2YQ5A

Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. bulgaricus: nad complexed form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
328
Chain Sequence
TKIAMYNVSPIEVPYIEDWAKKNDVEIKTTDQALTSATVDLAEGCSSVSLKPLGPVDEEVVYQKLSEYGVKCIGLRIVGFNTINFDWTKKLLVTNVPVYSPRAIAEMTVTQAMYLLRKIGEFRYRMDHDHDFTWPSNLISNEIYNLTVGLIGVGHIGSAVAEIFSAMGAKVIAYDVAYNPEFEPFLTYTDFDTVLKEADIVSLHTPLFPSTENMIGEKQLKEMKKSAYLINCARGELVDTGALIKALQDGEIAGAGLDTLAGESSYFGHTGLTDSEIPEDYKTLAKMPNVVITPHSAFYTETSIRNMVQICLTDQLTIAKGGRPRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of D-Isomer Specific 2-Hydroxyacid Dehydrogenase from Lactobacillus Delbrueckii Ssp. Bulgaricus
pubmed doi rcsb
molecule keywords D-ISOMER SPECIFIC 2-HYDROXYACID DEHYDROGENASE
molecule tags Oxidoreductase
source organism Lactobacillus delbrueckii subsp. bulgaricus
total genus 102
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yq5A01
3ONDA 3FBGA 4YT8A 1LRLA 2V6GA 3GRPA 1N9GA 2PGDA 3JV7A 4NBWA 1DAPA 2XF8A 4BVAA 3IUPA 1KC3A 3JQGB 5TQVA 4MINA 2X0RA 3HE3A 4K6FA 2CSUA 4YRAA 1PJ3A 4WEQA 1YO6A 2OMEA 3I4FA 3ZCXA 1VSUA 2ZQYA 2Q2VA 3PP8A 1I33A 4MVJI 4WLVA 1T2DA 1H6DA 2EKQA 3RCBA 5CDUA 1C1DA 1N1EA 1OAAA 3D4NA 3KSDO 3JCZA 5KJEA 3GRKA 1P1JA 2I99A 4E21A 1T25A 3L07A 1YS4A 1ZJYA 1E6WA 3RIHA 1HTBA 1PJBA 3F6YA 4GMGA 4DMMA 1WPQA 3NGXA 3SC4A 3QVSA 1EZ4A 4IDCA 4GLOA 1P33A 1N92A 1TEHA 3KLMX 3IMFA 2XOXA 1IYZA 3V2GA 3BTUA 1ISJA 1JWBB 2RCYA 3KB6A 4HXYA 2FSVA 1NVGA 2GLXA 1U2GA 1KEUA 3CTMA 4D0SA 4CM3A 3KTDA 3ZU5A 3ZV4A 1DPGA 2H5LA 4E3ZA 4XQEA 5LDHA 3DAGA 3JSAA 5MGBA 2O50A 4TVOA 3LQFA 4IIVA 4KTVE 4XR9A 3LYLA 4ZQBA 2WM3A 1E5QA 3WQQA 1R0LA 3PFFA 1I32A 3U4DA 2CDAA 2YZ7A 1M76A 2E49A 4WPGA 5TT0A 3LT2A 5C7OO 4CODB 2D0IA 1FDWA 2OP0A 2EHDA 4H16A 2JHGA 1DFHA 1ZBQA 3PXXA 1R4MA 3VH2A 1PGJA 2VUUA 5KVCA 3U62A 1FDVA 3KEQA 3RUHA 4PLFA 4Y67A 4LW8A 4UVIA 5K6AA 3FR8A 1X1EA 3KUXA 4WE3A 4AL4A 4CV1A 2SCUA 1WP4A 3C8MA 1LLCA 3G17A 5G4LA 5BQFA 1Q2XA 4J0EA 4IJUA 5LDGA 5JAMA 1Z75A 2VTEA 3PQEA 5B37A 1DRWA 5T8KC 2VOEA 3WJ7A 1SBYA 3GDOA 4GH5A 3WGIA 1UAYA 4KWHA 4EEZA 3V8BA 1EVIA 4E2WA 5ITVA 2BMAA 2X86A 4KP7A 4O63O 1W6UA 4IDBA 4DC0A 1H2BA 3UW3A 4BNWA 4DWVA 4BO3A 3JD2A 3D3WA 1C1DB 3NAQA 3DMTA 2X8LA 2EP5A 4DTIA 4J7UA 2W4QA 4GVXA 2HAEA 2QZZA 2RIRA 1X15A 1XR3A 1EFLA 1UP7A 5IZCA 4GSKA 1NFQA 2FR0A 1DSSG 3AM5A 3BMQB 3LC2O 1LNQA 3E5RA 2I3AA 3I9LA 4BNKA 3LVFO 5HTOA 1W0CA 2W2KA 3FNGA 4GLLA 1DRVA 3S2FA 2EF1A 4BKUA 2B0JA 3WSVA 1BWSA 1TI7A 1EQ2A 4AJEA 1A5ZA 3OQ6A 5AXBA 1SOVA 4Z9XA 3ZNQA 1EBFA 5GZ6A 2JFHA 2QYSA 1WXDA 2WTBA 5FF9A 1LLUA 4IQGA 9LDTA 2X23A 1P9LA 1NWHA 1H9BA 3GDFA 1LLDA 3BMNA 5B4TA 3TZ6A 5KWEA 3TZKA 1H2HA 4CQLA 3AM4A 4Y6PA 1G1AA 1R4MB 3ICPA 3OECA 2H6EA 4IZHA 3H9EO 2UUOA 4ND4A 1I01A 1I2CA 1GZ4A 4WLFA 4E5PA 1UXIA 2FR8A 3D64A 1I3LA 3AWDA 3I1JA 2DC1A 3RUEA 3TJRA 2Y68A 1PQUA 4FFLA 4H15A 4MIOA 2BELA 1XU9A 1U1IA 2WYUA 5FEUA 4AJIA 1E0DA 4E6PA 4MVJA 4EUHA 3PTZA 3QVXA 5A1TA 4AJNA 1C0LA 2RBEA 4PLTA 1E3WA 4E2ZA 4NK5A 4RQUA 5JS6A 5JAZA 2NVBA 3PHHA 1PZFA 4E32A 2G17A 5CDSA 2GDZA 3O38A 3ZGYA 4AVYA 4WEOA 2WSBA 4ID9A 1ZO8A 1HSZA 3ZHZA 3TNLA 2VHYA 1DXYA 1QYXA 4M49A 3QWFA 3HDYA 4MVJE 4UVGA 3B6ZA 1ONPA 4U8GA 1I3KA 3NTOA 3UH1A 1DLJA 4FC7A 3GUCA 4MVJP 2W2KB 3A28A 2CUKA 2VT2A 4K26A 4BB5A 3WSWA 2NUAA 4MIYA 3TL3A 1VI2A 1OMOA 1E3JA 4XX0A 4ROSA 5L9AA 3VH1A 3DBHA 3H3JA 2B83A 1VM6A 4CMEC 4YAEA 3QHAA 2FN7A 4AJHA 4AICA 1M75A 3GHYA 2X22A 3KVOA 5U4QA 4F6LA 5TRTA 4PN3A 3JYOA 5L3ZA 3FTNA 2QRLA 1E7WA 5CEJA 4W9NC 4ZQEA 5DNAA 3VPXA 4M1QA 1J0XO 2AG5A 1NQ5A 3FPCA 2EW2A 3SLGA 4A7PA 1U4SA 3GF4A 1GYRA 1U3WA 5COBA 4DQUA 4UUNA 2GERA 1DLIA 2C7VA 3ZWAA 2W90A 2DBVO 1JVSA 3JYNA 1Q1NA 3UN1A 4CMIA 1TB4A 3GH3A 1W73A 2ET6A 4MJLA 5IJZA 1NTOA 4BNFA 5EERA 5AXAA 3NUGA 1NYTA 3WMXA 2CVZA 4IDFA 4ND3A 4A27A 4J49A 4CLDA 3E18A 1HL3A 3DXFA 4TRNA 4BNVA 3RAJA 4NBUA 2FMUA 2V6MA 3G1UA 3AFMA 5KJFA 1QORA 1T1RA 1X7GA 5KVQA 1R66A 4D45A 4W6ZA 3UFXA 8LDHA 1QRRA 1QXSA 1ZMOA 2J3IA 3F47A 5JDCA 3TQHA 3BHIA 3R3JA 4OOFA 4ZU3A 1O9BA 2B5VA 3JQAA 1MFPA 2GZ1A 3TOXA 1F8GA 1QKIA 3L4BA 3CPSA 3LF1A 1B16A 4RV9A 4S3MA 3LSYA 4ZQGA 3CH6A 3ZV3A 1RKXA 1PS0A 5CPFA 5G4KA 1HLDA 2ZATA 4YEDA 1SB9A 3MEQA 4RORA 1EUCA 4JBGA 4W4TA 3VH3A 1PJSA 1PGNA 1PWXA 1XQ1A 3L0DA 4R68A 3WLFA 2X0JA 5IZ4A 2VN8A 5BT9A 3VPFA 1B0AA 4BO2A 5A02A 3WGOA 2QYTA 3STHA 1LA2A 3HFGA 4Q3EA 2OP1A 4GVLA 2PD4A 1XU7A 3EK2A 3QIVA 4BNHA 3LDHA 3GQVA 2CY0A 1T26A 2BFOA 3ZW8A 4HNHA 4D41A 3VKUA 1GFSA 1AXEA 4ILKA 1NPTO 3D5TA 4BO7A 4WKGA 4J7XA 4J4BA 1PGPA 2JAHA 3IUSA 2D5AA 4CR7A 1X0XA 1X13A 2A9FA 4PLHA 5EIOA 3ZWYA 4ZJUA 1R0SA 4KUGA 5A04A 1QYDA 4UREA 1OI7A 2PH3A 1NR1A 4ZRNA 2C5AA 5KKAA 2GUGA 1VC2A 4E31A 4HADA 1P77A 3F1LA 4LVCA 1KERA 3E1KA 3WOHA 2FPIA 3HG7A 2I6TA 1RM5A 4JP3A 1XYGA 2AEMA 4YAGA 4YAJA 4L73A 1H0KA 2JJYA 1LC3A 4GI2A 5JNLA 1WW8A 1PJ4A 1GQ2A 2JFGA 2AQ8A 4TMFA 5DP2A 5L45A 4JJIA 3PGJA 4MO2A 3TSCA 2Q50A 4O1MA 2DTEA 4I1IA 1BRMA 3AI1A 1ZIDA 1EUZA 4QECA 4RPHA 1LSSA 5IDYA 2Y1FA 1P1KA 3GFBA 1K89A 4EUEA 4PZCA 3SBOA 3ABIA 4BNIA 4TRMA 4BO0A 1HZZA 2UV8A 1LRJA 2CVOA 4NBRA 4CM9D 5JO0A 4CM8B 1E1LA 1Y81A 1SB8A 1GUFA 1H9AA 2RAFA 1G6KA 3O9ZA 