2YQ5A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus: nad complexed form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus
molecule tags Oxidoreductase
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A01
5IN5A 1QORA 4LSMA 3JYNA 3CTMA 3PYLA 4UUNA 1RKXA 1EDZA 3E18A 1WWKA 4CV0A 2X9NA 4YVFA 1UJMA 3ZV5A 5CG1A 1B8PA 3UOGA 1O94A 4OSPA 4OXKA 5A5EA 1NVTA 3ITKA 4L0QA 5F21A 3VTFA 1N1EA 5CDUA 4CV2A 3V1TC 3BMCB 2QHXA 3KLMX 3PIIA 1GZ6A 5JY6A 4ND5A 3C7DB 3OIFA 4BIIA 2EIHA 4BNNA 4D42A 1DFHA 4R1UA 4C4OA 4AJ4A 1EE9A 4J4HA 3CINA 3V1YA 3GZ4A 3OEYA 1OC4A 1G6KA 2WWRA 3BMOA 3D5QA 2FPIA 4L74A 5EESA 4N54A 4WCFA 4CLOB 1JKFA 4DREA 5EINA 2F1KA 1KVRA 2YYYA 4JROA 1K6XA 3NT5A 1GV0A 1I24A 4YYZA 1YXMA 1I01A 4HFRA 1T2CA 2QZZA 1GYRA 1LTHR 1AN9A 4YWJA 3ZH2A 1YH3A 2B4RO 1KEWA 2VOJA 4BVAA 2WYUA 3JQGB 4MVJE 4U7WA 1NP3A 1VM6A 2CDCA 1IUKA 2CFCA 3BMCA 1JAXA 4DTIA 1E6EA 5DCUA 3ETDA 2JAHA 3VDQA 2ZYDA 4WLOA 4XR9A 3S8MA 3GVHA 5A9SA 4MP8A 5L4LA 4Q3EA 4NBUA 4K6FA 4L9RA 3BMOB 2NQ8A 1L7DA 1WZEA 3JD3A 3L6EA 5ES3A 4QUKA 4RLHA 5KKAA 3VZSA 1I3NA 5B4UA 4RGBA 1A4IA 3PYXA 5H81A 5I9LA 1KERA 1KC3A 5JY1A 2P4QA 2PKQP 3AU9A 5BT9A 3GEMA 4LCJA 2VT2A 3EK2A 4E30A 1GDHA 1H9AA 3RBZA 2YV1A 3V8BA 1F0YA 3I23A 3JYOA 1E5QA 2J8ZA 5JO9A 3L0DA 4LCEA 3TPCA 2CUKA 1PS0A 2C82A 3PK0A 5I8WA 3FCOA 1KY4A 3WMXA 2Q1SA 4PLPA 3WGIA 2YY7A 1U3TA 1TVEA 1Q0HA 2GDZA 1U5AA 3DZJA 2JAPA 2PD4A 3U4CA 3INTA 3WYCA 4B4UA 1VL8A 4B4VA 2X22A 4GSLA 4LRSB 4ND1A 1EBFA 2AEJA 4D41A 5ILOA 4J49A 5FYDA 1LQUA 3PEFA 2DFDA 2X4GA 3DBHA 3HDYA 4NI5A 1LDNA 1Z73A 4XGIA 5JNLA 5C5IA 1LDGA 5IDQA 4II2A 2NACA 2HRZA 2VQ3A 1ULSA 2EJVA 3BIOA 1LI4A 1TA4A 3ZU2A 3IUSA 5I7FA 3QVTA 1PJ2A 3C85A 4CMBA 5CEFA 2JFGA 3RUAA 4D79A 5JW6A 2HLPA 3QWBA 4OXNA 3OP4A 2O2SA 4YJFB 3DR3A 2ZYAA 3UCFA 4R54A 3EVNA 1BTOA 1X14A 5LDGA 3IKTA 2Q2VA 4N18A 4A0SA 4LW8A 5ADHA 4RORA 2YFHA 1HE5A 3RC9A 3CH6A 3S2GA 5L53A 5A06A 3BA1A 4OXYA 3TZCA 2RH4A 2AG8A 4RQTA 1R4NB 3ZWWA 5FWNA 1BSVA 1G1AA 1QYCA 4PFJA 1LJ8A 1K0UA 2GD1O 4QX6A 2CDBA 2HK9A 4UEOA 2YW9A 4A10A 4B8ZA 1D3AA 1N5DA 3ONDA 2GYYA 2IXAA 1GUYA 1B3BA 3A4VA 1MFPA 2OZPA 1RYDA 3AWDA 4MIEA 4L73A 1DIRA 4BO9A 1E7MA 3QRWA 1DXYA 1EK5A 2Q1WA 1MC4A 2X1HA 3C1AA 3Q2IA 3QP9A 1Q1NA 1ENYA 3SJUA 1N7HA 2VZ9A 2FOIA 2EGGA 3KETA 4TSKA 3OIGA 1ULUA 5THKA 1ZFNA 1JWBB 1ZW1A 2V6GA 3M2TA 3TOZA 3GAZA 4FW8A 4I5FA 2EP5A 4GQAA 4OOFA 4BB6A 3ZV6A 4B3JA 1PSDA 5GZ1A 3D3EA 2XF8A 4CMCA 3CZRA 1O89A 3F4LA 1YBMA 3ULKA 3ZI0A 2GGSA 3SLKA 2VNSA 5KVQA 1F8GA 1R66A 4NJOA 5KWEA 4CQLB 1TLTA 2X8LA 4IJWA 4CL3A 3D4NA 1U4SA 1A7AA 1DPGA 3FWNA 1D8AA 4MO2A 1LDEA 1MXHA 1PJCA 1YGYA 4J4TA 1A27A 2OL4A 2R2GA 3FSRA 2C54A 3JYPA 1RM3A 1SCUA 3WNQA 2C29D 1LDBA 1IPEA 2VWGA 4Q3DA 5I8ZA 5BNIA 3RIHA 1LXCA 3AY3A 3M1LA 4J7CA 4NJMB 2SCUA 5JE8A 3D7LA 4QTZA 4Z0PA 4L4SA 1SEPA 4JBIA 1HE3A 1YB5A 2H9IA 3E48A 2DTDA 3IS3A 3KM0A 1CF2O 4J1QA 2OGUA 4Q3CA 5B37A 5HS6A 5IZCC 1PJTA 5DF1A 4F45A 1TT5B 3Q6IA 5BSFA 2Q2WA 3WBFA 1XA0A 4CQLA 1Q7CA 3OETA 4CR6A 2V65A 4ZD6A 4ALNA 2B35A 4Z9FA 2B83A 4CM8B 1ID1A 2WM3A 3P2OA 2Q4EA 2PH3A 5JAQA 4BNMA 4ND2A 4PLWA 3D1LA 4GVXA 3ROMA 3T4XA 1E3IA 1QKIA 3E1KA 1ADBA 3GY0A 2X5OA 4WNIA 2WE8A 3RVDA 4QXMA 4DRYA 4D3SA 3H5RA 1NX6A 1R37A 3V2UA 3ZU4A 4ZN6A 3MJTA 1IY8A 3QE3A 1X7HA 4NR0A 4B4WA 1GD1O 4FGWA 3JQFA 2ZQZA 1Z7EA 2DAPA 3HE3A 2WD7A 1T4DA 2BFOA 2ZB4A 2RHCA 2O50A 2D59A 4BQPA 3VH2A 1ZEMA 4GX2A 4CLHA 5T6BA 5TC4A 4JGBA 2VZ0A 5KIAA 1LC3A 4R1TA 4WJZA 1HDRA 5KJEA 5IG2A 5DNAA 1IZ9A 1NAHA 4ZQHA 3ZU3A 3NDJA 4BNIA 1PGNA 1HDCA 4UEKA 5KJ6A 1GY8A 1EVIA 4IJVA 4Y6RA 3MOIA 3PJGA 2NVBA 2QX7A 2Q99A 3HN2A 2NU9A 2BLLA 3SC6A 3ZWBA 5TQVA 1SMKA 4LMRA 2B36A 5FFFA 3O8QB 5TNXA 1LBEA 1YWGO 1NPYA 3QWIA 2GN6A 3EYWA 4CQMB 1FF9A 4ILKA 3HWRA 1HDGO 1U8FO 4TVOA 3NAQA 4MVJG 3ZDFA 1MV8A 5BSGA 1I2ZA 4YCAA 2PK3A 4G2NA 1XCBA 3WYBA 5T57A 2YHIA 3L4BA 4JIGA 3E6AA 1MP0A 5ER6A 4XDYA 3GT0A 2Q46A 3K92A 5EERA 3WBBA 8ADHA 4YACA 1B7GO 1Y81A 4BGUA 2O3QA 3DBHB 1KEUA 3E03A 3GR6A 4KP7A 5DT9A 4JLWA 3O38A 4KOAA 3I9MA 4RLSA 1UXJA 3UICA 2UV8A 1WXDA 4R5MA 3OMLA 2D2IA 3DBRA 1PU2A 3E9MA 1XQ1A 4O1MA 3OJLA 4OMUA 4XD2A 1EE2A 3PHHA 3GMSA 4HP8A 3MWDB 1SPXA 3UCEA 4R5HA 3LC7O 4J6FA 1R4MA 1Y7TA 2BRUA 3OF2A 1LNQA 1HE4A 3GC6A 4UVEA 2X0NA 2CY0A 2E4AA 3B70A 2YHUA 3F9IA 1SB9A 1YRLA 2NVWA 2J5KA 4DC1A 3RUCA 3GPDG 3GF4A 3F1KA 3QHAA 4FC6A 5JDCA 3OM9A 4JJFA 2FHSA 1ZZEA 4MOWA 5F1PA 4CM1A 2C7GA 1BXZA 3DFUA 1TEHA 3WGHA 3DQPA 4II3A 1HDOA 2O4CA 4GH5A 1V3TA 3KSUA 1HZZA 2EXXA 3E82A 4BNVA 4BKQA 5L45A 2FSVA 3A06A 1VL0A 5EIOA 1NQAO 3GUCA 4P4LA 5G4LA 4CMAA 4GLOA 5TT0A 1SB8A 1ZKMA 1TXGA 2Y99A 4BO5A 1AXEA 2QRKA 3FPCA 3NKLA 2O23A 1ADCA 3ZWCA 3WFJA 2FWMX 1V9LA 1E1KA 1LC0A 2I9PA 5HM8A 4XB2A 2PTGA 6ADHA 4TRJA 3ADOA 3TF5A 2EW8A 3BTSA 3GGGA 5KKCA 1C0KA 4GMGA 1E3SA 5B4TA 3SLGA 1T4BA 1ONOA 3I6QA 3RUFA 4YDRA 1NXQA 4IDEA 3M1AA 3OJ0A 3B1JA 3ON5A 1DIGA 4Z3KA 5FI3A 3ANLA 2ZIZA 3GN2A 2FSSA 2BH9A 3G1TA 3NGXA 2AMFA 1E3WB 4IXWA 1L1FA 1UUFA 1MGOA 3NJ4A 3QVXA 1R0LA 4XGKA 2CVZA 1VLLA 3O8QA 1EBUA 1HT0A 4NPCA 1OZAA 4QECA 1R6DA 4R41A 4XQGA 1V8BA 