4D3SA 1GPJA 5CEJA 1P1KA 2FR0A 4OXKA 4BL5A 2CDBA 2VHZA 1NTOA 3PXXA 2CUKA 4GAEA 4E2ZA 4MIYA 1Z7BA 4BO0A 1ZUD1 3DMTA 1RM0A 2V6BA 3LK7A 3EAGA 2PK3A 4GSLA 3CZMA 3INRA 4W82A 2YUTA 1LU9A 1G0NA 3G0OA 4ZHSA 2PKQP 1GQYA 2QX7A 3E5MA 4CMIA 3LDHA 3AUUA 3VVCA 2NVUB 1K2WA 2Q2QA 2C7VA 4F3YA 4LGVA 4Y6SA 5LDHA 4MVJF 3DXFA 3RD5A 3GNTA 3ZV6A 2PWZA 4BGIA 1RPNA 3LT2A 4Z9XA 3KEOA 1EBFA 2I66A 4NFSA 5CP8A 1HDZA 3UH1A 4CR8A 4P4LA 3ETEA 3ZWMA 7ADHA 2WE7A 3PI7A 4NHEA 1Y8QA 3AW9A 4ZICA 3I9MA 3QRWA 5F1PA 3GRKA 1PZEA 4OL9A 3EUWA 4TZTA 5A9SB 3U62A 2BD0A 1RYDA 4CR6A 1JQBA 2IDZA 2PZLA 3AK4A 3B1KA 1HE4A 1Y5MA 5CHEA 4JJGA 2JJYA 2W90A 3QVSA 3WJ7A 1NR1A 2A92A 3VH1A 4AJ2A 4R5MA 3BMOB 2YHUA 2O48X 4R1SA 4WASA 4ALLA 1T4BA 2CVOA 3L77A 5CDSA 2OMEA 3EZYA 4HFNA 3NT5A 1I2BA 4CM8B 4CM4B 2HMVA 2NM0A 4FN4A 2CZCA 5KKAA 2J3HA 2AEFA 4B8WA 1ZMOA 3L9WA 3QIVA 2O4CA 4UVHA 2X5KO 2Y99A 4RVUA 2XF8A 1DC5A 2PZMA 4IDBA 3UN1A 4AVYA 3HSKA 2PGJA 3KTDA 4PG4A 4TRNA 4XR9A 1LRJA 4XYBA 4Y98A 1Z75A 1QYVA 3JSAA 1ZO8A 2HK7A 2OP0A 5ICMA 1UJMA 5IZCC 2X22A 2GN9A 3OICA 4EJ6A 3VZPA 2Z5LA 3RWBA 3TDKA 3K73O 3PHIA 5KVQA 1A4IA 2ZKLA 3F4LA 3JQ9A 1NASA 4PZEA 3VKVA 2PZJA 2SCUA 4GGPA 3IUPA 4BV9A 1VM6A 1U2DA 1I3MA 4FFOA 2Y67A 4R68A 3DONA 1NYTA 4MKZA 4AJOA 5T8KA 2DTXA 1SB9A 1BWSA 4MINA 2BI7A 1K6XA 3GVCA 3IP3A 2QG4A 3DTTA 4IZHA 2EGGA 1T26A 2GSDA 4K26A 2DLDA 1ZIDA 3I9JA 1UH5A 1YB5A 3NTQA 1D8AA 4XB1A 1R0LA 1R4NA 1EUZA 4ZRNA 5EIOA 2EP5A 5L4SA 3H8VA 3RIHA 3RFXA 1K5HA 1Q0QA 1TA4A 3KB6A 3PWSA 4Q3DA 4UVGA 3VH2A 3ROQA 1KC1A 1NM5A 1P1RA 3OIGA 1LXCA 3DOCA 2YQ4A 3RC1A 3ZNQA 4BNTA 1ZK4A 3JTMA 1PJTA 3TZQA 3D4PA 3GVHA 2NSDA 5F1KA 4EUEA 1DXYA 3WR5A 3WYBA 1SAYA 1PJQA 1IL0A 2Y1CA 4YJFB 2GLXA 3OIFA 2UDPA 2VN8A 3B70A 2AMFA 5GZ1A 2XXBA 3T7CA 4K1LA 3LC7O 2Y0EA 1PR3A 4BNYA 2HMTA 4WE3A 2YYYA 4JJFA 5DOZA 4Q3NA 3P2OA 3WXBA 1PJCA 4RPLA 3IL2A 1H2HA 2HKIA 3FNGA 4KUEA 1F12A 2Z1MA 2DBQA 2GPTA 1ZXLA 1LDMA 1FDSA 4YCAA 2GR9A 3IMFA 2CY0A 4R3WA 4H7PA 1EK5A 2QRKA 4A0SA 3LSYA 4L75A 4JN6B 3FR7A 4MKXA 2W2KA 4MVJH 5KVVA 1DJNA 3GZNB 3OFSA 3KEQA 2DQ4A 3JQAD 4D43A 4ZJUA 3CSDA 2YDXA 3NAQA 4K6FA 3BTOA 3PRJA 3RBXA 4IJKA 1PU2A 1HSOA 4XYLA 3D7LA 4Z9YA 1H2BA 5A5EA 2V6GA 2Z95A 3OJLA 1UXJA 5AXDA 1SPXA 3D64A 3UFXA 4DWVA 2AW5A 1QYDA 4PLPA 1I5RA 4CMIB 4QT0A 1QYCA 2E49A 5TT1A 4Q3EA 1K3TA 4BKPA 2A4KA 1XCBA 4MVJI 3GVIA 8ADHA 3KYCA 3JQAB 4KOAA 1XDWA 5L9AA 2GZ3A 3H4VA 1N2SA 2JFFA 1UP7A 4R9RA 4RF2A 4BO9A 1H6BA 4J4HA 1PQUA 2ZQYA 3DB2A 1P1FA 5ER9A 1B8UA 3H7AA 3JQBC 1BTOA 3GA0A 1ZH8A 1QMGA 4QO8A 3MWEB 1OBFO 4OKNA 4NK5A 2O23A 4EW6A 2X7HA 1HZJA 1R15A 3RU7A 3ZWYA 2VUUA 3H3FA 3ZHBA 1PS0A 4W9NA 4U5QA 4AJKA 3GVXA 1CRWG 2Y68A 3SXPA 3BTSA 4L74A 4RPGA 3C1TA 1PZGA 1K89A 5G0VA 4FPXA 1LDEA 1NXQA 4HNGA 3ZWNA 4RDIA 1A27A 4LSMA 4R51A 5EMHA 2R6JA 4IS3A 2O3UA 4RPHA 3WQSB 2YFQA 4II3A 5U1PA 1LRLA 4IUYA 3G1TA 4WLEA 3IQDB 4G2NA 2ZTUA 2D2IA 4GGOA 3I6QA 4DBVO 5ES3A 2BF7A 4M55A 2A35A 4DTIA 1Y1PA 2Q46A 2P5YA 5JCJA 4NQZA 5A03A 2C82A 4M87A 1MLDA 4J49A 3FPLA 4TROA 4D44A 4TKLA 3C1OA 1UAYA 3ZWBA 3RC9A 4CLXA 4J43A 4CQMA 1HLPA 3AUSA 3E9NA 1P1IA 2YV2A 1LSJA 4IINA 3WICA 4WGGA 4DMMA 1GDHA 1L1FA 3Q1LA 4K9DA 1ZK0A 1JDJA 3JQFA 3JYPA 3BMQA 1EFKA 1OC4A 3IDSA 4YWJA 1E3WA 4CM1A 3L4BA 4UUPA 2NQTA 1B16A 2PD3A 2OL4A 1AHHA 3B1FA 3HFSA 1N9GA 2BELA 4I5DA 4E2WA 5HS6A 4NI5A 1JW9B 4MVJG 4D7AA 4YRDA 2HJRA 5A04A 1C0PA 5FYDA 2DBZA 2YZ7A 5B12A 3CTMA 3WGIA 1KVQA 1N92A 1T2CA 1GPDG 4W9NC 2YFHA 3MTJA 2JAPA 2IZZA 1VKOA 3AY7A 1QSGA 2C7GA 2QRJA 5GZ6A 5JY6A 2YV1A 1YH3A 2Q3EA 2ZYAA 1MB4A 2EV9A 4BNMA 3HADA 2WD8A 3PWKA 1YKFA 1MC4A 3A9WA 1KEVA 3PK0A 3G79A 4F45A 3C85A 3UCEA 4PG7A 2VOEA 3EGOA 4DL9A 3ROMA 2DPHA 4JX8A 1R0KA 1R0SA 3UXYA 1M76A 5G4KA 3RJ9A 3LF2A 3PIIA 4BUCA 4RZIA 5MGBA 1MA0A 1RM4A 3X2FA 4YEDA 5I8WA 3DBRB 5TF4A 5IZ4A 1PJ2A 4P38A 4XIYA 1H9BA 1E1MA 4BOYA 4OMUA 2CMDA 3WGZA 3GOHA 1V3TA 3PJEA 