2YQ5A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus: nad complexed form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
source organism Lactobacillus delbrueckii subsp. bulgaricus
molecule tags Oxidoreductase
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A01
1ZNQO 3ONEA 2EERA 3TJRA 3F4BA 2GPTA 2WYVA 4WEQA 1E1LA 1KEPA 3JQDA 1P77A 3C1TA 3S1LA 4LRSB 3FD8A 4ND4A 1PWXA 3INGA 4E33A 1O95A 2SCUA 3UFXA 1J4AA 5ENDA 1N2SA 1DDOA 2X0RA 5CPBA 2G0TA 2DTXA 2VQ3A 3AUSA 4HFJA 1WDKA 1W73A 1NM5A 1XGKA 4GVXA 3VPSA 4PG4A 3H8VA 2UAGA 4N18A 5L4SA 4IMPA 3FPLA 3WGZA 1GUFA 2PKRA 3HNPA 3OA2A 3ZW9A 3RC7A 5JYEA 4P4LA 4RF2A 1J5PA 1VLLA 2C07A 2VOJA 4OQZA 4BGUA 4AVYA 1B2LA 2P2SA 2HMVA 8ADHA 4WKGA 4IXTA 2H63A 4ZQGA 3HDHA 4BNXA 1I5RA 2NVWA 3WIDA 3KSUA 2VTDA 3NTRA 4FOOA 1JWBB 4N5NA 4W9NC 1LRLA 3EC7A 3GEDA 3ZV6A 3RI3A 1ZCJA 1EEHA 2BLLA 2I67A 4MVJG 2HU2A 5KJ1A 4IJVA 4NG5A 1DC3A 1EE2A 2FR8A 4IGFA 3RWBA 2VHZA 3QY9A 1XYGA 1XU7A 3VPXA 2QRKA 1WW8A 4RPJA 4PN3A 2FR0A 5JAMA 1B7GO 5I9NA 2QYTA 1SCUA 2J6IA 4Q3AA 4B3HA 5H83A 3K96A 3NDIA 2CVOA 3I3OA 1YVEI 1CDOA 2FP4A 4XYEA 3JQBA 3WGTA 1U3VA 1QYXA 1NYTA 2I9PA 3UUWA 2CFCA 4OJNA 4GVLA 3GHHA 3H3JA 2WE8A 1V3UA 3C7DB 3Q11A 1QYVA 4AJKA 2VOEA 4J7UA 3DQPA 1PZGA 1HT0A 4BHTA 2BKAA 2NU8A 2YHIA 3KYCB 2HMUA 2O2YA 2C7VA 5T57A 3AUUA 3GDOA 2B83A 4Y67A 1HE5A 1NP3A 4PLHA 3EW7A 5FWNA 2H1SA 1GEEA 4DYDA 2VNSA 4WECA 5F5NA 1R37A 3MJ4A 2Y0EA 3NEPX 2DUWA 2O7QA 1BTOA 3CIFA 3WJAA 1XEAA 2AG8A 2HUNA 1E7WA 1JVSA 4MIEA 4ALKA 1PX0A 2B37A 2V7PA 1YRLA 1K2WA 1IL0A 1Z45A 3IS3A 3UHAA 3PYXA 1XA0A 2FSVA 4YB8A 3LQFA 4WCFB 4QTZA 4UUMA 4EZBA 2RH4A 1CEQA 2Y1FA 1U3TA 2W4QA 1YO6A 5JAQA 4FFLA 4L4SA 3GRKA 1R0LA 1E92A 2EEZA 3WGHA 4IQ8A 4DL9A 4IQGA 4ZQEA 2Y1CA 2PZLA 4XYBA 3ROMA 3ZI0A 3WGQA 3MJSA 2W2LA 4BKPA 1HYGA 1DAOA 3WYEA 2X22A 1YE3A 3IUPA 4JJIA 4UUPA 1PL6A 3DONA 3RSHA 3PDUA 4OYRA 3WOHA 4R5HA 1KEWA 5BR7A 1KY5A 1F17A 2VWPA 1BXGA 1M6WA 2XF8A 3HWRA 4XQ9A 4OIMA 1UP4A 2Q99A 4MIYA 5U9CA 4K1LA 4E2WA 3B1KA 4PG5A 4BGVA 2VT2A 1X14A 4R51A 3E03A 2EIHA 2VHXA 3U49A 3Q9UA 4FGWA 4OXKA 1GQYA 2C20A 1HDRA 5EESA 3VZRA 2AQKA 2HMTA 1JN0A 3ABIA 5T6BA 1IPEA 3QWBA 3H4VA 4B79A 3NT2A 2YDYA 3K5PA 5TS3A 4RQUA 3UGKA 3TQHA 5FI5A 3X2FA 3E6AA 2QW8A 2DUUA 4CMIB 1B0AA 4URFA 4O6VA 1PJ3A 2DPGA 1ZW1A 3GC6A 2E37A 1BXZA 3H65A 1P1JA 1RJWA 4B4OA 2X0IA 3ZWMA 4BO4A 3KSDO 2R00C 4IDBA 3KBOA 1EDZA 2Q49A 1PIWA 4WK6A 4B8WA 1PZFA 3QQPA 4CMIA 4PFJA 3H2SA 4WJZA 3I9JA 4ZQFA 1LDBA 4ALIA 1VJ0A 4BQPA 1Y1PA 3A4VA 4DLBA 2W2LD 4E5NA 3QWFA 4DYVA 3E8XA 3W1VA 4E4YA 5AXCA 2NM0A 1T1RA 1N5DA 2B5WA 4ZU3A 3PQDA 4ND2A 3UH1A 2NQTA 2JAHA 2DLDA 2VNAA 1BWSA 1EBUA 2V6FA 3T7CA 3W4IA 4BOYA 4EITA 1P31A 4H7PA 4UREA 4R1SA 4NBWA 4IDAA 4C7JA 1N9GB 5G4LA 3F4LA 3MTJA 3JQGB 3NRCA 4OM8A 4E5YA 1OFGA 2DBRA 1VL6A 3H9UA 5HA5A 1RWBA 2NTNA 2HMWA 1UR5A 4TZKA 4AG3A 3ZHYA 1E7MA 1MG5A 2J5QA 5FEUA 5F1PA 1TA4A 4NFHA 1PQUA 3KEOA 4RV9A 4UAGA 2POQX 2H6EA 3PEFA 3I9OA 3KYBA 4YXFA 1KVTA 4QECA 4DIFA 1TI7A 4N5MA 2R2GA 4R1NA 4XZ3A 4YVFA 4NNJA 5B4VA 4DPKA 2ZQZA 2ILTA 1DIAA 2GO1A 1SBYA 3BMQA 4N54A 3BTVA 3H5AA 4UVDA 3ZWYA 2VN8A 1EUDA 3NTQA 1N9GA 5COAA 2O4UX 3PJEA 1PZHA 2QZZA 3PDJA 3KUXA 4GKBA 2J5RA 4MVJP 1Q7GA 3VZSA 2VRCD 4GX5A 4CM9D 1UAGA 3PZRA 4JIGA 1N1GA 1AHIA 1UH5A 4QO8A 4DLLA 3VH3A 3KVOA 4WOKA 4MKXA 4JBGA 1KY4A 4ID9A 4MO2A 3RBXA 4CR6A 3DZBA 4OKIA 3H5NA 4CV0A 4YJFA 4DQXA 1IY8A 5IG2A 4B4WA 3HADA 1ONPA 3L6OO 4EUEA 4N5LA 4KDEA 5KIAA 5A02A 3GVCA 5C5IA 1Y8RB 2A35A 3RBVA 2WD7A 2EHDA 2FZWA 4DQVA 1HF3A 4TKMA 2VUUA 3TOZA 3HN7A 4JNKA 4XIYA 4XKJA 3GN2A 1LDGA 5IJZA 3CINA 3DBHA 3PWZA 3CPSA 4WEOA 1EZ4A 3ONDA 3TDKA 3VAZA 3QJ5A 1HWYA 3PXXA 1FDWA 1LSJA 2EKPA 1LLDA 1N92A 3UAGA 3ZWVA 3W4JA 1LX6A 4WNIA 1C0PA 2OO5A 1YB1A 3ADOA 3ZWNA 2FRDA 2X6TA 3WGGA 4BNHA 1ARZA 4U0KA 3T4EA 3WBFA 3WTBA 2ZTMA 2ZYAA 2WDZA 2O3QA 5FFFA 3QWAA 1UDCA 3FR7A 4L0QA 5JFOA 1DFGA 4HY3A 1CF2O 2AW5A 1R4NB 3KM0A 3ZNNA 4A0SA 5BSHA 3H9EO 5CDGA 3R1IA 4DIOA 3GAZA 2HK9A 4MP6A 3GZNB 1OAAA 3FBTA 1EDOA 3LZ6A 4I5EA 4J9VA 5A3JA 2YZ7A 4FJ2A 2B4TO 4Q3BA 5COBA 2QG4A 4GX0A 4RZHA 4J7CA 4RPHA 4PLFA 4CLRA 1R4MB 4WCDA 3LC2O 5A06A 2ET6A 1ENYA 2CF5A 4XDZA 5JAIA 1DEHA 4XJTA 2ZB8A 3CTMA 2DM6A 3GRPA 3SLKA 1GR0A 1H6CA 4NU5A 1LDYA 1U2DA 5DF1A 3WLEA 4JBIA 2F00A 1QRRA 3ZGYA 3B1JA 5J23A 1P3DA 2VTEA 1S7CA 1HDOA 3MWEB 2O7SA 3OQBA 3CEAA 5GZ6A 3RUFA 1I2ZA 1ISGA 1WWKA 4NR0A 4XB2A 5COQA 3RUHA 1W0CA 1WVGA 3BTOA 7MDHA 4QO7A 4U6SA 2IODA 4WUVA 1KEUA 1JKFA 4J1SA 3PQEA 4BNKA 5KJEA 2A94A 1TVEA 5G4KA 2Q50A 2P9GA 1ML3A 1YL5A 4YJDA 3W8DA 3RJ5A 2PFGA 4ZGWA 1XDWA 4WPGA 2VWGA 5L53A 3ETGA 4NFYA 1V6AA 3JQ8A 4ZQBA 1P1IA 2PZJA 4CMJA 4YAKA 1I01A 4RDIA 1AXGA 4K26A 4B4UA 1WZIA 2O3TA 1GYRA 3GGGA 4J4BA 1HSOA 4LISA 3OQ6A 2XOXA 4HUJA 4J4TA 1ENOA 4MVJH 3CKYA 4BKRA 3K2EA 4P8RA 1UJMA 4UVHA 4MOWA 2Y1OA 4NJOA 3VZQA 2VHVA 4RPGA 4Y6PA 1VJTA 2DTDA 5HS6A 1C0LA 2NADA 3I4FA 4CQLA 1QYDA 3P5SA 2Y05A 1U8FO 1YQXA 2UVDA 4TKLA 2BD0A 4L4RA 1J49A 2OMEA 4GKVA 1DSSG 4JN6B 4HNHA 2O2SA 2PY6A 1H9BA 2OFPA 4YRBA 5IFLA 1O5IA 4YJHB 4EBFA 5HTOA 2GF2A 3OJ0A 