1JN0A 1YJQA 4EDFA 3F6YA 5I9MA 3P2YA 2NVUB 4F46A 1LX6A 2C2XA 4PLHA 3WDSA 2CF6A 4LRTB 5L7YA 5G0UA 4Z0HO 2TMGA 3HADA 4KQWA 5F5LA 5JMPA 3KOUA 5G4KB 4AJPA 5JDIA 3AM3A 3G0OA 3FNEA 4TKMA 3BAZA 5L9AA 1E77A 2DUWA 2PKRA 2DM6A 1E6WA 2O3RA 2WD7B 4PVCA 4TKLA 4YT2A 1T2AA 1SEVA 1UZNA 4QEDA 2C07A 1GV1A 1OOEA 3DONA 2VRCD 4WASA 4RCVA 1RM4A 3G49A 2NTVA 1B8UA 2XXJA 3S2EA 3WJAA 3K2BA 4W4TA 3WGQA 3FTPA 1M2WA 2NVUA 2OBNA 2HO5A 1ZBQA 3GN1A 3U0BA 1T1RA 3T7EA 3UW3A 3H2ZA 1PQWA 4O6VA 1MLDA 3IDSA 2C0CA 1BXGA 2HRBA 3LDHA 4Z0TA 5JAIA 5COBA 5CPFA 2VHVA 1K6IA 4PLFA 1RM0A 3DB2A 2E82A 3ZWMA 4E5KA 1UDAA 4AJ2A 4J2HA 3DZKA 1PGJA 4JXKA 1MXFA 5T8KA 1JDJA 3VDRA 3WICA 1BXKA 4OAQA 2FR1A 4EITA 4PVDA 4IGFA 4B7CA 4MDHA 1I5RA 2CZCA 2CSUA 3OQ6A 1ONPA 3IC5A 1YQDA 3TJRA 3F1LA 3Q9UA 5ITVA 1PJ3A 2AQ8A 2PZMA 3GRKA 3RJ5A 4OQZA 4X54A 1O9BA 1IB6A 1C1XB 3KXDA 5IDWA 1PWXA 3GK3A 5L7TA 3RAJA 1I2CA 3HDHA 1GU7A 1N7GA 2X5KO 4CR7A 1ZMOA 4U6SA 1I33A 3OSUA 2W8ZA 4GSKA 1E3JA 4PZDA 5I7VA 1MX3A 3JSAA 5JC1A 4LK3A 2VZ8A 5BQFA 1SOWA 3GNTA 4MKRA 3OA0A 4KWIA 3V5NA 4JP3A 4EJ6A 4O5OA 5L51A 3KZVA 3NT4A 3WGGA 3E9QA 3KYDB 1GZ4A 2IYOA 3DHNA 5I7EA 4GMFA 2JCXA 3NJ8A 1H6DA 2ZCUA 3Q2KA 4OIMA 3CXRA 5T64A 3UXYA 4IM7A 1P31A 4R9RA 3NV9A 3Q11A 3TL3A 3PHGA 4RDHA 3RUDA 3TDKA 1K89A 5F3RA 1NAIA 2BGLA 1E3LA 3L07A 3LQFA 1TB4A 1YJ8A 4AJHA 1DHRA 3PWSA 3DAFA 1OC2A 1RPNA 4M87A 4HV4A 3FR8A 5U9CA 4MVJM 1T26A 4A5OA 1W73A 5TS3A 5ICMA 4RQUA 1YQGA 2NU8A 3D0OA 4S1VA 4XJTA 4CMIB 3O9ZA 3DAGA 2PZLA 1SO8A 4XB1A 4BO1A 3PJEA 4OHUA 1N9GA 1E7RA 4E2ZA 4EEZA 1B15A 4H16A 2QZ9A 1WVGA 9LDBA 3O03A 4BNHA 1JU9A 4NMHA 1MUUA 4LVCA 4F3YA 1Y5MA 1U3UA 3GFGA 2OBYA 4IZHA 1PR3A 5I7SA 1ZH8A 5AQ1A 1EVZA 1XU9A 2D4AA 4Z6KA 4DGSA 4G5HA 4BNFA 4DIFA 1KVSA 3I9OA 1Q0QA 3ABIA 2XXBA 4LISA 1KIFA 3OJOA 1FDUA 3PP8A 4GBJA 3GG9A 1C3VA 4HY3A 3JD0A 1PGQA 2W98A 4P8RA 3WXBA 4EUHA 1V3VA 1I10A 2Q2QA 3LYLA 3P19A 2NU6A 2VHWA 1Y8QB 3I6IA 3JQAD 5A04A 4P22A 3JQCA 5LC1A 3CMCO 3LT4A 1XG5A 3ZCXA 1YONA 2P68A 3JYLA 9LDTA 1X0XA 2IODA 4C7KA 4PLGA 1PL7A 2RHRA 1TI7A 1W6UA 3S55A 1PJ4A 4J7XA 5J23A 1QSGA 1FXSA 2VN8A 4CMEA 3HB5X 3KHUA 3ORFA 2Z1MA 1VKNA 2X0IA 3RC7A 4DLAA 3RBVA 2WSBA 2DUUA 5HRUA 1LLQA 2BFMA 4E32A 3KSDO 5C7LO 3KV3O 1J0XO 3JQGA 1YKFA 3G1UA 1NQOA 3PI7A 3NYWA 1DBVO 4FCCA 1PZEA 4PZEA 5A5FA 3MJCA 3GNSA 4XYEA 4IGEA 4R51A 2JHGA 1P0CA 1QMGA 3MCVA 2YDYA 3IP3A 3R6DA 4BUCA 4BHTA 3B6ZA 1DFGA 1R16A 2YHIB 1ZEJA 2YDXA 5B1YA 4R9SA 3W8FA 2Y0EA 4DL9A 3C3XA 1GPJA 4N7RA 3V1UA 5A1TA 1E7QA 3LK7A 3VH4A 1M67A 3C1OA 3AUUA 4DQUA 4FB5A 4ALMA 4XQCA 1E3EA 1O6ZA 5EPOA 3I52A 5G4KA 2B4TO 2VUSA 2D1YA 1F06A 3A28A 3FD8A 2G0TA 1PR9A 1SC6A 1WMAA 2IXBA 4HXYA 5COAA 1DC3A 3B1FA 4W82A 1H2BA 4M54A 2BGMA 2X86A 3RU7A 1ZSNA 2HDHA 5L3ZA 5H83A 3R1IA 5T8KC 4WEQA 1Y6JA 2WJPA 4M49A 3X2FA 4XIYA 1PTJA 4MP6A 3BMQB 4B3HA 3IKVA 1WW8A 2EHDA 3IIEA 3U9LA 3BXXA 1XKQA 4UULA 5IJZA 3FWZA 5DOZA 1MA0A 1BGVA 3OIDA 4RF2A 5KVVA 1HKUA 4FS3A 4CM4B 2BD0A 3WR5A 4YPOA 4WECA 3IQDB 1RM5A 5MGBA 4BKOA 4FSHA 1ZUD1 3QA9A 1KOLA 3FNHA 3ZHYA 5JSFA 3JQAB 4BKUA 2P2SA 1GYPA 3TFQA 2LDBA 4KWHA 3I1JA 4EEXA 4FFOA 3ONEA 4YRDA 5BSEA 4AJOA 4IJKA 5TJ9A 4XGNA 2EEZA 3KSZO 1QLHA 4WUVA 3DO5A 1QYDA 4L8VA 1Z75A 5DP2A 4RVDA 4CM7A 4ZICA 1T2FA 4BV9A 3I83A 1P45A 4G65A 1H5QA 4MVJI 3UUWA 1HSZA 3W4IA 4MIYA 1QV6A 4UREA 1HL3A 1M76A 4Q9NA 4BNZA 3HFSA 2Y68A 3PJDA 4FQ8A 3L77A 4PLTA 4H3VA 3WGZA 4JBHA 2O3JA 1YBVA 2GZ1A 3H9QA 4IUYA 2JFFA 2ZQYA 5IXYA 3INGA 1Y1PA 2EW2A 1V0JA 3BTUA 1BXGB 3KEQA 4KMSA 3RQSA 2EJWA 2RBEA 2FY8A 1DB3A 5DN9A 3IUPA 5G0VA 1HRDA 5JAMA 3VPSA 2I76A 4K6CA 2V7PA 4IDGA 1EFKA 3E5RA 4BO0A 2RIRA 5DULA 4KUGA 5TJHA 4Y67A 2ZB8A 3RROA 2I67A 2VCYA 2A94A 2G5CA 3I9JA 3PHIA 3QY9A 1CQIA 3D3WB 1XIVA 4CLRB 1EDOA 1UXGA 1Y8RA 5TX7A 4DXHA 4M55A 1XR3A 4DQXA 3KYCB 4XQEA 4INAA 4NFYA 2AHRA 3H5NA 5CEJA 3RD5A 1FDTA 4BO8A 4IINA 1I2BA 1EUCA 1HF3A 4WE3A 1M6HA 2HSDA 5IZCA 3AI3A 1GTMA 2JCVA 1O95A 2X9VA 5C7OO 4IIUA 4F6CA 4MVJP 3ENKA 4C7JA 3L6DA 3BMNB 2DPHA 1DRWA 1MC5A 5BSHA 2PH5A 2QYTA 1NFQA 4NK4A 4HADA 2X5JO 2UAGA 3DFZA 3LF1A 3M6IA 1NNUA 3INRA 4YQYA 5CG2A 4QQRA 2E48A 4WNCA 4RPGA 2Y93A 1EQ2A 4GX5A 2Y66A 4CMHA 4CM9A 3JD2A 1KVQA 2ZK7A 3KRTA 2P4HX 4CR8A 2O48X 4GGPA 3RUEA 2VWHA 4B3IA 4RO0A 1NM5A 3BHJA 1OI7A 2V6MA 1LSOA 2O7SA 4YJDA 4YEDA 4FJ2A 4IDDA 4E12A 2EWMA 2OOSA 1X7GA 5JPIA 1J5PA 1NQ5A 2BFAA 4J0FA 2WD8A 3FN4A 4ZQFA 1B14A 2AG5A 2V6BA 1P1RA 3C24A 1KEPA 3AY7A 3U3XA 1VJTA 5DCWA 1MG0A 1UP6A 4KUEA 3W4JA 4YAKA 2UDPA 1C0IA 1DAPA 1LRJA 3TNLA 3HHPA 4W6ZA 3TZ6A 2XAAA 2JCYA 3FNFA 3MJSA 3PQFA 4EGFA 1NVMB 3KYDA 2G82A 4N5MA 1IYZA 4RF5A 4PN3A 3NDIA 4BO3A 3AI1A 3PGXA 2HAEA 2OP1A 1GYQA 1V6AA 4IMPA 4FC7A 4O59O 4ONEA 4RL6A 1DAOA 3FHLA 1K5HA 2IRWA 5IAAA 3AOEC 1NFFA 5TLSA 3WTBA 4U6QA 4HWKA 1EQUA 1GADO 1KY5A 2D3TA 3S2IA 3AFNA 4XIJA 1WLYA 4BNYA 1I8TA 3U09A 2I65A 4YA6A 4GX1A 2B0JA 3WIDA 2AXQA 3NUGA 3TSCA 1WAMA 2QRLA 1SZJG 2PFGA 1C1DB 2Q50A 4GGOA 5L40A 1X7DA 2A92A 3JQ8A 4P38A 4JX8A 4DWVA 3GH3A 5GZ3A 3UHAA 2VTDA 5A03A 1NR7A 4RZIA 2ZTVA 1U9JA 1C0PA 4WOJA 4BV8A 3W6UA 1P1KA 1I3KA 3JQEA 3KTDA 