3JD2A 1LQTA 3S55A 3WGTA 3QY9A 1EQUA 2X86A 4ND5A 3E6AA 2FOIA 2I3AA 3G1UA 1UZNA 4RGBA 1LQUA 4BS9A 1JVSA 4CM3A 1N1EA 1G0OA 4RVDA 4AJNA 4NJOA 2G76A 3A1NA 3ZW8A 1X0XA 1X1EA 4KTTE 5BSEA 5L7YA 4E33A 4TSKA 1U4SA 2E6UX 2PR2A 2FSSA 3ZV5A 4ND3A 4O1MA 3WOHA 1ZMTA 3BMCB 3M6IA 2DUWA 4YT8A 1KEWA 2RHRA 5A05A 3ST7A 2DBVO 3CEAA 5JYEA 5JCJD 3KO8A 3UF0A 1IY8A 2G17A 2O4UX 2ZB4A 1A71A 1ZSNA 5JBIA 4NZ9A 3LZ6A 1LEHA 1VJ1A 3AWDA 1LI4A 4B7CA 4DRYA 5IAAA 5TNXA 1QR6A 1EBUA 5A5FA 1Z74A 3KSUA 3MTGA 5CAEA 3VPGA 4HFJA 3IJPA 3W8FA 3C7CB 4FIZA 3BMCA 3DTYA 3ZGYA 4OJNA 1IYZA 5GMOA 4BKOA 3E9MA 3VKUA 1S6YA 2DTEA 1ZEMA 2EW2A 4WLNA 2AQIA 4YT4A 1HT0A 4Z0TA 2GN4A 5JW6A 1ONNA 1SEPA 1YB4A 4BNKA 1E1NA 2EF1A 3DDNA 3PVZA 2D5AA 3ZN2A 2IYPA 1Y81A 3O8QA 2P4HX 3L9XA 4E6PA 4D42A 4Z3KA 4QUKA 3DC2A 3JCZA 1ADCA 4O6VA 3GMDA 2NU9A 2Y93A 3F1LA 5TGDA 3R1IA 5KKCA 5AVOA 5TQVA 3FI9A 3TL3A 1PJSA 1UZMA 3Q9UA 1KVUA 1DIHA 3W4IA 5L7WA 2Q4BA 4E2YA 5I7FA 1WDLA 1M6HA 3WNQA 3E82A 4PLHA 4FJ2A 1A7AA 4OXNA 5JFOA 3O03A 1GL3A 4URFA 1BDMA 1B15A 2WYVA 2P9EA 3KZVA 4YACA 2BLLA 3RBZA 3IS3A 4E21A 5AXBA 5JAZA 3BMQB 2H6EA 4GVLA 2HRBA 4J9VA 4M54A 3SBOA 1BVUA 2CDAA 2RAFA 4B3IA 5CFZA 4I9UA 4Q39A 4Y8VA 3GC6A 1E5QA 3EK2A 4WKGA 3TZ6A 4A03A 4H15A 4ZQGA 3KSZO 4OQYA 4BNWA 3HZZA 3W8EA 5A3JA 5IF3A 3WLEA 1XEAA 4BVAA 4J91A 3N58A 3WFIA 4DIBA 3JQ7B 2DU8A 1GCUA 3D3WB 4W7IA 5KJEA 4YJHA 2X9GA 1MUUA 4JBHA 3UVEA 1ZJYA 2EJVA 1HDRA 2EGHA 4PLVA 1C1XB 3HN2A 5L51A 3QJ5A 1GY8A 4YAJA 3INGA 3TOZA 1SOWA 3OQ6A 1SBYA 4AJLA 4B8ZA 1JN0A 1LUAA 1S7CA 3AM4A 4RF5A 3ZWCA 3O26A 4ND1A 1I01A 3L6OO 3Q11A 4QX6A 1YE3A 1ISGA 1NR7A 3LU1A 3QA9A 2BFPA 3SX2A 4B7XA 3OECA 5JYDA 1WZIA 3Q0EA 4O63O 4DC0A 2H1SA 3PHJA 2AHRA 4ZGWA 3U4HA 4P22A 2X6TA 4IJUA 1I10A 4CM8A 3RUIA 2FWMX 5HA5A 4E2XA 2BFAA 3LLSA 1F8FA 1NVTA 3PGJA 2B37A 4E3ZA 4EGFA 1TEHA 5KTKA 3NYWA 3I83A 2DFDA 3ICCA 2RIRA 1GFSA 1DSSG 3DQPA 1GQ2A 4Y67A 4EYEA 3D1LA 4OHUA 2RBEA 2I65A 1MXFA 1I8TA 3K92A 2FPGA 3NV9A 4LW8A 2I3GA 3AFNA 4IMRA 3WJAA 5CEFA 1XHLA 1F0YA 5ENDA 1TB4A 4QQRA 3SVTA 1P9LA 4R1TA 1PQWA 2H5LA 3MOIA 4KWIA 4CQLA 3HB5X 2WE8A 4WPGA 4XGIA 4BNFA 3NTRA 1WZEA 2D4AA 3OF2A 4IIUA 3ANNA 1MG0A 3S2EA 4WOJA 1SB8A 4BO2A 2GNAA 1I0ZA 4PG5A 4CUJA 4UUNA 3CXRA 3DOJA 4CLOB 4JROA 3QSGA 4CMCA 4NFYA 1DRWA 1XELA 4CQMD 3OBBA 3JQ7A 3E1KA 4OM8A 4XA8A 1Z45A 2FPIA 4YYZA 2VYVA 5CG1A 1VI2A 2EP7A 3W1VA 2CF6A 2Y1GA 5EJ2A 4ALKA 3K5PA 4CMKA 4PN3A 4CL8A 1GR0A 3S2GA 4CMHA 4PLTA 3PFWO 3HDJA 1KBZA 3H9GA 4YJGB 3WQQA 3PDUA 3TSCA 2VHYA 1LDYA 3PYMA 1LBEA 1K6JA 2PH3A 4E30A 3AY6A 4OKIA 4DA9A 5CPBA 3RUEA 2W2LA 4H16A 1DBVO 1R4MB 4BMNA 2W2LD 2EW8A 1WMAA 2C5EA 3NJ8A 3JYOA 3GZNA 1ADGA 1GYRA 1HE5A 3FN4A 4PVDA 3VC7A 1BMDA 1HLDA 2VWQA 4JBGA 4ONEA 3AOEC 1OAAA 5T6BA 2PLAA 2NNLD 3KLMX 3A14A 4LMPA 3WGHA 1U9JA 1I36A 1O0SA 2O50A 3ASUA 2FP4A 2PD4A 2PNFA 5BSFA 2GDZA 5JAQA 4PGFA 2JCVA 1R4MA 4CUKA 4YAIA 1P1JA 4IY1A 2PD6A 4GWKA 2RHCA 5DOVA 4IIVA 4CLEA 4J2OA 5G0SA 1FF9A 4DPMA 5IXYA 1JWAB 3TF5A 3KLPX 2DFVA 2GGSA 1DIGA 4PLCA 1YDEA 2NTVA 5B4TA 4Q9NA 4BB5A 4GKVA 1JKFA 6LDHA 1OOEA 1PTJA 3ANMA 4R4JA 1KVRA 4LRSB 2IE0A 3ITDA 1M75A 3JQ9C 3F9IA 3GQVA 1YVEI 3KSDO 1ISHA 1E3EA 1IULA 4Z6KA 1PR9A 1DHTA 5DCUA 2PH5A 3MJ4A 3GN1A 3Q3CA 4FR5A 1BG6A 4FFLA 3DZJA 1DLIA 5G0TA 3P5SA 3ONDA 3DR3A 4OOFA 4XQGA 5KJCA 3U09A 1Q7CA 1GD1O 2O3TA 1ZK1A 4Q3AA 4A73A 3IKTA 1PL6A 3D5QA 2VZ9A 2Q1SA 3GG9A 2VT2A 4ZD6A 4NG5A 4BV8A 1I32A 2HQ1A 1YL6A 3ZWOA 1N9GB 2Q1UA 4BO1A 4NU5A 5F3RA 3QWBA 5EERA 1R6DA 1C0LA 1SEVA 1M2WA 3WQRA 4ZU3A 2VYVD 3LQFA 1TLTA 4R1UA 4RQTA 1JWBB 4HXYA 2ZTLA 1VSVA 5CG2A 3VDQA 2IRWA 3HDYA 3U4IA 3AUTA 1J4AA 1YO6A 1Y8RB 2DBRA 4DVJA 2B83A 4S1VA 1GEGA 4RCVA 4EUFA 3K96A 4YRBA 1CF2O 2RH4A 2BGKA 2O3RA 3LC1O 2NACA 1EVZA 2G5CA 4JCOA 4NU6A 4XD2A 5KNLA 4EUHA 4LISA 1H93A 3OP4A 4CUZA 4ZA2A 3BTVA 1PL7A 2EHDA 3BMOA 3MJCA 2FR1A 4HFRA 1LJ8A 1GTMA 1PJ3A 1V8BA 