3H3FA 3ITKA 5CG1A 2GR9A 3B6ZA 4PLYA 5K9ZA 1I30A 2A9FA 4BGEA 5H82A 4D44A 5B4UA 3EVNA 5ES3A 4XQCA 3I83A 4PG6A 2VHYA 1ADFA 4XD2A 2EKQA 4FB5A 3JQ6A 3ROPA 4BNNA 3IKTA 2PTGA 2WE7A 4JP3A 4XCVA 2VUSA 1C1XA 1ZXLA 3JQ9A 2YFQA 2VZ0A 2Q45A 2NNLD 2XPCA 1JA9A 4RL6A 1QP8A 1U5AA 5AVOA 1P1KA 2FOIA 2ZYDA 1M2WA 3H9JA 3OP4A 3QIVA 1PJCA 4GX1A 1YDWA 5L3ZA 1LC3A 3ZU2A 1TLTA 1D4FA 2AEJA 1MA0A 2HCTA 3VPGA 5LDGA 1MB4A 5IDWA 3G17A 5IDYA 2ZKLA 3BYZA 4YCAA 4ND1A 1K6XA 1PWZA 2HAEA 3ZV3A 1GCOA 3AI2A 3P7MA 2I66A 4DUPA 1XG5A 4U0JA 1GU7A 4IZHA 3OQ1A 1P1RA 3WWZA 3E9NA 3LSYA 1SEVA 3VPHA 2QX7A 3MWDB 4IGEA 5DOVA 5JMWA 4A2CA 3RCBA 2PWZA 1KOLA 1VSUA 4CQMA 1BVRA 2HQ1A 1NR1A 4WLOA 4U6QA 2C29D 3RUDA 4LCEA 3DOJA 3PIDA 4W6ZA 4ZRMA 5C3MA 1RPNA 1LDMA 2VCYA 3GG9A 4L4XA 1PR3A 3ULKA 3UW3A 1DFIA 3D3WB 4BO7A 3PTZA 1DBVO 4KMSA 4IQ0A 4HX5A 1IYZA 3U62A 4IDFA 3IQDB 1VPDA 3QWHA 4CMEA 1H94A 3NT5A 1DC4A 4YAGA 3QHAA 3DZIA 5L95A 4NI5A 3U9LA 5IN5A 1I33A 1K5HA 1GEGA 3QWIA 3UICA 4FW8A 4YPOA 4I5DA 4BV8A 2DTEA 1NQAO 3H6KA 1GPDG 3WG9A 3KSZO 3PJGA 1GYQA 1NPTO 2IEDA 2O3JA 3PHJA 3ICCA 1EK6A 1KVUA 2BI7A 2NACA 2Z1MA 1T2FA 4OHUA 5B1YA 3JQFC 1JWAB 2W90A 3ZNOA 1O6ZA 3GDFA 1GPJA 1LLQA 3GN1A 3PLNA 4IS2A 4WE3A 4YACA 3WQSB 1HDGO 3OEWA 4UULA 4LVCA 3ZHZA 1O8CA 2J3HA 3ST7A 4XRRA 1YJQA 2OBYA 5TT0A 2BI8A 2NU9A 3GGPA 3FSRA 4ND3A 1GQQA 1M75A 1T1SA 2WSBA 4D3SA 1YGYA 3CMMA 4E21A 5FI3A 3NX4A 4TQGA 4R4JA 3A28A 1Z7BA 4QX6A 3CXRA 1NTOA 1V9LA 3Q0EA 2V6BA 1DRUA 3K73O 1MLDA 1DC5A 1U28A 3A1NA 2EG9A 4FDAA 1PJQA 3PIIA 1I3MA 4CV3A 4F6CA 1U5CA 4Y6SA 4ZRNA 4UUOA 3HDYA 1UAYA 3RUCA 4E5MA 4XEHA 2OHXA 5ADHA 1LSOA 1LBEA 1LSUA 5DBIA 4DMMA 1YJ8A 3BHIA 3DEYX 5KOIA 3ICPA 4W82A 1P0FA 4J4HA 1BSVA 2V6GA 3Q3CA 2Q1UA 4FIZA 2I6TA 1EE9A 4J90A 3OF2A 1ULSA 1ZKMA 3BZUA 4OH1A 3IOYA 3OECA 3AU9A 2EF1A 1WP4A 2BRUA 1JW9B 3DB2A 4Z0HO 3ANLA 4JQCA 4XGNA 3ORFA 2HKIA 4RPKA 2WTBA 3CZRA 1QLJA 3N7UA 4WLEA 5C37A 1LDEA 5GZ3A 2P4HX 1WNTA 4INAA 1ZUD1 2JHGA 3BMNB 1FJHA 4NK4A 2XAAA 4CLOB 5L9AA 4DWVA 1LA2A 4F6LA 2ZYGA 4YWJA 4RORA 3CH6A 4KQXA 3S2IA 5IZCC 4PVCA 4PLWA 5DULA 4UEOA 2XXBA 5THKA 3M2PA 1GY8A 2R6JA 1JAYA 1V0JA 1R4MA 4GI2A 1KVSA 4Y98A 1GZ3A 3GHYA 1DB3A 3VHRA 1YL6A 4JLWA 2AA3A 1H0KA 1X1EA 4R1UA 5JC1A 5B4TA 5C7LO 5I8WA 4FGSA 2RAFA 3O26A 4ND5A 5ITWA 3AY3A 2H9IA 3RC2A 2D5AA 4OOFA 3EZLA 4Z3KA 1LNQA 3FWNA 1YONA 1HTBA 3FTPA 3U3XA 4B7XA 4CV2A 5JNLA 2Y0CA 3PYLA 1H93A 1YH3A 3WYBA 1EVJA 1PR9A 1NX6A 1X0VA 3VZPA 2O3UA 3DFZA 4WCFC 4WLNA 2DPHA 2GN4A 3UVEA 4B8ZA 2OP1A 4IDEA 4L74A 3VDQA 5G0TA 2PLAA 3VVBA 1QORA 4RF3A 1EMDA 3E9QA 5JXWA 2IE0A 2CY0A 3NTOA 4DTIA 1LRJA 5DCWA 5THQA 4YT5A 4BNIA 1UDBA 4IY1A 1J0XO 1P33A 2AQHA 4YYZA 3RVDA 5DCUA 4F3YA 3ZWWA 4UUNA 2OBNA 4D3FA 3AM4A 4S1VA 1BVUA 2OOSA 3AK4A 2IYPA 3ETEA 1B14A 1ZK0A 3IP3A 1NFQA 1YL7A 3ZHXA 3PWSA 2NV6A 4TVBA 5JW6A 2DT5A 2X9VA 1MUUA 1WAMA 4K6CA 2G82A 3FN4A 2FZEA 1VL8A 4I5GA 2GLXA 2Q4BA 2CSUA 4J2HA 4BNTA 1KVQA 2GUGA 3NT4A 2ZTVA 4Y9DA 1ZK3A 2YDXA 2Y93A 4XB1A 3VDRA 3E5RA 3JQ7B 4PRKA 5TJ9A 3OEYA 1NR7A 2AXQA 4BKQA 3GNSA 3VTZA 2X0NA 3WLFA 3OHSX 1V8BA 3H5RA 1QKIA 1T24A 4QSMA 3AU8A 3U4HA 1B3RA 1WXDA 1PQPA 5KVSA 1YB4A 1FDUA 4KZPA 3OMLA 1ONOA 1VC2A 2PD4A 1HEUA 2BH9A 4GSKA 2CVQA 5BSEA 1PGJA 4NDNE 1VE9A 3IC5A 3OIFA 2NTJA 3GPDG 5IDQA 3QVXA 3JQGA 3K8ZA 4TRRA 5JDCC 4CUZA 2JCVA 2Y1GA 2HJRA 3DZKA 1N8KA 4W7IA 3ZWPA 1SMKA 4RPLA 3EVTA 5L51A 3Q1LA 1CJCA 3DR3A 3C85A 1BHSA 1E3WA 3DTTA 3QE3A 2Y1EA 5CFZA 5K0ZA 5CEFA 4D46A 3G1UA 3A14A 4GWKA 4BMNA 1DRVA 3OIDA 1SC6A 2FPGA 5GMOA 5F3RA 5T8KA 4C4OA 2I99A 1SNYA 4PG8A 2YY7A 3KXDA 1JDJA 3KO8A 3GVHA 3AI1A 3HDJA 3D4NA 5TT1A 4DIBA 2C5AA 3HUDA 4BO0A 2E4AA 4Y6RA 3MTGA 2X7HA 4F45A 3WGYA 5DP2A 1PQWA 5TSDA 4MDHA 5BNIA 2V6MA 4QXMA 4E13A 3NYWA 3ROKA 4OQYA 5A9SA 3D1LA 1I10A 2WMDA 5U1PA 4ALMA 2D5CA 4CM4A 2X4GA 1K0UA 4GMFA 3L4SO 5HRUA 2YFHA 1CQJA 4B7CA 4FCCA 4DBZA 5DOZA 1TEHA 2C2YA 3DHYA 2ZB3A 2D0IA 4J6FA 3WX0A 2CVZA 1LXCA 2JD0A 5HM8A 2B0JA 1HE4A 3RD5A 3AY6A 1SPXA 1HZZA 2EWMA 2FY8A 1I3KA 1PGOA 4DXHA 1LTHR 2HDHA 2NVBA 3NGXA 4J0EA 4XGKA 5JY6A 1U3WA 4M49A 4NJMA 4D45A 1ENPA 1A9YA 1ZH8A 5CHEA 1HDZA 4R5MA 3I9LA 4IXWA 1ZSYA 1GV0A 4EW6A 2OUIA 1EK5A 4A03A 1ZEJA 3I9KA 1QYCA 4BO2A 4RO0A 4A27A 5KJ6A 5EPOA 3AUTA 4IMRA 2GN8A 2J3IA 3RU9A 3DZHA 1ZSNA 1DIBA 2GZ3A 4NK5A 5KNLA 1I8TA 1ADGA 3MOIA 1K6JA 4M1QA 3I5MA 2AQIA 3T7EA 3PZBA 5ILOA 1ZJZA 1P1HA 2JCXA 1WPQA 3WSWA 3GMDA 3WWYA 1Q0QA 5CDUA 2OZPA 4CUKA 1OOEA 1CERA 2AHRA 1Q7BA 3D5TA 3W8FA 5TLSA 5ICSA 2FHSA 4H16A 4PLGA 1C3VA 4OXYA 1D7OA 1Y8RA 3IMFA 5EQDA 3RFTA 3JTMA 5TIIA 3KOUA 1NPDA 2V65A 4GL4A 4WLUA 3FPCA 4FFMA 1KYQA 1AXEA 1S6YA 2X58A 4J1NA 5IZCA 3HSKA 2AMFA 4IM7A 1C14A 4LSWA 3F47A 4K6FA 5LDHA 1IZ9A 4JROA 4O5OA 4AJNA 3GGOA 2Y67A 1YWGO 3IJPA 1DPGA 4I08A 4K9DA 4FOSA 5G2OA 4YAIA 4YT2A 3EDMA 2EP7A 4O1MA 4BNLA 4CLHA 4QEDA 2PGJA 3DC2A 1HL3A 5JDCA 1HRDA 3B70A 3NAQA 1IHYA 1D1TA 5A4DA 2NLOA 4LMRA 3F5QA 1L1FA 1UDAA 1KS9A 3M6IA 3NV9A 3FRJA 3L6EA 4B3IA 1ZMOA 4Z3DA 3WICA 2HK7A 1B26A 1E6UA 2O50A 4TROA 3HE3A 4X54A 1O9BA 4ZQHA 3UCFA 2ZQYA 3DBLA 3I4CA 4Z9YA 2AQ8A 3LVFO 