2YQEA

Solution structure of the arid domain of jarid1d protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ARID domain of JARID1D protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Jumonji/ARID domain-containing protein 1D
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2yqeA00
1IG6A 5K4LA 2EH9A 2RQ5A 1KKXA 1C20A 1RYUA 2JXJA 5CEHA 1KQQA 2JRZA 2CXYA 2LI6A 1KN5A 2YQEA 2LM1A 4LJXA 2OEHA 2EQYA 2KK0A
chains in the Genus database with same CATH superfamily
1ZQOA 3V7KA 2J6SA 4Q43A 4OJ6A 2LYHA 1JXEA 3BZKA 1L7MA 4RQ8A 4IS7A 2BZFA 4AYBF 5KL1B 5KAIU 8ICAA 4RNOA 4O5EA 4C8NA 1KQQA 4F3OA 3GQCA 3QU2A 3RB4A 2H3IA 4YMMA 4RT3A 1HUOA 2WF8A 4ECUA 4FBTA 2C28A 4DEZA 4J9KA 3GU3A 4Y2RA 3AUOA 3CP8A 1NNLA 1QCKA 5ALGA 1A77A 2FPLA 8ICBA 3KHLA 3V6KA 2ZIUB 3MFHA 4NJ8A 4RNMA 4UAUA 4NLKA 3KHHA 5KFBA 3RB0A 1TV9A 2LYBA 3NASA 1HIWA 5AKZA 3T3FA 4UB6U 1ZQJA 2K4PA 1MC8A 3NVZA 4TUSA 2ZIXB 2KTQA 2ASDA 2ZTCA 1PVQA 4PHDA 5AM0A 3M8SA 1X9XA 5ALWA 3DV9A 4OO1J 5D49A 1N5XA 4IQUA 1VLBA 4QW9A 2BGWA 8ICSA 2FMSA 3MDAA 3RB6A 4DF4A 2YY6A 2EANA 3RF9A 1T94A 3RB3A 1ZD3A 4CF5A 3ISBA 3RRHA 5BOMA 1IV8A 2XGPA 1N62A 4YXMA 5ALHA 5J2EA 2R8GA 2A1AA 5EOZA 3UXPA 3LK9A 9ICEA 2YX8A 4BJQA 1TAUA 3LVWA 2JMGA 3PX4A 5KFSA 1ZQAA 2XGQA 2V9WA 4QZ8A 3MR2A 4K4HA 4KLUA 1RM6C 4F4WA 3OTQA 1T3NA 1DRGA 2KEYA 3JPNA 4F2RA 2Q4TA 4DCCA 5DQIA 2HBJA 3SQIA 4P0PA 5J2BA 3SV4A 5ALRA 4O5CA 5CR0A 2W8LA 2M9NA 2HDOA 2D6FC 3H0RB 1SB3C 4KLFA 4IQVA 3TFSA 1SWVA 1Y88A 4TURA 4DOBA 5EWEA 5KL8B 2H5XA 5AKEA 3G6VA 2KV2A 1Z1BA 3C21A 3HILA 3DEEA 3MGIA 1Q3UA 2XY5A 2DGZA 4Y2PA 3NGDA 1UA1A 3I28A 3KD3A 4BGDA 3GFKB 2FJ6A 8ICHA 1V85A 3A0HU 4I2JA 3OSNA 3F2DA 4I2CA 2VIXA 1TK8A 5IILA 1SV0C 4Q44A 3OHAA 2G07A 5L1IA 2EDUA 3FM9A 1TVAA 2QLTA 3F5AA 1N48A 2KHVA 4C0ZA 4PHEA 1U9LA 1ZQNA 3O0FA 4QJFB 2KK0A 4KLOA 3C28A 4RQ2A 3UMBA 2MSNA 4UASA 4JK1A 3AU2A 5CWRA 1TE2A 4WJ3B 3C1YA 3C2MA 3KHRA 1ZQPA 3OPXA 5HP4A 1TAMA 4UAWA 5KFJA 2KVSA 3B9JA 3PX0A 3WKAA 2ISPA 3PSIA 4KLSA 1WCNA 1JRPA 1XNSA 2LBOA 3QZ7A 2ES6A 5AKLA 1P7DA 4Q8FA 3MR3A 2E8OA 2Y0SF 2XCAA 4G9BA 5KFWA 2Y9UA 4F50A 1BNOA 1NK9A 4KLTA 3BQTA 8ICOA 5J2DA 2ALZA 4DOAA 5CJ7A 2KKVA 3FDSA 4M6WB 2KZMA 3QX7A 5DDMA 1ED1A 1RG6A 7ICNA 5KFPA 2JR5A 2WAQC 4I2EA 4KX3A 5AM5A 4QZDA 4EEKA 3ALRA 4ED2A 4UQGA 3M9OB 4KLGA 3ED5A 1OW5A 2C22A 5J0UA 1J97A 9ICAA 5JU5A 3RAQA 2MAXA 1NK6A 3EPGA 4RQ0A 4NLZA 2W43A 1CI4A 1SV4A 2G09A 3V7LA 3DDHA 2IHMA 9ICOA 4I2AA 4UB8U 2ZXIA 1MQ2A 3QNMA 1ZQWA 4KTQA 3WK8A 4GXKA 4UB2A 4DQSA 3QUCA 3HKZF 2ZXHA 3ZDBA 5KFOA 1ZQLA 3BS7A 3RRGA 1XWLA 2VA8A 5J2IA 4Z6DA 8ICGA 2GWSA 1ZQTA 4NXZA 4KX5A 2DF4B 4TUQA 2LM1A 3HT3A 1ZJNA 1ZQEA 3PW2A 4FFDA 7ICSA 1LKYB 1WCLA 2IOHA 3QUBA 4GLXA 2F3NA 3I1YA 2G5HB 4UB1A 2KNJA 5KT6A 8ICTA 4MFAA 5JTIA 4YQWA 1KKXA 4DSJA 7ICGA 1HEKA 1NOMA 4BUGA 1NKEA 1SXDA 3LWLA 5HR6A 4R8UA 3ONNA 5ALVA 4Z6FA 2HHSA 2E5SA 1ZJMA 1CRXA 3SENA 5TISU 1FFUA 1KSPA 2P6UA 3T5JA 5HMLA 4NLBA 2G5IB 4ED1A 7ICLA 5J0SA 2HHUA 3E58A 2M0NA 4UB3A 3HW8A 4QWEA 2GH1A 3EPIA 2JZBA 3EW9A 4Y2TA 1QQ6A 2CPRA 4MEYA 4RUAA 1RYRA 5EE3A 3J81j 2HBLA 3AL0B 4O0IA 5J8YA 4TQSA 3NUQA 4PL2A 3HRDD 3H8SA 4QZHA 1ZQRA 1NJWA 1L3UA 4DSLA 5DBBA 2GLEA 2LM4A 2AQ0A 5F9LA 5DG8A 1PK1B 4Q45A 4B9VA 3L4PA 2QARB 2IBKA 3RH6A 9ICJA 3UQ0A 9ICNA 2JH7A 4F92B 1ZD4A 3GV7B 4IQWA 1TAQA 2LKYA 2B0CA 5KFNA 3K4GA 4E0DA 8ICUA 3ISDA 3KKAC 4DL7A 1X6IA 3C29A 4YD1A 3G6YA 2I5HA 2CRXA 3NVYA 2QB0B 1ZQYA 4Q8EA 2NRTA 3NVWA 3SAFA 4M04A 3L5KA 4RQNA 5F9NA 4P0QA 4Y2QA 4F5RA 3FC4A 5L1LA 5D46A 4FZNA 2W03A 2WHEA 4NY8A 5ALTA 2R8JA 2A1JB 3TKAA 3QXGA 1MQ3A 2ATLA 2QB0A 4KLIA 2I6XA 1SV0A 2HOFA 1ZQUA 4DFKA 2KE7A 1DGJA 2V4RA 4JUZA 3UMGA 1JALA 4YMNA 9ICTA 3AQFA 4CE6A 1HJPA 4DLGA 4XA5A 2ZUDA 