1EQ2A 1CQIA 3AOEA 1HE3A 4O0LA 1GYQA 2FSVA 1P31A 1EK6A 1GEEA 2FRDA 1I24A 1B0AA 4OAQA 2EIHA 4A10A 2C5AA 4JQCA 5TIIA 5JLAA 4CL3A 1PGJA 3E9QA 4ND4A 4K6CA 4CM9A 2FZEA 3U5TA 1P77A 2JHFA 4M86A 4EBFA 4AJHA 3W4JA 4NBTA 4RPJA 2QZ9A 1ZJZA 3OEWA 1DRUA 4OXYA 2JCYA 2F1KA 3D3EA 5FWNA 3UGKA 4AJ4A 4B4OA 1B8PA 2IXAA 1WMBA 2WDZA 3Q9NA 4FQ8A 3P2YA 3ONFA 4J1TA 3EHEA 3CE6A 5I7VA 1ZNQO 5KJFA 2VYNA 3FHLA 5JC1A 4IMPA 1KY5A 5TJ9A 3QQPA 4P4GA 5DZSA 4KQXA 1CETA 3MOGA 3ZDFA 1H94A 2OUIA 4G81A 2VNSA 5B37A 3RUHA 1T4DA 4J7UA 1C0KA 1QG6A 4WEOA 5EINA 1Y7TA 2DVMA 4LCJA 1YQXA 3DZHA 3K9QO 2HMWA 5ILGA 3GUYA 1DDOA 5IG2A 1ZKMA 3H9EO 3JD1A 5TJHA 1HEUA 2D0IA 1YBMA 1IUKA 2V65A 3CZRA 3K2EA 5KCZA 1T1SA 3DHNA 3K2BA 1H9AA 4G65A 1UDBA 2HCTA 1QYXA 4FJ0A 1VJTA 4DXHA 1HDYA 3MCVA 3RUAA 3QWHA 4D41A 1LLDA 1U3UA 4ESOA 2PTGA 3V8BA 2EERA 4HP8A 3V1UA 2AQHA 2HO5A 3WB9A 4E13A 4MIEA 1IOLA 3P7MA 1O8CA 4L76A 4NIMA 2Y1DA 4DYVA 1IB6A 5JY1A 3JQCA 2BFOA 4OGWA 5F1OA 3KBOA 1PJBA 2VQ3A 1C1DA 4KMSA 1LDNA 1BDBA 1TI7A 2NV6A 3PTZA 3S1LA 1VC2A 5G0WA 4IZIA 3X2EA 5T64A 1NAIA 4XIJA 4EEXA 4MVJP 2C29D 2NTJA 5EESA 2DAPA 4BGEA 1LDGA 1XQ6A 1SO8A 3JQFC 1B8VA 4GX2A 1PGPA 3EZLA 1DFIA 1UXKA 4BMSA 2Z1NA 3I4FA 5COAA 5H83A 1NWHA 3GFGA 4RVHA 1VPDA 3O4RA 3FR8A 4I1IA 1D1TA 5K6AA 3JD4A 3HE3A 1PWZA 1X7GA 4MDHA 2BKAA 3BMNA 3L07A 2FMUA 4GLOA 4AJEA 1M6WA 5L53A 1SC6A 5A1TA 3KETA 1ULSA 4LVUA 4TWRA 2GUGA 2OZPA 3DBRA 3NT2A 1MFPA 1ENYA 3DWFA 1YRLA 3HFGA 2QRLA 1QXSA 1GZ3A 1XR3A 5F5NA 1IZ9A 4FD3A 4L4SA 4HFMA 1Z73A 2C2YA 3C8MA 1ULUA 1XWFA 2AE2A 3UICA 1BRMA 2E37A 1L7EA 4IDAA 4M89A 3ZHXA 3TNLA 1MGOA 3NUGA 2WM3A 4XYEA 4I5EA 3S8MA 3QP9A 4BNVA 1R16A 5L40A 2FPPA 4CLRB 3WYCA 3RVDA 3TZCA 4CMAA 4E5PA 1E5LA 4I5FA 4FW8A 3RUCA 3W6ZA 4LK3A 1T1RA 4CMGA 3GPDG 1C1XA 4HADA 3L6EA 1T2FA 2C2XA 2ZCUA 1F8GA 1ONOA 3K30A 1XYGA 4CPDA 1SOVA 1BXKA 1DB3A 4YXFA 1I2ZA 1ZSYA 4C7KA 1C14A 3B20A 5TRTA 3GNQA 4PRKA 3EYWA 4L8VA 1I2CA 1HYHA 1T2DA 1GUFA 4MPDA 4NK4A 4D79A 3VPXA 3RC7A 1NVGA 2FZWA 4FC6A 1ENPA 3GVPA 5TS3A 4ZQHA 4K28A 1OC2A 1CJCA 4DYDA 1JAXA 4YAKA 3JYNA 5I9LA 2CSUA 2GF2A 4QXMA 1B26A 1XKQA 1O9BA 4J7XA 4UEOA 2GERA 2J8ZA 3OMLA 1FXSA 3RUDA 2PA3A 4YB8A 3WLFA 2JFGA 3O9ZA 3V1YA 5JPIA 4BB6A 1PS9A 6ADHA 3I1JA 1X0VA 4CQMB 3AI1A 4ZQFA 5JDCC 1NAHA 1DEHA 5IN5A 3LF1A 3HHPA 7MDHA 1A9ZA 1SNYA 4E5YA 2X9VA 3GRPA 4WCFA 4H3VA 4MP8A 1BHSA 1FDWA 3DBLA 3OEYA 2VRCA 5B4UA 3K31A 5BNIA 4PVCA 4TVOA 3JQDA 1JAYA 5G4LA 3GGGA 4DMLA 1NNUA 1T2EA 2O2SA 4DC1A 2EKPA 3CMCO 4FFPA 2VOJA 1UDCA 2NU7A 2DC1A 4ID9A 1IPEA 1NQOA 3DZGA 2GYYA 2J5QA 3RCBA 3AUAA 3QW2A 3SJ7A 2WD7A 4DBZA 1PL8A 2B5VA 2VWPA 3GG2A 3RROA 5JXWA 2W98A 4CV3A 1E7RA 3JQEA 4FFMA 3DBLB 4JLWA 4DLBA 3AM5A 1ZBQA 5KIAA 1LSOA 5IDWA 1T24A 2VT3A 1PX0A 3H9JA 3HG7A 2X4GA 5U9CA 3WWYA 1V35A 2BH9A 5A9SA 3DZBA 3D5TA 2I76A 5I8ZA 4PLGA 1WDKA 4TKMA 4XX0A 3VTZA 3ONEA 2B69A 4QO7A 4FCCA 4F6CA 1HRDA 4FBGA 5THKA 1C1DB 5KVSA 3TL2A 1TVEA 5ICSA 1OZAA 2IXBA 1TT5A 2PV7A 3OA0A 3EC7A 1XU7A 4M8SA 5AXAA 5I9NA 4IXWA 3L6DA 2VRCD 3A06A 2BFMA 5EQDA 1HETA 1N7HA 1OI7A 4HY3A 3KXDA 3GEMA 2H63A 1ID1A 2B4QA 4J4TA 4PLFA 4WLUA 2HJSA 1I30A 5A06A 5JNLA 3GZ4A 3C7DB 4GI2A 2I5PO 1NFRA 1H6CA 1CIVA 3ADPA 4YJHB 3IP1A 3ZW9A 4FGSA 1ADBA 3MJEA 5CPFA 1BGVA 4TRMA 3ZV3A 4BNGA 3CIFA 4YJFA 4JP2A 4RO0A 4JBIA 4FB5A 2D59A 4E5KA 3RC2A 1AHIA 1EVJA 2OBYA 2B35A 2FY8A 5H81A 1E6EA 4CM9D 4EITA 4BO5A 2NU6A 3WSVA 3GHHA 4MKRA 4PZCA 3RKRA 3WFJA 4PIVA 4E32A 1HTBA 4CJXA 1Q0HA 5AOVA 3UW3A 4BNXA 3LVFO 1Y5RA 3ORFA 3BA1A 1Q0LA 1E7YA 3VAZA 4RL6A 4ND2A 2VCYA 2X23A 2Y1OA 1B14A 2JD1A 1KY4A 4GMFA 3B1JA 5MDHA 1LSSA 1U3TA 2B36A 2PZKA 3T4EA 3F5QA 4KUHA 2Q99A 4O59O 5JO0A 3WG9A 1CYDA 3H5NA 4J0FA 4FFNA 4MO2A 1IZ0A 2I99A 2NQ8A 3ZU4A 5HWSA 1F06A 2Q49A 1CEQA 4HKTA 4IQ0A 3E48A 4HV4A 3EVNA 3RBVA 2NVBA 1WW8A 2D8AA 3I4CA 4RV9A 3ULKA 4BNZA 5L45A 5C5IA 2I9PA 5DBGA 3F47A 2P9CA 4D0RA 1TT7A