3MOGA 5HBRA 1E7SA 4R16A 3NKLA 1XKQA 3DHEA 4EEXA 2B4QA 4E6PA 3NGLA 2YW9A 1P9LA 4J9UE 4R9SA 1LU9A 4MVJF 1JQBA 1YKFA 1Y7TA 3OJOA 5FF9A 4H3VA 2O3SA 1DIHA 2EGGA 1SOVA 4QQRA 2X5JO 4NMHA 1I36A 1LQUA 2ZB7A 2BFOA 4BKOA 4DQUA 4BNYA 4PLPA 3HFSA 3O38A 5A5FA 2JKVA 3ZU3A 1E5QA 2Z1NA 4P38A 3C8MA 3ZU5A 3V2HA 3WR5A 1HE2A 2QQ5A 2I76A 5F1OA 1MX3A 2EJVA 2HSDA 4HP8A 3DAPA 3W6ZA 1VM6A 2ZK7A 1GYPA 4XR9A 4FN4A 1TXGA 1ISJA 4RQTA 2DBZA 4J43A 4E2YA 4XJSA 4LSMA 2VZ9A 1OI7A 3BMNA 5CPFA 2ZCUA 1E7YA 2VHWA 4IIUA 3TL3A 4KP7A 3SLGA 2PH3A 3WBBA 1XLTA 2B4RO 4IUYA 2Q1WA 2IRWA 4BNVA 3GDGA 1QSGA 3I52A 4BNGA 2D1YA 7ADHA 1K89A 1ISHA 4RVSA 5JC8A 1ONNA 2EW2A 3K31A 1N7HA 3WIEA 1JKIA 4UEKA 3COSA 3JQBC 2J8ZA 4RVHA 2WYUA 4ZN6A 3DMYA 2FPIA 3OJEA 5G0VA 1V35A 2WEKA 4G81A 4KTVE 5IAAA 1R6DA 3AJRA 4R3WA 1Y9EA 2JFGA 1YBMA 3GUYA 1SZJG 3WYCA 3CMCO 3JSAA 2O4CA 3G49A 3CUKA 2CNBA 1I3NA 4HWKA 2GASA 5TJHA 1ZEMA 4GPD1 3VVCA 4Z6KA 4ALJA 1RYDA 2RIRA 1P1FA 1UZNA 1NQOA 2YHIB 4DREA 4RF4A 3TNLA 5TF4A 2P5UA 4YT8A 4AJPA 3CSDA 1B8PA 1DLIA 1JLLA 1WZEA 2OL4A 3KYDB 4N7RA 4J49A 1R12A 5EIOA 3KV3O 4XYMA 1MV8A 3AOEC 3JD3A 1E3LA 5LC1A 4HKTA 1Q1NA 3FR8A 4BMVA 1U7TA 5EQFA 3A06A 1F12A 4AJ4A 3AFMA 1UXKA 3JQEA 2I3GA 4II2A 1HE3A 1QV7A 5DP1A 3F1LA 2BMAA 1K3TA 2IEBA 5L7YA 3U0BA 2BHLA 2Y99A 3W8EA 3LLSA 3WNVA 4CM1A 1PJTA 3V1TC 1A4UA 3E48A 3SJ7A 3WMXA 3LT2A 1B8VA 5JO9A 3HG7A 2PZMA 4TRNA 4CUJA 1RKXA 1CWUA 1XCBA 4O59O 4J3FA 1X15A 3E5MA 2YV2A 5ILGA 2Z95A 9LDTA 5JS6A 1M66A 1VKNA 1H6DA 2I3AA 4U8GA 1E3SA 3RKRA 1GD1O 2IZ0A 1LJ8A 1C1DB 1GUYA 1Q2XA 3Q2KA 4E0BA 3D4OA 1M6HA 2BFMA 3G0OA 4NJMB 3RFXA 1X7HA 3ANNA 3RAJA 3O4RA 3PHIA 3ZHBA 3V5NA 3JYOA 4E2ZA 6ADHA 2VWQA 1JAXA 2GERA 3FHLA 3GA0A 3B20A 2FMUA 3BMCA 3DO5A 1ZSVA 4CMBA 1T2AA 3BHMA 4OOEA 4M55A 1E5LA 1R4NA 2QRJA 3VKVA 4CLOA 3I1JA 3ZWCA 5BSGA 2F1KA 2YYYA 4RZIA 1IPFA 3ASVA 3TOXA 1Y81A 5IXSA 1H5QA 4R1TA 4BGIA 3LT0A 5KCZA 1Q0HA 1G0OA 1VJ1A 2J3KA 4DBVO 4YQZA 3VH2A 2VRBA 1O94A 3K6JA 3LC7O 2RH8A 4M86A 4TRMA 3STHA 1AE1A 3GVXA 3I23A 3S2GA 3AWDA 3AOEA 2VWHA 5DNAA 4Q3EA 1L7EA 1XELA 3BTSA 3L9WA 3PK0A 4YAEA 4MJLA 5JCXA 3DTYA 2P9EA 4YJFB 5CEJA 2JL1A 4MKRA 1NXQA 1NFFA 4Y8VA 2C7GA 1NWCA 2DVMA 3KRTA 4GGOA 1E3EA 1RM3A 2UV8A 1U4SA 1V3TA 3PWKA 4D79A 2GZ2A 1A27A 1LQTA 3LK7A 3LU1A 3PP8A 4CV1A 3TL2A 2PZKA 2X86A 3PHHA 3TZHA 5A9RA 4J1TA 3HZZA 5DDIP 4IJUA 4FJ0A 1MGOA 2DBQA 3BTUA 2NWQA 1QG6A 1G0NA 1Q0LA 3SEFA 2E48A 1FDVA 1ZJYA 4P22A 2GN6A 5EINA 5F1KA 4BUCA 5JO0A 5MDHA 3PYMA 5I7EA 4CL3A 1C1XB 3LF2A 5ITVA 1YOVA 1PGQA 4FJ1A 2FSSA 1U4OA 3S8MA 5JDIC 1ID1A 2GCGA 2UUPA 3QP9A 3INRA 4RVDA 2ZATA 4FC6A 5HWSA 3RUEA 2IZ1A 2G1UA 1RM0A 1X7GA 3T4XA 4RVFA 4YAJA 4D0SA 1ISMA 2EXXA 4J1QA 2NVUA 4WASA 4Z0TA 2PGDA 5BT9A 4ZJUA 4ZA2A 3RKUA 5A03A 3OH8A 2P9CA 3O03A 2JFHA 4RCVA 4I9HA 2GZ1A 3JQAA 5A3VA 1Y9AA 3CE6A 4E31A 3EY4A 4BS9A 3HB4X 3DBRA 1X1TA 4MVJI 1I24A 2JHFA 3C7CB 3N74A 4HFRA 1NNUA 1E1NA 2DQ4A 3ENNA 1U1IA 4S3MA 4I5FA 3EYWA 4R54A 4Q3DA 4JX8A 3EMKA 4EJ0A 4BIIA 4TMFA 3BHJA 5ER6A 3D3WA 1BGVA 1PL7A 4KOAA 3AM3A 3C7AA 3ZWAA 1DXYA 4I1IA 4FFRA 3H7AA 2CZCA 1M67A 4L75A 1E6WA 3OM9A 1KIFA 1Z7EA 3KB6A 4ALLA 3MJVA 4CR8A 3HHPA 2G17A 1O0SA 3O8QB 5T5QA 2I5PO 3GOHA 3TFOA 3C1OA 5U4QA 3RFVA 4HADA 1FDTA 4BO3A 3SX2A 4DRYA 1KERA 3FTNA 1KC3A 2PV7A 1QYWA 2AEFA 1LDNA 4U7WA 1DIGA 4BMSA 4MINA 4D42A 1ENZA 1R0SA 2LDBA 4MVJM 3D7LA 4OXNA 2E6UX 2CDAA 5H81A 4AJEA 4CM8A 3FBGA 1IE3A 1NWHA 4CM6A 8LDHA 4IDCA 1HYHA 4L76A 5JMPA 1ZMTA 2QZ9A 4GBJA 3V2GA 3HFGA 3S2EA 2Y1DA 3M2TA 4CMEC 1LLCA 4LRTB 2IYOA 1W6UA 1A4IA 1QR6A 3IJRA 5DCYA 4KWHA 2OP0A 3Q9NA 1UP7A 4CR7A 1H6BA 1YQGA 2W2KB 3C3XA 1DIRA 1WMBA 3GF4A 1DJQA 5KJFA 1G1AA 4D7AA 1C0IA 3BMCB 4YT4A 2OGUA 4OGWA 4DPLA 2VYND 3H9GA 3D5QA 3M1AA 3DWFA 1PL8A 4K28A 3PHLA 4L9RA 3RU7A 3D4PA 3PHGA 2DFDA 4J2OA 2ZB4A 1C1DA 1H6AA 3DMTA 2P5YA 3ADPA 4FC7A 4BO1A 3MCVA 5KJCA 2J5KA 3MEQA 3RJ9A 1QLHA 1TT5B 1FF9A 3F1KA 1YBVA 1AUPA 3BMOA 4YJGA 4G65A 3AOGA 3ZZNA 1XIVA 4XX0A 1ZK4A 4R68A 1K6IA 1NVGA 5L4NA 2VYVA 2D3TA 3UN1A 5KVQA 1PJ2A 4XWYA 4R9RA 4YEDA 1NFRA 4L8VA 1LLUA 3UCEA 3ZNQA 1BMDA 2TMDA 1BDBA 3LF1A 5EERA 4BL5A 1PGNA 5IDXA 3RUIA 3IP1A 3PJDA 2P4QA 2O48X 2D2IA 2GNAA 5TRTA 1F0YA 3NUGA 3DBVO 3ON5A 2EJWA 4RLHA 3C1AA 5K6AC 3WJ7A 1XQ6A 4UVEA 3BMQB 4BV9A 1P0CA 2A92A 4YBZA 4I8XA 2HRZA 3UCXA 4FR5A 3SVTA 3BXXA 4ROSA 4ONEA 2WWRA 3QVTA 4P4GA 2PD3A 3GNQA 4J7XA 1E6EA 1OC4A 2FN7A 3MJCA 4UVGA 5LCXA 1WDMA 3EHEA 4BO5A 3ETDA 4E3ZA 4RF5A 4YDRA 4CQLB 1BG6A 2X8LA 5G0UA 1U7HA 3JD1A 4XIJA 5TC4A 3ASUA 4LVUA 3PPIA 1PJLA 4Q3CA 1A7KA 2VYNA 1NPYA 1NAIA 1ULUA 3L9XA 2ZCVA 4Z9XA 2O3RA 1PJ4A 3U4IA 4FS3A 4EEZA 5JE8A 4CLEA 1MFPA 1NVTA 3TSCA 2VT3A 4IJKA 3L77A 4PIVA 1GZ6A 3VKUA 1UXJA 1EVIA 3GZ4A 3L4BC 3VTFA 3FNFA 1T2DA 2XXJA 4FFNA 4R41A 2B35A 2P68A 3DDNA 4XRGA 1T26A 2CF6A 1EUZA 3JQ8B 4GAEA 2ZJ1A 2QHXA 4JGBA 1Z6ZA 1GADO 2ZTUA 3IUSA 3CZMA 1NHGA 2BGKA 3K2BA 3GEGA 3TRIA 2G76A 4Z0PA 1IZ0A 3KLPX 4IBOA 3NJ8A 3ZDFA 4CLXA 1DO8A 3INTA 5C7IO 4CMHA 3GAFA 1BRMA 3JYNA 3TF5A 5G0SA 3N58A 3LT4A 2DBVO 1LC0A 2X5KO 3WTCA 3FCOA 3VH1A 4QFCA 5AYVA 1CETA 4BKUA 1YS4A 