4DQRA 4O3MA 1COKA 5E79U 3BJYA 5DBAA 2AH5A 4US8A 3M6KA 4EBDA 1AROP 3CW2C 4B9LA 1ZRNA 2FDRA 2NO5A 4UATA 3EWAA 1DK2A 3AU6A 4B9TA 5DB6A 2H3FA 4I2DA 4U6PA 2BPGA 4PGQA 5EWFA 4OJPA 2IMWP 8ICRA 4KN4A 1S76D 3QZ8A 3TACB 3UPQA 3RR8A 5JUMA 9ICGA 5KFIA 1BPXA 5AI8A 5KFRA 2RQ5A 4PHPA 1SWWA 3HP6A 5ALFA 4YP3A 1CUKA 1QSSA 2KG5A 3ZDDA 1NZPA 2EZYA 5AI4A 2ZIVB 2KJ8A 1FFVA 1ZQHA 4UAZA 5D4BA 2UVVA 2HBMA 3H8MA 4HYKA 3AEVA 4M0AA 4C8LA 4FBUA 3PMLA 4YR0A 3IHQB 1XSNA 3THVA 4DL3A 2YMLA 1KLNA 1SL0A 1S0OA 2IOFK 5J2AA 1X6JA 4J9NA 4O3NA 3KZIU 3SAHA 1KL9A 3UXNA 4EX7A 1L8LA 3HWTA 3C23A 2HHTA 4P4OA 3I76A 2OHFA 5ALNA 5EWGA 3QU7A 1X9MA 2EAPA 3GDXA 4J03A 4EYIB 2ISOA 5ALIA 3UM9A 3TAQA 4RUCA 2J6TA 2A1JA 2G06A 3F2CA 1U49A 4DL5A 2F2AB 1NK5A 4RU9A 4QZFA 1ZXIA 4NM1A 7ICTA 2ZUBA 8ICVA 4UB4A 9ICIA 4F91B 3MGVA 3QUTA 4GC7A 3LWMA 1ECWA 2UVWA 2IOFA 1HUZA 2R8IA 8ICEA 4O3PA 2BKEA 1UT8A 1ZOLA 4EX6A 5KFEA 4DFDA 4DFJA 2F8KA 2XICA 3KKAA 4OD0A 3F2BA 2HVIA 5ALEA 2K8CB 5KAFU 3JPQA 4FS1A 2RDIA 5EE0A 4RPXA 4JWMA 2NRZA 7ICHA 1O03A 5KFMA 4DOCA 5KT2A 2NYVA 5KFQA 1V9PA 4J9LA 2ASJA 3PMNA 1N56A 4KITB 4JV2A 9ICQA 2VJ5A 9ICPA 2PFPA 9ICLA 4KMUA 5J2HA 2PI4A 5ALXA 1C20A 4NLCA 4PZOA 4C4RA 4O3QA 3PNCA 2ODGA 4I2IA 5ALYA 4XRHA 2C2EA 5AKKA 5J2CA 2JEGA 7ICKA 1X66A 2LPEA 4ELVA 2W9CA 1ZQCA 4QW8A 5HHIA 1KFSA 1DXSA 3D2NA 4YN4A 4ED0A 1D8LA 2KJ9A 1F5SA 1L7OA 2W3RA 1DK3A 8ICNA 3IP4B 4GXJA 2IA6A 1ZQKA 3T79A 2K4IA 5AM1A 1RXVA 1XO1A 3ZI4A 3PY8A 3N7RC 2V4QA 1FIQA 5GTIU 4EZ9A 1RDFA 3ZD8A 1BVSA 5G5GA 5KFCA 3GIMA 1LKYA 9ICRA 3OJSA 2MA1A 4J9PA 3KBBA 4UW9A 4ECXA 7ICVA 4C8MA 2DKZA 1WUDA 1TK0A 3ZDCA 4F5PA 1VJ5A 4EBCA 4Y2JA 4Y2YA 4DFPA 1PK3A 1ZQBA 3WKBA 1SL2A 2YB1A 5HHHA 3ZD9A 5AICA 2JRZA 3M7DA 3TFRA 4QZBA 3WKCA 4LVSA 4MFFA 5J0YA 4PGXA 1V38A 2KSOB 5FP0A 3QUQA 5KFZA 4C80A 1A0PA 4QZAA 2C2RA 4B9NA 3TQ1A 3SV3A 4PL1A 4DSKA 4QWBA 3ZDEA 2ZUCA 3ZDAA 8ICQA 3WKEA 2K8BB 1NK0A 2EZZA 1MA7A 4UB5A 1UA0A 2JEFA 3C5GA 4PPXA 1BNPA 2CXYA 1WG8A 4I27A 1Z19A 4C8OA 3NRZA 2H3VA 4J9RA 4AP9A 2QKQA 2MUTA 3RJIA 1QQ5A 3T5HA 3N97B 2C2DA 2FE9A 2KN7A 4QZEA 7ICUA 5B66U 1DOQA 4CF4A 4DO9A 4BDPA 2JXJA 8ICJA 2I9GA 4ECVA 1KFTA 2J6UA 3RH4A 4HAIA 5AKJA 1SZPA 2JEJA 4DSEA 1F44A 8ICZA 4IRKA 2KZZA 1PVRA 3SD7A 3AM9A 2P6RA 1UQVA 3LVVA 3BQ0A 4DFMA 5AI6A 4ED8A 3OGUA 3MBYA 3ISCA 3BQ1A 2KOBA 3WU2U 1L5UA 2KJ5A 3SR6A 2KKPA 3BS5B 5KG5A 4DL2A 2GO7A 2GOLA 1Z4OA 2UVUA 5AKYA 4RPZA 2KVCA 7ICFA 3TANA 4P4MA 1B22A 3MGHA 3SZ2A 4ECTA 4QIWF 4MF8A 2EAOA 2FLLA 3V6HA 2KICA 2HHWA 4DWIA 3OHBA 5C0YA 2KHQA 3HKZC 2CN1A 2KIWA 1D8YA 3KHGA 1FO4A 4DL4A 2LI6A 3RR7A 2A19A 4O5KA 9ICBA 3RJKA 5AKGA 2D8CA 3OJUA 4F4ZA 4OJOA 9ICSA 3RJJA 2W7PA 3B0YA 2G08A 2BCQA 4ACOA 1XC9A 2ZIUA 5IIIA 4ELTA 1KW4A 1EXNA 4FZLA 2QARA 4RQ3A 4CF3A 2XVTA 4PH5A 5KT4A 5DB7A 1BPYA 2XY6A 4Z6CA 1JIHA 3LDAA 4YFKA 4ECWA 2F44A 4ED3A 3SAGA 2FMQA 3JPRA 4QWAA 1B43A 3U26A 3D2SA 3M9NB 9ICHA 4QNLA 1U45A 1NK4A 3IDWA 3GIIA 1ZQFA 9ICVA 5AHXA 5J2JA 4R64A 3RFAA 4RQ1A 5DLGA 3CNHA 5J0RA 1TKDA 1S0NA 3MC1A 2HOIA 3Q8QB 3PSFA 3HPOA 5CRXA 3HX0A 5IIOA 1L3TA 2PMZF 2OEHA 3H0LB 2PFOA 2OXOA 2W04A 2WF7A 3GV5B 4Y2XA 2MUTB 4Y2UA 1JUDA 1IM4A 1X40A 1NJYA 3IG5A 2KZ3A 2W9BA 1Z1VA 1D9FA 3CYMA 2KIVA 5CA7A 2BPCA 1X9WA 4F5NA 5IIJA 2O6KA 2WF9A 1SZHA 1PZNA 5CHGA 4RQMA 2FPMA 3M9MB 3KZXA 4IR9A 1T3QA 3ORYA 3PSTA 7ICQA 2JEIA 1RQLA 1JN3A 2EH9A 3IG8A 1NI3A 4KN7A 4K4GA 3IRUA 1X9SA 5AIBA 5L1JA 4RQ6A 2RLTA 3M6ZA 1IIPA 2UVRA 1KBUA 5GTHU 2VA3A 4YMOA 2E3TA 5KT3A 1S9FA 1ZQDA 1WWUA 4OJLA 3RBDA 1M6YA 3BS5A 1JXLA 1TFRA 8ICYA 1YZ6A 2YTUA 1ZQ1C 3BQ7A 3UQ2A 3Q8SB 3HJEA 4DSFA 8ICPA 4AYBC 1LV5A 5G5HA 3VCBA 4B6JA 4RQ5A 8ICXA 2RDJA 5J8YC 4F5QA 3FYHA 1QTMA 4ECYA 4QIWC 4NL9C 2BQ3A 2RP5A 4B9SA 2DPIA 1OXJA 