1EVYA 2EG9A 3C7DB 3GN1A 4K28A 5EESA 4OIMA 5IAAA 3W8FA 4AJPA 3KM0A 3A4VA 5EL0A 1NVMB 4PG5A 4U6SA 2ZYGA 5HS4A 1FK8A 3TZCA 2PFGA 3Q9UA 4LVUA 3JQFC 4IQ8A 4PG7A 4LSWA 2Y99A 3PWZA 4IZIA 3RJ5A 1K5HA 1UR5A 2WYWA 2PLAA 4Z3DA 1MGOA 4XB2A 4L4RA 5U1PA 2DQ4A 1HDYA 2RH4A 3F9IA 3T7CA 5BNFA 4URFA 5KIAA 2OO5A 4N5LA 4EYEA 4YACA 5DN9A 1XCBA 5DDIP 5TSDA 1J49A 3RBVA 4WLEA 4DBVO 4L4XA 2EKLA 1WMBA 2J5KA 5MDHA 4D44A 1T2EA 1XGKA 3HDHA 4ZA2A 2P4QA 1E1KA 2HKIA 2ZK7A 4BNUA 2AEJA 3IDSA 4AJ4A 1ZK4A 3HB5X 2GASA 2O7SA 2VT3A 4CMHA 4BGVA 4MVJF 1M67A 1ENYA 3HB4X 2F1KA 3DAPA 2IXAA 1A71A 4JIGA 4NJOA 1ORRA 2AMFA 1I3NA 4GX1A 3FPLA 4XRGA 3AUAA 2X6TA 1NHWA 1HZJA 5TX7A 3OFSA 3L6EA 3FCOA 3C85A 3R0IA 5COQA 4C7KA 1I3MA 4TWRA 3HFSA 2Z1NA 3FN4A 3VZSA 4FFRA 3OSUA 3I9OA 2BI8A 4GPD1 4HUJA 3ROMA 5JC8A 3B1JA 1Z73A 5DULA 4NJMB 1NR7A 5F1KA 4J1NA 2C59A 1BDMA 1PJTA 1NFRA 4U0JA 1MC5A 3WWYA 1PGOA 2GN9A 2Q4EA 4BGEA 4E30A 5I7SA 3VTZA 4I8XA 2YYYA 1LQTA 5DCYA 4IMRA 2O7QA 3OIFA 2XXBA 2POQX 4OXNA 1KS9A 1MP0A 4GKBA 4KDFA 3AOGA 1SCUA 4J90A 2NTJA 4DIFA 2R00A 4L8VA 1OBFO 4DIOA 4CMKA 1MX3A 1V0JA 3SX2A 4ZD6A 1SEPA 2ZTUA 4R3WA 5FI5A 1IULA 1H94A 1YQGA 3QSGA 1PL8A 1TA4A 5JE8A 1DB3A 4MKXA 5F1PA 1GYQA 4D79A 4RJTA 3JQ9C 2DVMA 4PLZA 4YA6A 3W4KA 2RH8A 2Y1EA 1RM3A 4ALJA 3CEAA 4FW8A 3GMDA 4I5DA 4ND1A 4XDYA 1QYVA 2I67A 3NJ8A 3U0BA 3UCFA 2Q2WA 4IBOA 3EY4A 1E3IA 2WD7A 5F5LA 3VPGA 5A06A 3K8ZA 4IJWA 3V2UA 2A94A 4WNIA 3LLVA 3WB9A 4WUVA 2ZTVA 4OSPA 3PWSA 2O4CA 1KEPA 3ULKA 4LRTB 4D46A 3AOEA 4JROA 3H9JA 4LMPA 4F3YA 2PWZA 5U9CA 4BGIA 4DQVA 4WCFB 1DIHA 4MOWA 1HSOA 1YL6A 4AJ2A 5AXCA 1MV8A 3KBOA 2VQ3A 4BKPA 4NMHA 1UP6A 5H82A 2IZZA 4G5HA 3GPDG 4Y9DA 2C7GA 3D0OA 3RBXA 3PYXA 3BZUA 4PLVA 1YOVA 3GG2A 1UZMA 5JO9A 1X1TA 4G81A 5L7WA 6LDHA 3RFXA 4DQXA 2WYVA 2B35A 1ZK1A 2BFPA 1PR3A 1Q7CA 3JD4A 4YJDA 2J3KA 4ZQFA 1IZ9A 4UEJA 2VCYA 5G0SA 2EIHA 3ZWOA 1F8FA 3MCVA 2ZCUA 2ZKLA 5L7TA 1H6CA 4O0LA 2GYYA 1Y8RA 3PHLA 4YJGB 5A05A 4NI5A 2PD3A 4JBHA 2VNSA 2VRCA 2HO5A 3WIEA 3H6KA 1AN9A 3ZHYA 3KRTA 1E7RA 1ZXLA 5F21A 3EAGA 3GVCA 1JWAB 1P44A 3JQ6A 5JDIA 1EDZA 4YBZA 1T4DA 4KUEA 3B1FA 3OMLA 5EQFA 1CQIA 2TMDA 3GGOA 3OA2A 4N54A 3TDKA 3DO5A 1U7HA 3DZFA 1F06A 4JX8A 1VKNA 4R9SA 2WE7A 3U49A 1X0VA 1BXGB 3QWIA 2VTDA 1IOLA 4NFYA 3NDIA 5ES3A 3TF5A 1Y8QA 4CL8A 1B14A 1TT5A 3U3XA 5HWSA 4EJ0A 4QSMA 5EJ2A 1VJ1A 1MXFA 3QV1A 1NNUA 2W2LA 2DBQA 4BO4A 2CDCA 2HMWA 1GCOA 2DAPA 3VOSA 2Q49A 2Q2QA 4YCAA 2YDXA 4XEHA 1HYGA 4PLYA 1QG6A 1I24A 4FGSA 3WBFA 1KVTA 4BNMA 5DBFA 1XG5A 2CFCA 4CMGA 5KJCA 2JD0A 4Q3NA 1I2BA 2HLPA 3IJPA 4FOOA 4NZ9A 5IXSA 4NG5A 1EE2A 3I9NA 4W82A 2WD8A 5GZ1A 3OIGA 1JKIA 2YW9A 1FF9A 4BMVA 4MVJD 4P22A 1Y9AA 1T2CA 1PR9A 1DO8A 3MWDB 4NHEA 2VHVA 3OETA 4J1QA 2R2GA 4DYDA 3MWEB 3ZWXA 1ISFA 3UUWA 2CDBA 1Y8RB 4BL5A 3DZIA 5ILOA 4NFSA 1X7HA 3FF4A 1ZMTA 4A0SA 3RUIA 4HFNA 1HDZA 2JAPA 3E9MA 4DA9A 2IYPA 5B12A 1ADFA 1E7SA 1KVRA 3MOIA 3UXYA 1TXGA 3E48A 1UXHA 4GL4A 3TRIA 2IZ0A 2Y0CA 3W4JA 3N74A 3PHJA 1KY4A 4FD3A 2I5PO 3CSDA 1NP3A 3H65A 3KYDB 3Q2KA 3RI3A 1UP4A 4U5QA 3ETEA 3C24A 3ORFA 2NSDA 3LLSA 4DUPA 1JA9A 3HWRA 4RVHA 1IB6A 1KEWA 2NU8A 1C3VA 3BAZA 4DVJA 3UAGA 1A9ZA 3F5QA 3WQRA 1C14A 1FXSA 2VWHA 2B4RO 4FFOA 3WFIA 1SAYA 2I76A 2AEFA 3SJUA 4YT2A 2YQ4A 1M6HA 3H5RA 5JBIA 1UAGA 1LBEA 4LCEA 5TIIA 2OOSA 2NQ8A 5H81A 4N5NA 1ADGA 2ZQZA 5JMPA 3IIEA 5JCXA 1RJWA 4EBFA 1BGVA 5T6BA 2IRWA 2OFPA 3K30A 4XJTA 3OQBA 3W8EA 4GX2A 4NNJA 3WTCA 4NFHA 2DLDA 3GT0A 3QJ5A 1E92A 2IODA 1JTVA 3DEYX 1RPNA 4NIMA 3K73O 4OXYA 2CF6A 3HN2A 2UYYA 1N9GB 3OA0A 2YHUA 3WIDA 5ER9A 2OHXA 3OHSX 1NPDA 3ROPA 3QWBA 4WCDA 3WR5A 2VWPA 3EUWA 4DLLA 2FPPA 1N7HA 1HDGO 3H5AA 1QV7A 4JLWA 5IDXA 1D8AA 1HF3A 3RUAA 4G65A 1U7TA 2GNAA 4F46A 3N58A 1G0NA 2GN8A 3RD5A 1NBOA 1XIVA 3M1LA 3G0OA 4E13A 3BMCA 2XXJA 1J4AA 4UUMA 3WGQA 5A9SA 1R6DA 3RSHA 4LSMA 5TGDA 3HUDA 3CMCO 4IDGA 4WLUA 4I9UA 4IY1A 5ICMA 5A3VA 3ZWNA 2G5CA 3EVNA 3JD1A 3QWAA 4M55A 1YE3A 4CR8A 3RKRA 3DQPA 5FWNA 3C7CB 2Y0DA 4OAQA 3D7LA 1P1HA 3L77A 3H3FA 3HSKA 5G2OA 1A72A 1A7KA 1R12A 1CF2O 2PH5A 1LSOA 3ASVA 4O6VA 2B4TO 1P3DA 3NKLA 1XSEA 3Q6IA 1ZNQO 2X9GA 1PTJA 4GKVA 2Q45A 2PR2A 3GZ4A 4Z0HO 3HHPA 4BO5A 1GADO 4BNXA 5ICSA 4Q3AA 4IJKA 3ICCA 1HXHA 3ZN2A 4CV0A 2ZJ0A 4KTTE 4OQYA 5EINA 4BIIA 2DKNA 2NADA 5IDQA 1MXHA 1TLTA 3JQBC 5KNLA 4IGFA 1KYQA 3WGYA 1PZEA 4GWKA 3GR6A 1GEEA 4RZIA 3NT5A 5THQA 5KCZA 2DBRA 4IS2A 2VZ9A 1QYCA 3KEOA 2QX7A 1D3AA 1NWCA 2GO1A 1D4FA 4RPGA 4XGIA 2X1HA 1C1XA 3LK7A 4OKNA 1GU7A 5BSHA 1SMKA 2V65A 3OH8A 3K2EA 1QR6A 3D3WB 3L9XA 1N8KA 3JD3A 3LT0A 4ZVVA 4CM1A 3EDMA 2H1SA 1GPDG 2JD1A 1DIBA 5DP1A 1L1FA 1H6BA 2VYVA 1YQXA 3PEFA 4CJXA 1BDBA 2W8ZA 5C7IO 3QE3A 1P45A 3O4RA 1R0KA 5JCJA 3DZBA 4BQPA 1AGNA 1RYDA 3QVOA 5ENDA 4CM6A 1KVSA 5L51A 4U6QA 5GY7A 2B5WA 1HT0A 2BRUA 1LXCA 2FR1A 2HMVA 2VUTA 1Y5RA 4CUKA 3B70A 3VHRA 1NFFA 1QYWA 4CMCA 2AE1A 2HRBA 3RWBA 4D42A 4OSOA 4BNGA 1DFIA 3WICA 4BOYA 1EE9A 3QLJA 1Y1PA 3DDNA 3GNSA 5JY6A 1UH5A 2ZIZA 2EGGA 1T2FA 3BMNB 1QMGA 4QO8A 1CDOA 4M8SA 5IG2A 2NU9A 3G49A 4WCFC 1GPJA 2EKPA 1B3BA 4CQLB 4QEDA 3DHNA 3KLPX 4FB5A 3AI2A 1U2DA 3HQ4O 2VZ0A 1YH3A 3K9QO 4JQCA 3ADOA 1ARZA 1C0IA 2Q1SA 1B3RA 1D1SA 4XRRA 