1UDCA 5G0TA 3VPFA 3PFFA 3CSDA 3IAHA 3C1TA 1Q0LA 3JYQA 2ZCVA 3K96A 2EKPA 3AY6A 5A02A 4WCFC 2J5RA 4D46A 1Y8RB 5COQA 3A14A 2VYNA 4ZQBA 5CDGA 4PLCA 1CDOA 3PGJA 4FR5A 4BMSA 4XCVA 2EV9A 3C8MA 2YJZA 1LSSA 4CQMA 3W8DA 2J3IA 1ZSYA 3AW9A 1AHIA 3K2EA 4GLLA 5JDCC 4NZ9A 3LVFO 1ISHA 1N92A 1BVUA 4D0SA 4OKIA 4BL5A 4XYBA 2OHXA 4BNLA 4MVJH 4YT8A 4CM3A 2Y1DA 1Z6ZA 3ZHBA 2VUUA 2NLOA 1C14A 4GX0A 4CM5A 1E1MA 4CPDA 2ZYGA 1LLUA 4PG4A 3BTOA 4Y6PA 1QG6A 3P5SA 3ZHXA 3F46A 3G17A 2XOXA 2HMSA 4ZRNA 4J2OA 2ILTA 4NU6A 3L9WA 3K73O 1ZMTA 4JJIA 5KTKA 5A3JA 4ND4A 3SXPA 1XQ6A 3PQEA 1VJ0A 3EZLA 3ZV3A 1WNTA 3DBRB 3PWZA 3SBOA 4I9UA 4OH1A 5TRTA 2O2YA 3DHYA 3JQAA 1NPDA 4WLUA 1XU7A 1QLJA 2GNAA 1LSUA 2A35A 4DIOA 1GCOA 3QV1A 2VYVA 1DRVA 2Y67A 3HSKA 4YR9A 2AQHA 1YVEI 3DZBA 2HMWA 3HB4X 3ONFA 1RJWA 4PLYA 3EUWA 2X23A 3PYMA 4LSWA 3Q3CA 1ZJYA 4AJKA 2FPPA 2VYVD 4WCDA 2BELA 3ZW9A 4DC0A 1X15A 4W99A 3U4DA 2UUPA 1HDYA 1HXHA 1KVTA 3P7MA 4IBOA 4A73A 4E13A 5DCYA 2HK8A 4J4BA 3K6JA 4ESOA 3NRCA 4BMVA 4TWRA 2O3UA 2DBVO 2GN9A 4WPGA 1PIWA 3NTRA 1VJ1A 3HDQA 1UR5A 5JLAA 5JYDA 3D4PA 3KBOA 2G76A 4ZGWA 3GGOA 4LGVA 3W4KA 4CUZA 4FGSA 1E6UA 1LLDA 1E3WA 3PHLA 3JQ8B 3Q9NA 5G0WA 4D45A 7MDHA 5G2OA 3WGOA 4J1NA 1FDWA 1LUAA 1VSUA 3HN7A 4YT5A 4UVHA 1ZO8A 1S7CA 1HDXA 1R12A 3PLNA 4CQMD 7ADHA 3U4IA 2BMAA 5T67A 4BQRA 4QT0A 1Y9AA 4Y8VA 3OFSA 5CPBA 4MKXA 2PV7A 2PY6A 3I5MA 3F47A 1E1LA 2FPGA 4UVIA 3FI9A 2EERA 1A72A 1PL6A 4NFHA 2YV2A 4HFNA 2GSDA 5JCJA 4BO2A 2X0JA 5FF9A 3ZN2A 3GOHA 3WQSB 5KCZA 3JQBA 2VTEA 4CL8A 5LCXA 2AQIA 2Y1FA 3WMWA 1X13A 3RASA 5JAZA 2FN7A 4NJMA 5U1PA 5ITWA 4BNTA 4E5YA 1U2GA 1GQQA 4DMLA 1H6AA 2YZ7A 1XELA 2AEFA 1MG5A 4P4NA 1K3TA 4I08A 3KO8A 5TT1A 5HWSA 4O63O 4BOYA 3UKOA 4CLDA 4J7UA 3WFIA 3EC7A 1LRKA 1XWFA 1E5LA 3PFWO 2GN4A 5G0SA 1E0DA 2FP4A 3F3SA 1U4OA 1X0VA 1ZVMA 1ZK4A 4WLFA 4IIVA 1T1SA 4DPMA 1QYXA 1I0ZA 3PDJA 3QVWA 5HBRA 4BNKA 5GZ6A 3K31A 4CM9D 1EZ4A 4ALIA 4BKPA 1U8XX 4Z9YA 1HYEA 1U3VA 3FR7A 4D43A 5AYVA 1IHYA 4ZHSA 2JD0A 2WTBA 3AOEA 4EZBA 1ADGA 1P1FA 2DLDA 1JTVA 4PG7A 4B7XA 4XYLA 5GMOA 1HYGA 3IJPA 4L75A 3ANMA 2R00C 4E5PA 3QWHA 4MPDA 3ZWAA 4BB5A 4QSMA 4JK3A 4CMKA 1VRWA 3ETEA 4EUEA 3MTJA 3U62A 3UN1A 1BMDA 2DT5A 1CERA 4HKTA 5ILGA 3PVZA 1SBYA 4EJMA 1HDZA 4MVJD 4UUPA 3UVEA 4TZKA 3HZZA 5A9TA 4AJNA 3WWYA 1MB4A 2EG9A 3RFXA 4P4GA 4B8WA 1NPTO 4L76A 4R69A 3VZPA 4AICA 1SOVA 1EK6A 2GRAA 2X7HA 1PJSA 4IQ8A 4RPLA 2PA3A 5TF4A 3LC2O 5KOIA 4OKNA 1A4UA 3DC2A 1DC5A 1YB1A 2CF5A 4R1NA 3DZGA 1K6JA 1U7HA 1U5CA 1YL5A 4ZQEA 3EZYA 3LZ6A 2HJSA 1DEHA 3WX0A 3AFMA 3V2GA 1ZSVA 3GMDA 5DBGA 3ROPA 1X1TA 4BNJA 5IDYA 1VE9A 6LDHA 3VVCA 4E2YA 3B20A 2ZJ0A 3TN7A 2WYWA 2ZTLA 3H7AA 2GR9A 2E6UX 2GO1A 3JD4A 3VAZA 3WS7A 5IN4A 1C0LA 3EY4A 5F5NA 4BGEA 3GDOA 1DSSG 2C59A 4K9DA 3TRIA 1Y8QA 5HTOA 2VYND 3LLSA 2FR0A 2LDXA 4KUHA 2IEBA 5AXAA 3WNVA 3PPIA 4YAEA 2WMDA 4DLLA 3AUTA 5F1KA 2C7VA 4UAGA 4XZ3A 3ZW8A 4ZRMA 4I8XA 4FN4A 1P0FA 1T2EA 3GQVA 3R0IA 1EEHA 4R16A 3AJRA 3ZWYA 4BNUA 1XHLA 2ZTMA 2GZ2A 4AL4A 4E33A 1IL0A 3CKYA 3ZV4A 2V6FA 5FI5A 3QSGA 4OQYA 5JFOA 1PS9A 1YBAA 3WQQA 2WDZA 2UUOA 2D5AA 3FNGA 4JQCA 4CMJA 1H93A 5TSDA 4D0RA 4FOSA 1GL3A 3VOSA 1B8VA 4RJTA 1JAYA 4AVYA 4EYEA 4UUOA 1ZNQO 3DBLB 3H9EO 1K2WA 4BS9A 4RZHA 5JYEA 2BFPA 2J5QA 5K6AA 4I9NA 4YXFA 4IPTA 3DMTA 1Y9EA 2PGDA 4R01A 1HSOA 3W6ZA 1P33A 2Y05A 2H63A 2DTXA 4CLOA 1QV7A 2C20A 2Q49A 3K5PA 3LT2A 4Q39A 3O26A 5ENVA 4XJSA 3L4BC 1ZJZA 3UF0A 1NR1A 5A4DA 4J1SA 3VPHA 1EVYA 4QO8A 3JQ6A 3BHIA 3ZHZA 3JQ9C 4DBVO 2WE7A 3WTCA 4ZQGA 1DJQA 3DL2A 4Q3NA 4EJ0A 5BR7A 4IQGA 4WKGA 4WCFB 4QFDA 4U8GA 3VH1A 1OMOA 4R68A 3RSHA 2P9EA 1XLTA 3DBLA 4WLVA 5KJFA 1Z82A 1Q7GA 3Q0EA 4CM6A 2WEKA 3LSYA 1GPDG 2B5VA 1RWBA 2ZB3A 2Q1TA 3LT1A 4R3NA 1P9LA 4IDBA 3WJ7A 1DHTA 4NBTA 2P9CA 3LF2A 4WLNA 3KYBA 4TZTA 3PTZA 3L9XA 4FOOA 3HNPA 3FBTA 3AUAA 4UEJA 4MKZA 1X1EA 2E49A 3KVOA 3ZGYA 1ML3A 2Z95A 2OUIA 1PQPA 2PZJA 3NX4A 3AU8A 4RVHA 5U4QA 1ISGA 3TOXA 5K9ZA 4GVLA 5EQFA 1B3RA 1T25A 3DXFA 3KEOA 1KYQA 2JD2A 4FPXA 5FEUA 1U1IA 3FBGA 1KBZA 1F17A 1B16A 3RBXA 2NWQA 2GERA 1D1SA 3A1NA 3GZNA 3NTOA 4IDAA 3TZQA 3WLFA 2C5AA 3ZWOA 1ZXBA 1PL8A 2HJRA 3PLRA 3K9QO 3H5AA 3DOJA 3PZBA 1U28A 4NBVA 1CJCA 1V3UA 3DEYX 4GWKA 4I5EA 2J3JA 2PWZA 1O5IA 4DQVA 5I9NA 1LQTA 4KZPA 1UP4A 1GQ2A 4XRRA 4M86A 4L4RA 3ASVA 4TVBA 4PZCA 4FJ0A 2X6TA 4HUJA 2HCTA 3UCXA 2VNAA 1BDBA 4DMMA 1N9GB 4XA8A 1PJQA 4PRKA 3SVTA 4F6LA 5K6AC 3CEAA 1DLJA 3I4CA 3JQBC 3MJ4A 2FZWA 4S3MA 5TIIA 2CMDA 3GA0A 3N7UA 5EQDA 4IZIA 1HTBA 2UYYA 1BW9A 1NHGA 5DZSA 4ZA2A 3RFTA 4FFLA 3H9GA 4CM8A 3DOOA 2CDAA 1BVRA 5AXDA 3TZKA 5AXBA 3WWZA 2H6EA 3OICA 3S2FA 2FRDA 2Q45A 1XDWA 2W2KA 4J9UE 4KTVE 2EP7A 1IHXA 4YAGA 2W2KB 3RJ9A 2VHZA 1DIHA 1I32A 4DVJA 2Z5LA 2NADA 4FFMA 4D44A 4DPLA 4E21A 1NYTA 4XYMA 4RF4A 1XSEA 4BO7A 3U5TA 1LSJA 3N74A 1ISIA 4M8SA 2P91A 3R3SA 4TQGA 3QIVA 1A5ZA 4YT4A 2G17A 1T24A 1CWUA 3G79A 4ND3A 3ZZNA 4YJHB 3IJRA 3RKRA 2ET6A 1D1TA 1KEVA 5CP8A 1R4MB 1AXGA 3BMNA 5IFLA 3DZFA 1NFRA 3PRJA 4XKJA 2CNBA 1FK8A 3ICPA 4E31A 1BDMA 1QXSA 1GCUA 1Z74A 2Q3EA 4BNGA 4LVUA 1DFIA 2YUTA 5LDHA 3GDFA 