1Q8KA 4MFCA 5AKHA 5L1KA 2E8MA 5DGAA 2E8PA 2VA2A 3QE9Y 8ICIA 1RYSA 2PFQA 2JV3A 2PFNA 4GIBA 2JH1A 2JHDA 3RTVA 1RXWA 1KEJA 1SKWA 1U47A 2BQRA 3AQEA 2MRLA 5KG2A 3BDPA 5KT5A 5L9XA 1IG6A 4P2HA 2KFNA 3N28A 3E2EA 3PR5B 4I28A 3ETRA 2BHNA 1K1QA 2W3SA 3WKDA 3BQ2A 4M2YA 1VDVA 5KG6A 3MABA 2YB4A 3D6JA 2HBKA 4F93B 1L8OA 1ZQMA 1ZYQA 5J2GA 2VKQA 3QU5A 2OM6A 4BX9C 2E1FA 1S0MA 3JPSA 5HR7A 1WYGA 1LB2B 3RJEA 3IN5A 3VC8A 4R65A 5A0LA 4OJ5A 1L6NA 2DQNB 1MSWD 4QWDA 1KN5A 8ICMA 1D9DA 2Y1JA 3MR5A 2E1EA 2FMPA 1Q3VA 4QWCA 1RPLA 2IHNA 3F53A 3WK6A 4J9MA 3E0FA 1NKCA 2YQEA 2N1RA 2YN4A 4F72A 4EZ6A 5B5EU 2KP7A 1KFDA 5AK4A 3EYZA 4EBEA 3TADA 1IXRA 4BWMA 2NV3A 3NVVA 4GXIA 4Y2VA 4DF8A 2K4HA 4PHAA 4C4TA 4YXJA 1PVPA 7ICIA 4P0PB 3A0BU 1XSPA 3SI8A 4KLJA 5KFUA 4C7YA 4YR3A 2K8AA 2Q0ZX 4IL6U 3GV8B 3PVXA 3GILA 9ICWA 1ZQQA 5H2FU 2WB1F 5BPCA 2ZIVA 3EZ5A 2HHQA 1T7PA 2R8KA 2HHXA 3C2LA 2YMQA 2P35A 3FAHA 2P66A 3IV6A 1L3VA 4KLDA 4I2FA 2H3QA 4KMOB 1S97A 3B0XA 2OYYA 4DQIA 4MHVA 1JMSA 5AKIA 5TZVA 3M8RA 4CDGA 5F3XB 5AIAA 2RHFA 2F1JA 2OCEA 5J0XA 3Q8RB 2B21A 2WB1C 3C5FA 2AU0A 3GIJA 1D8BA 2AHOB 5ALOA 4TQRA 5EE9A 4R8UB 2F76X 4M9NA 2F1HA 3V72A 3WK9A 4ECQA 4KLLA 2W55A 3N7PD 4EEYA 4R63A 5DGBA 3MDCA 1BPDA 2FI1A 3EUB2 5DB9A 4FO6A 1T4GA 4RT2A 3RBEA 9ICFA 2Y9TA 2BR0A 1UT5A 9ICUA 1N60A 4NL9A 4PJ0U 1U4BA 2F1IA 4QZGA 3WK5A 4JV1A 5AK3A 4ZOHC 5ALQA 4DS5A 5DG9A 4EENA 1ZQIA 5KG1A 1NK8A 4DQPA 3PW4A 5AM3A 4NLNA 4UARA 4QZIA 4YVZA 3PR4A 3T5KA 4R66A 4P0QB 2LYAA 5DBCA 3WK4A 1PUZA 4Y2SA 3AN1A 3SMVA 4M9HA 4NM2A 3H40A 1K1SA 2KFZA 3M1YA 2BCUA 2XIDA 5K4LA 2PXIA 4MF2A 1AQ6A 4IC9A 4QZCA 3PW5A 3TARA 2W11A 1XO0A 1TK5A 1S77D 2W9CB 4KLHA 4XQ8A 2OWOA 2BCVA 2LMRA 3Q8PB 1U48A 4LJXA 3Q8MA 1RZTA 3RAXA 4F4YA 1H38A 5J0PA 4C7ZA 3ICXA 2QB1A 8ICWA 2EZXA 2ZTDA 1X2IA 5KFFA 5J0QA 3CRXA 4J9QA 4MEXA 4M9JA 4BXOB 3QEBZ 2XO7A 4ZH4A 4M9GA 4I2GA 2Z7JA 5AK6A 4DSIA 2JGAA 5KFYA 3KOOA 4BXOA 2ESEA 2ZJ8A 4RZRA 5J2KA 4GFJA 4F5OA 3PSPA 1J2NA 4UAYA 5AI5A 1JI7A 5AI9A 1K5OA 2K60A 1ZD2P 4YG2A 1BPEA 2BDPA 4LZGA 4OCZA 1BPBA 2LHTA 5J0WA 3RJGA 4J9OA 2E8NA 3QU4A 2XI9A 1L3SA 1YT3A 5ALJA 2VJ4A 5AM4A 3PO5A 4B9UA 2HSZA 1WWVA 9ICKA 4NWIA 3C2KA 3JPTA 2MU2A 4USAA 5EE1A 4ELUA 5ALMA 4CRXA 3H7IA 1ZQXA 3GIKA 5AKXA 1YZ7A 1MN8A 2DKXA 7ICPA 1SKRA 4QZ9A 2YMMA 3D2QA 4UBCA 1X42A 2EAMA 3JPOA 3TAPA 1J2MA 4KLEA 5J29A 2PKEA 4IQTA 4US9A 2AGPA 4I2HA 2D3DA 2HMXA 2A3VA 2ZJ5A 3N7SC 1N5WA 5ALUA 1JX4A 4YR2A 2W54A 8ICCA 5T14A 5IIMA 4ED7A 3K75D 2FPKA 1Z3EB 2OH2A 3RJHA 1ZQGA 4B9MA 5ALSA 2ZIWA 2XC9A 2W8KA 2HVHA 2DL0A 4I29A 4DLEA 1ZRMA 1KDHA 1XS9D 1LVHA 1QSYA 1T8EA 2WF6A 4CGZA 2W9BB 4P4PA 1KTQA 4IR1A 1Z00B 4RQ4A 1NZBA 2WFAA 3MFIA 2WTFA 1RQNA 2Y0SC 2K89A 1B4FA 1JROA 4EYHB 3PW7A 2R18A 2W9AA 4DS4A 2PMZC 4M6WA 2BCRA 2NRWA 9ICCA 3SEIA 4TUPA 4NV0A 1Z4NA 1ZQVA 1COOA 2XCPA 3V7JA 4F8RA 5AM2A 8ICFA 3PZPA 4Z6EA 1SL1A 3G6XA 5JRTA 1QLNA 2F77X 1NJZA 4O9MA 4NLGA 5ALPA 3UXOA 4DQQA 4J9SA 5AK5A 5KFTA 3Q8LA 3KFUF 1N61A 4CNQA 4LZDA 4FZMA 3QEAZ 4JB3A 2G0AA 1NKBA 4BWJA 3JPPA 3SYZA 4C8KA 1Q46A 1V97A 4K4IA 2ZIXA 3MR6A 3RH5A 4JV0A 4YCXA 4JWNA 1RYUA 2AQ4A 2HI0A 5DG7A 4PZNA 2HHVA 1A6SA 5HMMA 5DQGA 1L7PA 5KFXA 2WF5A 5KFKA 3H4DA 2BCSA 1B0XA 5KFGA 1SXEA 7ICMA 5J2FA 5KG4A 2NRVA 3F5EA 1N2XA 3OSPA 2W7OA 2XY7A 4F71A 3PX6A 1ZD5A 5L1MA 1BPZA 5CB1A 2R8HA 1SIJA 4RNNA 3BZCA 5KG3A 2BPFA 2RRDA 2K4EA 5IIKA 4YD2A 2HOQA 2DFLA 5CEHA 2HCFA 1S5LU 4U7CA 4F4KA 1ZQSA 4RQ7A 5DLFA 4JMUA 1Z00A 1GO3F 3NTUA 3H8JA 1QQ7A 2JZBB 4CCHA 1FEZA 7ICOA 4PGYA 1QSLA 2DBYA 3NRWA 2DWQA 1N63A 3RJFA 4O3OA 3Q8KA 2AGQA 4F4XA 5KT7A 3AMZA 4O3RA 3PV8A 1SKSA 2W9MA 3R9KA 2HW3A 3WK7A 3L3FX 5KNIA 3H0MB 4O3SA 4KLMA 2ASLA 2ZIWB 5KFLA 2ZJAA 2DPJA 5AI0A 7ICJA 4G3IA 2VANA 4ECZA 