2E4AA 3BHMA 4JN6B 4L0QA 1LU9A 4J7CA 2QZ9A 3I6IA 4XYMA 4CQMA 2DPGA 5C3MA 3Q11A 4RF3A 4Q3CA 1ONNA 3QA9A 4DGSA 1LQUA 1A9YA 1E3WB 2YDYA 4CLOA 3LT4A 4XQ9A 1P1FA 4NK4A 1CQJA 1GQQA 1BMDA 2OZPA 1JQBA 2AE2A 1MG5A 2C0CA 5J23A 1CEQA 3TWOA 4AFNA 5LC1A 3DOOA 2CZCA 1XQ6A 2P4HX 3I83A 3QQPA 4P4NA 4WNCA 3P5SA 3I9JA 5CDYA 3PHIA 4XYBA 2OXIA 4PFJA 1I2ZA 2J6IA 3MTJA 1I36A 3KO8A 1WAMA 3ON5A 3TFQA 1CIVA 2HUNA 2PKQP 3FNFA 1GV0A 3OM9A 4RZHA 1W8DA 4ALKA 5F3RA 2PZMA 1EEHA 3DBHB 4HBGA 4D43A 4BHTA 1HE2A 5L7YA 1L7DA 1GQYA 1P1IA 3R1IA 3WTBA 4DREA 3JTMA 4XGKA 2E82A 2P2SA 5JY1A 1FDSA 4DYVA 1DIRA 5CDGA 5KJ6A 4Q3DA 3IP1A 3WGHA 4BB6A 1LSUA 1PSDA 2CD9A 1KY5A 3E9NA 1R16A 3WDSA 3ZW9A 2QIOA 1R4NA 2GF2A 2HK8A 2PA3A 4QT0A 3IKTA 4CMIB 4E5KA 1LTHR 1U5CA 4CQMB 4UEOA 4W99A 1Q0QA 5ADHA 4WLOA 1CJCA 5TNXA 4RDIA 4FFNA 4NDNE 3UCEA 4XD2A 3WMWA 1IUKA 3EHEA 1FJHA 4GX5A 1L7EA 2EV9A 4XDZA 3C1AA 4IS3A 3UHAA 2QRJA 4DIBA 5ER6A 2FWMX 4EW6A 4IUYA 4IDEA 5JC1A 1CYDA 3H2ZA 4RF4A 1PWZA 4QFDA 3MJSA 3NJ4A 2AG8A 4TKMA 1KVQA 1Z7BA 4N18A 4L76A 1LDBA 4L9RA 2VHZA 4ALIA 3DHEA 1DRUA 3I9MA 3MJTA 1KC1A 3JQAB 4JCOA 3OICA 1LI4A 4M89A 1HDXA 1MLDA 2B37A 4KQXA 1IPEA 4R51A 3OBBA 4N7RA 3P19A 5T8KA 1BXKA 1PU2A 4YQZA 1PGQA 4RPLA 5AXDA 1V8BA 1PQWA 5G4KB 2PY6A 4FFMA 1H5QA 1LDMA 3TN7A 1YB1A 1K3TA 4A73A 3M1AA 4FGWA 5KKCA 4R5MA 4FJ0A 3SVTA 4OYRA 3ZWVA 2QHXA 1EK5A 2LDXA 3RU9A 2VWGA 5H83A 2PTGA 1M2WA 1Q0LA 2AQIA 4PCVA 2GRAA 4XGNA 2FP4A 1JLLA 1DEHA 1DC5A 2P5YA 3C1TA 3VTFA 1WDMA 1IHYA 3GVHA 3H9GA 4IMPA 3W8DA 3DFZA 1P0FA 4MP3A 3OJFA 5EN4A 3VPHA 3RUFA 2GR9A 4FCCA 1LJ8A 4M86A 2O3JA 2BKAA 2QRKA 4TVBA 3Q2IA 5JAQA 2VRCD 5COAA 1WDKA 2BGKA 3PGXA 2E6UX 5C37A 3NX4A 1ADCA 5DBGA 5L4NA 4YT5A 4CR6A 1HETA 3M2TA 1B8PA 4PG4A 4Z0PA 3TFOA 1AHHA 4EI2A 4OHUA 1WWKA 4RPKA 5T67A 4A2CA 1VE9A 3C1OA 3BTOA 3I23A 2BFMA 2O3SA 3P7MA 1GUZA 4IDAA 4YYZA 4J16A 3PJFA 3PFWO 1HE4A 4CUJA 4FDAA 4B4OA 3QVTA 1KETA 3LC1O 1HDRA 5FI3A 3HADA 1GV1A 2W2LD 1DOHA 3KYCA 4YRDA 4BMNA 3E8XA 3UCXA 1O6ZA 2NVUA 4RO0A 1VJTA 1E3LA 4FQ8A 4LMRA 1ZK0A 4DPLA 3WX0A 1HKUA 1ZJZA 2HQ1A 4J4TA 4DBZA 4CLRA 2X5JO 2X58A 1E5LA 1Q7GA 2DUUA 4B7UA 5BSGA 5GZ3A 5CG1A 2JCYA 2X9NA 3GY0A 1VKOA 4EGFA 2D3TA 3LT1A 4HFMA 1S6YA 2OGUA 3PJGA 3AY7A 2ZCVA 1GR0A 1ENPA 4HFJA 4OH1A 5TC4A 1HYEA 1OC4A 4QFCA 1HWYA 4B7CA 1O8CA 3BMOA 1EFKA 3GZNA 4OQZA 1U5AA 2JL1A 1GZ6A 4JNKA 2VYND 2FPGA 1U28A 3LF2A 1DC3A 1UJMA 5IN4A 1DHRA 3JYQA 2H9IA 5TJHA 3ZU3A 5K6AC 4Z6KA 4L4SA 7ADHA 3EW7A 3DBVO 4CMEA 3DTYA 4QX6A 1QP8A 2NU7A 3OIDA 2HRZA 2JCVA 3ZWCA 3DOJA 5BSFA 4BMSA 1LC0A 4W9NA 4L75A 1T4BA 3HNPA 4HFRA 1NQTA 3LZ6A 4KWIA 2PK3A 5A4DA 1B8UA 2CNBA 1XKQA 3R3SA 4GSLA 4IGEA 4YPOA 4WOJA 1YB4A 1IL0A 4R16A 1ZZEA 1GY8A 3DMTC 4CMJA 4FSHA 5ENVA 4J3FA 3RC1A 2ZB8A 4TRRA 3ZZNA 1YJQA 3WYEA 5G0VA 2V6FA 7MDHA 2HK7A 4XKJA 5IZCC 1EK6A 2OUIA 2EJVA 4JXKA 2NVUB 3WJAA 1YQDA 3FD8A 4CLEA 4OO3A 1DC6A 2Z95A 4R5HA 3JQCA 3NV9A 4UEKA 4CLRB 1B2LA 4O59O 4M87A 3NT4A 5DF1A 5EQDA 3ETGA 3NTRA 4R1UA 3O26A 5DCUA 4OGWA 2HMTA 3KHUA 3BTSA 3PYLA 1V35A 3W1VA 3WGGA 1YJ8A 3RC7A 3I9KA 3DZGA 5HS6A 4CUZA 2P9CA 3S8MA 1ISIA 3ITKA 4J4HA 5BSEA 4LN1A 3GVXA 1Z6ZA 4PRLA 5KJ1A 1NHGA 2Y1GA 3CE6A 1EVJA 1I5RA 2C29D 1KEVA 3GDGA 4R1SA 2O48X 1T1SA 3K2BA 4AJOA 4QQRA 2J8ZA 1DJQA 3ZNNA 1N2SA 3W4IA 4NH4A 3V2HA 4GWGA 1HYHA 4WECA 5I9NA 4J91A 4B8WA 4D7AA 4BO8A 2O2SA 4XCVA 2EGHA 5LCXA 1TVEA 4MDHA 3GLQA 3BTVA 1O5IA 1E77A 1W4ZA 2IE0A 3PYMA 4CLXA 5I7EA 2R6JA 2C20A 1EMDA 2UVDA 4ZRMA 2Y67A 4EZBA 5A5EA 4YVFA 2X9VA 4ZICA 4CM9A 1I10A 3INTA 3SJ7A 4GQAA 2HJRA 1ISMA 2I3GA 1ZUD1 1J5PA 1N5DA 1U8XX 2W98A 4BO6A 1DDOA 4IQ0A 3VH4A 1BW9A 4BV9A 4F6CA 1OZAA 3GGGA 5G0UA 2XPCA 2J3HA 4I9HA 3RQSA 4A5OA 3OJOA 5IDWA 4LISA 3AUSA 4XYLA 5I8WA 2DM6A 3AFNA 4HWKA 3ETDA 4E4YA 3E5MA 2EERA 2E48A 2FY8A 4KQWA 3DZJA 2WD7B 3F1KA 3PIIA 5A9RA 4IINA 1XWFA 4J6FA 5DCWA 5JLAA 3AW9A 5L95A 3P2YA 2VOJA 4RDHA 2Y05A 2AQHA 2Q4BA 3EZLA 1ZVMA 5TS3A 3GN2A 1DBVO 4R3NA 5JXWA 3RC2A 3LU1A 5I7FA 5HA5A 4FFPA 4MKZA 3BYZA 4PLPA 4CMAA 1VSVA 3KYBA 3DL2A 4B4WA 2P68A 1IPFA 3SLKA 4J2OA 1UUFA 2O23A 4IIUA 3FNEA 2VHWA 2EEZA 3WGTA 4MP8A 1YOVB 3IL2A 5JW6A 2I65A 2FSSA 3U09A 1U4OA 1B15A 5CPBA 4P4LA 3JYPA 2GZ2A 3RASA 4XJSA 4MPDA 2GPTA 4II2A 3DOCA 4OXKA 3U4CA 1F12A 4I08A 3UKOA 1HEUA 1YONA 3HN7A 3SC6A 4YR9A 4RVGA 3OP4A 3ENKA 3GFGA 4Q39A 4JJFA 3ZNPA 5CFZA 3KV3O 4XQCA 2YFHA 3GAFA 2VHXA 1OOEA 4CV3A 4TSKA 5T64A 4PZDA 4RPJA 1C0KA 1J6UA 1B7GO 5A3JA 1YBVA 1U3VA 3F46A 1WLYA 2VYVD 4I5EA 1PQPA 4ND5A 2NM0A 3OEWA 1UZNA 5IF3A 1NX6A 1GZ3A 1HRDA 1T24A 1YXMA 2E37A 5JDCC 3QVWA 3RFTA 3FTPA 3V5NA 5JCJD 1Z74A 3PZBA 3JQFA 4TRJA 2LDBA 3WXBA 2O3UA 3L4BC 3M2PA 1ONOA 1Q7BA 3S55A 1A27A 3I6QA 2DU8A 1ZEMA 3V1YA 1Y8QB 2D59A 2DFDA 1TT5B 3PLNA 3WG9A 4D0RA 4AJJA 2OBNA 1A4IA 3E9QA 3GNTA 1Y7TA 1LSJA 1HDOA 1PS9A 3CINA 4UAGA 1BHSA 4YTEA 3GGPA 1I30A 1F0YA 3DBRA 4TQGA 3GVPA 3PJDA 3L6DA 5L53A 1XELA 2VUSA 3UF0A 2JFFA 4OKIA 1HE5A 1ADBA 3FI9A 3IC5A 3PLRA 4YB8A 5DOVA 5AOVA 4DC1A 3BXXA 2WJPA 4GGPA 4J9UE 2BHLA 3BMQA 4WJZA 1KVUA 1LUAA 3RC9A 2AXQA 1ZW1A 1NQAO 4B8ZA 2CF5A 2D4AA 4CQMD 1IY8A 1U3UA 3GNQA 1WMAA 2B4QA 3FBTA 3QW2A 4IPTA 2FZEA 3S2GA 2B69A 2ZTLA 4CMBA 