3IP1A 3VC7A 3H65A 3CIFA 3GPIA 3U49A 2DVMA 3OQ1A 3F5QA 2Q1UA 1PZHA 1UZLA 3D5TA 1FDSA 4ZVVA 5C37A 5JBIA 4YJFA 1GUFA 3I4FA 5F1OA 3V2HA 3OHSX 4A03A 2VRBA 4DIBA 1QP8A 4KDFA 5JCJD 3MJEA 4I9HA 2G1UA 1UAGA 4H15A 4RDIA 1H94A 4I1IA 1H9BA 2W2LA 5C3MA 4BKRA 1LRLA 1DDOA 5JCXA 3H9UA 1ISMA 4NG5A 4PRLA 1J6UA 2IE0A 2I6TA 3COSA 3WG9A 1KETA 2X0RA 3WB9A 4BGIA 2EKQA 1ZCJA 1NWCA 2PLAA 2ZTUA 4Y9DA 1OBFO 2JKVA 3BTVA 3R3JA 4D3FA 2I3GA 4J0EA 4AJJA 3GVCA 1D4FA 3AK4A 1NQTA 4Y6SA 3TFOA 5JC8A 3JD1A 1HLPA 1NTOA 4NH4A 3QWFA 5ENDA 1ZK0A 1I36A 5C7IO 3PQDA 4CLXA 3C7AA 3EVTA 5K0ZA 1Z7BA 4KTTE 1LA2A 1UH5A 3CZMA 4TMFA 2VT3A 2QW8A 4FD3A 2DTEA 1YDWA 2QQ5A 5A3VA 4RVFA 4J16A 4W9NA 3DBVO 3VVBA 4R4JA 4E5MA 2I66A 4HFJA 4E2XA 1DC4A 1WDMA 3OECA 5CDYA 3S1LA 1W0CA 1Q7BA 3I9NA 1P1JA 1UDBA 4H7PA 3ZNPA 1B2LA 2VWPA 3PHJA 1PX0A 1EMDA 3PJFA 1PGOA 1UP7A 4OJNA 4XRGA 3H3JA 3X2EA 4J91A 3VZQA 4E3ZA 4YRBA 5KNLA 3GVPA 2AW5A 1VC2A 3FF4A 2HK7A 4IMRA 5IZ4A 4DYDA 3CPSA 4TRNA 2D5CA 3DMTC 4HFMA 1E7YA 4DLBA 1VI2A 3H9JA 1TT5A 1ENZA 3AM4A 3OBBA 2D8AA 1ENOA 2WYVA 3ICCA 4IJUA 3JTMA 2J3KA 4M89A 5DBFA 3T7CA 1UAYA 2JL1A 4TRMA 5ER9A 4W7HA 5JS6A 2F00A 5JMWA 1YO6A 2Y1OA 4YRAA 4NDNE 4NNJA 4FFPA 2O7QA 1VKOA 1U3WA 1ADFA 1JKJA 4RPKA 3TL2A 5H82A 1JA9A 3RFVA 4OO3A 4HBGA 4BGVA 3E9NA 5HS4A 1ISFA 3DTYA 3O4RA 2PKQO 4I5DA 3HJAA 5B12A 3PWKA 4J1TA 1J4AA 3CMMA 1O0SA 1LDYA 3EHEA 2X58A 4K1LA 2DKNA 4A26A 1JVBA 1YS4A 5CDTA 3GDGA 2PD3A 3DZHA 4YTEA 1LEHA 3EGOA 4YB8A 3RC2A 4HX5A 4NIMA 2E37A 4XX0A 1I3MA 1TT7A 4U0JA 3BZUA 1GQYA 1A9YA 1YOVB 1GR0A 1PWZA 4R1SA 1CRWG 1W8DA 1E7WA 1GAEO 2IZ0A 2NSDA 3NGLA 5BNFA 1NASA 3WSWA 1EUDA 2QRJA 4E4YA 3CE6A 4WOKA 1P74A 3DOCA 4EBFA 1H2HA 3OH8A 3M2PA 3TZHA 1PJBA 1P1HA 5EL0A 1GZ3A 3I9KA 3JQ7B 4OL9A 1H6BA 1M75A 1Z45A 3RWBA 4NBWA 1B26A 3K30A 4W9NC 1CQJA 4M1QA 4O0LA 1VSVA 2R6JA 4A27A 2TMDA 3SC4A 5JO0A 3OEWA 4Q3AA 4AJIA 4ZJUA 3AM5A 4GAEA 4PIVA 1FDVA 1DC6A 4RPHA 4D7AA 2B69A 1AGNA 3ROQA 3NT2A 2OFPA 2O3SA 4XWYA 4EI2A 3H8VA 3GZNB 3DDNA 4FFNA 2CVQA 5CHEA 2VOEA 1Y5RA 3ROKA 3ZNQA 3DWFA 2QG4A 4RF3A 1F8FA 2BKAA 3QWAA 3D64A 4WGGA 3WQRA 1SNYA 3TWOA 2DBRA 3AUSA 3KYCA 1PZFA 4U0KA 1VL6A 1AHHA 1NHWA 4FBGA 3VPXA 2IZZA 2P5UA 3GGPA 4E0BA 1A71A 3JCZA 2PD6A 4QFCA 3ZWPA 2AQKA 4QO7A 1P3DA 1N2SA 2IZ1A 1YQXA 2HMVA 4MJLA 3ETGA 4BO6A 2W4QA 3C7CB 4HNGA 4JJGA 5AOVA 2B5WA 2BF7A 2W90A 5MDHA 4NBRA 3MTGA 3STHA 2DQ4A 1NVGA 4GI2A 1F14A 2GCGA 4YJGA 3AOGA 3WOHA 1DIBA 3HQ4O 4CLRA 1CYDA 1KVUA 1AE1A 2HUNA 3E8XA 4AFNA 4MP3A 3GEDA 3H3FA 2NM0A 3DZIA 4FFRA 1A9ZA 1ARZA 1KS9A 3KUXA 4AJLA 1LLCA 1PJLA 2VHYA 2VUTA 3PXXA 4XYGA 3FPLA 2VHXA 5L95A 3GVIA 3RI3A 4JBGA 3UAGA 2GF2A 3I3OA 3OA2A 4BNWA 5ICSA 4IS3A 2I5PO 4XDZA 2NV6A 3JQFC 3ZWNA 5CAEA 3OJFA 1E1NA 3U4HA 4CUJA 1GEEA 1CEQA 3IL2A 5B4VA 5TGDA 2JJYA 5KJ1A 4J90A 4AJEA 1D7OA 2AE1A 3GG2A 2UVDA 3B1KA 1M6WA 3EW7A 2JFHA 1BRMA 3UGKA 3D3WA 5IF3A 3VH3A 3VKUA 3NDRA 3ZNOA 2CD9A 2PGJA 2QYSA 4CMIA 3SEFA 3ADPA 4GWGA 1B0AA 2NTJA 1R0SA 4UVDA 4UUMA 3D4OA 3QJ5A 4CMGA 2EF1A 2AE2A 1P1IA 1NWHA 3MOGA 4R3WA 1E7SA 1HWYA 1G0NA 4EUFA 4MINA 3JV7A 2C2YA 3BMQA 4K26A 4YJGB 1HE2A 5DBIA 5A9SB 1YDEA 4HNHA 8LDHA 4YAJA 5IXSA 3SJ7A 4IXTA 2POQX 5DOVA 1DIAA 1M66A 4WEOA 1C1XA 4YJHA 4NFSA 3OQBA 3LC1O 3QVSA 2AEMA 3I9LA 1HZJA 4DUPA 4PG6A 4CMEC 2HKIA 3GLQA 1L7EA 5AVOA 2B37A 4PCVA 2Z1NA 4BO4A 1E92A 2DPGA 3DAPA 3JQ7A 4ALJA 1MFZA 4W7IA 2W2LD 4JN6B 1FJHA 2DU8A 4XQ9A 2BI7A 1P44A 4IDFA 1IULA 4XR4A 2OORA 5A05A 4CJXA 1UXKA 4U5QA 4J9VA 4A2CA 4ZU3A 4OSOA 1QYWA 3ZWVA 3KLPX 5L4NA 1OAAA 1BW9B 4RVUA 2EGHA 2HQ1A 1GFSA 2PR2A 1ZK2A 1T2DA 1ISJA 5EJ2A 3VKVA 4KQXA 2BGKA 3GFBA 1ENPA 1EUZA 5L4SA 1YL7A 3IOYA 4E5NA 3ITDA 4IY1A 3H4VA 3ANNA 3F5SA 5DP1A 2FMUA 3L4SO 1HEUA 4I5GA 1H0KA 1WDLA 1BHSA 2R00A 1PGPA 1A7KA 4IDCA 2CVOA 3GAFA 2IYPA 4YAIA 4B4OA 2I3AA 2JD1A 2QIOA 3RCBA 1BG6A 3IMFA 4CM4A 4LMPA 4MVJA 5L7WA 5CEEA 3QQPA 1LU9A 2YQ4A 2C5EA 3Q1LA 4J43A 5AXCA 1QRRA 3BHMA 1EFLA 2Y1CA 4KDEA 2J6IA 5CFZA 2RH8A 3GHHA 4DPKA 1I3LA 4LN1A 5KVCA 3QLJA 3NEPX 1N1GA 3HUDA 2ZB7A 2HMTA 4MIOA 3RC1A 1KC1A 1GUZA 5CDSA 1WDKA 4MVJF 4CUKA 4URFA 1N8KA 2Y1EA 4PGFA 3GEGA 1R4NA 5EMHA 1U7TA 3MWEB 4XEHA 2EKLA 3DMYA 3PZRA 2RCYA 3GRPA 1R0KA 1JVSA 4A7PA 2VWQA 4Q3BA 1S6YA 2OXIA 3AI2A 3WIEA 3ZWXA 1C1DA 1U2DA 3RU9A 4FDAA 3WGTA 4GKVA 1W4ZA 3ST7A 3EAGA 2J3HA 1YE3A 4NHEA 5JXWA 2HMUA 4ALLA 4WK6A 4B7UA 5IDXA 2Y1GA 4TRRA 1RYEA 4K28A 3G3EA 1PZGA 4DA9A 2PNFA 2Q4BA 3L6OO 1QR6A 4RV9A 3ZU5A 4Z3DA 3H6KA 3MZ0A 3PDUA 4J3FA 4ID9A 4CV1A 1ZK3A 3ENNA 1WZIA 4CLEA 1O8CA 5BNTA 3DTTA 4PG8A 1XEAA 4OYRA 3VTZA 1IOLA 3K8ZA 2GZ3A 4B79A 2XPCA 3GVXA 1ORRA 1CIVA 3HFGA 2D0IA 1HYHA 2X9GA 4ALKA 4CODB 2OO5A 2DBZA 3TQHA 2ZATA 4IQ0A 4ROSA 4DBZA 4E6PA 1VPDA 2DFVA 5KJCA 1YL6A 2JHFA 1GEGA 2I99A 3A9WA 5HA5A 1WMBA 1ZIDA 3WGYA 1YOVA 4YQZA 4NQZA 5JDIC 3CUKA 3F4BA 2GUGA 4PLVA 3LU1A 4GPD1 5T5QA 3KB6A 2DBQA 3RUHA 3JQ9A 3WYEA 2Y0DA 3FTNA 3HDJA 1OFGA 3LT0A 3HG7A 3RKUA 1HLDA 1DLIA 4DYVA 2A4KA 3MEQA 3NTQA 2Y0CA 2VRCA 1XYGA 4OM8A 2PGLA 1ZXLA 3QW2A 2BI8A 3EMKA 3E5MA 1XGKA 2P9GA 4JCOA 5THQA 1HETA 4AG3A 4BNXA 1FMCA 