3T5LA 3TADC 1SGGA 5CP2A 5HNKA 1KRPA 2PI5A 3C1ZA 4KLQA 2B6GA 1F0MA 5KFHA 5ALDA 2FLNA 3K1RB 5KFDA 2F8LA 4X5VA 1XSLA 1BGXT 1S10A 4UBBA 4XUSA 1OUQA 1O08A 5KG0A 5DDYA 4M47A 1NJXA 4IRDA 2Y1IA 3KTQA 2I1QA 5C5JA 2YMPA 4FS2A 3ETLA 3LYSA 2KSOA 1ZQZA 1URJA 2L5YA 2FLPA 4F2SA 3UMCA 1UCVA 2BDUA 2KD1A 4ICAA 3S6JA 9ICMA 2ZG6A 3K1ZA 3PW0A 8ICLA 4GC6A 5ALKA 9ICXA 1CEZA 5ALZA 1A76A 2EQYA 5DKWA 1ZETA 3IM1A 4DL6A 4I2BA 5KFVA 5IINA 5KTQA 2WAQF 5ALLA 1L7NA 3V6JA 1DGSA 5KFAA 3NS1A 1XU4A 3H4BA 8ICKA 3GZFA 4M9LA 2H3ZA 2NO4A 3TI0A 3QYPA 4ECRA 5BOLA 2AJQA 4UAVA 1C7YA 2KMDA 2AGOA 4C4SA 5DB8A 1UHUA 1QH9A 4ED6A 1PK1A 2NRXA 3QU9A 4EELA 2DUYA 1UPHA 2ZTEA 4RPYA 4IRCA 5J0OA 4A8EA 1S0VA 2AXTU 4ECSA 5DQHA 3N4MB 3PO4A 4FE3A 5KG7A 1NK7A 7ICEA 5J0TA 7ICRA 3H8WA 2BQUA 1S8OA
chains in the Genus database with same CATH topology
1IG6A 5K4LA 2EH9A 2RQ5A 1KKXA 1C20A 1RYUA 2JXJA 5CEHA 1KQQA 2JRZA 2CXYA 2LI6A 1KN5A 2YQEA 2LM1A 4LJXA 2OEHA 2EQYA 2KK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG6 A;  5K4L A;  2EH9 A;  2RQ5 A;  1KKX A;  1C20 A;  1RYU A;  2JXJ A;  5CEH A;  1KQQ A;  2JRZ A;  2CXY A;  2LI6 A;  1KN5 A;  2YQE A;  2LM1 A;  4LJX A;  2OEH A;  2EQY A;  2KK0 A; 
#chains in the Genus database with same CATH topology
 1ZQO A;  3V7K A;  2J6S A;  4Q43 A;  4OJ6 A;  2LYH A;  1JXE A;  3BZK A;  1L7M A;  4RQ8 A;  4IS7 A;  2BZF A;  4AYB F;  5KL1 B;  5KAI U;  8ICA A;  4RNO A;  4O5E A;  4C8N A;  1KQQ A;  4F3O A;  3GQC A;  3QU2 A;  3RB4 A;  2H3I A;  4YMM A;  4RT3 A;  1HUO A;  2WF8 A;  4ECU A;  4FBT A;  2C28 A;  4DEZ A;  4J9K A;  3GU3 A;  4Y2R A;  3AUO A;  3CP8 A;  1NNL A;  1QCK A;  5ALG A;  1A77 A;  2FPL A;  8ICB A;  3KHL A;  3V6K A;  2ZIU B;  3MFH A;  4NJ8 A;  4RNM A;  4UAU A;  4NLK A;  3KHH A;  5KFB A;  3RB0 A;  1TV9 A;  2LYB A;  3NAS A;  1HIW A;  5AKZ A;  3T3F A;  4UB6 U;  1ZQJ A;  2K4P A;  1MC8 A;  3NVZ A;  4TUS A;  2ZIX B;  2KTQ A;  2ASD A;  2ZTC A;  1PVQ A;  4PHD A;  5AM0 A;  3M8S A;  1X9X A;  5ALW A;  3DV9 A;  4OO1 J;  5D49 A;  1N5X A;  4IQU A;  1VLB A;  4QW9 A;  2BGW A;  8ICS A;  2FMS A;  3MDA A;  3RB6 A;  4DF4 A;  2YY6 A;  2EAN A;  3RF9 A;  1T94 A;  3RB3 A;  1ZD3 A;  4CF5 A;  3ISB A;  3RRH A;  5BOM A;  1IV8 A;  2XGP A;  1N62 A;  4YXM A;  5ALH A;  5J2E A;  2R8G A;  2A1A A;  5EOZ A;  3UXP A;  3LK9 A;  9ICE A;  2YX8 A;  4BJQ A;  1TAU A;  3LVW A;  2JMG A;  3PX4 A;  5KFS A;  1ZQA A;  2XGQ A;  2V9W A;  4QZ8 A;  3MR2 A;  4K4H A;  4KLU A;  1RM6 C;  4F4W A;  3OTQ A;  1T3N A;  1DRG A;  2KEY A;  3JPN A;  4F2R A;  2Q4T A;  4DCC A;  5DQI A;  2HBJ A;  3SQI A;  4P0P A;  5J2B A;  3SV4 A;  5ALR A;  4O5C A;  5CR0 A;  2W8L A;  2M9N A;  2HDO A;  2D6F C;  3H0R B;  1SB3 C;  4KLF A;  4IQV A;  3TFS A;  1SWV A;  1Y88 A;  4TUR A;  4DOB A;  5EWE A;  5KL8 B;  2H5X A;  5AKE A;  3G6V A;  2KV2 A;  1Z1B A;  3C21 A;  3HIL A;  3DEE A;  3MGI A;  1Q3U A;  2XY5 A;  2DGZ A;  4Y2P A;  3NGD A;  1UA1 A;  3I28 A;  3KD3 A;  4BGD A;  3GFK B;  2FJ6 A;  8ICH A;  1V85 A;  3A0H U;  4I2J A;  3OSN A;  3F2D A;  4I2C A;  2VIX A;  1TK8 A;  5IIL A;  1SV0 C;  4Q44 A;  3OHA A;  2G07 A;  5L1I A;  2EDU A;  3FM9 A;  1TVA A;  2QLT A;  3F5A A;  1N48 A;  2KHV A;  4C0Z A;  4PHE A;  1U9L A;  1ZQN A;  3O0F A;  4QJF B;  2KK0 A;  4KLO A;  3C28 A;  4RQ2 A;  3UMB A;  2MSN A;  4UAS A;  4JK1 A;  3AU2 A;  5CWR A;  1TE2 A;  4WJ3 B;  3C1Y A;  3C2M A;  3KHR A;  1ZQP A;  3OPX A;  5HP4 A;  1TAM A;  4UAW A;  5KFJ A;  2KVS A;  3B9J A;  3PX0 A;  3WKA A;  2ISP A;  3PSI A;  4KLS A;  1WCN A;  1JRP A;  1XNS A;  2LBO A;  3QZ7 A;  2ES6 A;  5AKL A;  1P7D A;  4Q8F A;  3MR3 A;  2E8O A;  2Y0S F;  2XCA A;  4G9B A;  5KFW A;  2Y9U A;  4F50 A;  1BNO A;  1NK9 A;  4KLT A;  