2WM3A 2Y0DA 3I9NA 1Z74A 2WYWA 3PRJA 3ZWBA 1UXIA 2W8ZA 4MP3A 3W6UA 3SC6A 1OC2A 1TB4A 1N1EA 2CDBA 4PGFA 1WMAA 4RVUA 5AXAA 4L73A 4LK3A 2JJYA 1E1KA 5DBFA 1GCUA 4BNFA 3ANMA 1R66A 2ZIZA 1L7DA 1DFHA 3ONFA 4OO3A 1EVZA 4CMCA 3E1KA 1A7AA 2IXBA 4PVDA 5ENVA 5TQVA 4IPTA 3WGIA 3O8QA 3QVWA 3AFNA 3DBHB 5EN4A 5F5LA 1Z73A 4XGIA 4RJTA 4H15A 4YR9A 4Q9NA 3TZCA 3F9IA 1ZBQA 4XA8A 4OAQA 1G6KA 1HDXA 1R16A 5AQ1A 3A9WA 3WMWA 3D3EA 3D64A 5KWEA 2C54A 4YA6A 1JU9A 3LLVA 1OMOA 2PK3A 4ZVVA 4OSOA 1BW9B 4RDHA 4B4VA 5L7WA 1XQ1A 2VZ8A 1NHWA 3K30A 3GG2A 4AJIA 1A71A 1GDHA 5A05A 5A1TA 5AXDA 3GUCA 1ORRA 4WLFA 2JD2A 3B1FA 1BDMA 5G0WA 3RUAA 1X7DA 3G3EA 3IIEA 3H2ZA 3VOSA 3IL2A 4KWIA 2RHRA 4PLCA 3WS7A 4OMUA 2ZTLA 1XHLA 4CODB 1W8DA 5AOVA 1EBFA 1PZEA 2P91A 1PS0A 3VH4A 3OJFA 4EJ6A 5K6AA 3FF4A 3GEMA 3UKOA 1UZLA 3GPIA 3LDHA 2YQ4A 3FWZA 3OSUA 4G2NA 4DMLA 1DC6A 2PR2A 3EGOA 3LYLA 4BVAA 5T67A 4KTTE 3K9QO 4JK3A 4ESOA 2AE2A 2NQ8A 3VC7A 3JQAB 4M8SA 2HO5A 2JD1A 2X9NA 3ZWXA 3SJUA 4NIMA 4MP8A 4CJXA 4EI2A 4I9NA 4A10A 3BA1A 2HRBA 4ZICA 3HJAA 2A4KA 4FQ8A 2NU6A 1H2BA 4U5QA 4YRDA 1EUCA 5BQFA 3QSGA 1DOHA 3QA9A 5CEEA 3PQFA 3GNTA 5L45A 4AFNA 4GGPA 5BSFA 1D3AA 4DC1A 3S55A 1EQUA 4XR4A 1U8XX 3AUAA 1NQTA 4XQGA 4XQEA 1QV6A 5F21A 4OSPA 5FYDA 3TZQA 1AN9A 2DU8A 2OORA 4NU6A 1IB6A 3L07A 3ENKA 4PZEA 1UZMA 2Y66A 3C24A 3U4DA 4BB5A 1EVYA 4JP2A 5T8KC 2DC1A 5AXBA 4C7KA 4DVJA 2UYYA 4M89A 2HMSA 2Q2WA 4A26A 5BNTA 1YDEA 1VL0A 3PFWO 1HYEA 1T25A 2YV1A 4AJ2A 5IN4A 2O23A 2Q2QA 1E77A 1OBFO 3QVOA 1HDYA 4D41A 5L4LA 1LUAA 1CQIA 1B16A 4XDYA 2X9GA 3D0OA 1E1MA 1U2GA 4XYGA 5TX7A 4MIOA 4RGBA 3TZ6A 1BXKA 1SB9A 4IDGA 4P4NA 4TZTA 5JY1A 1B15A 2YJZA 4LN1A 4W4TA 3RQSA 1ZK1A 4WLVA 2HLPA 2BFPA 5TGDA 2BF7A 3L0DA 3F5SA 4Q39A 4CPDA 2QIOA 5KTKA 3IDSA 1W4ZA 4EDFA 4CM3A 4BNJA 4TSKA 3JYQA 5I9LA 2J3JA 2BFAA 3QRWA 1AGNA 1E7RA 1GUZA 3JCZA 3WQRA 3UXYA 5ER9A 4EGFA 3GMSA 3WQQA 1ZZEA 5L40A 1CRWG 5TNXA 1ZO8A 2VUTA 3ZNPA 3E18A 4NBTA 2NSDA 1YQDA 2X5OA 4IS3A 3EAGA 5KKAA 4RVGA 3WXBA 3MJEA 3RIHA 1PS9A 1PTJA 1H2HA 3GQVA 3DZJA 5DT9A 1GQ2A 1I2CA 3GR6A 2WD8A 4FFPA 4NPCA 1UP6A 4O63O 3DXFA 5CG2A 4A5OA 1M76A 1MP0A 3AY7A 3GZNA 3W4KA 4CM5A 2D8AA 1PJBA 3GFGA 1LSSA 4HNGA 1Y6JA 3H9QA 2Y68A 3RBZA 2YHUA 1SB8A 3DZGA 4GX2A 1Y8QA 3MZ0A 4G5HA 3JQ7A 3DZFA 1HDCA 3ZCXA 2E49A 4GLOA 5GY7A 4HFMA 1GV1A 2YUTA 3UOGA 3EUWA 4PZDA 5JDIA 5MGBA 2GYYA 4IDDA 4HXYA 3DAFA 3Q6IA 1PS8A 1VI2A 4NBUA 5JLAA 3PFFA 3AI3A 1CIVA 4YTEA 2RBEA 1DHTA 1P45A 2YV3A 1PSDA 2GD1O 4FPXA 2EKLA 2Q4EA 3OA0A 1LRKA 3Q2IA 3F46A 4QUKA 1D8AA 3FI9A 3EZYA 4GQAA 3BAZA 4W99A 3SBOA 3WSVA 1KC1A 3DMTC 1BXGB 1HSZA 5JSFA 5KKCA 2Q46A 3G1TA 1KETA 4ZHSA 1UUFA 3GT0A 4DA9A 4CLDA 1R15A 4KUEA 3JV7A 2PKQO 3JD0A 6LDHA 4J0FA 3WNQA 2PH5A 3WGOA 5BNFA 1VRWA 1YOVB 4EYEA 1LI4A 1CYDA 3QVSA 2NVUB 1IOLA 2VYVD 5EJ2A 1Y8QB 5G4KB 1Z82A 1F8GA 3NDRA 3QW2A 2WJPA 2C0CA 3JQ9C 3SXPA 1U9JA 4MVJE 4CMKA 4CL8A 1SEPA 1GL3A 3KYCA 3ZV4A 3DL2A 1FXSA 4EUHA 3ZU4A 4OKNA 4PZCA 3BIOA 2PA3A 4CQMB 2D59A 2HJSA 1N7GA 1ZIDA 4D3DA 1NVMB 1F8FA 1DRWA 2C82A 3S2FA 2FR1A 3GK3A 3L4BA 1FMCA 5A5EA 4MVJD 4CM4B 3FNHA 2ZJ0A 1ZXBA 1HKUA 4JBHA 3ZWOA 4Z9FA 1H9AA 4LCJA 4E5KA 1BW9A 1XR3A 2EP5A 3OFSA 2EW8A 3QLJA 4PLZA 1JKJA 1JTVA 2B69A 5JAZA 5EL0A 1A5ZA 1PGPA 3LC1O 5IF3A 4IJWA 1ZVMA 2IDZA 2GN9A 1GAEO 4PLVA 4LGVA 5DBGA 5JCJD 1SAYA 3FNGA 3RC1A 1NAHA 4DC0A 3P2OA 5CDYA 2PNFA 3PGXA 1ADBA 1HLDA 3ROQA 3AW9A 4EUFA 2Z5LA 3DFUA 4D43A 4FFOA 3HN2A 4HBGA 4GSLA 4JJFA 3GVIA 1C0KA 1MXHA 2HK8A 4PCVA 2OXIA 3OETA 3KZVA 3QV1A 4TRJA 3WFIA 2NTVA 2EGHA 3U5TA 4QT0A 5CP8A 3PJFA 5B37A 2AE1A 4DLAA 1YB5A 2CMDA 3OIGA 4JCOA 3TFQA 1UXHA 1E3WB 4WGGA 1FK8A 3WB9A 2BGLA 4B7UA 4B3JA 2G5CA 4FSHA 3JQAD 1Z75A 1A72A 1UXGA 2H5LA 1SOWA 3PLRA 3DOOA 4ILKA 3G79A 1RM4A 1X13A 5B12A 2UDPA 4NH4A 3DBRB 4UVIA 4MVJA 3GVPA 3TZKA 1ZFNA 5HS4A 1HLPA 1T4DA 1HETA 5L7TA 3R3JA 4JJGA 1XSEA 1B8UA 4YJHA 3GY0A 3JYPA 4J16A 4KQWA 4HV4A 1VKOA 1HXHA 2GDZA 2X0JA 3E9MA 2X23A 2TMGA 1NASA 1KBZA 1YXMA 1FDSA 3V2UA 3WDSA 3GFBA 2PGLA 3KYDA 2AEMA 3I9MA 1EQ2A 4BO8A 2UUOA 5ICMA 3I6IA 4ITUA 4DPMA 1RM5A 3F3SA 4KUGA 1LEHA 1O89A 1E3IA 1ISFA 3LT1A 4KDFA 2W98A 4II3A 2X1HA 4O0LA 4Q3NA 1DLJA 1ZK2A 3KEQA 4NQZA 4QFDA 1NQ5A 4MPDA 5KVCA 3M1LA 3U09A 1Y5MA 3AM5A 4D0RA 3MJTA 1HZJA 2JCYA 3IAHA 4A73A 4A7PA 4AJOA 5I9MA 3PVZA 4BNZA 2LDXA 4ZD6A 1MG0A 4GH5A 3R6DA 1MC5A 1PEDA 3JQCA 4M54A 5A9SB 1U3UA 2C59A 2D4AA 3TN7A 1EFLA 3X2EA 4EJMA 2W2KA 4BB6A 1J6UA 1P44A 4W7HA 3ZH2A 1EFKA 4AL4A 2B36A 4JXKA 5JCJA 4E5PA 4NZ9A 5I7VA 4YRAA 1SO8A 1QMGA 1MC4A 2PD6A 4FD3A 4PLTA 5DZSA 1YBAA 2BELA 4CM7A 4CMGA 2RHCA 5JBIA 4E32A 4IINA 3DHNA 3L6DA 3JD4A 2C5EA 3JQFA 1TT7A 3ZV5A 5C7OO 4M87A 1GZ4A 3BMOB 4YJGB 3IKVA 2AG5A 4PRLA 1X0XA 5JYDA 2GGSA 3DAGA 1TT5A 3TWOA 4F46A 1I0ZA 4AJ1A 1T2CA 4WOJA 3P2YA 4DGSA 2BGMA 5IZ4A 1I2BA 4CLRB 1F14A 1XU9A 3HQ4O 1B3BA 1IHXA 2B5VA 4E2XA 5JPIA 1IULA 3ZN2A 4AJJA 2E82A 4R3NA 3JYLA 1GTMA 4OL9A 4HFNA 3R3SA 1WDLA 3ZW8A 3F6YA 1XWFA 2YQ5A 1PJSA 3RROA 2Q3EA 2I65A 4LMPA 1JVBA 1D1SA 3FNEA 5GZ1A 3HDQA 5CDTA 3SC4A 3OBBA 4J91A 4AJLA 5I7SA 4W9NA 4BNMA 3KHUA 