chains in the Genus database with same CATH superfamily
2WSIA 3EQ2A 2JH9A 1V5FA 3E03A 5EHXA 3F3SA 1EXVA 4OFXA 1ESDA 1FTYA 5SY9A 4Q1EA 1NUPA 1SD5A 3QMMA 1ZD3A 1EWYA 4WFQA 5DCWA 1Z16A 2FUNB 2P8JA 4EEZA 4O3MA 2I78A 1BXGB 5E6UB 4DFDA 1JMKC 3NRJA 3BB3A 3NNDA 1PVOA 1UBUS 2KYRA 4QG3A 3K6RA 4F71A 4FGLA 4M53A 3AQ4A 3UJCA 3RAGA 4CQLB 3AKEA 4CKWB 4G0XA 3W2GA 5D5HA 2XYGA 4FFRA 2WFAA 4L85A 3W5AA 5LA6A 4I55A 2J9ZB 4UTPA 3M2TA 1XTQA 1Q22A 4IUDS 5AK0A 1BJTA 4ZYWA 3L6RA 1ODIA 3RRJA 1KNQA 3JYHA 4LNUA 4NYJQ 2YRWA 4EENA 1I3KA 2ZAMA 1WMSA 1KMHA 3CLUD 2ORYA 2AN1A 3N2EA 1KS9A 2JGJA 3NFRA 4AX4A 3ZDDA 5T4EA 4W8OA 1K7FB 5BSVA 2VXCA 3VVMA 2R7LA 1KHTA 4HNHA 4F5ZA 2CXOA 2CB9A 4N54A 4XLLA 5CT4A 4PG8A 5IYZB 4P32A 3W8RA 4DQ0A 3BH6A 1W0JA 4GM4A 2ZRIA 2JFHA 3CPSA 4IIXA 1MX9A 2A9PA 2QJFA 3GUZA 1EUCA 2W37A 4HAWA 3KUDA 1NBEA 1SZJG 2BEJA 2JHGA 1N7GA 3HJNA 4FYXA 1VIYA 3OHSX 1XCOA 2V7WA 5T4FA 4B40A 1MZPA 3EODA 3DMFA 3OPMA 2HMSA 3R3SA 5A4IS 1YRBA 2ID4A 1EFCA 4EGCB 1FK8A 1JVNA 1K97A 4DG8A 5C3MA 4IFIA 3G23A 2BZSA 3KYDA 3K94A 4Q1FA 2GTHA 3IHTA 4PAOA 3UJPA 4HN4B 2FX3A 3ZY4A 4CIAA 2BFDA 1NVDA 3BL6A 1EE1A 3LP6A 3F49S 4P53A 5TLSA 1KFJB 1SCNE 5KWIA 4MW2A 3HP1A 3HI6A 1P2FA 1L5MA 4J0HA 3WIDA 4ZAZA 3TBHA 2IP2A 2YDYA 3RRNA 2EZ4A 2PN1A 2KLBA 4RNCA 3EEOA 2EX0A 3HQ4O 3KT3A 1QPGA 1XI2A 2H1OA 1CSEE 4JIGA 2FR8A 1BW9A 3HHEA 2JB9A 3PCXA 3PIDA 2G1UA 1Y48E 4WXHA 3GV0A 2RHBA 4PZAA 1WP4A 1F17A 1S1CA 4MCIA 2RJ3A 1VSUA 4TN1A 3HCOA 4BKQA 5HX7A 4F2DA 2O7NA 4UARA 1KOFA 3LHKA 2YN0A 4W99A 5AI6A 1FDOA 4O5AA 5KOHB 3KSBC 2J3KA 2AMLA 3DKIA 4R1PA 1YBHA 1SH7A 4K40A 2AZMA 3AEYA 5CLFA 5IKMA 4LOHA 4RXTA 2YWJA 3TFOA 4IKEA 1NFFA 1D2MA 4WJLA 4CKWA 4EPYA 3O4GA 3O9MA 1KQFA 1VLHA 5FKJA 4NABA 2GFHA 3VDMA 1E9SA 1MJ5A 1Y4SA 2AV6A 2OCXA 5AYVA 3GBPA 5T57A 4UKDA 3VRHA 3VZCA 1ZGZA 1S3FA 3AHGA 3K1AB 3O8OA 1TVKB 1FDVA 5GTDA 4YX9A 1AZSC 1Q1BA 4TMFA 3F8SA 4G84A 2HD4A 4OLFA 5EMKA 1FDUA 1UDAA 5FOUA 4AN4A 4D80A 2ERYA 4IQ4A 3AB7A 3SPXA 1M66A 1LWNA 1CDOA 1RKVA 5CLJA 1LBQA 1DIBA 1PNTA 3RS0A 3W4KA 5JPCA 4FNMA 2AEJA 2BP7B 5ER6A 3VO9A 3CTPA 1YJBA 2C59A 3A4MA 3PE6A 5JWOA 1P1CA 2VUSA 4OEHA 2WU0A 4D82A 5KOJA 3PUWA 2WFMA 5JSZB 3ABOB 4OSOA 1ENOA 3QVVA 3WL8A 4BTLA 3ISJA 3OOYA 1N75A 4K6GA 4B2IA 1G38A 3TRIA 1O6GA 2XVMA 1JSLA 3ESDA 3LVBA 4TS3A 3RRFA 1MNAA 2JARA 4BVGA 3HCRA 1N5RA 3H42B 5KNCD 1JIKA 2Q1WA 3SLGA 4M88A 5E1OA 5E4YA 5CLQA 1UT5A 2HADA 1BO6A 3CRW1 8ATCA 2PX8A 3JU3A 3MJTA 4TKZA 5F73A 3RT9A 3PZRA 1CWUA 1EAMA 1OZHA 5DXAA 3KUUA 1D2NA 2FYTA 3NAGA 2INGX 1U2TA 3WBFA 5BUSA 3U44B 4CM6A 2WT4A 4OAQA 3GGJA 4PO1A 1H4TA 1G2PA 4I08A 3NPMA 4JODA 4UM9B 2QQ5A 1E69A 4TMTA 4XXHA 4FMBB 3HDQA 2WQ6A 2GI4A 3VBEA 3QKSB 4QFCA 1UZLA 1X94A 1FLVA 2EZTA 3GEGA 2FXVA 1D1QA 3HUEA 2R1VA 4ALJA 1CR2A 3LWNA 1NI3A 1SG0A 4XJVA 5GONA 4QARA 5HEKA 4ERNA 1USWA 2ZREA 1YBVA 2JATA 3NHAA 4P7JA 3T5MA 2C42A 3OLYA 3K7EA 1D2RA 2PGDA 3JR3A 2O5RA 2QGZA 3MSCA 4MAAA 4NULA 5H7XA 1ZUIA 3O0DA 4PC2A 1Z6TA 3JALB 5I47A 1Q7TA 4MVXA 3TSOA 2DWCA 1SXPA 3NALA 3BYZA 1U7WA 3M1IA 5CVTA 5HKKD 1PYOA 1IN7A 2IUUA 3VR6A 1W0CA 2FE1A 5E3IA 1ORWA 4QASA 1M67A 5ANRB 2Q4EA 2YW9A 1GUDA 2OPHA 1GPH1 3KQMA 1G8SA 5KTYA 3L79A 2P9GA 3GFBA 1Q0TA 4YJ3F 3TLEA 2B7CA 2ZYSA 2RI1A 5LMNB 3KUCA 1X77A 1NVWQ 3FPFA 1Z0FA 3GJTA 3OZRA 1WETA 5EE0A 1I6WA 1KEPA 1H8HD 1YD7A 3AUKA 3GEPA 3KQSA 5IHPA 5AVKA 3G2HA 2ZAGA 4QTYA 3BE8A 2V3CC 3C98A 4C6RA 1QWOA 3ETDA 1M6EX 3IILA 2LXNA 3FYTA 1JIXA 3MM4A 3MMSA 3K0CA 4JHLA 5TJHA 5KTMA 4DLVA 1IHXA 3VC2A 2ZBQA 3NM6B 1C7FA 4S12A 2UUPA 1W7AA 1OILA 4Z7NB 3B6ZA 2VZ8A 1QIGA 3PDIB 4G26A 5JDIC 2WJPA 3CF2A 3TKYA 1BCRA 5FPKA 4IH1A 5DJ5A 5IPFA 3PEUA 3V7YA 2PVPA 1YDMA 1FYVA 1XHEA 1SBCA 3ZNPA 1EWTA 1UEXC 2R8XA 4EP1A 1L7DA 1DC8A 1NG1A 1ESZA 3CWCA 3OZIA 4LE0A 1ZFNA 1OHHD 3WB9A 4ETNA 2ZJ4A 4RCZA 3IUEA 1VL5A 4F2PA 4MGKR 3PLNA 3TG8A 3RO7A 1JR3E 2I87A 2XT9A 1X6VA 3PUVA 4KZPA 