3BQT A;  8ICO A;  5J2D A;  2ALZ A;  4DOA A;  5CJ7 A;  2KKV A;  3FDS A;  4M6W B;  2KZM A;  3QX7 A;  5DDM A;  1ED1 A;  1RG6 A;  7ICN A;  5KFP A;  2JR5 A;  2WAQ C;  4I2E A;  4KX3 A;  5AM5 A;  4QZD A;  4EEK A;  3ALR A;  4ED2 A;  4UQG A;  3M9O B;  4KLG A;  3ED5 A;  1OW5 A;  2C22 A;  5J0U A;  1J97 A;  9ICA A;  5JU5 A;  3RAQ A;  2MAX A;  1NK6 A;  3EPG A;  4RQ0 A;  4NLZ A;  2W43 A;  1CI4 A;  1SV4 A;  2G09 A;  3V7L A;  3DDH A;  2IHM A;  9ICO A;  4I2A A;  4UB8 U;  2ZXI A;  1MQ2 A;  3QNM A;  1ZQW A;  4KTQ A;  3WK8 A;  4GXK A;  4UB2 A;  4DQS A;  3QUC A;  3HKZ F;  2ZXH A;  3ZDB A;  5KFO A;  1ZQL A;  3BS7 A;  3RRG A;  1XWL A;  2VA8 A;  5J2I A;  4Z6D A;  8ICG A;  2GWS A;  1ZQT A;  4NXZ A;  4KX5 A;  2DF4 B;  4TUQ A;  2LM1 A;  3HT3 A;  1ZJN A;  1ZQE A;  3PW2 A;  4FFD A;  7ICS A;  1LKY B;  1WCL A;  2IOH A;  3QUB A;  4GLX A;  2F3N A;  3I1Y A;  2G5H B;  4UB1 A;  2KNJ A;  5KT6 A;  8ICT A;  4MFA A;  5JTI A;  4YQW A;  1KKX A;  4DSJ A;  7ICG A;  1HEK A;  1NOM A;  4BUG A;  1NKE A;  1SXD A;  3LWL A;  5HR6 A;  4R8U A;  3ONN A;  5ALV A;  4Z6F A;  2HHS A;  2E5S A;  1ZJM A;  1CRX A;  3SEN A;  5TIS U;  1FFU A;  1KSP A;  2P6U A;  3T5J A;  5HML A;  4NLB A;  2G5I B;  4ED1 A;  7ICL A;  5J0S A;  2HHU A;  3E58 A;  2M0N A;  4UB3 A;  3HW8 A;  4QWE A;  2GH1 A;  3EPI A;  2JZB A;  3EW9 A;  4Y2T A;  1QQ6 A;  2CPR A;  4MEY A;  4RUA A;  1RYR A;  5EE3 A;  3J81 j;  2HBL A;  3AL0 B;  4O0I A;  5J8Y A;  4TQS A;  3NUQ A;  4PL2 A;  3HRD D;  3H8S A;  4QZH A;  1ZQR A;  1NJW A;  1L3U A;  4DSL A;  5DBB A;  2GLE A;  2LM4 A;  2AQ0 A;  5F9L A;  5DG8 A;  1PK1 B;  4Q45 A;  4B9V A;  3L4P A;  2QAR B;  2IBK A;  3RH6 A;  9ICJ A;  3UQ0 A;  9ICN A;  2JH7 A;  4F92 B;  1ZD4 A;  3GV7 B;  4IQW A;  1TAQ A;  2LKY A;  2B0C A;  5KFN A;  3K4G A;  4E0D A;  8ICU A;  3ISD A;  3KKA C;  4DL7 A;  1X6I A;  3C29 A;  4YD1 A;  3G6Y A;  2I5H A;  2CRX A;  3NVY A;  2QB0 B;  1ZQY A;  4Q8E A;  2NRT A;  3NVW A;  3SAF A;  4M04 A;  3L5K A;  4RQN A;  5F9N A;  4P0Q A;  4Y2Q A;  4F5R A;  3FC4 A;  5L1L A;  5D46 A;  4FZN A;  2W03 A;  2WHE A;  4NY8 A;  5ALT A;  2R8J A;  2A1J B;  3TKA A;  3QXG A;  1MQ3 A;  2ATL A;  2QB0 A;  4KLI A;  2I6X A;  1SV0 A;  2HOF A;  1ZQU A;  4DFK A;  2KE7 A;  1DGJ A;  2V4R A;  4JUZ A;  3UMG A;  1JAL A;  4YMN A;  9ICT A;  3AQF A;  4CE6 A;  1HJP A;  4DLG A;  4XA5 A;  2ZUD A;  4DQR A;  4O3M A;  1COK A;  5E79 U;  3BJY A;  5DBA A;  2AH5 A;  4US8 A;  3M6K A;  4EBD A;  1ARO P;  3CW2 C;  4B9L A;  1ZRN A;  2FDR A;  2NO5 A;  4UAT A;  3EWA A;  1DK2 A;  3AU6 A;  4B9T A;  5DB6 A;  2H3F A;  4I2D A;  4U6P A;  2BPG A;  4PGQ A;  5EWF A;  4OJP A;  2IMW P;  8ICR A;  4KN4 A;  1S76 D;  3QZ8 A;  3TAC B;  3UPQ A;  3RR8 A;  5JUM A;  9ICG A;  5KFI A;  1BPX A;  5AI8 A;  5KFR A;  2RQ5 A;  4PHP A;  1SWW A;  3HP6 A;  5ALF A;  4YP3 A;  1CUK A;  1QSS A;  2KG5 A;  3ZDD A;  1NZP A;  2EZY A;  5AI4 A;  2ZIV B;  2KJ8 A;  1FFV A;  1ZQH A;  4UAZ A;  5D4B A;  2UVV A;  2HBM A;  3H8M A;  4HYK A;  3AEV A;  4M0A A;  4C8L A;  4FBU A;  3PML A;  4YR0 A;  3IHQ B;  1XSN A;  3THV A;  4DL3 A;  2YML A;  1KLN A;  1SL0 A;  1S0O A;  2IOF K;  5J2A A;  1X6J A;  4J9N A;  4O3N A;  3KZI U;  3SAH A;  1KL9 A;  3UXN A;  4EX7 A;  1L8L A;  3HWT A;  3C23 A;  2HHT A;  4P4O A;  3I76 A;  2OHF A;  5ALN A;  5EWG A;  3QU7 A;  1X9M A;  2EAP A;  3GDX A;  4J03 A;  4EYI B;  2ISO A;  5ALI A;  3UM9 A;  3TAQ A;  4RUC A;  2J6T A;  2A1J A;  2G06 A;  3F2C A;  1U49 A;  4DL5 A;  2F2A B;  1NK5 A;  4RU9 A;  4QZF A;  1ZXI A;  4NM1 A;  7ICT A;  2ZUB A;  8ICV A;  4UB4 A;  9ICI A;  4F91 B;  3MGV A;  3QUT A;  4GC7 A;  3LWM A;  1ECW A;  2UVW A;  2IOF A;  1HUZ A;  2R8I A;  8ICE A;  4O3P A;  2BKE A;  