4BQRA 4RLSA 3RASA 1PU2A 2VRCA 3VPFA 4CM9A 4MKZA 1Q7CA 1E0DA 1OZAA 3V1YA 9LDBA 4BO6A 1VSVA 4TVOA 3ITDA 3R0IA 5CAEA 3WFJA 3O9ZA 4YQYA 2QYSA 4ALNA 2C2XA 4IIVA 4KUHA 3OJLA 4BO9A 3K92A 3NDJA 2EV9A 4R01A 4CM8B 1MXFA 3P19A 3E82A 4PG7A 4IZIA 3HB5X 2CUKA 1R0KA 2DAPA 4NHEA 1I3LA 3PGJA 2Q1SA 3KETA 3V1UA 3UF0A 1T2EA 4NFSA 2FPPA 3TPCA 4NBRA 2CDCA 5I8ZA 3JD2A 4UEJA 2DFVA 1Y5RA 2IXAA 4E12A 5KVVA 3U4CA 2GSDA 1E3JA 2DKNA 3DBLB 4TWRA 4LW8A 3GH3A 1ADCA 2NU7A 5A9TA 4GLLA 5CDSA 2Q2VA 5DN9A 2WD7B 1KEVA 1DAPA 4BNWA 1F06A 1GFSA 3I6QA 1E7QA 2RCYA 4I9UA 4WNCA 3PI7A 1DJNA 5I7FA 1T4BA 2NUAA 4CQMD 4XYLA 2PKQP 4R69A 3KLMX 3V8BA 1P74A 2JAPA 2QRLA 1ISIA 1NBOA 3KTDA 5A04A 3DOCA 1IUKA 1I32A 1MFZA 3RC9A 4AICA 1QXSA 2GRAA 2FWMX 4CMAA 2IZZA 4NBVA 4GMGA 1V3VA 1WLYA 2JFFA 1KVRA 1RYEA 5IXYA 2CD9A 1AHHA 4AJHA 4WCFA 1A9ZA 5T64A 1DHRA 3EK2A 4FBGA 5EMHA 3OICA 2R00A 3NJ4A 4GWGA 4E30A 3GLQA 2Q1TA 4BNUA
chains in the Genus database with same CATH superfamily
2WSIA 2YV5A 2WUVA 3BGIA 3O8OB 4KACA 2OHJA 3E5NA 4EENA 4B3MB 3ECSA 4QJ4A 4Q1CA 1E1LA 1KEPA 4MWBA 3A6ZA 3RIMA 4BU1A 2CDRA 1ZHOA 4ND4A 1ZIOA 3IP6A 3HEAA 3HH8A 1ACMA 1O95A 3INGA 2A9OA 4OL0A 1JU3A 1WETA 2ZBUA 3MAJA 2VUHB 1RXCA 1OUMA 1ZCFA 2IW1A 2FMXA 2Q9AA 1DDOA 4L9WA 4WERA 4YCDA 4CEHB 2YWRA 4F1KA 3RANA 2ZAOA 1W73A 2OCLA 1NM5A 4RV5A 5TR9A 2PS9A 4L5YA 3H8VA 2UAGA 2Z1DA 2QU7A 5IF9A 2A7XA 5TMEA 3WMFA 1K9VF 4FIDA 4I1RA 4H7FA 4IMPA 4F38A 2GCNA 3ZW9A 5JYEA 4ZCSA 4LXUA 5CFNA 5B3AA 1E61A 4BGUA 2VOJA 4TT8A 3I37X 4JLBA 4AG6A 2H4WA 2HXSA 4YCNA 2XNCA 4PR0A 3MW8A 1XJQA 4LXYA 4IXTA 2H63A 5K8TA 1WCXA 2WD9A 1A88A 1KQOA 4M1EA 3EDOA 4EMSA 2AR0A 3MINB 5ARBA 1Q11A 2UUAB 5B2EA 4FOOA 1Z88A 4X62B 1PNOA 3IJ5A 1Y6ZA 4YJ3B 1OX4A 2AEEA 5G1NA 3LDGA 4Z4GA 3AF1A 4XLZA 4GMXA 1BHJA 2ZVJA 1EEHA 1KI2A 1DBWA 1MO4A 2BLLA 4E5VA 3U49A 4C1NA 2WIFA 4MVJG 3N7AA 1HORA 4OHOA 4NG5A 2FR8A 3NTLA 3OEHD 4Q7LA 3QY9A 1PFKA 3WLJA 3HU3A 4EF6A 4CIWA 3SM9A 3QKTA 1LS1A 5JAMA 2BBTA 5HK8A 5I9NA 2OV1A 2QYTA 3QKWA 1K7XB 1SCUA 4ZOCA 5SZKB 4QDXA 1P4JA 2ONJA 3V9AA 2OZLB 1XLTC 4Q3AA 1QO7A 3JAKA 3IAS1 1K2VN 3L6CA 3I3OA 2KW5A 1KI1A 1CDOA 1NVDA 3KR9A 2G77B 3CEJA 2BBOA 1QVWA 4K46A 2AZ4A 4R2KA 4GICA 3WGTA 1NYTA 3UUWA 5ECDA 1E2BA 3ZJVA 1NJ8A 2WE8A 4DC9A 4GZ3A 1P91A 3C7DB 1L1RA 3EG9B 1U3FA 1QYVA 2QQ0A 3Q11A 4QDTA 2CEKA 4M9ZA 1JFRA 1N77A 2PL3A 5GP1A 1HT0A 1KH3A 4TTQA 3W9UA 4AXXA 2DCMA 4FE3A 4XGQA 3KYCB 1R6BX 1TRHA 3TKLA 4QOJA 2WLSA 2O2YA 4L6CA 5BR4A 3BJIC 1XZDA 4Z2YA 5FWNA 3CGGA 1MO6A 2H1SA 3TGWA 4P32A 2PLFA 3EARA 2RGYA 4B33A 3T7RA 3ZQ4A 4EWLA 4HDNB 3GP5A 4YAOA 4FOLA 2DFKB 2AOWA 2Y0EA 1QGUB 2OAGA 2DUWA 3L7KA 1BTOA 3Q7TA 3WJAA 4M8IA 1IWBB 1K68A 1VYTA 3AB3A 1NVAA 2AG8A 2PL1A 3I30X 5HFAA 3PEEA 2VPIA 2PT9A 3P9QA 3SCZA 1E7WA 4BCDA 4KFTA 1FJ2A 3HLTA 4PHGA 4URZR 1K2WA 2QV0A 1IL0A 3IIKA 1KMCA 3QXJA 2ZJ3A 3PYXA 4W8OA 3SY8A 1XA0A 2AK2A 2WJ6A 2FSVA 4YB8A 4DY4A 5LN1A 4GOJA 5BWBA 1W46A 3ANSA 2ZYTX 4IJQA 1APBA 1Y6RA 2CHFA 2OZVA 3DZ8A 3LAWA 2RH4A 1CEQA 4WCFB 2W4QA 4EZBA 1YO6A 1A4XA 5DYYA 4QIHA 3KTAB 2H2DA 5FWAA 4XUDA 1EXVA 2D54A 3HXPA 4X1YA 2EEZA 1KJYA 4ARBA 3RVOA 4M6WB 3O93A 4Z49A 2Y1CA 3K5IA 4ZO4A 4DZZA 1PG2A 3EGDB 3K35A 5KYTA 1GZSA 1J2YA 1XVTA 2L69A 1Y89A 1MHTA 2I6GA 4P2GA 1HYGA 5D86A 1DAOA 2X22A 1M5UA 2ZAMA 5DHQA 4Y2YA 4G0WA 3UMRA 3QPAA 4BV2A 1Z26A 3IUPA 3O8DA 1QS0B 1FLDA 3KNZA 1NVVR 2FPIB 4Q1VA 4LJLA 3AUKA 3H1AA 1B43A 1L5SA 4R5HA 2HTFA 5BR7A 5HOEA 1KY5A 1AS0A 2A1TR 3EXFB 5FWDA 4MO9A 4WJLA 1YCDA 3CNQS 2CXSA 4NCXA 2O54A 4E2WA 1AG9A 2QXTA 1A9PA 3R7WA 2QPOA 3EGCA 4LPKA 5KAMA 4PG5A 4BGVA 3VX4A 3ZIAD 3TQQA 3PPXA 1RIIA 2E5WA 2EIHA 3AR4A 4AI6A 5K0EA 3Q9UA 1TCVA 1GQYA 1XYYA 2C20A 1IN8A 1HDRA 4CF3A 2ODTX 2JLQA 2YY6A 2AQKA 1JN0A 1G3UA 4ZPJA 2WSYB 3B2EA 1JH8A 3QWBA 5FAXA 3H4VA 1K5PA 2R25B 2JBHA 2XI4A 2C57A 3K5PA 3NT2A 4GXNA 4NMXB 3UGKA 3TQHA 5A6SB 1KBQA 4FKZA 3X3HA 4D56A 1EK1A 4YX9A 3E6AA 5CLLA 2B94A 3PPYA 5BOSA 2XSZA 1CXZA 3ETCA 1NLUA 2ZREA 2E37A 3H65A 4B4OA 1CVIA 1RJWA 4HH0A 1E1CA 4RH1A 3SIXA 3NORA 4Q7EA 3UFBA 1BX3A 4UBIA 2VYCA 1QIIA 3A3NA 1U8ZA 3DO6A 4WK6A 3T4UA 2M6LA 3QQPA 1O2DA 3GXBA 3VU1A 1MTOA 2N46A 3IFSA 3MRVA 1P9OA 4RIEA 4KVFA 4PFJA 3HXMA 2Z43A 2KE5A 3H2SA 1TAQA 4OP2A 1SBNE 3W2FA 5ABPA 3V32A 1FXWA 1F0KA 3IVXA 4QRIA 2IHVA 2XMGA 3GW8A 4H35A 1KSJA 4HDQB 1T13A 4TMTA 3OKCA 3CONA 1WQ3A 5DM60 4B47A 2NM0A 3EMBA 1JSXA 4ZU3A 3A26A 2JAHA 1NI4A 1Z2OX 2I2DA 5L3RA 1N6PA 1XJ0A 1EBUA 2VNAA 1XBTA 2V6FA 3T7CA 5FTKA 1RXEA 4RTKA 1Q6YA 1XNGA 2D13A 4H7PA 5LBIA 1GWNA 1YIAA 4RKEA 5C8XA 4IDAA 1XAIA 5F1YA 3S4YA 5EIHA 3K9LA 1G4HA 2DQSA 4L4ZA 1AQJA 1T5LA 2P62A 3E4DA 2IX3A 1D1QA 4JSYA 1QNFA 3T7IA 1QH0A 1JIUA 2XLBA 4B1FA 1OR8A 1VL6A 5HA5A 2R87A 3S2UA 1XMSA 5INTA 1JB1A 1WCV1 4Q6BA 3QI7A 3UUFA 3WL7A 1EESA 2J1LA 1JGTA 3O4JA 5EE5B 1E7MA 2B2NA 4MI6A 5G3YA 3CX6A 4HRVA 8MHTA 2B7BA 2B61A 4V0RA 2ZR7A 1PQUA 5CCDA 3S1AB 4EB6B 4BMPB 4TS9A 1S4MA 4UNNA 4DNFA 2Z6VA 4AKEA 3PEFA 4PHTA 5BWNA 1VLZA 2R62A 1KVTA 1SXHA 5E9WA 1CT9A 2GK6A 3DEJA 2RIPA 5DTMA 3SYNA 4MKFA 3KAKA 3AVOA 4DIFA 1XWIA 4N5MA 1XRNA 3B82A 1SG9A 2IU6A 