3L0YA 1N3BA 2PXXA 3I9KA 5ECDA 2QMHA 3E9EA 4ZI3A 5JD4A 1UR5A 4P4SA 4P80A 1T43A 3OQJA 4X85A 1F4PA 2PO7A 4CMEA 1W5BA 4FS3A 4GI5A 5JQGB 3FDFA 5KX5F 1HF3A 1C3XA 3EZGA 3KYBA 3FYSA 1V3QE 3KQQA 2I7VA 2YJZA 3BRWA 3LJKA 3B5IA 4Y2GA 4WFJA 4XQ9A 3OT5A 1T9GR 2ZYTX 1A88A 3PG5A 5GONF 2C9MA 2W6QA 3LECA 3NMUF 2Y71A 3ND9A 1GV1A 1S2MA 3QOXA 3KQHA 4ZVKA 3IA7A 1VMIA 1UPFA 3SC6A 4JUFA 5BMVF 5KTSA 1W93A 3FPCA 3EC1A 5LQUA 1WOMA 2NU6B 2X5XA 3SKYA 5I7UA 1QHGA 2RJNA 3FAZA 2CF5A 3DFUA 1I2AA 4C43A 2ZJ7A 3I5AA 2C8VA 3KXPA 1G8GA 1P0FA 1YS6A 3E22A 2E4YA 2ZIFA 4J4BA 3W3ZB 4ZCRA 2R0QC 1E6KA 3WLJA 1KDOA 2XOEA 3TZKA 1FJHA 1HG0A 1A9XA 2H4ZA 1ESCA 2CBGA 1CS4C 2HJHA 3EC2A 5GAJA 4KKXB 4OP1A 3RASA 2O1SA 3ZWKA 4ZGGA 3EXAA 3SIPA 2QF7A 1FQWA 3COPA 2ATEA 3LUKA 3OFNA 4ZVMA 4C9BA 2PUDA 3LYUA 4JGBA 5CX1A 4WJZA 3E18A 3EXIB 3QV2A 3DZKA 4H2DA 5B58T 5DTMA 3TH5A 3W06A 3DA8A 3IE0A 4AJ1A 2PT6A 3GNSA 4X0EA 1AU9A 2YTZA 4MUEA 2DM6A 5BN3A 3JVEA 2X8LA 2ZT8A 3V46A 1GTZA 1NRWA 4H1VA 2LUOA 2BDUA 2W8ZA 1QM5A 1PT9A 2VJKA 3V1NA 3WL7A 4BPRA 5DP1A 3EXHA 4LSGA 5C32A 1PK7A 4TKUB 5B5SA 1XFDA 1C4OA 3DQZA 1X1BA 2JKVA 1ZOOA 2B1QA 2QD3A 2QUKA 2ROQA 2WD7B 4BVHA 5KQSA 1PE0A 3MWFA 4LOJA 3P9NA 3GLGA 3IPLA 4ZOAA 1CYEA 2X0FA 3B12A 4X1YB 4NDNE 2BFCA 2R00A 1JF8A 1R4NB 3ODGA 1W73A 3FRJA 3ZZNA 4LTMA 3FCOA 4ZTZB 4QU0A 1K75A 2QBYB 4XUEA 2VHVA 2VIIA 1LI5A 5AK4A 2ZZNA 1OYOA 2H2AA 4BN4A 4KH1A 4GMGA 3EE6A 4XUDA 4LXYA 4JVNA 4ROSA 2C9YA 1QHXA 1D2AA 3JVDA 4XIFA 1FFHA 4QOFA 3WYDA 1P2UA 5LLSA 1AV6A 1A69A 4KPFC 4FGWA 4YJDA 2RHDA 1JU4A 2B82A 1Q7BA 4KXWA 4PLYA 4KR2A 4X61A 4L9RA 3IYLW 4ZDKA 2VPXA 2BE9A 1GRRA 3AF2A 3DKPA 4E5NA 2J5RA 2ENWA 3Q7QA 3WIEA 2C7RA 3QFTA 2C4KA 3H6GA 1EE9A 2HAEA 4Q4LA 4IDGA 1IJBA 3I5UA 5WRFA 4CIBA 4ENVA 2A2ZA 5J23A 1NE2A 2UXDB 4TTRA 3UHAA 2XYPA 4IGAA 4ESEA 4ER5A 2M1XA 4H27A 4LJ4A 1CE8A 3BA6A 1LA2A 2BHRA 2M1ZA 5DNDA 3UK1A 5EJ9A 3LCJA 2EG9A 2CHGA 3WS7A 5JATA 1WKCA 1YQUA 3FOEC 3ZDCA 2QMQA 2FLKA 3OQHA 3S81A 1DQZA 4AJJA 4YLYA 2K4MA 4W1RA 5ERGB 4ABTA 4NYMQ 1DARA 5TMEA 1OI4A 4CT4B 3CLRD 2Q4RA 3HRKA 2FDXA 3WYNA 4BBJA 3MTIA 1QV7A 1D9XA 3OX4A 4TMVA 4ZYZA 5BNWA 3VR6D 2J5KA 1TF2A 2VJYA 2WABA 1BIFA 2J9XB 1NQAO 1NPYA 4Z0PA 2GBGA 2VDUE 4OQ4A 3P2KA 4IIJB 5F3DA 4LRTB 3LS2A 4YUYA 1J00A 3EGIA 3T7IA 1SWWA 1ZJ6A 2XGMA 3UJHA 4ES6A 9LDTA 1RFGE 3EMVA 3DNPA 3FUVA 4Q3BA 3DH0A 4YRMA 1AMUA 3QVTA 3WSTA 1A9YA 1FYEA 3HKBB 3IXMA 4RMHA 1J1ZA 1U31A 4Q24A 1E79D 1TKAA 1IUOA 1SULA 2DZDA 4GX0A 3EEFA 2WHXA 1Z6ZA 2I4NA 3I0ZA 3A9VA 3DXXA 2RCNA 4Q19A 2WWRA 5CEEA 1ISIA 4U6NA 4KQCA 3SQNA 3IEXA 1PTKA 2UUBB 2IA5A 2I55A 3F1KA 4S0XA 5LC1A 4BGUA 3BAZA 1A5SB 2CFCA 1E7QA 1OPRA 2C58A 4WXPA 1S8AA 2BEUA 2HUNA 2AZDA 2OLJA 2Q5IA 3NDIA 5JBNA 3DDSA 3IX7A 3JQ8B 3L7MA 4UVDA 3WL4A 1E7MA 1RWKA 3PA6A 4YRPA 1W94A 2J7PA 4REQB 4CG3A 2OZVA 4EG7A 4KAAA 3K0EA 3EXEA 1V1MA 1QK3A 4RD3A 4RETA 5U4XA 4YJGA 5CRIA 2JAOA 3MG9A 2WJ3A 1KZYC 3EFOA 2CNNA 1TYAE 2A9OA 5T8KC 3VX3A 2EFJA 3ZXIA 5GINE 2VP5A 3NWPA 4K9SA 4MQFA 4AL4A 3DC7A 1Z3IX 1ZIXA 3ZDQA 3RUFA 1T3GA 1SRRA 4QAJA 4J3FA 4UU7A 2IV3A 3H1GA 3A6HA 3LC2O 5LR6A 4RY0A 5DTJA 3H2ZA 5DIFA 3IOYA 4AYWA 1E8NA 5FLXA 4PPYA 4CIDA 1UP6A 4WCFB 1GA1A 1T4CB 1PN3A 3AR8A 1MOSA 3PWZA 3U3RA 5HTOA 3RFTA 2YCBA 4ZCPA 5HNKA 1DTWA 5M3BA 4MIOA 3OT4A 3RYFB 1ETUA 2AH5A 2KHZA 4BLRA 1UDWA 3BCRA 3UMSA 4CGZA 1K8YB 3U4AA 3MRSA 4ZO9A 4RJKA 1DJOA 1SWVA 4X1KB 2V7QD 1YBAA 3SI7A 3K70C 2PZGA 3QPDA 4I19A 5JS6A 1R37A 4NH4A 5AJTA 1Q0UA 3VZSA 3VMMA 1TXGA 4C3ZA 3MB8A 1QYIA 3ZLJA 4AUMA 4JWKA 2OD7A 1C2TA 4UM9D 1NF8A 2DT5A 1PZFA 3SSNA 2JD0A 4Y1EA 5CFNA 2ZM6B 1QJ4A 2DCMA 1GG8A 5F64A 3PXGA 3HB0A 5JCOA 1EJ6A 1GPAA 2WNIA 1W87A 1A5BB 4FE3A 4U8GA 1ZUHA 1KOLA 1D7OA 1QP7A 3SEAA 3EDQA 5FNZA 3PUZA 5JRJA 4CFYA 1HUQA 4ZVVA 3K09A 3WSWA 2AG5A 3GA5A 1VPEA 2X6RA 3WGYA 4JVMA 2ODTX 2Z4RA 1K6EA 3WVNA 3N07A 2H48A 3JATA 1YE5A 3EIHA 4H60A 4LQCA 1JDPA 