5EN4A 4EW6A 2BHLA 4RPJA 1IE3A 2OP0A 1ZK1A 4N5LA 1SAYA 3EDMA 2NUAA 1UZMA 4FJ1A 4NU5A 3N58A 1PQUA 2YQ5A 4RVSA 1NBOA 4GKBA 1QYVA 2A9FA 4WLEA 2O4UX 2OMEA 5DDIP 1JW9B 1AUPA 2ZJ1A 3MJVA 1P77A 3VPGA 4OGWA 1F12A 2B4QA 1DJNA 1J49A 1UXHA 3LLVA 3FRJA 4G81A 4OOEA 2ZKLA 4GL4A 3W1VA 2H5LA 3VHRA 4E2WA 1PEDA 3ASUA 2NU7A 2AA3A 2YFQA 1IPFA 1I30A 2YV3A 5KVSA 1R15A 2DC1A 1G0OA 3JQDA 4JNKA 1JQBA 4N5NA 1H6CA 1DOHA 3WLEA 2NTNA 4PLZA 1CETA 2FR8A 1EVJA 4RVGA 3UH1A 4D3DA 2H1SA 1WP4A 3PIDA 4AJ1A 3UFXA 2HU2A 4YBZA 4Y98A 1YB4A 3GUYA 3WSVA 2FZEA 4PG5A 1DRUA 1JLLA 3GNQA 1DO8A 2NQTA 3SX2A 2GN8A 2RAFA 4L4XA 3T4EA 3QVOA 1JWAB 4CV3A 2IDZA 3OJEA 2GPTA 5A9RA 2NNLD 2GLXA 1Q2XA 3BYZA 1V35A 2O3TA 3H2SA 4ITUA 3W8EA 1BWSA 3GHYA 1PS8A 4NK5A 1LDMA 1ONNA 4JP2A 3DHEA 4Z9XA 2P5YA 1JKIA 4UVGA 1IZ0A 2IEDA 4TROA 3VZRA 1WPQA 3ZNNA 1UXIA 2GASA 3RUIA 4IS2A 4FIZA 5GY7A 2PZKA 4BMNA
chains in the Genus database with same CATH superfamily
1VHJA 4PYIA 1ABEA 1QDLB 5C51B 1RQNA 1E1CB 5NULA 4ISBA 3TQOA 3PYLA 4I2NA 2CZGA 3E18A 1EGHA 1CNMA 1D07A 2AB0A 2D62A 3DA8A 4QQFA 3ZI4A 3FRIA 2MSCB 4YVFA 3RYFA 1FMJA 2PR7A 5JANA 2V3VA 1SCJA 2VPIA 4OSPA 3AZPA 4W63A 1J1UA 1XTZA 1NVTA 5F35A 2UKDA 3FWPA 2R65A 1B43A 1Y1QA 3GRZA 1K4KA 2BHTA 3A4IA 3KHTA 4LE2A 3T7IA 3TIXB 1T4CB 2WUVA 5KWIA 2CCJA 2QHXA 3KLMX 2EX1A 2LP4Y 3E9DA 4ND5A 2B99A 3ZLVA 3A1EA 2HIGA 3K70C 3E35A 4R1UA 1TU3A 1EE9A 3IAUA 4J4HA 1V25A 1MO6A 3I6MA 1TJYA 4RKRA 1DC7A 4YJ2F 1QFSA 3JZFA 1KJZA 3OEYA 5T4BA 4ARZA 3BMOA 1NF2A 3A3OA 2XUQA 5CVTA 4C6HA 1WUKS 1R0CA 2WF8A 3W7BA 4G5XA 2PMWB 4N54A 4U7JA 2AR0A 3UATA 3U1BA 1TGYA 4MLDA 1QZ3A 4DREA 1J20A 3NC0C 4QUJA 3F0TA 3SPXA 3X0DA 4OCZA 4F5ZA 3BDAA 5EHIA 1I24A 2H54A 2QP3A 4QSHA 3TQIA 1YXMA 1I01A 1PNVA 4KIFA 4FQ5A 1EGAA 3R3HA 5JJKA 4YFVA 1KEWA 1RHRA 3LCUA 3L93A 2OC4A 4EX6A 5KOJB 1PK9A 1AQNA 3JQGB 1NP3A 1TQDA 1P6XA 4COKA 1KQFA 2CFCA 3BMCA 2IYFA 1I3OA 1IOZA 3RT1A 1OXTA 4ENVA 3DVAA 1M9NA 1CC1S 3QTLA 5D5HA 1JDPA 4BZWA 4XWGA 1ZN8A 4WLOA 5EP4A 3S8MA 3SHVA 2IYVA 2QMHA 3OZ7A 5A9SA 5L4LA 2F3PA 4TZ6A 5AJVB 1L7DA 3JD3A 4NS1A 2QOEA 3GJTA 4LQ4A 2QW0X 4ZV7A 2QUIA 4BJ3A 1K7XB 2Q2OA 5B4UA 1IMOA 4FHDA 4E1AA 3SF8B 1NJ5A 4KDCA 2R86A 2O06A 4DKXA 1WETA 2P4QA 3AU9A 4Y2HA 5EUBA 3BSFA 3A04A 4KCGA 4AZTA 2RK3A 4H1UA 1J24A 2VT2A 4WERA 1FSPA 3KFXA 3RBZA 2M98A 2YV1A 3GFPA 5AVJA 1F0YA 1U31A 2JI9A 2W22A 3I2JA 4IF4A 4ITRC 4IP0A 1FMTA 3WHKA 3L0DA 3PQCA 5AVKA 1P1BA 2CUKA 1Z5UA 3TPCA 2YWBA 3WIBA 1UAAA 2ZT8A 4BU1A 4RH1A 3RGWS 2Q1SA 4PLPA 1GTZA 3L5KA 1PV2A 5JASA 5JJ5A 2O8FA 4PFKA 4ZEOA 2GDZA 4PO3X 1VI6A 4S1WA 4F84A 3ACBA 3U4CA 1Q0SA 1E1RA 1RD4A 1EH5A 4B4VA 1E2IA 5BVHA 1UBUS 4XM1A 1ESMA 2KX7A 3TLZA 3K0FA 2N75A 4OQ4A 3VKFA 4D41A 3HU3A 3KXPA 4JVSB 1ZVKA 3RTCA 1TKCA 3ABRB 3L7BA 4CKZA 4XWAA 2OAEA 4RIHA 1IN8A 3V46A 3M6FA 3IP8A 4X3CA 4C2BA 4FEAA 4CFSA 5KUTA 5TQ0B 3BJEA 4PPFA 1LI4A 4IIEA 3ZKAA 3ZU2A 4TS9A 1YR2A 2D3WA 1RRMA 3L46A 3PD7A 3QVTA 2OHOA 3RUAA 1TZKA 3M34A 3UK7A 5F9FA 4JGGA 4CN9A 5JSYA 2O2SA 5E1DA 4CDNA 3KQNA 3UJCA 1M1YE 4HTFB 2FPKA 3DR3A 4URYR 5B30A 4DB2A 5J5AA 1FVHA 2P11A 3TD6A 3WLTA 1A2QA 2D2VA 3IBSA 4BVBA 4D81A 1VFPA 2PBFA 2Z0MA 2QN8A 3G9QA 1F2UB 5ALHA 1L5ZA 4N18A 2R1VB 2GOYA 4A0SA 2OFXA 1OXKB 4B5LA 3O4GA 5ADHA 4B32A 2IT1A 1T34A 2X4IA 2NO0A 2YFHA 1HE5A 2OE2A 3CH6A 1MH1A 4O4LB 1NQVA 4RQTA 3ZWWA 2D1SA 5GM2A 5HCIA 4F1WA 1QYCA 3INNA 3NOOA 4PFJA 2G8LA 2UXBB 4ZARA 1SVLA 4OHZA 1VDMA 4UEOA 2BGUA 5AW4A 2AFIE 4BRSA 4AY4A 4KO4S 4W1SA 1SG6A 4B8ZA 1N5DA 1IIRA 3UK1A 4C4PA 2GYYA 3W77A 4RA6B 4LIPD 4N5DA 5F77A 1RWWA 2H3HA 1MFPA 2OZPA 4DIDA 3AWDA 4NCHA 4H6VA 4LVOA 1V37A 1QG0A 2QTTA 5EWMA 2SHKA 3A1TA 1N36B 3HS3A 3QRWA 1DXYA 3L92A 1EK5A 1KI2A 1OH6A 4QU8A 5IANA 2R8BA 1Z83A 1Q1NA 5EFZA 1ENYA 2I4MA 1Z5WA 2VDWA 2VQ6A 5D3MA 3LXMA 5JECA 1GVNB 4QUHA 5E4FA 5LU8A 1TGVA 2QMUA 2GBFA 3E0XA 1NNSA 1ZFNA 1BE1A 4KXXA 1L4BA 1S1CA 5JALA 4S1TA 4EJSA 2WPDD 4HWGA 1JDVA 3M2TA 1X94A 1A69A 2WDPA 4FYHA 3VU1A 4FW8A 4I5FA 1SQFA 1HQKA 1YFKA 4LRWA 3IIKA 5TF0A 4YECA 1UEJA 2CL5A 4WVLA 3B13B 4BB6A 3ZV6A 4QULA 1U6KA 4BBJA 4B3JA 2PSHA 2VJPA 3OAAD 2XF8A 4KH0A 4C07A 4XFDA 5GZ1A 5K99A 1O89A 2O1XA 1BVHA 2FEOA 4HDSA 1CRQA 1YBMA 1W4BA 2XNSA 3F4LA 4PXSA 4WOPA 2P4UA 3TMYA 3SFVA 2GGSA 4WVFA 3ROXA 3SLKA 4BLUA 4WXHA 3QBDA 2VNSA 2ZIXA 2XUZA 4NJOA 5DGXA 4JT8A 5KWEA 3HR8A 2OXCA 1TLTA 2X8LA 3K4PA 3KKZA 3C0KA 3GWGA 5E7IA 1SQSA 4CL3A 1AA9A 1A7AA 3JR3A 4CHTA 1V95A 2NT4A 4J4TA 1J9ZA 2ODBA 1Z36A 2XRYA 3KZCA 4G0QA 3PPVA 2NXNA 4LG1A 1RM3A 1SCUA 1VP9A 1KGDA 3RHSA 5EJGA 2C29D 2VP0A 1FQWA 3CLVA 3JASA 3JW8A 4Q3DA 3DD1A 3OTOB 3RIHA 3W2HA 4X95A 3M1LA 4LJSA 3HCBA 4NJMB 2SCUA 4M53A 3WGVA 5FOXA 5C8DA 1VSBA 1QHNA 3PUXA 2BH2A 2JJ8A 1YB5A 2H9IA 3JSXA 4ZTZB 3IS3A 2A9QA 3MJDA 5C5EA 2V03A 5KZMB 2OEPA 1CK4A 1L7BA 2GK3A 1NLFA 2I4IA 1PUIA 2Y76A 1XL0A 2YZNA 3EXIA 1MZVA 2H0QA 3Q7SA 4WFJA 1RI2A 1M2VA 2A9VA 2GARA 2PT5A 3N75A 3RRYA 3JVEA 3T3PB 4CQLA 4YWHA 2C2ZA 4BN4A 5CX4A 3N2EA 1A97A 2HF7A 4FHCA 4CR6A 2WJ6A 4KIUA 2D6FA 4UHJA 2WM3A 5JAQA 4L2IA 5LLDA 1N25A 2FEKA 2QRNA 3D59A 4C0KA 4ZHQA 3D1LA 3K0AB 