1UT8 A;  1ZOL A;  4EX6 A;  5KFE A;  4DFD A;  4DFJ A;  2F8K A;  2XIC A;  3KKA A;  4OD0 A;  3F2B A;  2HVI A;  5ALE A;  2K8C B;  5KAF U;  3JPQ A;  4FS1 A;  2RDI A;  5EE0 A;  4RPX A;  4JWM A;  2NRZ A;  7ICH A;  1O03 A;  5KFM A;  4DOC A;  5KT2 A;  2NYV A;  5KFQ A;  1V9P A;  4J9L A;  2ASJ A;  3PMN A;  1N56 A;  4KIT B;  4JV2 A;  9ICQ A;  2VJ5 A;  9ICP A;  2PFP A;  9ICL A;  4KMU A;  5J2H A;  2PI4 A;  5ALX A;  1C20 A;  4NLC A;  4PZO A;  4C4R A;  4O3Q A;  3PNC A;  2ODG A;  4I2I A;  5ALY A;  4XRH A;  2C2E A;  5AKK A;  5J2C A;  2JEG A;  7ICK A;  1X66 A;  2LPE A;  4ELV A;  2W9C A;  1ZQC A;  4QW8 A;  5HHI A;  1KFS A;  1DXS A;  3D2N A;  4YN4 A;  4ED0 A;  1D8L A;  2KJ9 A;  1F5S A;  1L7O A;  2W3R A;  1DK3 A;  8ICN A;  3IP4 B;  4GXJ A;  2IA6 A;  1ZQK A;  3T79 A;  2K4I A;  5AM1 A;  1RXV A;  1XO1 A;  3ZI4 A;  3PY8 A;  3N7R C;  2V4Q A;  1FIQ A;  5GTI U;  4EZ9 A;  1RDF A;  3ZD8 A;  1BVS A;  5G5G A;  5KFC A;  3GIM A;  1LKY A;  9ICR A;  3OJS A;  2MA1 A;  4J9P A;  3KBB A;  4UW9 A;  4ECX A;  7ICV A;  4C8M A;  2DKZ A;  1WUD A;  1TK0 A;  3ZDC A;  4F5P A;  1VJ5 A;  4EBC A;  4Y2J A;  4Y2Y A;  4DFP A;  1PK3 A;  1ZQB A;  3WKB A;  1SL2 A;  2YB1 A;  5HHH A;  3ZD9 A;  5AIC A;  2JRZ A;  3M7D A;  3TFR A;  4QZB A;  3WKC A;  4LVS A;  4MFF A;  5J0Y A;  4PGX A;  1V38 A;  2KSO B;  5FP0 A;  3QUQ A;  5KFZ A;  4C80 A;  1A0P A;  4QZA A;  2C2R A;  4B9N A;  3TQ1 A;  3SV3 A;  4PL1 A;  4DSK A;  4QWB A;  3ZDE A;  2ZUC A;  3ZDA A;  8ICQ A;  3WKE A;  2K8B B;  1NK0 A;  2EZZ A;  1MA7 A;  4UB5 A;  1UA0 A;  2JEF A;  3C5G A;  4PPX A;  1BNP A;  2CXY A;  1WG8 A;  4I27 A;  1Z19 A;  4C8O A;  3NRZ A;  2H3V A;  4J9R A;  4AP9 A;  2QKQ A;  2MUT A;  3RJI A;  1QQ5 A;  3T5H A;  3N97 B;  2C2D A;  2FE9 A;  2KN7 A;  4QZE A;  7ICU A;  5B66 U;  1DOQ A;  4CF4 A;  4DO9 A;  4BDP A;  2JXJ A;  8ICJ A;  2I9G A;  4ECV A;  1KFT A;  2J6U A;  3RH4 A;  4HAI A;  5AKJ A;  1SZP A;  2JEJ A;  4DSE A;  1F44 A;  8ICZ A;  4IRK A;  2KZZ A;  1PVR A;  3SD7 A;  3AM9 A;  2P6R A;  1UQV A;  3LVV A;  3BQ0 A;  4DFM A;  5AI6 A;  4ED8 A;  3OGU A;  3MBY A;  3ISC A;  3BQ1 A;  2KOB A;  3WU2 U;  1L5U A;  2KJ5 A;  3SR6 A;  2KKP A;  3BS5 B;  5KG5 A;  4DL2 A;  2GO7 A;  2GOL A;  1Z4O A;  2UVU A;  5AKY A;  4RPZ A;  2KVC A;  7ICF A;  3TAN A;  4P4M A;  1B22 A;  3MGH A;  3SZ2 A;  4ECT A;  4QIW F;  4MF8 A;  2EAO A;  2FLL A;  3V6H A;  2KIC A;  2HHW A;  4DWI A;  3OHB A;  5C0Y A;  2KHQ A;  3HKZ C;  2CN1 A;  2KIW A;  1D8Y A;  3KHG A;  1FO4 A;  4DL4 A;  2LI6 A;  3RR7 A;  2A19 A;  4O5K A;  9ICB A;  3RJK A;  5AKG A;  2D8C A;  3OJU A;  4F4Z A;  4OJO A;  9ICS A;  3RJJ A;  2W7P A;  3B0Y A;  2G08 A;  2BCQ A;  4ACO A;  1XC9 A;  2ZIU A;  5III A;  4ELT A;  1KW4 A;  1EXN A;  4FZL A;  2QAR A;  4RQ3 A;  4CF3 A;  2XVT A;  4PH5 A;  5KT4 A;  5DB7 A;  1BPY A;  2XY6 A;  4Z6C A;  1JIH A;  3LDA A;  4YFK A;  4ECW A;  2F44 A;  4ED3 A;  3SAG A;  2FMQ A;  3JPR A;  4QWA A;  1B43 A;  3U26 A;  3D2S A;  3M9N B;  9ICH A;  4QNL A;  1U45 A;  1NK4 A;  3IDW A;  3GII A;  1ZQF A;  9ICV A;  5AHX A;  5J2J A;  4R64 A;  3RFA A;  4RQ1 A;  5DLG A;  3CNH A;  5J0R A;  1TKD A;  1S0N A;  3MC1 A;  2HOI A;  3Q8Q B;  3PSF A;  3HPO A;  5CRX A;  3HX0 A;  5IIO A;  1L3T A;  2PMZ F;  2OEH A;  3H0L B;  2PFO A;  2OXO A;  2W04 A;  2WF7 A;  3GV5 B;  4Y2X A;  2MUT B;  4Y2U A;  1JUD A;  1IM4 A;  1X40 A;  1NJY A;  3IG5 A;  2KZ3 A;  2W9B A;  1Z1V A;  1D9F A;  3CYM A;  2KIV A;  5CA7 A;  2BPC A;  1X9W A;  4F5N A;  5IIJ A;  2O6K A;  2WF9 A;  1SZH A;  1PZN A;  5CHG A;  4RQM A;  2FPM A;  3M9M B;  3KZX A;  4IR9 A;  1T3Q A;  3ORY A;  3PST A;  7ICQ A;  2JEI A;  1RQL A;  1JN3 A;  2EH9 A;  3IG8 A;  1NI3 A;  4KN7 A;  4K4G