1SWWA 2QMZA 1R5JA 3F6BX 3NC4A 1V7QA 5B4VA 1A97A 1K4KA 2GH1A 1JAIA 1OX5A 3TJZA 3WRYC 3NYRA 2ZQZA 1TX4B 1ESDA 3HC7A 1E2GA 2ILTA 3ZY6A 2IOHA 4YXWA 3UJPA 2XODA 2UZ4A 3E27A 4MITA 3BTVA 1ODIA 4NPAA 4XLLA 3W9BA 3NTQA 4AKSA 4P2BA 5A0FA 2ALJA 1N9GA 1PO7A 3PJEA 1PZHA 3HVIA 3LBFA 4K8RB 1VE3A 1SJ9A 3KUXA 3EW9A 5KNDA 3VPCA 1L6IA 4YRZA 4V0MA 4CG3A 3GLIB 1Q7GA 1SVOA 3AB7A 4CM9D 1UAGA 1M1YB 4JIGA 1N1GA 1UH5A 4K3UA 1T4GA 1RYBA 4QO8A 3W7VA 2E5FA 2XNJA 3CQ9A 4GZ5A 4J16C 4WOKA 3F96A 1Y5NA 4JBGA 2O14A 5IM4A 1CR0A 4LZZA 4JB2A 2WVGA 1L8AA 2QE7D 4OKIA 3H5NA 4GR5A 2QXYA 4M4SA 5CAEB 1VKJA 4P84A 3GLRA 4X00A 4CV0A 3Q8LA 2QTFA 1VA4A 3A6LA 1F7VA 5IG2A 3SBDA 1ONPA 1AKYA 2OB2A 4GEGA 1XC7A 1PZNA 3GVCA 4NCJA 5KIAA 1T36A 1TPYA 2A35A 1VDZA 5GGYA 4DQVA 1XMOB 1SBHA 2VUUA 5IK2A 2VF7A 4XKJA 2C4VA 3B7GA 1R8JA 1F8XA 5JWOA 1J00A 1YFJA 1GGJA 2XQVA 3O3NB 4F2WA 4WEOA 1EZ4A 2GETA 3U1VA 1EFDN 4KODA 3IB3A 1HWYA 3PXXA 1FDWA 3WHPA 3ZWVA 2FW7A 3UAGA 2Q3FA 1MX1A 2CE2X 3W4JA 1LX6A 3F8SA 4WNIA 4N5HX 1XTTA 1IY1A 3DZCA 2XA9A 3I2JA 3ZWNA 2X6TA 3WGGA 1HK7A 1VCNA 1KYTA 3OHPA 2FP4B 1AZLA 1USIA 3O82A 2M1XA 2OXCA 2QT0A 3OAAD 3WTBA 2VYFA 4LRXA 2ZTMA 5IHPA 1G8AA 1L8XA 2CLEB 5DYTA 4L0QA 2ACEA 4EI7A 3T5CA 1RT9A 1N7JA 3F0TA 3VYSB 3WIVA 2XDAA 2WA1A 5CA1F 3PWTA 3GAZA 5CLJA 3DXYA 1VSQA 3GLFB 1YU6A 3KQHA 2G4VA 5IUKC 2P7IA 3KB1A 4G8CA 2LWIA 2W2VA 2NXEA 2VG8A 1EDOA 1DX9A 3GLGA 3BXEA 1VXRA 4HQ0A 3IQIX 4I5EA 2GJ8A 3KWLA 1K4YA 2A0YA 7REQA 5A3JA 2YZ7A 1QQ5A 2B4TO 2VPQA 3CF6R 1OT3A 4GX0A 4RZHA 4BX9A 1J0EA 3BGVA 4J7CA 3EIXA 4PS1A 2A8YA 2FE4A 4XWKA 4D98A 1AGYA 3IOEA 3UA3A 2LE0A 5BN1A 2A84A 3WMEA 4DEVA 3D2CA 4US2R 5KDOA 2G9VA 4S1NA 5JAIA 4XJTA 4P5PA 3CTMA 1WXGA 3SLKA 4LMBA 2ZSEA 3A3PA 3DF7A 1RPTA 4NONA 3WB1A 4A8HA 2H5JA 2F00A 1QRRA 3ANTA 2G72A 3B1VA 1PT7A 3FOAA 5E8JA 1Q0UA 3A1DA 5JS7A 4MGHA 1P3DA 3R7FA 4DS3A 1N7IA 2O7SA 3BGSA 4G84A 2ZZMA 1GNQA 4LHSA 4XARA 4Y6QA 2QMHA 2RGXA 4M0KA 4KZKA 5D3QA 3I53A 3EMDA 1GARA 3W5BA 4DR1B 3HVJA 5EVCA 1N2ZA 1DUIA 3CBGA 2NIPA 2VAPA 3MNFA 3N1UA 4JEHA 3WDLA 4DSOA 4EHBA 2GTHA 4F91B 1RHQA 3COWA 3LQ4A 4B6OA 1XT6A 1PDVA 1LBSA 5DEIA 5FR1A 5JSHA 4PZPA 4MWDA 2W70A 5GADl 1R9NA 2WKWA 2VCEA 2P9GA 1MN6A 1W5BA 1YL5A 1MDFA 1VLJA 2PFGA 3RJ5A 1XDWA 3A1FA 4WPGA 4CFYA 1E60A 1ZN7A 3SSAA 2VA9A 1NLYA 1Q0ZA 3H5TA 4MQLA 4QEKA 1JSLA 3EZ7A 3LG2A 1JJFA 4MW0A 1XPRA 1VPEA 4KR9A 4EKDA 2DE0X 3RYCA 1C9NA 3C74A 4PAQA 1KJ9A 4DMHA 4HGPA 2C5LA 1AXGA 1IQPA 1VLQA 3FKSD 1I3OA 4I9GA 4K26A 3MQ4A 4B4UA 5IK2D 1SIBE 1GYRA 2O3TA 1WOYA 3LKZA 4L5JA 3NANA 4FQ5A 1JLRA 3GCGA 4LISA 5C32A 1UWKA 2XADA 4C0SA 1N2JA 4PFQA 4TYNA 1YJBA 3TO5A 5EZSA 3CKYA 1GKYA 4EZEA 4YLYA 4P8RA 2YCLA 4IIBA 3O4GA 5K0TA 1ZU5A 1XVIA 4EHJA 4LHXA 4P6VF 3EQ9A 3VZQA 1IATA 4ARCA 3PGA1 4X90A 4AO8A 1CKEA 3FBWA 4ZVKA 3HLKA 1X7ZB 4Y6PA 4B17A 4B32A 2OCAA 2PKWA 5K3CA 1C0LA 3I4FA 2HL6A 2ZJ4A 3Q3VA 1NMQA 2Y05A 3P5SA 3SZUA 4Z1MA 5KYUB 4GKVA 3GJ6A 5FBKA 1WU8A 2C94A 2RDMA 2O2SA 4HNHA 5C18A 2BFEA 4JXZA 1H9BA 3C3EA 3PEWA 2OFPA 3PHCA 4OI0A 3V4SA 4UDOA 2H0RA 2R8YA 1OH5A 1GFIA 3DFMA 1K06A 3FWPA 3J7AC 4M9UA 1P7YA 3ITKA 1OPRA 3B6ZA 4AKTA 1V8ZA 1I30A 4D25A 3GWZA 2ZBRA 4W5TA 3EVNA 1FC0A 5I4KA 5ES3A 2IW3A 2Q4OA 3I83A 2Z3VA 4RWZA 5JNRA 3ET5A 4XD2A 2EKQA 2K7ZA 5CT8A 4FB5A 3ROPA 3WB0A 1R0XA 5FIUA 2WE7A 3NBZC 4EL5A 5ALWA 4PTLA 3ZTTA 1JT9A 3PS9A 4XCVA 5PNTA 2LIVA 1G4UR 3TIFA 3LPMA 4MZDA 1WKVA 4UUBA 4ZAVA 2VUSA 4H7JA 4YWJA 2WMNB 1C1XA 1WM1A 3AERA 3JQ9A 5DHRA 3LLMA 2FPMA 2E2WA 4XDHA 5C53B 4PY2A 2Q2NA 1A8HA 2EJBA 3ONNA 4ITRC 1XXHE 5ADWA 4D9KA 1QP8A 1LK7A 1KK3A 1U5AA 1K27A 3TECE 3KLOA 3OP4A 2AK3A 1M2WA 1KMQA 3H9JA 5L3ZA 1I2MA 3AONB 4RA9A 3P20A 3T1YB 2RI1A 2FRDC 4LXQA 4ZO9A 1VQ1A 1LI7A 1YZGA 1D4FA 2AEJA 3QK7A 5LDGA 5IDWA 2QRVA 3DEKA 4LPSA 5IDYA 3BYZA 4YCAA 1W88B 3G8DA 2HAEA 4NRDA 3ZV3A 4KO8A 1GCOA 3JWEA 3P7MA 4DUPA 4EHLA 4X8HA 2FNAA 4D74A 1ORDA 1Z22A 1P1RA 1W5TA 2VT6A 3C4QA 3WWZA 4G0VA 1ES9A 4LJ4A 3LSYA 4TTIA 4HNSA 5AKYA 3HY4A 4H60A 3QFSA 1DAGA 1SEVA 3DOIA 5ADUS 3MGBA 3VU3A 5DOVA 1MC1A 3O6VA 3VBEA 2JI6A 3RCBA 2E0IA 2OC4A 3TINA 3CKKA 3OZIA 4OI1A 5JYBA 4DUZB 3FHTA 1WCIB 3AEZA 3W9SA 1NR1A 3OWXA 4KGXA 3A25A 1WTAA 4I4NA 5CVJA 3RUDA 1YZTA 1OU4A 1XTJA 1RPNA 4LZLA 2VCYA 1U9ZA 1L5VA 3GG9A 5IVHA 3ULKA 1DFIA 1M54A 2FZGA 2GAIA 3PTZA 4V1CB 5A4IS 2ILVA 1U0HC 3Q10A 4IDFA 1JFVA 2J0QA 2RGUA 1H94A 5AESA 2WM2A 4YAGA 4EQ6A 1GGVA 4NI5A 3U9LA 5IN5A 5ITZB 2XE6A 3AEKB 1O8BA 3ROXA 1K5HA 1GEGA 1A2QA 1PV1A 3H4IA 2N9UA 4NHOA 4AWXA 3FH0A 3LX6A 2W93A 3I2FA 1ZVJA 1MW8X 1J1UA 4YPOA 1WZNA 3P71T 1WUYA 3LDFA 2CBXA 1TUIA 2HD4A 1R6VA 3BOSA 2OE2A 1KF0A 3EHDA 3MOSA 3KSZO 1BHQ1 3SEAA 3WG9A 1OWPA 2IEDA 2HQSA 3D7SA 4PO9A 3ECCA 4V0OA 4ZT7A 3KPWA 5TGTA 2OFFA 3TSYA 4JYPA 1ACJA 1GRCA 1KVUA 3OMXA 4IP0A 4KQKA 5EE9A 4DUGD 2NACA 2Z1MA 1T2FA 3CRRA 3N39C 3M3DA 1SC1A 2VP6A 4Z1MD 1QJCA 4MMZB 4ND8A 4R1PA 4DR6B 2VZLA 2PEYA 3HYLA 1VA5A 1H2AS 1HDGO 1JG7A 1R2QA 3M6MD 1VB5A 3ZEIA 4M37A 3EVBA 4BTVA 3ZX4A 1JFSA 3O8RA 4RTNA 2ZWOA 2JANA 5BSWA 1YQUA 4ETMA 4LHYA 3ZHOA 3AZQA 4UBNA 5K2OA 2JLUA 3C3KA 2BI8A 3D54D 1CUWA 3VKGA 