3ZIAD 3C48A 3TCNA 4HGOA 4BJHB 2AFIA 1ISSA 1T9BA 1GGJA 2QEQA 3AEKB 4M7RA 3ZHQA 4F93B 1DG9A 1KYVA 2HOQA 5KNDH 1UIRA 1T8YA 5AVTA 3GAFA 3WL6A 3CINA 4A0FA 3FVRA 5DHSA 1AKTA 4GR5A 4X71A 1JEJA 2ZVPX 5C8DA 1YUMA 4L16A 3DMTC 1IVSA 1KR5A 1LBIA 1JH9A 2BBWA 3AVQA 5EJGA 2LNDA 3U6KA 4POAA 1XZQA 1JILA 4KL8S 8OHMA 3BD7A 4LV6A 4RMJA 2X3UA 1Q92A 4LZNA 1Y3BE 2Z8YM 3A6GA 3UAZA 2HX1A 1N5MA 1Y8QB 3LCVB 1EA7A 2IEAA 4LGCA 4PYIA 4C0SA 1XLVA 2WP0A 2O2YA 3GY0A 1XDSA 5JJCA 3H5AA 4A27A 1C0IA 2JCXA 1ZD4A 4I2VA 5AIBA 1SCUB 2QJRA 1U3WA 1AUPA 1NI4A 1XAJA 1PJLA 2QTVA 5A0VA 2XCOA 4P4TA 5FWXB 3SSOA 3ZWVA 1MEEA 1VB3A 2JAUA 1U8EA 2P4SA 1MD9A 3H18A 4R2IA 3GEDA 2F4NA 3GBSA 2VSNA 3FNHA 4XSGA 3PFNA 3OHPA 4N4AA 1G7RA 4UCXA 5AUQA 4KVZA 2CL5A 5LQRA 3GDHA 2PWYA 4FEAA 1U4NA 4JQYA 1V8ZA 1ODSA 2VK4A 1DPGA 2K87A 3WIBA 1L5VA 3COSA 2Q0HA 3UWOA 1GNSA 3MAAC 3A0UA 5EE5B 4Y6PA 4G1BA 3WTBA 1N0HA 2AQ8A 4EJ0A 4YRKA 1OUMA 3Q7SA 3RSHA 1QTRA 1GGKA 4ZT5A 1KJNA 4D0GA 1KBOA 3SKXA 2D2FA 3EA0A 5CA1A 1T9KA 2C31A 2FP4B 4KYUA 2W2XA 2OHGA 5FUVA 1KVSA 1OAKA 4C2BA 3EW9A 1PKXA 3H9QA 4N0QA 2OHOA 4PC1A 2SHKA 1AKYA 4MDEA 4HDOB 4J94A 3HXMA 4GXRA 5DE3A 3G0IA 2PVCA 1HL7A 5BVHA 5LKAA 1KAOA 1VRWA 4M8IA 1ACMA 1Y6JA 3I52A 5F5LA 3ESYA 3RARA 1G5TA 4JP1A 4QUEA 2RAPA 2QU8A 5G3YA 4DRZA 1GVNB 5AK3A 4LIPD 5BSRA 2BFBB 4PZLA 3KVRA 5LQKA 1Z63A 1DIAA 3GGSA 3ELUA 5DSXA 4QVIA 1ZH2A 1GYPA 2CYCA 3UC5A 1SU7A 1C8LA 2QPTA 3AJRA 16PKA 4K8OA 2R96A 2NVUA 3WGGA 2Y1EA 4EW2A 2A33A 1W6RA 2RGCA 1SBZA 1SN7A 4LRWA 4F0JA 3DNMA 4YAEA 4JJKA 1TQHA 2DBYA 1SKQA 2YV5A 1YS9A 3GD5A 4PZDA 3AVYA 3I1IA 1AXEA 2JJ1D 1BXRA 2V6FA 2ZRGA 2IHBA 3E4CA 3K16A 5JHHB 4CLRA 2H9IA 4WZAB 1YJ5A 4LRQA 5EUBA 1H9CA 1MN6A 3ETGA 1SVUA 3L0IB 2YS7A 3C7KA 4HDMA 1M6VB 3NGMA 4G1VA 1Z2CA 3T5TA 1S01A 5K3SA 1IE3A 2GZRA 4H77A 4NNJA 4P4UA 3O82A 1O03A 1EP2B 3CJRA 2B78A 3D4NA 4IG9A 4ZAYA 4ECEA 2VP0A 2A9VA 3DSRA 3T7SA 5J4VA 1DRVA 5B55A 2W11A 2A5JA 4BFZA 3TO5A 2EJBA 1W52X 1JIIA 2B4RO 4JZKA 2OWEA 3D6HA 4PGGA 4CXMA 1NTRA 2BFDB 2X1LA 1O94D 4D3YA 5LJLA 1TIKA 4IICA 3UAGA 3HLYA 2R62A 3H5LA 5KOYA 2VT7A 2XADA 3KQYA 5ALRA 1R12A 4LRUA 1PZNA 4YQYA 2VF2A 1IY1A 4YT5A 2PKQO 5IFLA 2P6RA 4H7IA 2H4FA 2D3TA 1K5DA 4HGQA 3AETA 4UNPA 4N7BA 5K0FA 3OG9A 3I2KA 3I4LA 4ENWA 5IX8A 2HJ9A 3CPHA 4HDRB 2GTIA 3UKOA 3CEMA 1ZCAA 4I9NA 4IQGA 4NKRA 2ZXEA 2W70A 3ZVKA 3RLFA 1HYEA 4W6QA 3RI3A 2G6TA 1E4YA 4BJ5A 3FUTA 3KFVA 1UP4A 2EAUA 3ENZA 3TQTA 4N18A 5LQCA 3VXKA 2OCPA 4EJMA 5JMPA 1K0UA 5EQFA 1HDGO 4JEMA 1FSGA 4Z3DA 5K05A 2JLAA 2AI1A 4JENA 1PYGA 2F1HA 4UM8B 5AKZA 1ABBA 2IYEA 1I0LA 4E51A 1GUZA 3IAHA 1GLGA 4CCAA 4OXIA 4HWTA 5I9TA 2C00A 4QOEA 1QP8A 1ONPA 1EEXB 1TIPA 1JHRA 1JUDA 3NBZC 3NUZA 1U0TA 3IEUA 3ZU5A 3ID6C 3L8ZA 2IYAA 2WJYA 3IDOA 2UXBB 3C3JA 3SDSA 3KYCB 4LMRA 4B34A 2QTNA 1HTWA 2RHMA 2ZYUX 4BMDA 2KPOA 3OSUA 5ALMA 1ZMRA 1UXIA 4AULA 4HNUA 3NC4A 1OYVA 2VHUA 3MEQA 3WZ2A 2UV8A 3DQQA 3JYLA 2WWXA 3NHKA 2Z8ZA 1JGTA 3AOGA 1H2EA 3MBIA 3O4VA 2REQA 4JDPA 4M21A 3DAGA 4IXTA 4M37A 4JSYA 5DNEA 4ZAVA 2GF0A 2PSHA 3LT0A 3DV9A 1CJKC 4PM4A 4HC4A 2I6TA 2W6OA 4WBXC 3VPBA 1QKIA 3QY0A 2HUPA 1NR5A 4L5AA 4U9IS 3H1AA 4WACA 5I7EA 1P4AA 4P08A 3VTKA 1ZD9A 3BD9A 3ZG6A 3ABIA 1U7OA 4BQRA 2B99A 2NSHA 1PGOA 3RJ5A 5KYYB 1KRWA 3ZHYA 5D86A 2PKXA 4ENUA 3G2IA 4U8HA 3JD0A 1SCBA 4HDSA 1EM8A 4HMPA 4XPIB 1PG5A 2ZROA 4J1QA 4BLUA 3JAWB 1OVGA 3NUQA 1CRPA 4R84A 2G09A 3ITKA 4Y7DA 3WYEA 4QGHA 1JZTA 3ZHUA 3JRXA 4DLSA 1I7DA 1EB9A 2BP7A 2V4UA 2XZDA 2XB6A 4N49A 2V6MA 4C22A 3BHMA 1XDDA 4URHA 2Q6OA 3U4GA 2H29A 1GP2A 4TXNA 3GHYA 3NIFB 4OHBA 5LP6B 5BQFA 3UJ9A 2PS9A 4AWBA 3WDKA 3GGOA 1JSZA 2DWPA 2OK7A 4XTCS 3VTFA 4DV5B 3GGPA 2B4TO 3LY5A 2OBBA 4XCVA 2GAAA 5TXGA 2A3RA 3AF6A 2TMGA 4J0EA 3USES 2Q0XA 3E9DA 5JROA 1XQYA 3AONB 1DC4A 4AICA 1IVNA 4Q4AB 2A5FA 5I9MA 2ID8A 5PNTA 1O7JA 4C0JA 1NW5A 1GUYA 2ISQA 4KO8A 1X9HA 2LIVA 1WVIA 1PNOA 3WMFA 1EJBA 