1Y6JA 3GEGA 3EYWA 4DXHA 5G0WA 3RFVA 4EJ6A 5T5QA 5L4SA 4B79A 1PZHA 3NGLA 1MUUA 2X4GA 4RF5A 2DPHA 4Y6RA 2C2XA 5DBIA 1SNYA 2JKVA 1E6EA 2NLOA 3ANMA 1SO8A 2JHFA 3NDJA 2Y93A 3S1LA 4BGUA 4JBIA 1ZH8A 4RLHA 3DFUA 3IJRA 3JQAD 1NXQA 1ENZA 1VLLA 4D3DA 1GTMA 1RYEA 2V7PA 3PDUA 2C2YA 3H9QA 3KXDA 4OMUA 3RVDA 1GEGA 5A5FA 2GZ3A 4GX0A 1P0CA 2UDPA 3L4SO 4Y98A 4EDFA 1FDUA 1V3UA 4P4GA 4E2XA 4WLNA 3RU7A 2ZJ1A 4RGBA 1GYPA 1M6WA 2DBZA 5C5IA 1E7YA 1D1TA 5B1YA 4FC6A 4UVEA 4KZPA 2EJWA 3JD0A 4NBVA 4BNLA 5TF4A 4PRKA 5IXYA 3B1KA 3DBRB 3FSRA 3OEYA 3DWFA 5JYDA 4B3HA 1Z82A 2NTVA 1DC4A 1V9LA 1BVRA 1E1MA 1GAEO 1JDJA 3JQ9A 3VZPA 3ZWMA 4MVJG 2H63A 2YY7A 5DZSA 4DLBA 2YHIA 2Q99A 3DZKA 3F5SA 2FRDA 2CMDA 2PV7A 4FOSA 3FR7A 4P38A 2X5KO 4BNJA 2Q1WA 1A7AA 4FS3A 2VRBA 1LLQA 2RHRA 1O95A 3O8QA 4IM7A 4CM5A 4RF2A 1N1GA 3NYWA 4Y8VA 4MKRA 1HLPA 5I9MA 5TJ9A 2HCTA 4BO9A 4BUCA 3VDQA 2BGLA 3GPIA 3GC6A 3WQSB 1X14A 1GL3A 1Z45A 4I5GA 4PLWA 5BNTA 4XA8A 4C4OA 2PZLA 4LCJA 5KOIA 3CMMA 3Q1LA 3HJAA 4K9DA 1M66A 2J3JA 2FZWA 4J1SA 2YV3A 3PJEA 4HY3A 4A26A 3ONFA 3DBLA 1PJLA 3QRWA 4B4VA 4D3SA 1GCUA 2C5EA 3JQ7A 4J43A 4FJ2A 1CERA 4HP8A 4KDEA 3DAFA 3T4EA 5CDTA 3R6DA 1BSVA 3MZ0A 3PHGA 2ZYDA 4YQYA 4BNTA 1CRWG 4XB1A 4XIYA 3ZI0A 3OJEA 3ZWWA 4YAIA 3BMCB 1LDEA 2YQ5A 3NEPX 5AQ1A 1E1NA 5A9SB 1NAHA 1P31A 2Y1DA 4BKRA 3H7AA 2GCGA 3X2EA 1MB4A 3RBZA 4DMLA 3DB2A 1I0ZA 2Y0EA 3EGOA 3ONEA 1IHXA 2DUWA 2WE8A 1EVZA 3G79A 5CHEA 4R9RA 4XQGA 3FRJA 4CM4A 1LDYA 4OJNA 5EMHA 3I3OA 3ROQA 4NQZA 2TMGA 1BTOA 4JJGA 4NU5A 1G0OA 1CETA 1JVBA 2G82A 4W7IA 4C7JA 2YHIB 3PI7A 5L4LA 1PEDA 3WNVA 2C54A 1ZSVA 4B3JA 3PZRA 1K0UA 1PZGA 4HV4A 3ZU4A 2HJSA 2NV6A 2QW8A 3O8QB 2WDZA 3L9WA 5T57A 4YRBA 4YJHA 3AK4A 2BI7A 2VWQA 1KOLA 4BQRA 1E7MA 2V6BA 3CUKA 1YGYA 3TZHA 4ESOA 1YBMA 1PL6A 1O0SA 1Y5MA 4Z9FA 3GMSA 1UXJA 3HDJA 3X2FA 3PRJA 3HZZA 5CP8A 3KETA 5FFFA 1AXGA 3O03A 4N5MA 2R00C 4BKQA 3EC7A 1H93A 1C1XB 2NTNA 2I66A 3DBLB 1FMCA 4Q9NA 3PK0A 4OOEA 1P74A 5K9ZA 3UVEA 4RLSA 3JQ7B 3C3XA 4XIJA 3T7EA 2BGMA 1I8TA 1SZJG 4CM7A 3D4PA 5FYDA 3HDQA 4YDRA 1RM0A 3MTGA 3PVZA 4BO1A 2PZKA 3NTQA 4GGOA 4F45A 3FNHA 4QO7A 2XAAA 3ZWPA 3I52A 1EDOA 4IXWA 3ZH2A 5KVVA 3JYLA 2C07A 4WK6A 3WBBA 4B7XA 4TZKA 3AY3A 3DZHA 5IN5A 3TL2A 1PJQA 1Y9EA 4RQTA 4EJMA 3MJ4A 2JD2A 3GEMA 1ZSYA 3V1UA 2D2IA 3FHLA 3IP3A 4CM4B 3H2SA 3U4HA 3F4BA 1OC2A 5CEEA 3Q3CA 1K6XA 1OFGA 3WWZA 3AOEC 5BR7A 2EWMA 1ENOA 5JFOA 3AUUA 4PGFA 1BVUA 1ZFNA 1XA0A 2F00A 3E6AA 4I5FA 3S2IA 1YVEI 1FDTA 5C7LO 4DPMA 2ZYAA 1KIFA 1EQUA 3QY9A 4J0FA 4YJFA 2O3RA 2O4UX 5K0ZA 2VNAA 1ULSA 1XDWA 4E12A 4ALMA 4YJHB 1E6UA 3U4IA 5F5NA 4K6CA 1LEHA 1GD1O 4ND2A 4UVDA 4G2NA 4ITUA 2OBYA 1PJ2A 3A1NA 1QLJA 4I9NA 5CG2A 2ZTMA 3WYBA 3OQ1A 3ST7A 4FBGA 2YJZA 4BV8A 3ZHXA 1LX6A 1ZK3A 3DR3A 1B26A 3ZV6A 4CM8A 4E5MA 2P9GA 3U5TA 1F17A 1WNTA 4PZEA 1NASA 4CLOB 3BHJA 4FJ1A 2EW8A 2PGJA 3K31A 1MA0A 4QUKA 3GHHA 1JAXA 1ZKMA 1AUPA 3PWKA 1VPDA 1CWUA 2Q1TA 5B4VA 4ONEA 2QQ5A 4GAEA 1ISHA 2A35A 3VPSA 1ID1A 2O3TA 3VVCA 4BNNA 1O89A 1DIAA 3GG9A 1EUDA 1MFZA 2ZB7A 4D3FA 5JDIC 3NRCA 1Q0HA 3N7UA 3MJVA 1WVGA 2WMDA 4TZTA 2GN6A 3ZNOA 4XYEA 4ALNA 1V3VA 3AI3A 4WASA 1GUYA 3Q0EA 4R4JA 3OJLA 3K6JA 2NVWA 3GVIA 2QG4A 3COSA 4EEXA 4H3VA 3UOGA 2DTXA 1JKJA 2WEKA 2C82A 3WNQA 2HMUA 4J9VA 2GD1O 4HNGA 4W7HA 5HBRA 1YB5A 4NU6A 1LRKA 9LDBA 3IKVA 4J1TA 4PLGA 1H6AA 3C7AA 3B20A 2FHSA 1T2AA 4PVDA 4RL6A 4NPCA 4Z3KA 4GBJA 2G76A 2NACA 4KOAA 5CAEA 4RCVA 4OM8A 1BXZA 2D1YA 1SC6A 3I5MA 3ZV5A 4YJFB 3L6OO 2RHCA 1WZEA 2BFAA 4BNZA 1YRLA 4R1TA 2A92A 1R4NB 3ANLA 5JPIA 1YWGO 5AYVA 2P91A 1PJCA 4R69A 1XLTA 1HDCA 3FWNA 3ROKA 2IEDA 4FR5A 3WGZA 2YFQA 5A9TA 3RROA 3K92A 2IXBA 4E33A 4Q3BA 1JN0A 3OF2A 2X5OA 1ZXBA 1YL5A 2IYOA 2Y1CA 2UAGA 1R37A 5A03A 1E3EA 2HMSA 2IDZA 4XR4A 3DONA 3MJEA 4E0BA 4NJMA 3RJ9A 2AHRA 3D5QA 1PL7A 4BKOA 2HDHA 4A10A 2O3QA 3ENNA 3F3SA 4BNYA 3EZYA 2G1UA 4WOKA 3JQBA 3G3EA 3JQDA 1AE1A 1UXKA 1XHLA 2BD0A 1EBUA 5GMOA 3W6UA 2ILTA 3NDRA 1U9JA 2NWQA 3E82A 2GN4A 4NBTA 3S2EA 1MC4A 4MVJH 4Z9YA 3I4CA 4IDDA 3CXRA 3E03A 4UUOA 4E5NA 1V3TA 3G1TA 2JCXA 4MVJM 4KMSA 2I9PA 4S1VA 3DHYA 3DTTA 1VL6A 1GDHA 3VVBA 4R54A 3SEFA 3PQFA 2NQTA 4YWJA 3PDJA 4XWYA 1AHIA 3KOUA 1U8FO 4PG8A 3IAHA 1NM5A 3VC7A 3GUYA 3RUDA 4INAA 4B4UA 1K6IA 3GK3A 2HU2A 4TKLA 2ZB3A 3GEDA 4HKTA 2FOIA 3PIDA 2YV2A 3IQDB 3VDRA 1IZ0A 3K5PA 5F1OA 2P5UA 4E2YA 2J5RA 3P2OA 2HK9A 1PS8A 3QWHA 4ZHSA 3SXPA 4AG3A 3INGA 4AJ1A 1ZEJA 3LC7O 3JQEA 3U9LA 3VAZA 3ZHBA 5JAIA 3ANNA 1JKFA 3JQ8A 4XZ3A 5TLSA 2OORA 5I9LA 1ZK2A 3MOGA 1YDWA 1S7CA 4GMFA 4WCFA 3NT2A 1DFGA 4PIVA 4YAKA 1YDEA 2Q46A 1Z7EA 3CZMA 4U7WA 4LRSB 3Q9NA 1JAYA 1QSGA 4B3IA 1NQOA 1VL0A 3GA0A 4CL3A 1SPXA 3H9UA 2VZ8A 4M54A 2X0IA 3EVTA 2IEBA 2EXXA 2X7HA 5I7VA 1U3TA 5JYEA 3OJ0A 4H7PA 2Z5LA 4MIEA 2P9EA 4CPDA 4YXFA 1DAOA 1D7OA 1PX0A 3ASUA 5AVOA 3KYCB 1UXGA 3TPCA 1WDLA 3D3EA 1IE3A 1DHTA 2G0TA 4U0KA 4PVCA 3VZQA 1RM4A 1YL7A 4CLHA 5ILGA 4YJGA 2Q3EA 4TROA 2YUTA 4UULA 1F14A 4FN4A 4JK3A 4R01A 5B4UA 4DL9A 2O2YA 3A9WA 2AW5A 4Z0TA 2ZB4A 2DFVA 3IOYA 4AJLA 4DPKA 3D1LA 8ADHA 4XYGA 1LDGA 1BG6A 1LDNA 4QXMA 4AJKA 4K1LA 1ULUA 2IZ1A 4RVSA 5L40A 5DOZA 1SOWA 2Z1MA 4RVUA 3BMOB 5CEFA 3GZNB 5DT9A 5HM8A 