1E2LA 4LHZA 2B1JA 1G21A 4FNOA 2GHRA 4J3JA 1M75A 5LMNB 2P6NA 2WSBA 4D3SA 1G2IA 2XWBF 3Q6NA 2WYIA 2AFIE 1QAOA 1L3IA 1Y80A 3A28A 2ARKA 2GILA 4RFVA 3QW4B 4A0QA 2AZMA 4KPFC 4CETA 1X1RA 2HWKA 1VRCA 4BJHB 4B3RB 3HKCB 3WLPA 1C7EA 1IBLB 1UK9A 3K73O 4MZXA 4G5XA 4Z7JA 4UASA 3OZEA 3A1NA 3P26A 2P78A 4HH1A 1QGUA 5EE1A 5J3JA 1PJQA 4IRUB 4J6EA 3ZDXB 4CV3A 1BJKA 4TWBA 4F6CA 4OEHA 2PUDA 1U6KA 4KPUA 2B21A 2JGDA 4Y6SA 5CJJA 2XKJE 3ZHSA 4B85A 4E5MA 5BXYA 1LW6E 2W6OA 2OHXA 1ZCZA 1FS4A 1CZUA 1LSUA 3ZE6A 3MRSA 4QOGA 5KOIA 5MF6A 1CIJA 1HQYE 5H3CA 3IT3A 4J4HA 2V6GA 3RRYA 1XOIA 4EVQA 2FDRA 3IUYA 3QMMA 3G59A 4C2BA 2WIBA 3HB0A 1U3GA 3L05A 3GFQA 4O25A 4TWAA 4YCLA 1EE9A 3WO1A 2I4NA 3H75A 4MW1A 4MH0R 4WESB 4J90A 3TNJA 2O8BA 2PNJA 4HYYA 3BXFA 4X1IB 3IOYA 1L4GA 4ZAYA 4UQLA 4TYWA 2B2CA 3AU9A 2XUAA 5CXSA 2EF1A 1WP4A 4OQMA 2BRUA 2QMYA 1RWPA 4DQDA 1L5QA 2ZI7A 3HJBA 4PZYA 2WTBA 4RPKA 4RESA 1U0TA 4OIFA 4KCGA 2HBQA 3CPEA 1QLJA 3CZRA 1JWLA 3SEQA 5KYNA 1WNTA 4INAA 4BWYA 3BMNB 2IPOA 2XAAA 3JZMA 1UWVA 4HWTA 5FEMA 5KYGA 3LL7A 1OA1A 2NG1A 1BFDA 2XT0A 3THRA 3TMYA 1A50B 4ENRA 2HF7A 1NF8A 3S2IA 4BEVA 5FOSA 5IZCC 5DULA 5LU9A 2P5TB 2PX6A 4UEOA 1OH6A 2YKGA 1HV8A 1JAYA 1OWLA 2AXEA 1R4MA 2R6JA 1KVSA 1WF3A 4L7QA 4Y98A 2XA1A 4DSTA 1X3LA 1SHJA 5SZHB 3VHRA 3WV5A 5MFPA 2WP0A 3FCSB 4JLWA 1H0KA 3ETJA 2KSQA 3FPBA 4NDZA 3G0HA 4NCHA 3L4EA 4ND5A 4PC6A 5P21A 3AY3A 4ZIRB 3EZLA 3N2KB 1SBIA 5AVZA 3DS8A 3UY4A 5AK5A 2N3ZA 2IBSA 2NYRA 2O8BB 4B7XA 1UC9A 2IZ6A 2O2IA 4U7TB 5JNLA 1QE0A 3AIKA 2YXEA 1EVJA 1ZD1A 1P80A 2HNAA 3BCUA 5DXJA 3W77A 3VZPA 4BWGA 3GFVA 1T0IA 1E79D 1V9SA 2HU5A 3AQ4A 4L95C 4QUAA 4YP9A 3UPTA 1AV7A 3NHJA 4N0EA 3VDQA 2PLAA 1QORA 2EIXA 4RF3A 1AO3A 1DAIA 2Q5IA 3IBYA 5I7AA 3NDPA 1J8VA 1CP2A 4JASB 2PRJA 3D8TA 5A1JA 3NTOA 3P9YA 1M2KA 2H9YA 2JFQA 4P3XA 3VNAA 1UDBA 4N40A 2D7JA 1GL6A 1O95C 4QGSA 2AQHA 3GFPA 4L78A 1I13A 4YYZA 1AQYA 3R5XA 4OGFA 4S1VA 1RTKA 1R0YA 4H08A 1AUOA 2OOSA 5AW5A 4DCSA 4QLBA 4FDMA 3P0EA 2MMCA 2XRMA 3IP3A 3PUHA 4DQ0A 3DWGA 3CVVA 1YL7A 1E62A 5DIFA 3LX4A 1PFGA 1R6TA 3L06A 3ROTA 5EYPA 5JW6A 1MB0A 2QDXA 4UNRA 1DAKA 2AFRA 2BDEA 2J9FA 2QRUA 1NJ6A 1JDNA 3DOHA 1RCTE 2W8BB 4QNRA 2FZEA 3LYHA 2ZRNA 3NM6B 4U9IS 4KWEA 2Q3BA 1KVQA 3FA2A 2GUGA 2D74A 3ZVNA 2AR9A 3NT4A 4CEHA 1ZK3A 1R3UA 3AEUA 1I6KA 1QKJA 2OD7A 2Y93A 2BGJA 2ERCA 4PX3A 4NCIA 4TUYF 2VDOB 3E5RA 3F49S 4KMOA 4OHCA 3SSMA 4B35A 2AXQA 2OCBA 1OAOA 3VTZA 4E32A 3PC3A 1V5FA 3WLFA 1GQOA 1V8BA 1QVRA 1ZLYA 1T24A 1VLMA 2V54A 2N1BA 1XA3A 2DY1A 2CBZA 2RKWA 4G5FA 4IH9A 4UQPA 4HNUA 4BIMA 2QTZA 4G89A 3QX3A 1DTSA 1EQAA 1ONOA 2PD4A 2P4EA 1KFBB 4RD2A 5FLXA 2FEWB 1KAGA 2E9SA 2X4IA 3CUYA 2OKGA 1YAHA 5EOVA 5LQRA 4HAVA 1PR5A 1VG0B 2XNSA 2I2BA 4P1ZA 5AHKA 5BSEA 4L5AA 3U9TA 1W4CA 2F8SA 5CA1B 1VGQA 1OWOA 1VHWA 1U31A 2RGGA 4ZI7A 7GPBA 5IH7A 3QFRA 4FMDB 1D6NA 4XFDA 3NP7A 5DHFA 3D81A 3LK6A 4KQEA 2HJRA 4X3PA 2RK3A 4C6TA 3PC2A 2TSYB 2E4VA 1RACA 3DR3A 3OCYA 1BHSA 1Q1QA 2HMYB 1DBRA 1GZVA 1IY9A 5T4EA 4F92B 3FNRA 3X1MA 5CEFA 1ZKDA 5AVJA 2HV9A 3PFKA 4BMNA 4YUWA 1DRVA 3EEYA 5SY4A 3K94A 2V8OA 3NPMA 1SZDA 4FUQA 2C5SA 4PAMA 3WLAA 2FPGA 4HLCA 5KU7A 1AXRA 3BICA 4HNRA 4HVAA 3IAFA 1T6BY 1NF9A 1E94E 2I99A 2YY7A 4CXMA 1FNMA 1OQAA 1TW2A 1TL7C 2G28A 5TF0A 5IS2A 3HDJA 3IQGX 4JQZA 4BQQA 3NKVA 3ZQUA 1QHHB 1U8AA 1SUEA 2GT1A 3EPLA 3AHHA 2GPSA 4F9TA 4F45A 1JE1A 4BYGA 4B5KA 4M88A 1D09A 4A1OA 3MJRA 3BZWA 4LYEA 2ZI3A 4UW9A 4GI7A 4MDHA 4HWOA 3TCXB 4OCZA 3TQIA 3GL9A 3ZC3A 3G9TA 3I39X 2V98A 3NYWA 4EUKA 4OQYA 5CXXA 5A9SA 1TNDA 2OYCA 1RZRA 4DOMA 4ALMA 1N3IA 1YE5A 4CM4A 3L0BA 1H4TA 5IT4A 5KCMA 3L7AA 1PDOA 1N5MA 3H1GA 1EH5A 2FXIA 3RTEA 3H5WA 1QGAA 3LBNA 1CQJA 1T10A 2PZBA 4PYRA 4CT0A 1ZD9A 1TEHA 3SJAA 1MORA 1ANKA 3DHYA 3ZVRA 4EO7A 2C98A 4JLAA 3LWNA 2CVZA 4LBVA 2JD0A 1YDHA 3RD5A 4EM6A 1QS0A 1SPXA 3BORA 1Y6GA 4MA0A 2YZGA 2C31A 2QQEA 4FFDA 1LJUA 4A23A 1LTHR 2HDHA 3NGXA 1Y8ZA 1U3WA 4M49A 4NJMA 4D45A 4G4GA 1M0SA 5CHEA 5LZ9A 1HDZA 3I9LA 5ILQA 4IXWA 4G24A 2HLHA 3VYUB 3EC1A 4TGLA 1GV0A 1W5FA 1HYQA 1KFEB 1EK5A 3PNSA 1YK0A 5AICA 2ISSD 2XKKA 3L7BA 2LD4A 1ZEJA 3I9KA 1BE8A 4O4HA 1GUBA 1QYCA 4RO0A 5D6NA 3ZBPA 4BVEA 1RYHA 2H11A 2GN8A 1GNVA 4IMRA 4JL8A 1IJEA 1R9MA 3DZHA 3A6EA 4OBXA 1E9FA 1ZSNA 2HQOA 3VU9B 3WLRA 2R6CA 2PX4A 2Q8QA 2OYSA 3TI9A 1YR2A 3P8ZA 4HQLA 2BKUA 1SZPA 4N03A 5SY9A 1I8TA 1GA6A 1TJ4A 4L3WA 5FO1A 2YNMD 1AF4A 3M3PA 2J9YB 3T7EA 4C78A 5ELMA 3KQOA 3G1WA 121PA 2C5HA 3WSWA 1P5RA 1ZIYA 3EH2A 2XWQA 1FW6A 3OCWA 1RW4A 1TF2A 1VSBA 1N6KA 4BYMA 5KC8A 2GJ9A 1GZ5A 2OZPA 1T1IA 1T91A 2Z2ZA 2G36A 4IIJA 2XYRA 4K88A 4BV3A 5CA1A 2Q7OE 1N2CE 5J47A 4X60A 1SXQA 3MTBA 3RFTA 1Y0BA 1H66A 3AGQA 1BEZA 1D7OA 3C6QA 3JWHA 3JTMA 3N86A 3ZZMA 5JVDA 5AVWA 3Q0TA 2TRSB 3HKBB 5EWLB 1S6YA 2FA9A 2C2GA 4J1NA 4JT8A 4FKBA 2O7RA 3VR5D 4A6EA 1R8SA 2AMFA 4M53A 1QCZA 5AM3A 3PG5A 5I3CA 1NNSA 4O5OA 4GMHA 3QFHA 3KPUA 2M6RA 3B7PA 1RKQA 1KDVA 3A7EA 1WSAA 3EDMA 1A9RA 4N1AA 3R5TA 5HIAA 1WDWB 4CLHA 5JD5A 2XVAA 4ZZ3A 3R3UA 2I8AA 3FVVA 4Y2GA 1D1TA 4KLZA 5EHNA 1EGAA 1JG3A 2IOQA 3F5QA 1WXEA 2O2JA 3F74A 3HFJA 3M6IA 