1E9CA 1KOJA 1NFQA 4LXIA 5HRCA 3CT6A 1DKLA 2QRUA 3ORSA 2D00A 1VE9A 1MABA 2QW8A 2QD1A 3G89A 5AK6A 4K9PA 1OD6A 2JC3A 3D3JA 3KVYA 1B3BA 1GQQA 1NHGA 1E1YA 2D7CA 1UT8A 1A2BA 2WUFA 1RMYA 4FC7A 3CCCA 2C98A 4X3OA 3TWOA 3W6OA 3MTBA 4QDZA 5ARCA 1IXZA 2XDQA 3VPHA 3R0VA 4MV7A 1FQOA 1JKJB 2WM2A 3GRVA 4UBNA 2Z2IA 3W90A 4F85A 2LWIA 4MYUA 5BOSB 4HDSB 5FNVF 4F6RB 4M1OA 5L3SA 1KPIA 1M0SA 1SFRA 1UFVA 1NQ5A 3GL9A 4YNBA 3QWFA 3NDRA 5IH3A 3I53A 4YDRA 3PLAE 4ER7A 5B4VA 4N6OA 2V5VA 3BORA 3L92A 5CW1A 4ND8B 3K0CC 1XCGB 3LQKA 1ODLA 1Z29A 3NHSA 5EHQA 1KAMA 2GN1A 4MULA 4QUJA 2BAGA 1JEYB 3OUTA 5I4CA 1SPBS 4GC9A 5IARA 3WRVA 3D8RA 4LZWA 4P5PA 5GVRA 4U7DA 2G82A 1JXMA 3UMYA 1UMBB 3PHGA 2KLHA 4LHSA 4LJKA 2J3IA 3KEFA 5AXCA 3ZZ1A 4QHYA 3WK6A 3U61B 1L7OA 2PKRA 1A2OA 4MS4B 4XDGA 2PL1A 3L7CA 1Q95A 5K4GA 2B98A 1WP9A 3SEQA 5IDXA 4KR7A 3DPSA 3JQ6A 5IXSA 2BGMA 2Y3IA 4LRXA 2VYCA 3E5HA 2VPZA 2WTXA 4NYIQ 4QUHA 1YCFA 5FBHA 2QWXA 4MW7A 1U3GA 1TT5B 4WZ6A 3KL4A 1NN3A 4RC9A 1QAQA 1MO2A 4AJIA 1LX6A 3GH3A 4I4CA 3U6BA 3F46A 4EKEA 1RU3A 2RARA 3HR7A 4RESA 5EJMA 1T3SA 3NBFA 2DYKA 4GZMA 5HE8A 3SNKA 4JKOA 4WOKA 3H5IA 3QHQA 5KHOC 4QYIA 1L1QA 2C2HA 3ACBA 5K0GA 3BXXA 1OFGA 1XWWA 2Z2YA 3PRYA 4W6ZA 1LFDB 4WXEA 3TI9A 3WDLA 2PHZA 5C53B 4GYWA 1ZVQA 4Y9DA 3IMEA 3GJ5A 2HDHA 3LI2A 1P5RA 4KODA 4DLLA 1IQPA 4C0QC 3EISA 5AM1A 3B5EA 5E9AA 1GT6A 3K53A 4ACBA 4KR3A 3I3SR 2NVWA 3QQ5A 2QT9A 1U3VA 1L4FA 1ZD8A 4L07A 3NKLA 3U49A 2FK8A 1V7PC 4MO9A 1ZW1A 3W79A 1UUFA 3IQEA 3VNBA 1JQLB 1J9GA 1SKAA 3JPYA 3GT4A 1YUBA 1UODA 4PR3A 2R7KA 2ZBRA 1HKHA 1QB8A 1XCJA 4BASA 3WLSA 4OXQA 4DIFA 3MK31 1P75A 3HDGA 3SC4A 3OQBA 4C7XA 2Q4TA 3K32A 4GX5A 4WWHA 2GETA 3H13A 2Q27A 1U3DA 1JLLA 3CSUA 4KVFA 4CM5A 1R9GA 4I50F 1E2EA 1NC3A 3S29A 1D04A 2C3PA 4NEHB 4D3SA 1KZGB 1QG0A 2DFNA 4KN9S 4KWTA 4MKIA 5CEJA 1P1KA 1REQB 1Z15A 3EZ7A 1LZLA 4BL5A 4R2WA 3SD7A 1NTOA 2WSSD 4G9GA 4MIYA 2GT1A 1Z7BA 2W48A 1HEIA 3A37A 4JJ8A 2G80A 4QHSA 5DYIA 2I1LA 4J76A 1MW8X 3KJIA 4DB2A 1ZUD1 1SXGA 5CX1B 1Q11A 1RM0A 3EF1A 2V6BA 3NIDB 3ZGVA 3HR8A 2VQEB 2UZAA 1SVWA 4CL2A 2QN3A 1VJCA 1FNNA 3G0OA 3M4YA 1RRFA 3IAS1 4I7EA 3H1TA 4HVAA 5CB8A 3DYBA 3VVCA 1KMIY 3QU7A 4Q48A 1P80A 2NVUB 3W78A 1JLLB 3DGEC 3LA6A 3RC8A 4ID3A 2OC4A 2Q2QA 2HMAA 4LGVA 3V80A 4F3YA 3HXQA 4MVJF 3EARA 3Q7RA 4UCQA 5EAIA 3M6UA 3TRDA 1X1CA 1IVYA 2Q3FA 3ZV6A 3AVXA 3L82B 4BGIA 1JG1A 4KO2S 4HVCA 2HSZA 3BGOS 2I66A 1GPWB 4NFSA 1AF7A 3WY9A 2VJCA 3DE0X 2H8GA 4P4LA 4RIGA 3ZWMA 2DQZA 2JBAB 2WE7A 4C01A 1NW8A 3CG4A 4LJ6A 9MHTA 3QRWA 1Y1SA 4OAOA 4GOXA 2D0OB 3O5AA 4MW6A 3HKBA 2UYOA 4OL9A 5C18A 3CCFA 4OQXA 4M7WA 3UPUA 3PNSA 3LRTA 3C8HA 1E2PA 1KH3A 3X1DA 4DAOA 3K5IA 3VDNB 1G4AE 3VMFA 2ZFUA 2IDZA 1R0CA 1VLVA 3AK4A 5BMVA 3EG5A 1A8IA 4F4UA 2W90A 3HJBA 3W2EA 3QVSA 3WJ7A 5IM4A 5AW9A 3RTEA 3C6KA 5IAJA 4WVLA 2YNMC 4Y9TA 2A78A 3VH1A 4AJ2A 3OU6A 2EOAA 2YHUA 3P2JA 5HZGA 5JYBA 3P0RA 4R1SA 3TLGA 3UMMA 2RGNC 2B9VA 5K0CA 3L77A 2WUDA 3B7PA 3HGQA 1KZ1A 1G20A 2FMFA 2QTRA 1KBQA 3B13B 1SUCA 3LBNA 1ZGBA 3KHTA 1JIJA 3NBQA 2FMHA 1UKCA 2A7QA 2AUNA 1OXXK 1YA4A 4HEJA 4L7VA 4TL9A 3ZHRA 2Q3BA 3BWDD 1UBRS 2VQSA 4LI3X 1RAHA 3ZW7A 3WGLA 2J0SA 1L5QA 1CUIA 4P0QB 5K0NA 1ZMOA 3QXSA 4A8JB 3QIVA 1TJ4A 1R6AA 3NM4A 4ZZIA 4UVHA 5JBQA 2X5KO 1X7XB 1OLSB 4GPTA 4PIPA 3V4PB 4AVYA 3UN1A 4ZHQB 4RK0A 5KPDA 2V8BA 4ISCA 3HYLA 5LP1A 3BE6A 3KTDA 4D9MA 2IYWA 2RHLA 4HQKA 4XR9A 5DH9A 5AW1A 1Z75A 3JSAA 5EWJA 1ZO8A 2HK7A 1EA5A 5CNJA 1UJMA 3OZXA 4JGIA 4OREX 3CVUA 3ILXA 5CAEB 1QNLA 4F96A 1IBCA 4QL3A 3CJTA 3RWBA 3U4MA 1QFMA 2XUOA 3V48A 3TDKA 4Y2XA 3K73O 1FRNA 3WLKX 2JGIA 5CBPB 3U3JA 5F7OA 4D4MA 5IULC 3FCSB 3F4LA 2Q5HA 4H08A 3PUJA 3IUPA 3I5XA 3UT5A 1VM6A 3GA7A 3ZWDA 4KRFA 4FFOA 5DLEA 1BYUA 3MRXA 1SM4A 2GUWA 4UBKA 4QBKA 1RCTE 1SBNE 2R79A 1RYFA 1BWSA 4MINA 1DBSA 4M9ZA 2LRHA 3IR5A 5BW6B 3VR5D 4M7OA 13PKA 1E3MA 2EGGA 3GFQA 2ZKIA 3E8SA 3KG2A 