1K6JA 4FPXA 1BXGA 4HX5A 2PNFA 4BS9A 4E5YA 2EP7A 3INRA 5EPOA 5KVSA 2AQKA 1ML3A 1V6AA 2A4KA 5TT1A 4DLAA 2GGSA 3DC2A 2DT5A 4A03A 3CKYA 1WZIA 5G0TA 2X0NA 6ADHA 3KSUA 4ZQHA 2D8AA 2PKRA 2PKQO 3JQ8B 1O94A 1UZLA 4YT4A 4EUFA 1P1RA 2J5QA 4RVDA 5THKA 3BA1A 1VJ0A 3CZRA 2HSDA 5JMWA 1VRWA 2NU6A 4FIZA 1QLHA 3WYCA 4UUPA 3KZVA 3PPIA 4II3A 3V1TC 1XEAA 2NNLD 3AUTA 3AU8A 1C0PA 2Y1OA 4PLCA 5JSFA 3ITDA 4X54A 4ALLA 2BLLA 1QV6A 1KBZA 3A06A 3TOZA 1MG0A 4JGBA 4KUHA 4OL9A 3ZWBA 2Q1UA 1SEVA 1B8VA 3D4OA 3AY6A 3M6IA 1UDBA 4QTZA 2UUPA 3JQGA 5HRUA 3H5NA 3ZU2A 1K2WA 2WWRA 4MP6A 1DJNA 3W6ZA 3AM3A 3BIOA 2B36A 3PQDA 3QP9A 3CIFA 5KTKA 3TZQA 1ZCJA 2BF7A 3KYDA 4EITA 3WFJA 1R15A 3VKVA 5ITWA 4DRYA 2BH9A 4JP2A 4LK3A 2PZJA 1JW9B 5IFLA 3A14A 2Y66A 3UGKA 2YV1A 3IS3A 1UDAA 2AA3A 4WGGA 4LGVA 1E3SA 1HE3A 2D5CA 2PGLA 1PIWA 3VZRA 3GOHA 3GAZA 4ZN6A 4P8RA 4ZGWA 4UVHA 1N7GA 1NPYA 1VL8A 4IJVA 1RWBA 1E7QA 1DIGA 1ZSNA 1A4UA 3T4XA 3WS7A 1YKFA 1X7DA 3EMKA 3ZDFA 2DTDA 3MJCA 1ISGA 3WLEA 3AJRA 1JU9A 4PG6A 4O5OA 4Y6SA 4CV2A 2PD6A 5BNIA 4L74A 4RVFA 1UDCA 3UICA 1YBAA 1BW9B 3FWZA 3H8VA 4NR0A 3RUCA 1NVTA 3RKUA 1TT7A 2GSDA 4J2HA 1NAIA 2VYNA 4IXTA 3AU9A 3H4VA 3K96A 3F4LA 4R1NA 4R41A 5I8ZA 2CVQA 3ADPA 3DMYA 2OL4A 3KSZO
chains in the Genus database with same CATH superfamily
4YQEA 1JNXX 3FBGA 3M6WA 4QICA 3L7DA 5K3SA 1LRLA 1X7ZA 3W7VA 4YT8A 3TI9A 4AIIA 1KWGA 4IIJF 1DAPA 2CJYA 4K9SA 1IN5A 3A1WA 3CN7A 4YI3A 1MHPA 3JQGB 5TQVA 4MINA 3TIFA 4N6NA 2CSUA 3V34A 1IJBA 2OMEA 3PFBA 5BO5A 2AI3A 3B38A 3OZSA 3PF8A 2PQ2A 5DLDA 1DC8A 1U0HC 3RCBA 1KI2A 4PGHA 3ETHA 1O7JA 4FUTA 4Q24A 5DM0A 5I48A 1VECA 1USWA 2ATCA 1AURA 1YS4A 2I6SA 1JG1A 1E6WA 2W6MA 1HTBA 3B6MA 2WSYB 1ZUNB 3QPAA 1CNMA 1WPQA 1CJVC 3SC4A 5BWMA 3B48A 4AQYB 1EZ4A 2R48A 3UK1A 4KFTA 1ISJA 4YASA 2RCYA 3KB6A 4HXYA 3GXOA 4IFIA 4HAZA 2XE7A 1CUBA 4YFVA 3V1LA 3L5KA 4ZYWA 2WWIA 2XKAA 4D0SA 2JGMA 2QE7D 3DD5A 2G1KA 5CFNA 2IK8A 3KTDA 3ZU5A 4NX2A 1GNRA 4E3ZA 4G41A 1VE7A 5LDHA 4KE8A 4RA9B 3DE3X 3MTDA 3LQFA 3MWLA 4KTVE 4ZQBA 1M10A 1C80A 1TKCA 1YZHA 2WM3A 3LGAA 4O2BF 4EQZA 3WQQA 3PFFA 5MN6A 4RHUA 3U4DA 2J1LA 4KFUA 2OYCA 1BZYA 1E2JA 3QLVA 1GKIA 3OO1A 3IDOA 1I7NA 4CODB 4EP1A 2ZJBA 5CH8A 1FDWA 2GZAA 4E1VA 3LDFA 2JHGA 4BAZA 2CNWD 2ZAYA 4H3SA 4U02A 1GP2A 3A9RA 3CRZA 1GZ5A 1CLUA 1PGJA 1CZRA 5BXQC 2LTAA 5JWRA 5F7JA 2FX3A 3RG2A 3RSOA 4AZTA 1KOFA 3BVPA 4UVIA 1JT2A 3RVQA 4PS1A 5DGCA 3TR6A 2BP7B 5FO0A 2C96A 1BVHA 2AFIE 1X7YA 1LLCA 3C8MA 4QFMA 1CUIA 2X42A 1B0ZA 3USZA 1Z75A 2VTEA 5EXEA 1XRPA 1YR3A 5LZ4A 4J94A 3WJ7A 2F2TA 1GTRA 1SUPA 4HAUA 1KTIA 2XX3A 4EEZA 4EW3A 2YMQA 4PQGA 1IN7A 1RHRA 3FVQA 2X86A 1F2DA 3CM0A 4O63O 4ZCLA 4DWOA 1W9MA 3CZQA 4IIXA 3OE1A 4PC3A 3N05A 1UMDB 4A23A 4IV8A 4BO3A 1NVVQ 3JD2A 3U4GA 4DWVA 2PL1A 2RKBA 1KSGA 3DMTA 3N39C 4RJKA 2X8LA 4UBLA 4ENTA 2BFDA 5A6VA 4DTIA 4JEIA 2W4QA 4IJ5A 2C7BA 3M4NA 4M8KA 4F7DA 5AVKA 1X15A 1C4WA 2IZ6A 1NYRA 3AUXA 4Y2UA 4DG8A 1UINA 5IZCA 3ICQB 2P11A 1M6YA 3OM0A 3TMYA 1QFYA 1DSSG 3ZHOA 5AW4A 3BMQB 5AHWA 3QVGA 3IAS6 2AVNA 2QUJA 3E5RA 4PC7A 4UUQA 5KCMA 3RRNA 4BNKA 8ATCA 3LVFO 3AF5A 4QRHA 1KFKB 1W0CA 2RGXA 3NATA 2XMRA 3WL7A 3HU5A 2B0JA 1N36B 1XQWA 5I45A 1TI7A 2DQKA 3A1EA 4OU5A 5C32A 3TO5A 4URHA 4AJEA 4DA6A 5AXBA 1OXVA 2F48A 2YZMA 1WVMA 2Y1WA 3REOA 1E9SA 2JFHA 1WXDA 1LLUA 2AFIB 3LPMA 9LDTA 1HK7A 2X23A 1P9LA 1NWHA 5I6DA 5DM70 1H9BA 1A8HA 3BMNA 3SOZA 3L41A 2PR7A 3DM5A 4CEHA 1E4VA 3D4LA 3HP1A 3GRRA 4CQLA 1G1AA 1LTQA 1UK9A 2YYSA 3SJZA 3G9UA 1KR2A 4IZHA 4L28A 1I01A 2VL7A 4UBIA 3MRXA 4I55F 3IR6A 1UXIA 3NONA 2OHGA 2HF9A 3AWDA 3UJ3X 4DLVA 3KKQA 2DC1A 5ESRA 3TJRA 3TX2A 2GJKA 4DR2B 2ZWMA 1IMOA 5FEUA 3H9BA 1D2HA 3H3XA 3E22A 2REOA 1DKNA 4H0CA 3VX4A 5C8DA 2C9DA 1DS6A 3TAUA 1QTIA 4MVJA 1KK3A 4XB6B 1EFVA 2OQRA 2V8OA 4FYJA 3VKFA 1WXQA 1EFRD 1LWNA 5GJCA 3UAXA 3VR2D 4DHEA 4E2ZA 1SZPA 4IGKA 2MSKA 5G40A 5AJYA 3UT0A 3UWSA 4C08A 3OKFA 4P81A 4EG8A 4E6EA 1G9XA 1QUEA 3DOEA 1AO3A 3FVVA 3O38A 2WF7A 4QATA 3E81A 4TLLB 2MR5A 2PFKA 3A05A 3OI7A 4J07A 4WEOA 1ZO8A 3ZHZA 3PKJA 5FJIA 4E5DA 3WBJA 3TNLA 1QGED 3RYFA 4YONB 4JVMA 4EGAA 1QYXA 1LI7A 2P2GA 3QWFA 3HDYA 4L7VA 2P90A 4QJ3A 2IIVA 4I1OA 4UVGA 4JJ8A 1ONPA 4A1FA 1FW6A 4P2GA 1I3KA 4P4SB 4Z1OA 3VSCA 3UH1A 1DLJA 4RQAA 3G5TA 4RKYA 4WN9B 4YUYA 5E2BA 2W2KB 1K7SN 4HZUA 4MMXB 4PC1A 5REQB 1U28C 1NJ8A 5CM2Z 4G5YA 4HXGA 4LXIA 2NUAA 4MIYA 4NCKA 3TL3A 1XLUA 2J0QA 4ZO8A 1NLUA 1VI2A 3MINA 3S3TA 3FA2A 3KQUA 4WAUA 3WE7A 3VH1A 5IP5A 4DLZA 3NZEA 3AFOA 2HN9A 5ARDA 3QU4A 3BWDD 2QNIA 3MTEA 3NFYA 4W5WA 5DM2A 3B9BA 2H7YA 2XNKA 1QZXA 4PYJA 2X22A 2J3QA 1QOQB 2P8JA 1C3JA 3HB9A 5FI0B 4F6LA 2G4CA 3GLIA 2O0HA 4YJ3B 3UXHA 3DYBA 3CNOA 3NOOA 1DJOA 4Q1EA 2JAXA 3JYOA 5DISB 1KORA 2W0MA 1SCBA 5CEJA 4W9NC 1R7RA 1SOUA 2H59A 2R65A 4M1QA 4PZUA 4D3YA 5E1OA 4KQGA 2G09A 2QW1A 3HYCA 2FEPA 2D1TA 1U4SA 3DEKA 1GYRA 1U3WA 4A7PA 4P1ZA 5JATA 5JTTA 3CVXA 3T9BA 3V2IA 4AM8A 2C2ZA 1Q1AA 2GERA 2C7VA 1DLIA 2H00A 2W90A 3NYIA 1JVSA 1T91A 1XXHA 4JLUA 3UN1A 1S3FA 2HXSA 3WK8A 4CMIA 5IUJC 3VJRA 5BSRA 1K6MA 2Y4NA 2ET6A 5GJWC 5IJZA 1M0TA 3MYYA 4M99A 3CONA 1JEYB 1QRSA 4TUYB 4FP9A 1FL9A 4TLBA 5TQ0A 3OOWA 4NZPA 1QTNA 4M1KA 1VKJA 5K3EA 