4GVXA 4OYYA 4BP8A 2CXOA 3W5SA 2YWRA 1E3IA 1IBSA 3NETA 4S0XA 1IDOA 3E1KA 1ADBA 3RRJA 4A8TA 2XEXA 5DXAA 4X62B 5DX8A 3VMFA 2QVCA 3VNSA 3TNDA 1NV9A 2JI6A 2P1RA 4WBSA 2BC9A 3OTQA 5CVCA 3SHWA 3DFMA 2ADFA 2PH1A 2FHPA 3DZCA 4TV9F 4QEZA 1QP0A 1VLHA 2XKKA 2EFJA 4HNSA 2IZ6A 4IDOA 3KD2A 4M0FA 4CU5A 4KDRA 5EI5A 2ZB4A 3A6PC 3ZVMA 3KT3A 2GWHA 3BL5A 4BQPA 4JL5A 4GX2A 4L5BA 1K5DA 3PRYA 4JGBA 2VZ0A 4W8OA 2IK8A 2QM8A 2Z2IA 4UTZA 4DCJA 3NANA 4YIHA 1XQVA 3ANSA 4ZQHA 5FBLB 4DZZA 1Q57A 8GPBA 1W5SA 2IELA 3B1ZA 1E63A 4PSKA 4YAOA 1IVSA 4IQFA 4XCQA 3FSJX 1D9ZA 1N9ZA 1SUAA 3SF0A 2POCA 4IJVA 2YZKA 1PR1A 2VT7A 1R7RA 5K8IA 4FSDA 4TPKA 5EPEA 5EE5B 3HN2A 1KJYA 1WDTA 3B89A 4MVYA 4KR3A 4D9CA 3PF8A 7REQB 1PT8A 1ZLYA 1F6WA 1SMKA 4Q3OA 1A5TA 5K20A 5LU9A 5FFFA 3CVXA 2JLYA 3O8QB 4ZEMA 1VLVA 2P35A 3BB1A 1PQ4A 1YS9A 5DLEA 2WJ3A 3NIDB 2YOFA 3BCHA 221PA 1QQ5A 3VZBA 4ZCRA 1E20A 2IF0A 1SWWA 4ILKA 4DJTA 4U3JB 2XYQA 3MF4A 4NULA 2A6PA 3DE2X 2DWCA 2QS9A 3QNUA 3BB3A 3V6LA 4RVOA 5CT4A 3CEHA 1NVBA 5CFPA 3S2YA 5BSGA 2JI4A 2HYDA 4HQ6A 4MW1A 3AQIA 2PCJA 4U6NA 5T57A 5LZ9A 4H15A 1OIWA 1V5FA 2R0QC 1JKXA 5KYVA 1U3CA 2GHQA 3DLAA 5HJ7A 1CHNA 3LY5A 3PV0A 5MF6A 2Q46A 2QZJA 2WHXA 4BGDA 1PJ8A 1NY5A 2I4LA 4JMPA 1I4TD 1E69A 2W6NA 3QVVA 4UZEA 3DTVA 1N75A 1Y81A 2ZRJA 5KSZA 1R4ZA 2A1UA 5HW0A 1WOMA 1YZFA 2ECPA 3E03A 4RMJA 4XSHA 3T1VA 2FZLA 3O38A 1H2EA 4RLSA 5CNJA 2FMXA 4JT4A 1UXJA 5I4BA 2C3UA 1R0XA 2JGEA 1FRFS 2UV8A 1WXDA 2FV8A 4P5EA 3KQYA 1KYYA 2E2WA 2VPPA 1I4WA 3DXYA 1PU2A 2OB2A 1AURA 5J4YA 1GN8A 2Q1XA 3O0DA 3E23A 1SPXA 3RVNA 2H29A 5KREA 3FB1A 1F2TB 1R4MA 1YZGA 1Y7TA 5D1NA 2EW1A 3OF2A 5KYXA 2ARKA 4HNQA 2FXIA 1SKAA 2E4AA 2ODQA 3GP8A 2GJKA 3UHJA 2XCOA 1OAOA 1SB9A 2RJOA 4NMMA 2J5KA 4DC1A 16PKA 3IAM1 3KALA 4PPNA 4L57A 1KZHA 2BGIA 1IOWA 4UKDA 4KITB 5JQWA 3UMMA 1HE8B 1JMYA 4GLFA 1U7XA 4GFDA 4N4AA 4BVEA 3TBKA 4PC6A 3BEOA 5KNBD 2V4UA 3FUCA 3C14C 3OM9A 3JVUA 4E07A 4JJFA 1ZZEA 2P8JA 2BCGY 1M0SA 4CM1A 3ZHOA 3BH0A 3G5UA 2WFLB 3DFUA 1QHHA 2VP2A 1UWKA 4JSTA 4O4JF 4OQEA 1JV2B 2VDJA 3OT4A 5F98A 3UJ8A 1U9YA 5ED4A 2AR7A 2JVJA 4QWMA 3FYTA 4GH5A 3JXEA 2CLDX 1N1MA 1ZUWA 4IKOA 1E79D 2G9ZA 3KSUA 5DU2A 2TMKA 3A06A 4N01A 1EZZA 1KO4A 4G09A 3QPBA 4Q37A 2VAVA 5EIOA 4WZAB 3U7QA 1EA7A 4TVKA 1VZ2A 1CE8B 4B3SB 2WIJA 1QQ7A 3D43A 2R8YA 4Q6WA 1ZKMA 4RK1A 2PRKA 1AXEA 2NZ2A 2QRKA 2B8JA 2WAMA 2O23A 3CLRC 3FPCA 4BUZA 4ETIA 2BZGA 2KYRA 5AVSA 3SS9X 1E1KA 2WLSA 1DAGA 1LC0A 2I9PA 1SIOA 2W6JA 1CB7A 2PTGA 3N5CA 2UU9B 4IF6A 4TRJA 1YVRA 2XCUA 1NE7A 2OCIA 4MA4A 3H17A 4G63A 2PM8A 5KTYA 1GFZA 4GMGA 1W35A 2BEWB 4TS1A 1ZITA 1ONOA 2JFNA 3I6QA 3RUFA 1ETUA 3GOQA 1N2OA 2P4SA 1NXQA 4YQEA 3OJ0A 4JI6B 2ZZNA 4LYEA 1JT2A 2IKQA 3B1JA 3C48A 1P60A 3PC4A 2R1VA 3QU9A 4EGSA 4HDAA 1Z5OA 2GD6A 3Q5GA 3VDMA 3WK7A 3ANLA 3GN2A 1B00A 1M1NB 1UJCA 4WAUA 3WIUA 2GEUA 4GSYA 1FTSA 2J48A 3TNYA 1XP5A 3DDHA 3IT2A 5ITSA 4KEAA 1X42A 4ER0A 1Y7PA 2AI3A 3DPUA 1R0LA 1ULZA 2CVZA 1VLLA 2EZUA 3KCNA 3O8QA 4PSDA 4XQGA 1ACJA 4QECA 1R6DA 4YRFA 1H42A 1V8BA 3SDZA 2VJKA 1DBPA 1Q1AA 3Q7PA 4IVRA 1P9NA 1NZDA 1HPLA 3QLUC 2I8AA 3F6YA 5I9MA 4D8TA 3THXA 3BXEA 3OZBA 4US2R 3ZQKA 4OHPA 4AN4A 4F46A 2MT9A 4O29A 1MZPA 1JAZA 2QVYX 4YUVA 3PPYA 2QPLA 2CF6A 1WF6A 3QSYA 4PX2A 1RHQA 2VLIA 4CWAA 1YRHA 4Z0HO 1S2LA 2OCXA 3HADA 2LPMA 5DW3A 5AHKA 2QNBA 5JMPA 2WB2A 5G4KB 1V1RB 1CEEA 1OVGA 1A88A 2FLVA 2IEGA 2GPAA 4TKMA 1NRJB 2HQOA 2ZSKA 4R1LA 2D5LA 3A4MA 5CA0A 5L9AA 3TTVA 4GKAA 3VHXB 2PZEA 4TKLA 1E6WA 3SZ3A 4DCTA 5B7QA 3ZE6A 4UDXX 2QD4A 1T2AA 2QE7A 4O3FA 4X44A 2O5EA 4QEDA 1NOKA 2QTVB 2JZOA 3WLLA 2C07A 2GTIA 1WO8A 1Z15A 3MELA 4UXIA 5K51A 1JVNA 2RGDA 1V41E 3AETA 1A9SA 2FX5A 1DDIA 5K0GA 2D4HA 2FK8A 2HEIA 4PQEA 1E3TA 1E96A 4HOYA 2WG2A 3KR2A 1MOSA 3D8SA 4Y1RA 4U02A 5C31A 4KXYA 4M0MA 1OW3B 3AFIA 4X5OA 3T3IA 3BGDA 2XKBA 4FR0A 2EZTA 1OROA 4PX9A 3A3PA 5ESXA 4W8GA 5FHRA 3IJ5A 3UW3A 5IC4A 4O6VA 1N3BA 4C4AA 4D57A 3IDSA 3BB4A 2C0CA 4Z0TA 1ZD2P 3S2UA 5JAIA 4B6FA 3ZDRA 1U9ZA 1PK8A 3QOFA 3ZCUA 3LY7A 4RK7A 3K0HA 4JENA 4YLYA 1SQGA 5FIUA 1KJIA 4TS3A 4KAXA 3UAZA 3D8NA 1MXFA 4TYQA 3VNQA 1YF3A 3WICA 1JDJA 2HI0A 1QRUA 2JLBA 2VXBA 4OUDB 2J9XB 2F1HA 2PEZA 3FIUA 1E4EB 1P7CA 2XCLA 3VR6H 2C2MA 4RD3A 2R3SA 1E4EA 2CZCA 1Q6YA 2CSUA 1NVXQ 2PL9A 4RENA 4ZOCA 2OAP1 3B1VA 1AUOA 1ONPA 3ETNA 4PX3A 4PW0A 3B9RA 1PJ3A 2AQ8A 1EK0A 3GJ6A 3HSSA 1V8FA 4OQZA 4RFLA 1O9BA 1IB6A 1H0RA 3QK7A 3RJ5A 3KXDA 5IDWA 1DADA 1PWXA 3VMMA 1CF4A 5L7TA 3EOBI 2XMSA 3UT6A 2GPJA 4ZAVA 4U6SA 1I33A 1K0FA 2W8ZA 2CV2A 1GPLA 1UT8A 1II8A 4Q5IA 1CZHA 3OPXA 2CXSA 1EPUA 3WADA 1W46A 3WZLA 3E3OA 4PZLA 2QI9C 3OA0A 4G67A 1Z9BA 4EL5A 3TLYA 2F3SA 4EJ6A 1GCGA 5L51A 1O0CA 2ZUCA 1L4YA 3ZY6A 1ZYUA 3HM9A 1W34A 2B78A 2WIAA 4E3WA 1P80A 1NMYA 9ATCA 4YQFA 1XK7A 1YFZA 4GP9A 3DHNA 1YKGA 5I7EA 4OFWA 4A6XA 2YFYA 3NJ8A 5IW8A 3RIGA 4LZWA 3ZIAA 2WAXA 5C8YF 1XHEA 2F17A 3GZJA 4E5SA 3RANA 1RJDA 5FR2A 3NV9A 3Q11A 1CEXA 1XZAA 1W2GA 2ZRFA 5IUKC 4MS4A 1UM9B 2IH2A 1M8PA 1NAIA 3WAGA 1NTRA 3OFVA 3HB9A 5EUQB 5KDLA 2RD2A 3IR5A 2F9LA 2MYTA 2BGLA 4NHOA 4NV3A 3CR7A 1YJ8A 1KY3A 3NHPA 