A;  3IRU A;  1X9S A;  5AIB A;  5L1J A;  4RQ6 A;  2RLT A;  3M6Z A;  1IIP A;  2UVR A;  1KBU A;  5GTH U;  2VA3 A;  4YMO A;  2E3T A;  5KT3 A;  1S9F A;  1ZQD A;  1WWU A;  4OJL A;  3RBD A;  1M6Y A;  3BS5 A;  1JXL A;  1TFR A;  8ICY A;  1YZ6 A;  2YTU A;  1ZQ1 C;  3BQ7 A;  3UQ2 A;  3Q8S B;  3HJE A;  4DSF A;  8ICP A;  4AYB C;  1LV5 A;  5G5H A;  3VCB A;  4B6J A;  4RQ5 A;  8ICX A;  2RDJ A;  5J8Y C;  4F5Q A;  3FYH A;  1QTM A;  4ECY A;  4QIW C;  4NL9 C;  2BQ3 A;  2RP5 A;  4B9S A;  2DPI A;  1OXJ A;  1Q8K A;  4MFC A;  5AKH A;  5L1K A;  2E8M A;  5DGA A;  2E8P A;  2VA2 A;  3QE9 Y;  8ICI A;  1RYS A;  2PFQ A;  2JV3 A;  2PFN A;  4GIB A;  2JH1 A;  2JHD A;  3RTV A;  1RXW A;  1KEJ A;  1SKW A;  1U47 A;  2BQR A;  3AQE A;  2MRL A;  5KG2 A;  3BDP A;  5KT5 A;  5L9X A;  1IG6 A;  4P2H A;  2KFN A;  3N28 A;  3E2E A;  3PR5 B;  4I28 A;  3ETR A;  2BHN A;  1K1Q A;  2W3S A;  3WKD A;  3BQ2 A;  4M2Y A;  1VDV A;  5KG6 A;  3MAB A;  2YB4 A;  3D6J A;  2HBK A;  4F93 B;  1L8O A;  1ZQM A;  1ZYQ A;  5J2G A;  2VKQ A;  3QU5 A;  2OM6 A;  4BX9 C;  2E1F A;  1S0M A;  3JPS A;  5HR7 A;  1WYG A;  1LB2 B;  3RJE A;  3IN5 A;  3VC8 A;  4R65 A;  5A0L A;  4OJ5 A;  1L6N A;  2DQN B;  1MSW D;  4QWD A;  1KN5 A;  8ICM A;  1D9D A;  2Y1J A;  3MR5 A;  2E1E A;  2FMP A;  1Q3V A;  4QWC A;  1RPL A;  2IHN A;  3F53 A;  3WK6 A;  4J9M A;  3E0F A;  1NKC A;  2YQE A;  2N1R A;  2YN4 A;  4F72 A;  4EZ6 A;  5B5E U;  2KP7 A;  1KFD A;  5AK4 A;  3EYZ A;  4EBE A;  3TAD A;  1IXR A;  4BWM A;  2NV3 A;  3NVV A;  4GXI A;  4Y2V A;  4DF8 A;  2K4H A;  4PHA A;  4C4T A;  4YXJ A;  1PVP A;  7ICI A;  4P0P B;  3A0B U;  1XSP A;  3SI8 A;  4KLJ A;  5KFU A;  4C7Y A;  4YR3 A;  2K8A A;  2Q0Z X;  4IL6 U;  3GV8 B;  3PVX A;  3GIL A;  9ICW A;  1ZQQ A;  5H2F U;  2WB1 F;  5BPC A;  2ZIV A;  3EZ5 A;  2HHQ A;  1T7P A;  2R8K A;  2HHX A;  3C2L A;  2YMQ A;  2P35 A;  3FAH A;  2P66 A;  3IV6 A;  1L3V A;  4KLD A;  4I2F A;  2H3Q A;  4KMO B;  1S97 A;  3B0X A;  2OYY A;  4DQI A;  4MHV A;  1JMS A;  5AKI A;  5TZV A;  3M8R A;  4CDG A;  5F3X B;  5AIA A;  2RHF A;  2F1J A;  2OCE A;  5J0X A;  3Q8R B;  2B21 A;  2WB1 C;  3C5F A;  2AU0 A;  3GIJ A;  1D8B A;  2AHO B;  5ALO A;  4TQR A;  5EE9 A;  4R8U B;  2F76 X;  4M9N A;  2F1H A;  3V72 A;  3WK9 A;  4ECQ A;  4KLL A;  2W55 A;  3N7P D;  4EEY A;  4R63 A;  5DGB A;  3MDC A;  1BPD A;  2FI1 A;  3EUB 2;  5DB9 A;  4FO6 A;  1T4G A;  4RT2 A;  3RBE A;  9ICF A;  2Y9T A;  2BR0 A;  1UT5 A;  9ICU A;  1N60 A;  4NL9 A;  4PJ0 U;  1U4B A;  2F1I A;  4QZG A;  3WK5 A;  4JV1 A;  5AK3 A;  4ZOH C;  5ALQ A;  4DS5 A;  5DG9 A;  4EEN A;  1ZQI A;  5KG1 A;  1NK8 A;  4DQP A;  3PW4 A;  5AM3 A;  4NLN A;  4UAR A;  4QZI A;  4YVZ A;  3PR4 A;  3T5K A;  4R66 A;  4P0Q B;  2LYA A;  5DBC A;  3WK4 A;  1PUZ A;  4Y2S A;  3AN1 A;  3SMV A;  4M9H A;  4NM2 A;  3H40 A;  1K1S A;  2KFZ A;  3M1Y A;  2BCU A;  2XID A;  5K4L A;  2PXI A;  4MF2 A;  1AQ6 A;  4IC9 A;  4QZC A;  3PW5 A;  3TAR A;  2W11 A;  1XO0 A;  1TK5 A;  1S77 D;  2W9C B;  4KLH A;  4XQ8 A;  2OWO A;  2BCV A;  2LMR A;  3Q8P B;  1U48 A;  4LJX A;  3Q8M A;  1RZT A;  3RAX A;  4F4Y A;  1H38 A;  5J0P A;  4C7Z A;  3ICX A;  2QB1 A;  8ICW A;  2EZX A;  2ZTD A;  1X2I A;  5KFF A;  5J0Q A;  3CRX A;  4J9Q A;  4MEX A;  4M9J A;  4BXO B;  3QEB Z;  2XO7 A;  4ZH4 A;  4M9G A;  4I2G A;  2Z7J A;  5AK6 A;  4DSI A;  2JGA A;  5KFY A;  3KOO A;  4BXO A;  2ESE A;  2ZJ8 A;  4RZR A;  5J2K A;  4GFJ A;  4F5O A;  3PSP A;  1J2N A;  4UAY A;  5AI5 A;  1JI7 A;  5AI9 A;  1K5O A;  2K60 A;  1ZD2 P;  4YG2 A;  1BPE A;  2BDP A;  4LZG A;  4OCZ A;  1BPB A;  2LHT A;  5J0W A;  3RJG A;  4J9O A;  2E8N A;  3QU4 A;  2XI9 A;  1L3S A;  1YT3 A;  5ALJ A;  2VJ4 A;  5AM4 A;  3PO5 