1WZCA 3HUTA 3OLVA 4PAWA 2WWYA 1ZIDA 4CCWA 2CXPA 3WNCA 2Y4OA 4CKEB 3QKRA 4YMLA 1R4NA 2YV4A 2EP5A 3WB0A 5L4SA 4IV5A 1IB0A 4L8LA 3RV3A 3QYPA 1ZR4A 3RIHA 3F6CA 1Q0QA 3RFXA 1TA4A 5CA0B 2IBSA 5MHTA 5K8VA 4PQFA 2VUIB 2RGNA 1KC1A 3IQGX 3P9QA 2W4MA 3S1SA 3TSWA 1A4XA 4G1MB 3ZNQA 3B6EA 3M89A 2H85A 2ONJA 3SP1A 4CI9A 1IWPB 5ALHA 1PJTA 3E2IA 2A1IA 2XZTA 1BA2A 3WBJA 4DY4A 1J2EA 2ECQA 5JZBA 2XUKA 1Z36A 2R8OA 5E1MA 1SQGA 2Q9BA 1E2KA 2RGXA 4GMDA 2BI4A 3REFA 5AUNB 5JARA 3BIXA 1PJQA 4JBWA 3UT0A 2QRPA 4U2EA 1IL0A 1KI9A 2Y1CA 2GLXA 3TAXA 4QULA 3VR4D 1YQEA 5LZ4A 4HDAA 3J81A 3BCSA 3DT6A 3B70A 5GZ1A 2B92A 5LOVF 4BNYA 1PR3A 2BGRA 2F3RA 2F1IA 2HMTA 4PBSA 4TXMA 3DCYA 1GOTA 4Q3NA 3R7SA 1PJCA 1LNZA 3D43A 3GJRA 1H2HA 1X74A 3HC7A 3FNGA 4KUEA 4DCVA 1F12A 2Q4DA 4Q1CA 2Z1MA 1A98A 3ZXSA 5JSUA 1GGMA 2DBQA 2CLOB 1LDMA 1R5NA 3FJOA 4YCAA 4AZ3A 3IMFA 2CY0A 2Z3ZA 1AZLA 1XZBA 3H1EA 1YTUA 4E15A 3OM1A 4ETIA 3UYLA 1E2LA 1E18A 2FRXA 4U7PB 3SJZA 2W2KA 3USZA 1Q1AA 2IP1A 4MV5A 3JQAD 1S8FA 2IWHA 3PFKA 7GPBA 4D4LA 5BO5A 3Q40A 2WAOA 5IDVA 4OQLA 4AQDA 2RK3A 2DERA 2CJXA 3DEAA 3H5WA 3VDRA 4NF2A 3V4VB 4EOGA 3C39A 1KI6B 3OO1A 4RTOA 3FETA 3N2KA 3OZCA 4JUAA 4PFSA 3M8KA 1FPMA 1H2BA 2PPVA 5A5EA 4LDPA 3RVPA 4C76A 1G64A 4PSCA 1QH0A 3LX5A 3D64A 4HB4A 1GWNA 2QLJA 1QYDA 1RZUA 1OIWA 3K1AA 3WMEA 1GAWA 1ODKA 2C9ZA 4CMIB 4C0HA 2E49A 3L4KA 1H3FA 3GVIA 3NI2A 1QZ3A 2WZQA 4JP5A 3JQAB 4KOAA 3KKLA 4GW3A 1XDWA 3AVPA 3BH0A 2R47A 1OZ0A 4N0PA 2GZ3A 1QC5A 4R9RA 5AVQA 3AJ9A 4J4HA 1JXOA 1D6SA 2PUTA 3M6FA 1PQUA 2ZQYA 3UG6A 1S3GA 5DSZA 1P1FA 5ER9A 1B8UA 3RVSA 3Q8XB 4EGJA 1G1MA 4P33A 3AYXB 1I4WA 1RBYA 4GSYA 4OKNA 4IIEA 1TTHA 4KQGA 1SOMA 4MRPA 2J7KA 2DPXA 4H1UA 4OKSA 2VDVE 2W9XA 3H3FA 4RIFA 3NORA 1QKKA 1J07A 2OHVA 4AJKA 3ZK9A 2BCJQ 5AVJA 9GPBA 3UPTA 1GPNA 3UMGA 5IT0A 3K35A 3BTSA 3TOVA 1QVZA 2P2GA 1V4BA 2KB0A 3C3AA 1FYFA 1D9ZA 2IU4A 3RVJA 5DNVA 1QX3A 4FPXA 2AFHE 5TGZA 5EMHA 1A27A 2H1VA 4FBLA 1RYBA 2R6JA 4B2LA 1P7WA 3Q3VA 4DJ5X 2CUTA 3GMTA 3WRWA 1JYSA 1YGPA 3DP7A 1A9QA 3I30X 2YFQA 5BWBA 4ENPA 1A9TA 1GM5A 4KSYA 4DIDA 1RI3A 1EU1A 1U9YA 1UJ6A 3QTLA 1L5KA 3G1TA 3A11A 3IQDB 4ZIRB 2DFLA 1G2QA 3EVEA 5FOVA 1T8SA 2GYVA 1O9GA 3I0MA 3HSSA 3I6QA 3L84A 3LYHA 2R8PA 3DOUA 1PO7A 4GOND 3A4TA 2OQVA 5EUQB 1GL6A 2Q46A 2P5YA 4KIJA 4EG5A 1HO3A 3PC4A 3FFTA 5JCJA 4CTJA 4M87A 1RHRA 1TO2E 3AIMA 2H7XA 3O4IA 2BFFA 4TLEA 3FPLA 4BFXA 4D44A 2Y77A 2HYDA 5LBIA 1G9SA 2QW1A 4C07A 3D0RA 4ZEMA 2AJCA 5BMOA 3RSCA 3I5YA 2V3WA 4X65B 4KYTA 4J43A 1C3EA 1WIWA 1WCIA 5DKFA 3TD2A 4JOSA 3EAFA 3WIOA 2HCBA 1G5IA 4S04A 1M2JA 3UWDA 4X6UA 3E15A 1MABB 5T6MA 1PFYA 1XC7A 2ACEA 3JYPA 4TYQA 1Y5LA 1I4DD 1E3WA 3IPAA 3RHTA 4AYXA 3EZ6A 2B5OA 1N2XA 2OL4A 1AHHA 2NV2B 1WB5A 3FB1A 5KU1A 4I5DA 2P9QA 2Q8PA 3SFTA 2A0KA 3MQFA 5FYDA 2DBZA 4FX2A 2V7VA 3JASB 3CTMA 1PG0A 5FUBA 2FQXA 4MGZR 3UMRA 3ZS9A 4PN7A 1T2CA 1K6MA 3LWBA 2YFHA 1QF7A 3U39A 7AT1A 4C5AA 2JAPA 3U44A 3VI3B 3SICE 3AY7A 1N2JA 1VBFA 4G5GA 3ROZA 5DGXA 1V45E 2EKDA 2C7GA 2OXRA 3C41J 4BRUA 4WK0B 5GZ6A 4EYKA 5EXEA 5LWHA 2Q3EA 1H1DA 4HWSA 5F1YA 2VXYA 2V4ZA 2WD8A 3PWKA 5EUCA 1MC4A 4PQGA 5AIAA 3K9WA 1CQPA 3ADDA 5SZHB 3V34A 3QNWA 5IWCA 2O05A 2P0EA 5LQJA 5FTMA 1IG0A 2PBFA 3PK0A 2YRXA 1J21A 1H4VB 1R6BX 2P2ZA 3D6FA 1RQXA 1TZKA 3C85A 4DA6A 2NYUA 3AX6A 1TJNA 2Z1DA 2ALJA 3LZCA 3FDJA 4M0PA 4U5XA 3KHKA 4ZVRA 4JX8A 1C3JA 1Y3IA 1R0KA 3RT7A 1R0SA 4JIMA 3UXYA 3UJ6A 3QE9Y 4CEJA 1FNBA 2FFBA 3M81A 3RJ9A 4CBVA 4IVNA 4GF5A 5HFNA 1WB9A 1MA0A 1NUTA 2VHJA 5GPBA 5EIAA 1L4YA 2CLLB 2FCAA 1FFSA 1PJ2A 2EGUA 2QGFA 2ZPTX 1F38A 2CMDA 3WGZA 3PJEA 1FBNA 2RK4A 4RZQA 3WGTA 4GEGA 1EQUA 5F7XA 4WBNB 3N6XA 2YMLA 1T0PA 1SA0B 4BX9A 3DE7X 4RGBA 4P54A 2BY4A 2OSVA 5KYUA 4BATA 3E1SA 4QYIB 1N1EA 4RA6B 4WFIA 4CM3A 3KR0A 4HXEB 3C3YA 4RVDA 4AP9A 4BKMA 4BZXA 3IEIA 4LZZA 4YFYA 2BSQA 4IEEA 4ANFA 4DCNA 4CTMA 1GGEA 1JDNA 3NCHA 2IU6A 3ANXA