5DW0A 1L5RA 3DAFA 3GQBB 3N3BC 2AOUA 5J4KA 1VJDA 4M87A 4DAEA 3ECCA 5U9CA 4GM4A 2LVBA 1T26A 4HN2A 4PYNA 1W73A 5TS3A 1UJBA 2AGVA 3D2CA 1FFXB 1OF1A 2QDKA 1WHTB 2WHRA 1W59A 1QIMA 2VO1A 3D0OA 5CM9C 3EEOA 1SXQA 2PZLA 4K1XA 1ORVA 5BR4A 4HH1A 3B1WA 3PJEA 2Q1YA 3NQ41 4OHUA 1OYVA 4OI2A 2X40A 3MWLA 1W49A 2I0FA 2OESA 3A10A 5TS2A 1OGYA 3AQ4A 1ZI8A 3KQUA 3UGQA 3RAPR 3RJTA 1JU9A 4UPDA 4R0MA 1CULC 2QX8A 4LVCA 3WNCA 5B6IA 4I1RA 1U3UA 2CXHA 2CLOB 3DE5X 4JXZA 2ABWA 3EXHA 3GFGA 1CJSA 1X92A 1ECGA 3Q12A 4V38A 1ISSA 1AKVA 3BGSA 4U9IS 1V8DA 3GCGA 3QHQA 4IZOA 1OX4A 4UXHA 5AQ1A 3GJRA 4G5HA 4BNFA 2W4IA 3CFYA 3NBFA 5DYWA 2XWQA 4EW3A 1KVSA 3I9OA 2BCJQ 2XUDA 6REQA 3UYLA 2GN1A 3EMDA 4OJMX 3T7JA 3GFSA 2OWEA 4FDVA 1K06A 4QQ8A 1R00A 3QKSA 1KZYC 3PP8A 4ML3A 3LW8A 4NOLA 3EXAA 1AF7A 4P3PA 1V3VA 4I4TA 3SKYA 3NRBA 1T5IA 4DLTA 1Z4QA 3P19A 3VOTA 5JATA 2M1ZA 4J07A 3ZCXA 5D1HA 4LI3X 4JXXA 2AVNA 4N48A 3SBDA 1WX1A 3KAQA 4HUQB 1CF9A 4Q24A 4KFCA 9LDTA 3COJA 2JGMA 1X0XA 1XTIA 1QWSA 1WLSA 1WF3A 2EOAA 2WKRA 4IIDA 4PLGA 3QFFA 1M1UA 3OEHA 1OFUX 1PAUA 1W6UA 1PJ4A 3A2LA 2FUG6 4CMEA 4QKQA 3KHUA 1VKNA 2X0IA 4P7KA 3HKEA 4WSOA 4DLAA 2DUUA 2CL0X 4CIYA 4E32A 3KSDO 4L02A 2O2CA 5AHWA 1VHQA 5ALIA 1ND6A 3FUVA 4N3GA 2DJIA 1BCSA 2R11A 3JQGA 3KKPA 1NQOA 4ZEXA 3PI7A 3F3YA 4YRRA 2WIBA 1QP7A 1B23P 3BORA 4RYLA 1R9MA 3OQVA 3ANTA 3CZAA 3URKA 4UNNA 3SWWA 1IXSB 2OXEA 3IAS6 3NYWA 4MAFA 3GLGA 1E3MA 1PZEA 1K68A 2NUPB 4PZEA 3MJCA 2QYHA 3CX8A 1ABFA 4Q34A 4XYEA 5D01A 2GHRA 2NYAA 4DLPA 1UKBA 3K0FB 3KE9A 1QMGA 3M6WA 1QVWA 2O05A 3MCVA 3R5KA 4YRIA 2Y8EA 3UNXA 1LBQA 4BHTA 3U4QB 4MB0A 2PPLA 2RHJA 3B6ZA 3SE0A 4I19A 1DFGA 2H57A 1X1RA 2BTEA 4JCCA 1G5IA 2Y0EA 3K2QA 2VNKA 3V1UA 4NABA 5KNCA 1XRPA 3LK7A 4IZ6A 4JHLA 3WGLA 3AUUA 2FF7A 1JHPA 1CQZA 1RLUA 4ALMA 2NW6A 4QJ5A 1O6ZA 5AJXA 1DG9A 1Y6QA 3OPVA 4J0JA 5G4KA 2MU1A 4YIKA 4P34A 4ZZ1A 1OLOA 1NMQA 2VUSA 1KL7A 3FPKA 1F06A 3A28A 3NM5A 5KAMA 4YR7A 5KU1A 5GIOE 1M2KA 2X19A 3EE6A 2G0TA 1E1YA 1KYIA 1PR9A 3FNRA 3HN6A 2QUZA 1DC3A 4BZPA 4TV9B 4W82A 3JTEA 1J5EB 2BGMA 1F3LA 1TM3E 1Q7RA 3E3LA 3LKBA 5L3ZA 3AR3A 2XNDA 4HPXB 3C16C 4IH9A 4M49A 2QV0A 4PHTA 2EBWA 3P9SA 4Z9BA 1QH1B 5GOZA 4B75A 3FMPB 1W9MA 1WW8A 2J5XA 3SNHA 4XXHA 2BMWA 1CS0B 1AUXA 2RKOA 1ZM9A 3T4PA 1GO2A 4RETA 4TT3D 4BEVA 4YCBA 2QMQA 4QARA 1SVWA 1DS6A 5IM4F 1US8A 4JVMA 4BP3A 1UWLA 1BGVA 3OIDA 1BJRE 3CW8X 1WUHS 4X1IB 3ZVLA 1ZN2A 5KVVA 2XA2A 2JCSA 3EWAA 4X45A 5BXYA 3TYXA 4YPOA 3TG8A 4AZ3A 3AGPA 1SCQA 3EYAA 3OSZA 3GCXA 1G1MA 4FSHA 4YDQA 3PC3A 3IB3A 3QA9A 4WDRA 3U16A 4FI3F 1XZMA 3DPSA 1GYPA 4EY6A 5GONF 1XD2A 2FKNA 2LDBA 1N5JA 2ORVA 1TM1E 3EGDA 4NMLA 4KWHA 4Y18A 5DTIA 4LXIA 3ONEA 3V3TA 3VBEA 3T3MB 4EEXA 5BSEA 1RXUA 4IJKA 1VXOA 1A7JA 4JNCA 4QOEA 1MABB 4M83A 4XGNA 5DNDA 4YUYA 2Z57A 4D9NA 1Z75A 1Z0AA 1ZCZA 4RVDA 1RIFA 5CA0B 1G9SA 2XNHA 3UAVA 1CVLA 1H5QA 4X7MA 1G6OA 3HRKA 4G86A 1MIOA 1JHOA 4MIYA 1QV6A 5IPFA 2OHJA 4IV5A 1SBCA 2PQ0A 3ZY5A 5AVYA 2DP4E 1WCIA 4UHKA 3K3PA 1PLJA 1HL3A 5BN5B 4Q9NA 3TEMA 3SJBA 2YXEA 1I7NA 3LUCA 2JANA 3PCTA 3DYVA 2X0EA 2CDRA 1SZDA 3CKKA 2DKFA 2ZRIA 4H3VA 4IIBA 1WB9A 1N2CE 4M76B 3RIYA 1YBVA 2INGX 3H9QA 2Q5CA 4IUYA 4JUDX 5LIRA 3THXB 4D8VA 3RC3A 1N2CA 2GFHA 3G0HA 2C4HA 2WWIA 2C84A 5EKDA 3JAWA 2IYAA 4ZIRB 3PTLA 1H1LB 2O1EA 3TM5A 2RBEA 3KAPA 3NBYC 4MW6A 5DN9A 1N7JA 3WB2A 5JAMA 3K5HA 2PRIA 1V8PA 4ND7A 5ESRA 5HP4A 4TTRA 2DLCX 3E8SA 4X93A 4RNCA 1XFAA 1ZONA 4RUKA 3JARA 4M1TA 3RROA 3Q6NA 4GBGA 4LBYA 1EFAA 4PO8A 1HFKA 2A94A 2P78A 4ZPJA 4H0CA 1L7QA 3C3JA 4S1PA 4X97A 3D3WB 4IICA 4GZLA 3KKKA 4DDWA 1CY0A 1TUBA 4U2GA 2C9YA 4QATA 1JIXA 3HEMA 2HSWA 4NFYA 1E9RA 2YHSA 3RD5A 3CR3C 4BO8A 4JI7B 4IINA 5FWYB 4R7ZA 5KYYA 4I1YA 1HF3A 3DP7A 4JYBA 5LZ4A 2HUPA 5DEOA 1TFRA 2JCVA 4JJ7A 5JEDA 1ILEA 1OWOA 1OX4B 3L6DA 5F52A 1HG0A 4P6VF 1MC5A 3OWOA 5BSHA 4MRRA 3FSGA 1GTL1 2UAGA 2X5JO 3DFZA 3LF1A 1NNUA 3A2MA 3GJQA 1FS4A 3P0FA 1M6VA 4NP6A 4V0SA 4MR9A 4WNCA 5DE3A 3H5IA 4WZBA 5KTNA 1EG7A 2Y66A 4CMHA 3N2LA 3WJ1A 1AZLA 4CM9A 1OIXA 3UG6A 4I3HA 1GGEA 5FTKA 3D8UA 2FWJA 2WAAA 4FT4A 3TQQA 2XLBA 4CR8A 3N0WA 2D06A 1MDFA 4W5JA 1J0DA 1ZD8A 2JFZA 5EIHA 5BW8A 2BI4A 2CE2X 3QXXA 3BHJA 4DM3A 1JZTA 4NG4A 2J5BA 3G9UA 5EJAA 2WSIA 3LUFA 1CR6A 2GJSA 2MSDB 4XJVA 1IHOA 3ZHQA 1RQGA 1J5PA 3L8CA 4YP6A 1O1YA 3C4QA 1F4LA 4KN8A 3ILHA 3MGKA 2Z5GA 3TW0A 4P4SA 2E6KA 4LJ5A 2NUAB 1RABA 1L9XA 1VSTA 2WWHA 3T8YA 4B3DA 1KEPA 2OHFA 3AY7A 4IOMA 5FPQA 1HFWA 4Z1MA 4RTQA 5EAIA 2JAQA 1MG0A 1ICIA 1UP6A 3LPDA 2FEMA 1Z6QA 3CVVA 1CFJA 3AF1A 2QTNA 1JPVA 2CYAA 3S5JA 3VNBA 4F2GA 1TUBB 1LRJA 1MPXA 5ALRA 3HHPA 3TZ6A 1WPGA 5HYVA 3I9V6 1UC4B 2LE0A 3Q0TA 3EIFA 4PPQA 2OHHA 1J1IA 1DI0A 2QLFA 3FKSD 2PS0A 3LL4A 4RK4A 2PUBA 3RTEA 2XIJA 2G82A 4FBLA 5EJEA 2ZJZA 1IYZA 4HDNB 1C2TA 3NDIA 2PG3A 5HKOA 1QIJA 4FBMA 1SQ5A 3KB2A 3O92A 3K9FC 4PQGA 1CUHA 4GRDA 1B1AA 3PNKA 1L5HA 1XCJA 3WQBA 1BKDR 4AY5A 1WMEA 4HBZA 4RL6A 1J0EA 2QRQA 4DARA 1SRRA 4R71A 4UTXA 4S1NA 3N2KB 1K5HA 2BW0A 1NFFA 3EWNA 2RGWA 4MV8A 4F7WA 2IGBA 1D6JA 1PUXA 2D3TA 1JDTA 5F33A 1JG6A 3PC7A 4XIJA 1FYDA 3N6VA 3U09A 5A3SA 