2QLFA 1E66A 3BE6A 1R3UA 5EMJA 1G42A 1HL3A 1SN7A 3DXFA 3LM8A 4G5XA 4EF4A 3QX3A 3R0VA 2Q21A 3N8KA 3UJCA 2V6MA 5GPBA 3ICWA 5K4GA 3G1UA 1AXRA 2PCLA 1BKDR 3E9YA 1QORA 1G3QA 2GNOA 4NCIA 5KVQA 3VPCA 4OB8A 4V1CA 2WAXA 3DLHA 3KQWA 3SZRA 3ZY5A 3U6KA 1POXA 2MT9A 4RFVA 1O97C 1X1QA 2H1IA 4ZU3A 1O9BA 3JQAA 3MQ4A 3TOXA 1NNI1 1F8GA 3HNRA 3R3WA 3CPSA 2IXTA 2PH1A 3LSYA 4QKQA 2CXQA 4UAJA 1WDWB 4WIAA 4ZQGA 3AP2A 2QTZA 1A9XB 3CH6A 4GUDA 3ZV3A 3S44A 4B6PA 4R2JA 2HCJB 5CXQA 2FUCA 5IMBA 1PS0A 1L5HB 5CPFA 5G4KA 4BPBA 2HBQA 2FPOA 1JDVA 2OVFA 4U7TB 4E5SA 3VU9B 3C4QA 4YPVA 2QU7A 1N5RA 1QRAA 3MEQA 4NBLA 4RORA 2PL3A 1EUCA 4W4TA 2ZSIA 1XPRA 2EARA 2H5JA 2YBDA 1ES9A 1XQ1A 2OD9A 4R68A 3WLFA 1VTKA 1E0AA 4IILA 4QPJC 1ZL0A 3EWSA 4ENSA 2VN8A 4YP9A 1KYZA 3VPFA 4ANFA 4JUCA 4F5EA 4BO2A 1YHNA 4HN2A 3TM4A 5A02A 3AG6A 1XMOB 4PX3A 3A2NA 2JCBA 1ZH0A 1LA2A 3P1JA 1J8VA 3HFGA 4OQPA 4HT3B 4Q3EA 1A8PA 2RK3A 4KIGA 2W2XA 4MQLA 2YCBA 1Z63A 4BNHA 3IEMA 3GQVA 1T26A 2REQA 2JFNA 3VKUA 2HRDA 1HFKA 2ZROA 3OQIA 3O8OB 1W76A 1MNQA 3PUXA 4WOBA 3R5HA 4X64B 2NAPA 3ND9A 3BIFA 1JLKA 4EPWA 3RFFA 2ZM6B 1K63A 1II9A 1OX6A 4UTXA 4TYNA 3SQMA 1JH9A 4CR7A 1X0XA 2JEYA 4DBLC 2W6ID 2W00A 3UAYA 5F7OA 3IIKA 3ZWYA 4LDPA 4ZJUA 2ZR0A 1R0SA 3C48A 5LP6A 4ZWNA 2FXVA 4N4AA 5ALZA 4QJ5A 4WFJA 2BCJQ 1OI7A 4ZRNA 1T10A 2QUAA 3MUOA 4TWZA 1PHRA 1VJGA 2FW1A 4N0MA 5KKAA 5BSMA 3DFMA 3IQWA 2CWWA 2F3QA 5CH3A 4KQCA 3OTOB 2Y6UA 2GTHA 2WILA 3QUBA 4HS9A 3DDWA 5DEOA 1FLAA 5FOXA 4B0OA 4LC1A 4BWVA 2ZYHA 2RDMA 1DDIA 2PMCA 4LVCA 1L7PA 2FSIA 2G8NA 1DQNA 4IEEA 5HJ2A 2I8LA 2YWXA 4EELA 3PIRA 3OTGA 4JP3A 5ELLA 3T9DA 2PS9A 3KLBA 1HFEL 3EIWA 4MRVA 2VP3A 1UKYA 2AOWA 2YOHA 3ZHCA 4HATA 2HWXA 1WW8A 1GQ2A 1XA3A 4L07A 4QG3A 4EHHA 3TSCA 2GF9A 3I72A 1YJ5A 3LCVB 4KHZA 1C7ZA 5CCEA 1ZJ6A 2WMNB 2Q50A 1JAIA 4O1MA 1RWKA 4B47A 4ZTUB 2DTEA 3AINA 4I1IA 2E4YA 4LYDA 3GYGA 2A67A 1Z62A 2UYHA 1CSEE 2RHWA 4NZOA 3GIWA 4QECA 4RPHA 4QNRA 4GG1A 2Y1FA 3W9YA 1Z6PA 3Q40A 1FXWF 1TA9A 2OV8A 3DMGA 3V8NA 6YASA 1C3EA 2A5DA 2QRMA 1DWUA 2UV8A 1KH3A 1LRJA 2AGVA 4NBRA 4NBKA 3VGPA 4CM9D 5M2QA 1LK0A 3HP7A 5L3QA 3WP1B 4WVFA 5KYXA 3NC0C 1BS2A 4J0DA 3NBQA 4MV0A 1G6KA 3O9ZA 5GWXA 3WL8A 4AKIA 1V16B 5EJ6A 1Y1TA 1EVYA 3EAFA 1FZQA 4MROA 3RIEA 1Z4OA 3CU5A 4CBVA 3MGAA 3O8DA 4K28A 4CKXA 4A2WA 3KM0A 1W5TA 3DFIA 1NVMB 3PD0A 1GSOA 1E69A 4XIGS 1W2GA 3BQ9A 5ECYA 4X7BA 5EJ5A 2X3UA 3L8HA 3ZK8A 1T1GA 5CJJA 1NT4A 1KHHA 4PG7A 2EKZA 1C2YA 3IR5A 1ZM3A 3FOBA 4JLVA 1EIWA 3IALA 2PGAA 5JPDA 3UJNA 1K5HA 3IA7A 3WZLA 1ISSA 3H0EA 3EFEA 2LRHA 2OAEA 3V4LA 3HYLA 1XRQA 4AUKA 1FFXA 5CB4F 4RM2A 2WYWA 5AKLA 3L1HA 4Z3DA 1A76A 3LXXA 4JUIA 1H1LB 4AROA 3DWIA 5U1PA 4HQOA 1G63A 3F9IA 5BN3A 1FU4A 1RNLA 2JCGA 3T7CA 3D3QA 2HLDD 4URFA 3TIGA 4E14A 3C8UA 3K0FB 1A50B 1XCBA 3BCSA 1HEIA 4WLEA 1SHTX 4L4XA 4KO4S 3T34A 3VZBA 4DBVO 4DNQA 5BV2P 4HDMB 1IRXA 4D44A 1U6KA 1XGKA 2PQ0A 1N6IA 3MM4A 1K6EA 1Q83A 5I47A 5I5EA 5F76A 4F0JA 5CD1A 4DDVA 2R8BA 4MQEA 1XJ0A 2EGUA 2AEJA 4AJ4A 3EVBA 4KR3A 3R5FA 4LNUB 3TEFA 2O7SA 2VT3A 3W79A 2CE7A 4TV9B 2FJUA 4BGVA 3TI7A 4GQIA 4JB3A 3SNKA 1TECE 4YUXA 4CEIA 1KAGA 1N2BA 4M76B 2F1KA 3ETNA 3I53A 4QQNA 1M9NA 1ORRA 4GKJB 3C3WA 2Q3LA 1YZ3A 1GRQA 1C41A 3FPLA 5HQ3A 3MAJA 4AKTA 1TM4E 2FLVA 2I2AA 3DAYA 3GQBB 4UNRA 3HU3A 2YXBA 5FLEX 3WNBA 1L7OA 2X6TA 3T8YA 1NIJA 1NHWA 2JK0A 3CR3C 3OFSA 2XUKA 1GLGA 2RKWA 2PMEA 2MDTA 4KQ2A 3C85A 1YRQA 2WBLC 3NM4A 3ZLUA 1DVRA 2Z1NA 3A7DA 5AW1A 2YWJA 3S2ZA 2OHIA 1PR5A 1RI4A 3UM9A 3K09C 3DMPA 4GPD1 3ROMA 1M54A 4BKMA 5JC8A 1JR6A 4JWTA 4W7SA 3JPYA 3HJGA 1L4NA 1P0IA 1NR7A 1W8IA 4J1NA 7GPBA 2C59A 1PJTA 4EQ6A 1SVIA 1NFRA 1VXRA 2VRNA 4BRUA 5IAEA 1MC5A 3QU7A 3WWYA 2ZBDA 1S2LA 2GN9A 2Q4EA 4G9EA 4Q6WA 4DG5A 1T9CA 1M8GA 3VTZA 5A6SB 4HAXA 3ZX4A 4IMRA 3ZDBA 1EWQA 4CTOA 2POQX 4M9RA 1KS9A 1NW6A 2VRWA 1Q44A 1Z08A 3KEFA 3MTIA 3NOVA 4GKBA 1XMIA 3DOUA 3A6EA 1JI3A 1QVAA 1SOMA 3AOGA 4FHGA 1SCUA 4KDFA 4NULA 2NTJA 5DNYB 2R86A 4FKZA 2ECPA 1F20A 4NZZA 4QNMA 1CZKA 2CK3D 4YIHA 1NVAA 1Y7IA 4CDRA 2R87A 2CB9A 4GIBA 2ZTUA 1IULA 2FQ1A 2OTCA 3TKLA 1X38A 1DB3A 1K1EA 1Y3AA 2I4RA 4K5QA 4LMAA 4EA8A 1FUKA 1ZXXA 3DEAA 2R4QA 5L3RA 3LKVA 1DKOA 4YA6A 4HAWA 2IOHA 3QPWA 2Y1EA 1JQJC 1DG9A 1S0UA 2CBZA 1XRNA 3Q12A 3W4KA 1GDTA 1IXZA 1IBRA 2RGNA 1U0OC 4I5DA 5LLDA 3GL9A 3L4JA 3KR2A 4TVSA 2FMXA 4C5BA 3RRFA 4CFZA 3N75A 5ALXA 3UCFA 3WGKA 4IBOA 3EY4A 3WGJA 2WD7A 1VIMA 4IJWA 4LXGA 1FSGA 2EP8A 1K8QA 4D82A 1KEPA 2QRVB 3GJ3A 3O7WA 4ZOAA 2CNNA 3U9SA 3ULKA 4JROA 3AGPA 4AKGA 1FFSA 1P9WA 2BPOA 2JRCA 1I80A 2IQ5A 4BGIA 3AVYA 3TLZA 1X9HA 1Z18A 2CL7X 7REQB 3IBCA 3TYXA 2JLXA 3P5BA 5B1DA 4BKPA 1UP6A 5H82A 1L3CA 3WK9A 4A8JC 1QCZA 1JQ5A 2O0MA 1DBRA 4MUMA 4H6VA 3TD6A 2XMZA 3CIOA 1CW2B 3OX4A 2XUAA 5JO9A 1EPUA 2NXNA 1X1TA 5L7WA 4XFDA 6LDHA 3RFXA 4Y2PA 3HGTA 1E2NA 1KTVA 2B35A 2BFPA 1BHO1 1Q7CA 2FZ5A 3EZ2A 3NNSA 3OOJA 2XDQA 3ZWQA 3X43A 2VCYA 2MJLA 1MOQA 2VI5A 3MCVA 2AXPA 2ZCUA 3UHOA 3LQ2A 3TUIC 1UK7A 1XYYA 5L7TA 1H6CA 2VF2A 4F4IA 4G4JA 1NYQA 2H2FA 5A05A 3KTOA 4M0PA 3W04A 2ENUA 2IXDA 3DL4A 3WIEA 4A6PA 1XB2A 4NABA 1T0BA 4QOJA 1AN9A 3T35A 3WOVA 3HWX1 1ZXLA 4PZAA 4S05A 4EVIA 1ZI6A 1JWAB 2XBUA 4XCXA 3P52A 