3L6EA 4H7IA 1X1DA 3HCWA 4FLEA 4OU4A 4QYIB 3TCNA 2K5UA 4WL0A 3R7SA 1E6UA 1L9XA 4J0DA 1RXYA 1FNDA 1JYEA 2O50A 1GXSA 1MJGA 3HE3A 4PO8A 4G1MB 5JNTA 4W63A 1AKUA 5BN4A 1BHO1 1ZONA 3DBLA 4Z9YA 1Q22A 3MUEA 4H7EA 3W06A 1NXOA 3OIVA 1E7SA 1AKEA 3CRQA 3X2SA 1Z5UA 4C5AA 4D8VA 4L72A 3UWPA 3NWBA 4AY5A 4E6PA 4DR3B 2P5SA 1P9LA 4L2IB 1E2NA 1JQBA 2FWAA 1T8RA 2LGJA 2Y6VA 4MW6A 1MZVA 2ZQ5A 4LOJA 5TQ2A 1LZLA 4ATNA 2DSTA 4K6HA 1OGIA 1DIHA 1SCQA 4UUAA 1HDIA 2EFHB 2IUTA 3DG9A 2CCJA 2AOVA 2ZRMA 4TN1A 4Z51A 1I36A 1LQUA 2ZRGA 4WY5A 5E1MA 4EA9A 2O0JA 1CNEA 3NZEA 5I9TA 3I1IA 1X77A 3KQTA 1VCHA 4C0BA 3DLHA 1YA4A 5ARDA 1D9XA 3RT7A 5K09A 1YCHA 1XXHA 4ZVRA 4B71A 4QXPA 3V2HA 3WR5A 2H4FA 2I76A 5F1OA 1MX3A 1R0ZA 1C4KA 4IW3B 3W6ZA 4RUKA 1FJGB 4WXMA 2JGNA 4I3HA 3QZUA 1WUIS 2FSGA 721PA 1EM8B 1KRHA 3D8BA 5E4FA 1E2MA 3QEMA 4MDYA 4PGMA 5E6UA 5A3RA 4J43A 4DJAA 1JSZA 1LK5A 3OZCA 3PRYA 1U6JA 1HA3A 2ZXUA 2EX4A 4H3HB 4YALA 1GN8A 3G7NA 4B09A 2VHWA 4IIUA 2BFBB 2I29A 3IVAA 2WINI 1ZI8A 3SLGA 3BD9A 3CEHA 1MNQA 1XFAA 4EGQA 2DCUA 3MGKA 4JJ6A 5IAOA 3G9ZA 4IHJA 4BNVA 3GDGA 1QSGA 1KPIA 2ZWIA 2V7VA 2VL7A 3I52A 2WYHA 2D1YA 4RSMA 1BCRA 5DSTA 1RYNA 4F21A 3NDBB 1NUUA 2EZ8A 1NMSA 4F72A 4Z86A 4GLJA 3JQBC 4K6GA 2J8ZA 4YO7A 3BFXA 5FWXB 1Q17A 2ZSIA 3I4LA 2O5EA 2WYUA 2RGAA 1SA0B 2I1LA 1N5JA 1T0HB 2Z5GA 1W48A 2OB1A 3AINA 3IERA 4WOCA 4G81A 3B3QA 3GT7A 4JQYA 3IOMA 4OPMA 4QJ5A 4RGQA 1T2UA 4RFSB 1IVSA 1NIJA 4R3WA 1M2OA 5K0BA 2D6FA 3SF0A 1Y9EA 1YBMA 1G16A 3JASB 1SZJG 3WYCA 1RMQA 2SCUB 3CMCO 4CBVA 1N3BA 5LOVA 2RHMA 4BQEA 3CUKA 2CNBA 1CHNA 4G1FA 1K7YA 3CG4A 2GASA 2E89A 3B3GA 3A27A 3OKAA 5TJHA 1Q15A 4M98A 4IIYA 4PPQA 2QEQA 1RYDA 2RIRA 2MR5A 3ICVA 4I2NA 2FG6C 2FUEA 4QAQA 1P1FA 1UZNA 1Z6GA 2WHPA 2YHIB 4DREA 4RS3A 1G98A 4RF4A 2H7CA 4KITB 2P5UA 2JGDB 4JS0A 3CSDA 4DLXA 1DLIA 4Y2UA 3KUDA 1FDOA 3I1YA 1WY5A 4GP6A 3KYDB 2OL4A 2RH5A 3STWA 4BNDA 1CZNA 4Q12A 3JRWA 5EIOA 2RHJA 3KV3O 3QEJA 4FVTA 1C7FA 4U2BA 3K6RA 4Y2QA 3ZGOA 1Z5ZA 1YGPA 4ND7A 2JAUA 4Q4AB 4DWWA 3JD3A 4B3CA 5ICEA 3OQMA 3DDWA 5LC1A 1GTG1 5EFOA 1UPXA 2ZRFA 2WU1A 4QATA 4DMRA 4Q02A 4Y9TA 2HEIA 3RDPA 1J9EA 1F12A 1IMOA 1SD1A 3AFMA 4AJ4A 3JQEA 5DP1A 4II2A 1QV7A 2G6BA 3C41J 4O1IA 4Q7JB 2BMAA 1K3TA 2K2QB 2NAPA 1XLWA 5E38A 1BYIA 5L7YA 1IPHA 3SE0A 3U0BA 4HF7A 1D2MA 2PQ2A 3TGPA 1W2GA 1Q1GA 3C6BA 4C5BA 1BVYF 5BQ3A 3SJ7A 1FPQA 3LT2A 1LW7A 5JO9A 4F0JA 7MHTA 4IX9A 1RKXA 1USGA 4GE3A 1CWUA 1S2LA 3M8KA 4MUMA 4TYPA 3DULA 3E5MA 2YV2A 5ILGA 9LDTA 1FLVA 2BFDB 3IUEA 1RPAA 4MW2A 4OB6A 1CF4A 2O8DA 3I28A 1E3SA 3VNUA 4Z99A 5FL7A 1GD1O 1T8PA 2IZ0A 3KXPA 5E7QA 4DR5B 1C1DB 5KTSA 2IWHA 3Q2KA 2ZT7A 1VG8A 4E0BA 3BFPA 2ZBEA 2PLWA 2JAXA 3OD5A 4NJMB 3GQBB 3RFXA 4LC9A 4C4AA 3O4RA 4CCYA 4II7A 2ONYA 2PQ0A 3G0IA 2FUKA 1C30B 1RKUA 2PRKA 3ACBA 2VPWA 1FUUA 4LRWA 2RGBA 4QDZA 4YV7A 1NOIA 1LX7A 3FWHA 1MJNA 2O2DA 2VJOA 5CXQA 4GC5A 1WHSA 1U8UA 3OX1A 4CMBA 3DO5A 1RS0A 4CGYA 4JI3B 4UU0A 5AQEA 4ODIA 5ERYA 2IPNA 3N9IA 3QNMA 3LYAA 1AK2A 1N9ZA 5BSGA 3CCCA 3VDMA 4NP6A 4JFAA 1RD4A 3AVPA 4QTTB 1VB3A 5EP4A 3ASVA 1MABB 3W90A 5IXSA 5JH7F 1X9GA 1SGWA 4R1TA 2WWWA 5KCZA 1F4LA 2J3KA 4KNVA 2Q8NA 4DBVO 4YQZA 2VRBA 3BPSA 3GP8A 2RH8A 3BX1A 4PYKA 4ZVTA 1L8OA 3S2GA 4DADA 3P2EA 3EAQA 1L7EA 1NN5A 2XCOA 3F5FA 4RANA 3L9WA 3N0RA 4YAEA 3WMRA 4MJLA 5BOSB 1TA0A 3MWJA 4UD6A 5EIEA 3R2JA 2P9EA 3TYXA 3WL8A 1DQZA 4Y8VA 3T12A 2PMWB 3QPWA 2CMGA 1OZGA 3KRTA 4Y1FA 1QDLB 3HU5A 3VGPA 2UV8A 5JISA 2ZJYA 1EGQA 4TLEA 1V3TA 1FMLA 1QOPB 1NULA 2PR7A 3C98A 3PWKA 1AZTA 1RU3A 1LQTA 4ML3A 3LU1A 4BE4A 4F8EA 4BLTA 5EIXA 3GD5A 8AT1A 3DE1X 1W9HA 3KHKA 3O31A 1P39A 2GPBA 3A9UA 4PYOA 5IVDA 5EJ8A 3QEAZ 1V8DA 1Y7HA 1T6YA 2DBQA 1N6RA 1WMEA 2NWQA 1G0NA 3BTUA 4FE7A 3RREA 1Z6XA 1FYDA 1ZJYA 4HPJB 4LQ4A 4QXRA 4F9FA 5M2QA 5CK5A 4P22A 5JO0A 5EINA 5EMLA 3H4TA 4CL3A 3AVYA 3ITNA 4Z7OB 4FU0A 5JJCA 1C1XB 4EY3A 3IIJA 3KFLA 4X24A 3FYUA 3N0TA 4J0QA 5DCLA 1X1CA 3N2GA 4DR2B 3B53X 3EN0A 5JDIC 1ID1A 3QP9A 3G6WA 1NURA 4OQEA 2A30A 4FC6A 2AFIB 3HZHA 3RUEA 2WJVA 3OLXA 1NM5C 1Y3CE 1EXNA 5CU7A 3T4XA 4EG8A 1PUIA 4HDKB 3IDQA 4OFWA 1RP7A 1T0JB 3I8XA 3JVIA 2O0LA 4BC1A 4E22A 2HEGA 4DV7B 4PZAA 4JC5A 3TKAA 3FNBA 1TZCA 3W8NA 1BCSB 4Z0TA 3RU2A 3SR0A 3NBMA 3F7MA 4BLSA 4DUYB 4JSTA 4FE4A 4ZA2A 4PN7A 2P9CA 3C6MA 2L42A 2A9VA 2ZYSA 1CNFA 1A04A 1T5IA 4G23A 1H4QA 1KNXA 2V4ZA 4S1WA 3EY4A 1QUFA 3HB4X 3DBRA 3NAZA 4TZ0A 1X1TA 1LPBB 4TVKA 2FI1A 3IQHX 2YTZA 3OKFA 4MVJI 2UZ0A 1THMA 3BK7A 2JHFA 3NAGA 2DQ4A 4B6EA 3ENNA 4S3MA 1M1YE 3EYWA 4R54A 4DN6A 3FSGD 4GO1A 4EVIA 3QBJA 3ENZA 1QX3A 3EMKA 4EAQA 1CJMA 2XB8A 5CNMA 2D62A 4DGQA 5I4CA 2AFHE 1X1SA 4M0PA 5DMHA 2HSJA 3C7AA 5LU8A 1DXYA 3PD7A 2C2ZA 3KUUA 2IYWA 3TTTA 3V1KA 2VPTA 2GJKA 5CMLA 5DW0A 4L75A 3OM9A 5J4HA 3HO6A 1GPBA 1O9GA 2QTCA 5HIKA 4X64B 1E4OA 3HHPA 5FOXA 2BTQB 2JJ8A 4PAWA 3RYTC 3GOHA 3TFOA 3PD0A 4PX9A 1QVVA 3Q6MA 1B73A 1J2TA 1ZM9A 3ILXA 2OHVA 1PFQA 4NX2A 4XJVA 3RF6A 1FDTA 5AJUA 4H18A 1PTKA 3NBUA 1GSOA 2C84A 4DRYA 1KERA 1FQOA 5JS2A 5JI2E 2QVXX 1F4PA 2ZJ5A 4U7WA 2CT8A 5AK0A 1R8YA 2I2AA 2XNHA 1JR2A 4TL7A 3TM4A 4D42A 2NXCA 3BGOS