3ZEAA 1Q92A 1UEXC 1P7PA 2B8TA 3NV7A 4YA6A 3HFJA 1GQOA 4EPYA 3DE6X 2B0JA 2FN8A 2Z09A 3QBVA 2ISQA 4QOJA 1PFQA 2ONJA 3VJLA 4PN7A 4QG3A 3TW6A 2ID7A 3NUGA 4NV1A 3TRDA 2W6ID 2G5TA 4S1OA 2GRUA 2IDMA 1KWKA 3W5BA 3MWJA 3Q15C 1ESCA 1GAWA 2XGMA 4GGOA 4L5YA 2IU6A 4LZAA 1K92A 2A92A 4YCSA 3W9BA 1PR4A 1SA0B 3CE9A 3NTVA 3RR2A 3ZCPA 4ENPA 3UHAA 5FPKA 4U7DA 5DM1A 4QYXA 1R0YA 1DT3A 3WK5A 1Y3IA 1E98A 3H1BA 4EHIA 3THWA 3PFFA 4COOA 4N0EA 3EXIB 4CW7A 1L5KA 3BRWD 3TECE 1Q0LA 3I09A 1Y3BE 1PBTA 4HRXA 4BVGA 3NWOA 5A02A 2N1MA 4BAZA 2J5RA 4J2TA 4PXYA 2H4WA 3WO1A 2XHEA 4QYIB 1GGKA 3C3DA 3I5XA 2SCUB 2VKTA 4AY6A 2HW8A 1JP7A 2ZREA 4IWXA 1RJFA 3AVWA 4YCLA 2FMTA 4FGZA 3PGJA 4ENSA 2OYCA 4LV5B 3RHZA 1YZVA 4XCVA 3U7QB 3C8MA 3GP5A 1EESA 2ZS8A 4MRNA 3V6MA 4UTOA 4DMRA 1QYIA 2UZAA 3W7AA 4ZYXA 4MRMB 3NVKI 1CRLA 2I34A 3F5FA 1BVUA 3R5TA 1ZG3A 2ZUBA 3OHMA 2WSYB 2MCFA 4OKIA 4BL5A 1ODSA 3TUJC 3S1SA 1QGDA 1E9SA 1VLZA 3MMSA 4ECEA 1Z6ZA 4HDOB 1Z4NA 3L1VA 2VUUA 4JLKA 4EUFA 9GPBA 4JBLA 3GLFB 5BN5A 2HCJB 3CUWA 3AESA 2IKSA 2O6LA 2ZYGA 4ZTUB 5C8XA 4BAUA 3UJAA 3QEMB 4BFWA 1KFCB 4XDHA 1CR2A 1KXJA 3D8BA 3NALA 4FYVA 2V59A 3GMTA 1QVZA 5DLQC 5G3YA 3UPUA 4F4HA 1A9PA 5JHHB 1KI3A 3PR2B 4KR0A 5CFQA 4NU6A 4H17A 1VBKA 1I94B 2WWFA 1YMQA 1R8SA 3GGCA 1TZ2A 5A3JA 5KTKA 1DXQA 3SXPA 2Z2XA 2B2CA 1GUBA 4R1PA 3N8DA 3C5HA 4I5IA 3PWZA 4EHHA 3RVQA 4C30A 2QD2A 4OH1A 1T8SA 1KEKA 4NJEB 1TA0A 1M0WA 3F6RA 3CLTC 2REOA 3R6WA 5L3SB 1KDZA 3BIWA 1XU7A 4HEHA 4QBKA 5JMTA 4RXTA 3SM9A 2GNAA 3HABA 4RMHA 2PUEA 4ZDKA 1S01A 1L4EA 5CDFE 1H5NA 2Q21A 3A1CA 5EIXA 4RVCA 4KMMA 5DTQA 1ZOPA 5WRFA 1DRVA 4ZT6A 2JVIA 3HSKA 4BEJA 4EKEA 4YR9A 1ZCFA 1XTSA 3DW3X 1JSCA 4QUBA 2PKXA 1PSZA 3OZTA 1L5LA 1A2OA 2AQHA 1P4HA 2GM5A 2B0CA 3MBIA 4KMRA 5HIIA 2YJ5A 3C5EA 3F97A 3PYMA 1ZJYA 1MH9A 2CLKB 3U7GA 2GETA 3HJCA 3GDWA 3JRWA 1DIOB 3IT0A 1XD9A 3VYTB 4AMVA 5MFPA 2DFPA 1JDBB 1R18A 1JHXA 3QU7A 1IWOA 2UUPA 1N57A 1U11A 3VR3A 5JSZB 4MARA 1HXHA 1QIEA 1PR6A 4UUAA 8OHMA 3P7MA 4OMCA 1QUFA 2YMLA 2XODA 4G0XA 1I7SB 3HEAA 4OD0A 1CS0A 4UNPA 2GN9A 1OBCA 1NA5A 1BO6A 1KKMA 2HWWA 2V45A 3CH4B 3G5TA 1PIWA 4ND6A 3L4KA 3BE6A 3P9RA 9ABPA 1UR5A 3LM8A 4U7PB 3R40A 5JLAA 3FDJA 3PUWA 2WOOA 3W4KA 1XXHB 4M37A 4CG0A 1JPNA 4FGSA 3EG9A 1IM2A 4KNYA 1XMVA 2V7EA 3EQ2A 1K8XB 3UQZA 3TQTA 4LOLA 4GG1A 4ESEA 5FORA 1L1RA 4G5SA 5J2TF 2DJ5A 3DFFA 1Z6TA 5SY4A 1SUIA 3HN7A 4YT5A 5AKHA 3BCSA 2IPXA 4NPAA 2G9VA 1O6CA 2OSBA 2YWFA 1S7CA 4YP0A 5DIFA 7ADHA 4FXPA 4CQMD 5TPZD 3I2FA 1O4WA 5T67A 3OX1A 3LZDA 4V0RA 1COWA 4QT0A 3MCUA 1Y9AA 1A2BA 1XJQA 4MKXA 2PV7A 3FNQA 2PY6A 1IWPB 1WJGA 1E1LA 2XUFA 5KX5B 2PUFA 4BRWA 3FI9A 2EERA 2R6FA 4NFHA 1E3DA 2B1JA 2G83A 6ABPA 4EQZA 3AVXA 2YV2A 2ZWMA 1GZVA 2D0OB 1FRVA 3U48A 5I9IA 1IEVA 3H42B 4H77A 4KQMA 1PVVA 3QITA 4YBRA 2MSKA 3H83A 4XPIB 1NKVA 1SIBE 5LCXA 4WJLA 3N86A 1T4GA 3KX2A 2KJQA 3X1KA 5HKAA 3HCWA 1AK1A 1OZHA 2VJCA 3UUGA 1X13A 1XLVA 1LFAA 3OPQA 5JAZA 1JEYA 2AZXA 2ST1A 1YHNA 5IBPA 1BE0A 5U1PA 1R0RE 2BFEB 2ZM5A 2AEFA 4HSEA 1VKZA 4D8WA 1BYIA 3KO8A 4HDKB 1II0A 5TT1A 4KPUB 2CVHA 1Z17A 1SCKA 3LBYA 4CLDA 3KJFA 2BTOA 1M6EX 4JBWA 5JT1A 1W85B 1RI3A 4Q7EA 1E0DA 2OXRA 1KO8A 3A4LA 5CDHA 1X0VA 2WSLA 1ZK4A 4O4JB 1NT2A 2IYLD 4H1WA 4JEUA 1YA8A 1XKLA 3PDJA 4KQCA 1CKEA 1NM5C 3VR4D 4BNKA 1WD7A 2A9RA 1FNSA 2PMCA 3K31A 3KWLA 4BKPA 4OLBA 4I1UA 4KBYA 1GPAA 1M72A 3FR7A 3DUFA 4NEQA 4D43A 1Z38A 4NONA 2XVXA 1KO5A 2P2CA 4BQFA 3U19A 4EB6B 2WTBA 4BLPA 2I1WA 5GINE 3UXEA 5BYBA 5EZYA 1C7QA 2EJTA 5GMOA 3FLEA 2DFTA 2VHQA 2BTQB 2DECA 2R00C 2ZS9A 3GCZA 3QWHA 4E5PA 5IF9A 5JD4A 4QOSA 4GC9A 4PWYA 2PMEA 2F64A 1X39A 3FVRA 3M5PA 4DRZA 1UJ4A 2YNMC 1RNLA 2KLBA 2NT3A 3ETEA 3L8GA 4I1SA 4ZOLA 3UN1A 3VC3A 5LSAA 1FJXA 5ALVA 3ERCA 1IVYA 5BV1A 1VGVA 3A27A 2BEUB 3JU3A 2WR8A 4N6NA 1N4DA 3TNFA 4L7VA 4MVJD 3UVEA 3TEFA 1BX1A 1WZUA 3HZZA 5A9TA 4TL9A 3D54D 3UJ3X 3RFXA 4EFNA 1PT5A 2OMKA 4R69A 4IJ6A 2HPZA 4JBYA 1EK6A 1VYTA 2FFBA 2GRAA 2X7HA 3Q5EA 4PTZA 3SSMA 4JHXA 4KX5A 2JBWA 4P33A 5FWAA 5KOIA 2OM6A 2QTCA 3WDMA 1A4UA 2GEDA 4WT7A 4LGMA 2CF5A 3RC8A 4KBFA 5JR3A 1YS6A 3H13A 1K6JA 1U7HA 1Y9JA 3WP1B 4ZQEA 4NICA 3VKGA 2GAJA 1JEJA 3LZ6A 2HJSA 1P7VA 3VAAA 1NT4A 3PXUA 1CY1A 5DBGA 3ROPA 4GYYA 1X1TA 3UMVA 5EUMA 3NYRA 2IS6A 5IDYA 4KXQA 2EVWX 3F6PA 2B8EA 5AK4A 2ZJ0A 3U9SA 4NFLA 2WYWA 3DWIA 2ZTLA 4MUFA 2R79A 1JAHA 2B4YA 3JD4A 3M1YA 3C7KA 3LGXA 4GZ6A 5K8VA 2QQGA 3CRZA 1ZJ5A 3QUTA 4BP9A 1AHPA 1X74A 4MUNA 2C59A 4TT8A 1OT3A 2ZYVX 3LLSA 2HXGA 3V1LA 1H66A 2WA1A 4EGCB 1JXAA 4LA4A 1XALA 3QPAA 3UT5B 3GBSA 5LOVB 5EXEA 3AUTA 1Z6YA 3UT5A 3T0IA 3OOEA 4UAGA 4XZ3A 1MAAA 2BR5A 1K4MA 1XYYA 2C42A 1XEWX 1ECPA 1G8HA 1VG1A 2NO9A 3ETJA 4Y1GA 3OPNA 4WBNB 1MCZA 1GKKA 4W5QA 1P0FA 1T2EA 4R40A 2BCEA 3AJRA 3Q7TA 2YH2A 2ZTMA 4BNUA 5JQGF 1N6NA 1B4DA 2G04A 3JAKA 3B85A 5FI5A 4A8JC 2XZDA 4KQJA 4RY0A 2C57A 2D5AA 2HA2A 3FNGA 4G9GA 4CMJA 4UAVA 4WN3A 2NUTB 4F9FA 2IHVA 4ZAXA 1WEHA 2B94A 4D0RA 1VYVA 4FOSA 4RMNA 2JEYA 4ZJZA 1UPBA 4AVYA 5LMNB 1QCYA 3AEZA 2JJ2D 3A6LA 1ZNQO 2NZWA 3H8WA 3QVMA 4Q21A 4RZHA 5DI9A 1AV7A 3S2ZA 2DF8A 2J5QA 5BR8B