3G6WA 3LDUA 4KXWA 4I9GA 2M1XA 2IS2A 3L0SA 4RD6A 1OFUA 3OMLA 4DJAA 2RSLA 1CQIA 3ICVA 1E20A 4FEYA 4LZJA 3ZGNA 5CXUA 2OECA 3TDKA 3DO5A 3J80A 4P5EA 1DEXA 3LG2A 2B8TA 3DKPA 4UUBA 3MW8A 3U49A 4KXQA 5DNCA 1BXGB 1O95D 3HWWA 3UAVA 5K8VA 2VTDA 1IOLA 1VHJA 4HQFA 4Y9RA 3TF5A 1T1JA 3QPBA 5HWSA 1EK2A 4DRZA 4LY9A 3G8YA 5EJ2A 3PEEA 1MXFA 4QXOA 5TF0A 3ZD6A 2V7VA 1NUAA 1DV1A 3IERA 4B33A 2GCEA 4LQDA 4OHWA 4ZXFA 1XEWY 1QHHA 1OB2A 1ZJ5A 1RQXA 2FW8A 2AYZA 4S0ZA 2H9YA 2QNBA 4L50A 1MW9X 1JSRA 2JI7A 2PLFA 4ML3A 1QG6A 5I01A 3HKEA 4BNMA 3A4LA 4RBNA 1VG1A 1F2TB 2CYBA 2GWHA 3HO8A 4CMGA 5KJCA 2JD0A 2P9ZA 5IXSA 4NZ9A 1KAOA 2PUTA 3TSZA 4K9PA 1EE2A 1P6QA 1SU8A 4D98A 4W82A 1RADA 2EQ5A 3OJWA 5HNKA 1DQSA 3BD7A 3AKEA 3HUFA 4Q4HA 3R7SA 1A04A 1GQRA 4FHFA 4BMVA 3E58A 4P22A 2Q6VA 1O8BA 2CMFA 3PQ5A 4KXYA 2O9JA 4FGZA 5IVKA 4LHXA 2VHVA 1HOXA 4GUAA 1FS4A 1Q1GA 1M83A 1VSQA 1IN4A 1JYEA 1R6AA 4FFBB 4RD3A 1IZZA 5FL3A 5ALRA 5DB4A 4IOLA 3AUKA 4MK4A 1DXQA 5AK4A 3UUWA 1Y8RB 2DP4E 2JI9A 4ADSG 4EG5A 4Y2VA 1WTCA 1E2KA 4XM0A 5IFKA 4GC9A 3PS9A 4FYVA 3FF4A 5D6OA 1BHQ1 2NT4A 2R7AA 4QLBA 3AT1A 3EXHB 3CCBA 4NCHA 1F8UA 3RUIA 5CU7A 2F1JA 3E9MA 2J9FB 4DA9A 5B12A 1KVRA 2RD2A 1OLSB 3MOIA 3Q87B 3E48A 1SGWA 3Q7EA 1ZD2P 1TZMA 4MDEA 3PXEA 1VMKA 2JGAA 2DQZA 5KSPA 2GDJA 1FDIA 1Y8AA 2I5PO 2C9OA 4EKNB 3Q2KA 3RI3A 1U7WA 4QPZA 5DXFA 2A78A 4EKIA 3ETEA 3GCZA 1TC1A 3OEHD 4IUCS 4EA7A 3D6FA 1P6UA 1C9MA 3C24A 1UPFA 3LLSA 5BV1A 2FE1A 2O1WA 3PPWA 1BJTA 4YO7A 4RVHA 3UAOA 1IQUA 5E4FA 3CZCA 1U5BA 3UOWA 5JLJA 3T3OA 1C3VA 1CZHA 2SKDA 1HE1C 4QYSA 3U1VA 2ATEA 3TXYA 4CJXA 3WQRA 3WFIA 3TX6A 4RDXA 3AEKA 4JZKA 4G0WA 1SAYA 5JG7A 3PHBE 5JFTA 2K4MA 4MMZB 4YT2A 2P9TA 3ZQ4A 1UJBA 1M6HA 3H5RA 3A6LA 3BRSA 4LRQA 4P7FA 3BBPA 3KTAB 3NBAA 2UUCB 1V43A 2OB2A 1MO3A 2CD7A 5DYYA 2QB5A 5TIIA 1CNFA 2IHUA 2QX9A 3LSTA 1JRLA 2OOSA 1YA6A 1S2NA 5H81A 4N5NA 2WNHA 3UW1A 2KE5A 5BSUA 4H4DA 3E9ZA 4K6KA 3NTLA 4QTYA 2QX4A 3PXDA 4MZXA 4JLNA 2FSPA 3KJQA 4XJTA 3O8CA 4YMLA 1D2EA 4F4JA 2C4MA 3HM9A 2YXNA 4JA2A 3L8GA 3WTCA 2C4WA 1JI0A 3CE9A 4HNVA 5IVHA 3RAFC 4ZQIA 3ZUGA 1CJUC 3QJ5A 3DEYX 2QF7A 1IOZA 3IP8A 2MHCA 3ILVA 4ALKA 4J0IA 3OA0A 3VR6H 1W5BA 4BMYA 3SFVA 2HA3A 2WHRA 3W5DA 4PNHA 1IY9A 1E8NA 3OHSX 1EFCA 2AR9A 3C39A 3FF1A 2P30A 2P9YA 4CCYA 3JQQA 1N7HA 3A6DA 3B5IA 1P2UA 4JLWA 3FNRA 3V8PA 3OBIA 3TL6A 3EQ6A 4HD8A 2A9KA 4XUGB 3SMVA 3L0CA 1G0NA 2GN8A 1TOAA 4UBNA 3N76A 3QJYA 5C5EA 4GWLA 3TW4A 4MUEA 3ZCSA 3CCCA 3H2BA 4PYIA 3REQA 2H2DA 3RSHA 2ECFA 1M1YB 2EOAA 4LSMA 5TGDA 2NU8B 3RABA 1FY2A 4NY1A 2FUG6 2J9ZB 5ICMA 3EVNA 3JD1A 3LKZA 2IPOA 3QWAA 1RXCA 1K0FA 2V1XA 4I50B 5JSYA 4ZV7A 1A2BA 5FWNA 3DMFA 1BN6A 4HRYA 2DYKA 2Y0DA 4MUIA 3G8AA 1J99A 4BX3A 4BXOA 3C8DA 3L4EA 3UHPA 5C5CA 4MQ5A 4WZBE 2GKOA 1EE1A 1A72A 2J33A 1A7KA 1BEZA 1CF2O 1J1IA 1SXJC 3FJ1A 4YJHA 4KK4A 1P62B 2W83A 4O6VA 1XT6A 5LBTA 4H1TA 3PNPA 4EF6A 2C5SA 3L46A 5LZ5A 4ILEA 2P1RA 3UQZA 3KOZA 2FZCA 3NKLA 4OXXA 1E9AA 1PR2A 3QELB 3WAKA 2YOGA 3DLIA 2PNJA 4GSYA 3ZE9A 2DRIA 1KMIY 1GADO 2LV8A 1W4RA 5AIAA 2QM0A 4BNXA 2YX1A 2FQYA 4IJKA 2Y0PA 2F1IA 3QPVA 3A6PC 1A9SA 5T4FA 3AVVA 2WJHA 4OQYA 3D3KA 2KQUA 4K3UA 3DL7A 5JBNA 5KNLA 1MXHA 3JQBC 3N6VA 3IQZA 2X8JB 1JR3D 4I4TA 4G1CA 5BW8A 2PUDA 1PZEA 3C1UA 3GR6A 4EG4A 4PNEA 2E9SA 3ZC3A 1ZN9A 5THQA 3UV3A 3DCIA 2DBRA 2J87A 3ZDRA 3V33A 4G97A 5IJ0B 5LOVF 1IH8A 1ISRA 5AO9A 3I05A 2QX7A 1P2TA 1J8FA 1MRZA 3MCTA 1MRSA 4RPGA 1X80B 3EUEA 3NBZC 4TKUA 1WUIS 4OLAA 1DQPA 1G8JA 1GU7A 1V5IA 4PPGA 5EG5A 3DYVA 3L7MA 5CNMA 4ZCPA 3LX4A 1QR6A 3L9XA 3T3GA 5KQRA 5B3KA 3EIEA 1J90A 2IV7A 2VHEA 4GDFA 4TYMA 1BH2A 4B6JA 4M9SA 1A95A 2JD1A 4L6AA 5C2JB 1WHSA 2X0KA 1YQXA 2VNJA 1CUVA 3PB3A 2OPBA 4MW7A 3NHPA 4WZBB 4UNNA 5EPEA 3V80A 5ADVA 5JQGB 2VAVA 4U2GA 4B5LA 3O4RA 1TVKA 1TCUA 3M81A 2D7CA 1RYDA 1G9SA 4AIRA 4WXRA 3JZMA 4NLLA 1LNSA 2JC3A 4U6QA 5GY7A 2FR1A 4Q9AA 2HMVA 2VUTA 7YASA 1N2IA 1WTAA 2YC4C 4O4HA 1QVZA 3B70A 2Q9AA 2X0FA 3VHRA 5JASA 2OXTA 1SUFA 4D42A 4NNOA 3E1SA 4OSOA 3MWJA 5AOCA 4ZCIA 2B94A 2BTOA 2ORED 3JWGA 3K0CA 3LBNA 1HA3A 1IJKA 4JYCA 1Z4IA 1Y1PA 3JARB 2OCBA 2OORC 4G0PA 1RLOA 1GNSA 2ZIZA 2EGGA 2R68A 2CVFA 1RJ9B 3A0RB 3VMFA 4REOA 2CCKA 2WI8A 4BYGA 2R97A 4P7GA 4WCFC 4PNPA 1THMA 1QHIA 2R1VB 4QEDA 5FWYB 5A3SA 5KI6A 4DILA 2HIHA 2R66A 3RSGA 3ZE6A 1OTXA 1REQA 4DDKA 5EJ4A 1YH3A 1ARZA 1C0IA 1JIKA 1RYMA 2Q1SA 4GD3Q 4WMLA 5JRJA 4LZLA 2FSHA 1XAHA 2VLIA 2X8BA 3BHMA 2QTHA 4L0QA 4CKWB 3ZE0B 3GBSA 3IELA 1ZY2A 4JGGA 2DPGA 2J0SA 1PZMA 1MB0A 3I32A 3QFCA 4PEVA 3ISVA 1G20E 3Q11A 5IW8A 2WFMA 3L0BA 1ZN7A 1BFKA 3WYDA 4Q3CA 2C78A 4DGSA 4KGDA 5ERYA 2FCRA 1G4HA 5EMLA 4Z1MD 2YDYA 4KAXA 4CLOA 3P4YA 2QQEA 4ENRA 3CBGA 2RHHA 3A6JA 4JKOA 2OZPA 3HKCA 3STXA 3LHDA 3SYMA 4D9KA 3U7GA 1F4PA 3LOUA 2EEPA 3RT1A 2F7SA 1MG5A 2DPLA 3LA8A 1M0WA 4BQFA 2HR1A 1F5NA 1N5MA 2HGZA 4CTNA 1XQ6A 1GSHA 1G21A 2CMKA 3HYSA 3P5SA 2Q3BA 3JATB 5CDYA 3IV6A 2VPXA 1TKBA 1WF3A 1ZLXA 3GT7A 1I2ZA 1GUBA 1VLVA 2BM0A 2ZRQA 3VO9A 2GXAA 1L4KA 2P6UA 2PZGA 2QSZA 2VTKA 1QC5B 1K8ZB 1MABB 3ORSA 4M0FA 1YVRA 5TMBA 2R4TA 2P62A 3ON5A 3K0KA 1CIVA 3GPCA 3WYGA 4LYEA 3KKLA 3AKYA 5DTQA 4AW9A 3GLTA 1KZ1A 1W8DA 1Z5UA 2OHOA 2WRZA 4XX0B 5F3RA 3SN6A 4XD7D 3WISA 3J7TA 3CNLA 1EEHA 1K75A 3DBHB 2AOXA 3I2GA 4HBGA 1SQ5A 4GECA 1GQYA 1XCPA 3R1IA 5HDBB 4FLEA 1XRJA 3KZ1E 3T3DA 3WTBA 1N34B 1M2VB 2YNMC 4XWAA 3HCAA 4JOSA 3R76A 2PT6A 2P2SA 4DEXA 1U3FA 1G20B 3L2OB 4BMXA 4MJ3A 6AT1A 1L7VC 4DYVA 3OUZA 2BFBA 4Q7QA 2IIQA 1IUNA 1DTWA 1NBME 1W94A 3P9SA 4HUQB 1B42A 3AF2A 3E3LA 4P9NA 3RF7A 1P5RA 4GYJA 3WGHA 1Z6QA 1I7SB 3AVTA 4XLLA 1KY5A 3FMIA 3I01A 1KJZA 1R16A 4LWPA 4F3CA 3TDMA 2GILA 4B85A 2QIOA 3VC3A 2C99A 3PRYA 2HK8A 2ZS9A 4DARA 1O03A 4LV8B 3KR1A 5D1HA 3ZOZA 4X1IB 1XOIA 4I14A 2OESA 5YASA 1CF9A 4QYWA 4C2UA 5KOHA 3NDBB 5K0EA 3UMFA 4S2UA 1Q0QA 3LPCA 4EO7A 1ZWLA 2C9BA 5TNXA 4IVPA 3C15C 1WVIA 1TIKA 5K8UA 5DJ5A 4FFNA 4XD2A 1L7XA 2ID9A 2ZI9A 1E9DA 3VOTA 4GX5A 5ELMA 4ZT4A 3DTVB 5IARA 3T99A 4ICIA 4XDZA 2Z5FA 2QRJA 4DIBA 2Q6IA 1J23A 4YK7A 2IYLD 3EXAA 4IUYA 1QS0A 1CYDA 3PXCX 4RKWA 1A82A 1I7QB 1L8QA 2AG8A 1RBMA 1TU4A 3HP4A 4N18A 1D9XA 2JLYA 2VHZA 1ITZA 2HHJA 3ZHTA 2ISQA 4CHGA 1DRUA 2FSFA 2HCFA 4JCOA 5EKUA 1YK0A 1F1JA 3L0OA 4MR8A 5CVCA 3ZLTA 3AH8A 2B37A 2YJ4A 2GTPA 2FB9A 1IPEA 4KBYA 3GRUA 5H68A 1TQ8A 4D4KA 3EOAI 2HX1A 3BE8A 3ROXA 2MR6A 1HBJA 2QTLA 3WLRA 3F6EX 2W2PA 3QV2A 1YB1A 4C0WA 4GXTA 5JJ5A 4MYSA 1KMQA 2RK4A 3W5HA 2C4HA 4Z3OA 1EGHA 4OYRA 1NJGA 2PRIA 4GZ6A 3SVTA 3RU9A 1ZD9A 4BZXA 2QD3A 5H83A 3WLJA 1IXYA 1Q0LA 3CX7A 3GZJA 5JZOA 2JS7A 2G0NA 4XGNA 4PSAA 2FWAA 4BFZA 3EPLA 1YBFA 1BU8A 5HPYB 4V0QA 3LE8A 1DEHA 1G16A 2P5YA 1X39A 1D04A 3C1TA 3PICA 1IHYA 1KSHA 2HF8A 2JK1A 3A6FA 4MV9A 1GGFA 5EFOA 4EHAA 3W8DA 3UBTA 2BBSA 2HHCA 2IEGA 4OQEA 4WD3A 4DCCA 1KSFX 3IRVA 3AETA 3QG1A 3MS4A 5EN4A 5EIHA 2MYUA 1CJTC 3ER6A 2GR9A 4FCCA 4E11A 2W9XA 1GFWA 2WWYA 2QRKA 2Z43A 4J3NA 4JLJA 4M0LA 4MIKA 3UJAA 2QN7A 5JAQA 3WGNA 4TTVA 2VRCD 2YW2A 5COAA 1WDKA 1F4LA 3TTSA 2ZRBA 2E6UX 3CX8A 3NX4A 4JYBA 5DBGA 2A9RA 3N8IA 3S1AB 3UAZA 3P2JA 5C8VA 5L4NA 2DH5A 2GXQA 2C3YA 3MPOA 4M7WA 4CR6A 2G5TA 4FCTA 5GM1A 4DLNA 4EHNA 1SXPA 1O4WA 2QJRA 2PG3A 5LYJA 1WCIA 3PPVA 1AHHA 5BWCA 4QREA 3OZCA 3QPCA 4HNUA 2R96A 4OYYA 5LFAA 4A2CA 4FHCA 4RD4A 3C1OA 1VE1A 3BTOA 4WL0A 3B2NA 1GPYA 3I23A 1XVLA 2O3SA 3C4VA 3P7MA 1XZHA 3FDIA 1ZUWA 4RFSA 2IS4A 3PFWO 3O4VA 3OCVA 2PDAA 2OBMA 3B9RA 3OZAA 4FDAA 4C0XA 4BNVA 1GARA 4O4LB 1HDRA 4RVOA 3HADA 2O8CA 3GJ4A 1GV1A 1V1MA 4MA0A 1Q17A 2KSQA 1CDEA 3K4HA 1JJIA 4GQBA 4MVCA 3E4CA 1M3SA 4XPIB 4HB2A 2OCPA 4PW0A 3E8XA 3KFXA 3UJBA 4D57A 5BW5A 3QTTA 1O6ZA 4MAAA 1I94B 3BK7A 3AGQA 3JAKA 3RRZA 3L7IA 3U81A 3RRBA 1N9KA 4I6EA 5AKKA 4DPLA 2R8YA 1ZJZA 2QRQA 4DBZA 4V03A 3GFVA 3KZOA 4CEJA 5DK4A 2C1EA 1Q7GA 1XZBA 5MHTA 2JJ1D 5CG1A 3CR7A 1GGKA 2X9NA 3LCUA 1ABEA 1EX9A 3O4HA 2E5WA 3E3AA 4EGFA 1L5KA 1C8VB 1M2FA 3EBOA 5BWNA 4Z4EA 2ONCA 3LT1A 2QP4A 2QZSA 3K8YA 1WXXA 5FUVA 1CULC 3D6HA 2B7LA 1GPKA 4EKYA 1ENPA 2MIIA 5TC4A 1E5TA 1DBWA 1JLLB 2Z4RA 3AUYA 3NIWA 3K53A 4QFCA 5H3HA 3FPKA 2XDYA 1O8CA 1KNXA 1EFKA 3M3PA 2V54A 2YRWA 2OVBA 3SE7A 1Q1EA 1MEOA 1WW3A 4H1UA 5HX7A 1H2YA 2V3WA 3G0DA 1JFTA 5ECGC 1ETHA 4EW2A 3KSMA 1CE8B 2BTQA 6GPBA 1DC3A 1F51E 1RWWA 1U9ZA 4BLWA 3OF3A 5DM60 1UJMA 5TJHA 3QVJA 1KU6A 5K6AC 2F64A 2PV0A 2VJNA 3DBVO 4N0DA 5BUQA 1IZ7A 3UC5A 3RG8A 2NU7A 3C6BA 2H65A 2ZJOA 3O31A 2JCVA 4RY2A 2QBYB 2XXAA 2HZBA 3DOJA 4LZNA 2JLQA 2H3EA 3S99A 4EZIA 4YLYA 4XI9A 2YVUA 3VDMA 2ZRHA 3H8JA 3OZWA 4LZOA 3THOA 4BMSA 3ZJUA 2C9ZA 1Y5NA 4HF7A 1YCFA 3BBLA 5E7JA 3LQQA 3G0IA 5C53B 4HFRA 2C2MA 1E9RA 2XY4A 3O83A 5A4DA 1XKQA 5F4ZA 2J9YB 4C06A 1BMFD 3C8HA 4ZEVA 4DRXB 4R16A 1ZZEA 3B85A 1ICIA 4MV3A 3EC2A 4CMJA 2B3TA 4FSHA 4EB6B 4CL0A 3MJHA 3RC1A 4CKEB 2PIDA 4O4IA 4BFSA 1T3SA 3V7UA 4WJKB 2OXEA 1V7PC 2EKBA 3JVDA 4PPYA 3I6YA 2V6FA 3JAWA 3IH5A 4FZ5A 5CT6A 3E7DA 2VJOA 4B6GA 1SELA 1YMUA 1Z9BA 3ET4A 2OUIA 4JXKA 3RVMA 4F9EA 4FFWA 1BX1A 4GRIA 4RTLA 1DC6A 1O4VA 3WNCA 1UJ5A 5JD4A 4CLRB 2PMWB 1KJIA 3ZHQA 4O59O 4M87A 4XM1A 5DF1A 2ZJ8A 3WRYA 3ETGA 1G7SA 1UMBA 4R1UA 2FV8A 3O26A 4RJJA 3T7AA 2IWHA 5A0VA 4PBRA 3EIHA 3QF4B 5BOVA 1V8PA 4TMZA 2XQGA 1YULA 1OBVA 4GXRA 1SUAA 2P9CA 4CHTA 5BSEA 2IHKA 4EY6A 5A5GA 1TLLA 4PRLA 4JOBA 4CIWA 2HEGA 4C6RA 4CG0A 1JZSA 5BWOA 4LY0A 3H1GA 2DR2A 1EVJA 1I5RA 1X1RA 1ZH2A 2C29D 4BU0A 4R1SA 5KNCA 3VKWA 3BD6A 1T4MA 2HZ7A 4AJOA 5F4BA 1QHFA 1SOAA 1Z5NA 1PT8A 3OPVA 1TCBA 2I0FA 4TYYA 1V5GA 3EGDB 4LJKA 1XTIA 1T5BA 4NG4A 4FU0A 1JFFA 2IX3A 4N1AA 1SK8A 2YZ2A 1CKEA 1YR8A 1LF5A 1HYHA 3BFXA 4Q6BA 1P8JA 2I6FA 3R5XA 2RIPA 1V8FA 2ERYA 2Y1XA 3RTEA 4BO8A 2IHNA 2V3VA 4HGRA 1J1UA 3DZ8A 1R0WA 3KAPA 3FJOA 5K7SA 4U00A 3GLQA 4HGQA 4NRDA 2GKGA 3FCYA 3P9IA 1O5IA 1E77A 1MORA 1SVOA 2IE0A 3ZDXB 3P2IA 5JAHA 2R6JA 3P0HA 3SR0A 3WHKA 1WMDA 4L5AA 4UDXX 2Y67A 5A5EA 4R6XA 4YVFA 1RYNA 3OIVA 3T15A 2AD5A 1II8B 1ISMA 1ZOLA 1J5PA 1N5DA 1U8XX 1IIRA 4YV2A 4KX3A 4IHJF 4NV1A 2VP2A 1EQAA 2A2ZA 1OJ7A 1FFCA 3LX8A 5P21A 2VDWB 4IQ0A 2AZMA 2JCSA 3VH4A 1XQXA 2EL9A 2PGOA 3BA6A 2D6FA 3VVLA 4R84A 4OKSA 1Q7EA 1JEQB 3G2QA 5TDHA 1RKBA 4BQQA 5LU8A 5ICFA 1HTWA 4YC7A 4A5OA 2PQ6A 1K27A 4EMUA 2GD6A 3G0HA 1E2BA 2Y6VA 3OJOA 5HP4A 3NUZA 3ACDA 5B1HA 3LGXA 3W3ZB 1A8SA 1FYEA 1MDBA 4EX7A 4JYMA 4ZI3A 1G7TA 3HS3A 4KI7A 1AH2A 1E1CB 2WJAA 1PP4A 5A9RA 4IINA 5BWBA 2A0WA 3DH0A