A;  4B9U A;  2HSZ A;  1WWV A;  9ICK A;  4NWI A;  3C2K A;  3JPT A;  2MU2 A;  4USA A;  5EE1 A;  4ELU A;  5ALM A;  4CRX A;  3H7I A;  1ZQX A;  3GIK A;  5AKX A;  1YZ7 A;  1MN8 A;  2DKX A;  7ICP A;  1SKR A;  4QZ9 A;  2YMM A;  3D2Q A;  4UBC A;  1X42 A;  2EAM A;  3JPO A;  3TAP A;  1J2M A;  4KLE A;  5J29 A;  2PKE A;  4IQT A;  4US9 A;  2AGP A;  4I2H A;  2D3D A;  2HMX A;  2A3V A;  2ZJ5 A;  3N7S C;  1N5W A;  5ALU A;  1JX4 A;  4YR2 A;  2W54 A;  8ICC A;  5T14 A;  5IIM A;  4ED7 A;  3K75 D;  2FPK A;  1Z3E B;  2OH2 A;  3RJH A;  1ZQG A;  4B9M A;  5ALS A;  2ZIW A;  2XC9 A;  2W8K A;  2HVH A;  2DL0 A;  4I29 A;  4DLE A;  1ZRM A;  1KDH A;  1XS9 D;  1LVH A;  1QSY A;  1T8E A;  2WF6 A;  4CGZ A;  2W9B B;  4P4P A;  1KTQ A;  4IR1 A;  1Z00 B;  4RQ4 A;  1NZB A;  2WFA A;  3MFI A;  2WTF A;  1RQN A;  2Y0S C;  2K89 A;  1B4F A;  1JRO A;  4EYH B;  3PW7 A;  2R18 A;  2W9A A;  4DS4 A;  2PMZ C;  4M6W A;  2BCR A;  2NRW A;  9ICC A;  3SEI A;  4TUP A;  4NV0 A;  1Z4N A;  1ZQV A;  1COO A;  2XCP A;  3V7J A;  4F8R A;  5AM2 A;  8ICF A;  3PZP A;  4Z6E A;  1SL1 A;  3G6X A;  5JRT A;  1QLN A;  2F77 X;  1NJZ A;  4O9M A;  4NLG A;  5ALP A;  3UXO A;  4DQQ A;  4J9S A;  5AK5 A;  5KFT A;  3Q8L A;  3KFU F;  1N61 A;  4CNQ A;  4LZD A;  4FZM A;  3QEA Z;  4JB3 A;  2G0A A;  1NKB A;  4BWJ A;  3JPP A;  3SYZ A;  4C8K A;  1Q46 A;  1V97 A;  4K4I A;  2ZIX A;  3MR6 A;  3RH5 A;  4JV0 A;  4YCX A;  4JWN A;  1RYU A;  2AQ4 A;  2HI0 A;  5DG7 A;  4PZN A;  2HHV A;  1A6S A;  5HMM A;  5DQG A;  1L7P A;  5KFX A;  2WF5 A;  5KFK A;  3H4D A;  2BCS A;  1B0X A;  5KFG A;  1SXE A;  7ICM A;  5J2F A;  5KG4 A;  2NRV A;  3F5E A;  1N2X A;  3OSP A;  2W7O A;  2XY7 A;  4F71 A;  3PX6 A;  1ZD5 A;  5L1M A;  1BPZ A;  5CB1 A;  2R8H A;  1SIJ A;  4RNN A;  3BZC A;  5KG3 A;  2BPF A;  2RRD A;  2K4E A;  5IIK A;  4YD2 A;  2HOQ A;  2DFL A;  5CEH A;  2HCF A;  1S5L U;  4U7C A;  4F4K A;  1ZQS A;  4RQ7 A;  5DLF A;  4JMU A;  1Z00 A;  1GO3 F;  3NTU A;  3H8J A;  1QQ7 A;  2JZB B;  4CCH A;  1FEZ A;  7ICO A;  4PGY A;  1QSL A;  2DBY A;  3NRW A;  2DWQ A;  1N63 A;  3RJF A;  4O3O A;  3Q8K A;  2AGQ A;  4F4X A;  5KT7 A;  3AMZ A;  4O3R A;  3PV8 A;  1SKS A;  2W9M A;  3R9K A;  2HW3 A;  3WK7 A;  3L3F X;  5KNI A;  3H0M B;  4O3S A;  4KLM A;  2ASL A;  2ZIW B;  5KFL A;  2ZJA A;  2DPJ A;  5AI0 A;  7ICJ A;  4G3I A;  2VAN A;  4ECZ A;  3T5L A;  3TAD C;  1SGG A;  5CP2 A;  5HNK A;  1KRP A;  2PI5 A;  3C1Z A;  4KLQ A;  2B6G A;  1F0M A;  5KFH A;  5ALD A;  2FLN A;  3K1R B;  5KFD A;  2F8L A;  4X5V A;  1XSL A;  1BGX T;  1S10 A;  4UBB A;  4XUS A;  1OUQ A;  1O08 A;  5KG0 A;  5DDY A;  4M47 A;  1NJX A;  4IRD A;  2Y1I A;  3KTQ A;  2I1Q A;  5C5J A;  2YMP A;  4FS2 A;  3ETL A;  3LYS A;  2KSO A;  1ZQZ A;  1URJ A;  2L5Y A;  2FLP A;  4F2S A;  3UMC A;  1UCV A;  2BDU A;  2KD1 A;  4ICA A;  3S6J A;  9ICM A;  2ZG6 A;  3K1Z A;  3PW0 A;  8ICL A;  4GC6 A;  5ALK A;  9ICX A;  1CEZ A;  5ALZ A;  1A76 A;  2EQY A;  5DKW A;  1ZET A;  3IM1 A;  4DL6 A;  4I2B A;  5KFV A;  5IIN A;  5KTQ A;  2WAQ F;  5ALL A;  1L7N A;  3V6J A;  1DGS A;  5KFA A;  3NS1 A;  1XU4 A;  3H4B A;  8ICK A;  3GZF A;  4M9L A;  2H3Z A;  2NO4 A;  3TI0 A;  3QYP A;  4ECR A;  5BOL A;  2AJQ A;  4UAV A;  1C7Y A;  2KMD A;  2AGO A;  4C4S A;  5DB8 A;  1UHU A;  1QH9 A;  4ED6 A;  1PK1 A;  2NRX A;  3QU9 A;  4EEL A;  2DUY A;  1UPH A;  2ZTE A;  4RPY A;  4IRC A;  5J0O A;  4A8E A;  1S0V A;  2AXT U;  4ECS A;  5DQH A;  3N4M B;  3PO4 A;  4FE3 A;  5KG7 A;  1NK7 A;  7ICE A;  5J0T A;  7ICR A;  3H8W A;  2BQU A;  1S8O A; 
#chains in the Genus database with same CATH homology
 1IG6 A;  5K4L A;  2EH9 A;  2RQ5 A;  1KKX A;  1C20 A;  1RYU A;  2JXJ A;  5CEH A;  1KQQ A;  2JRZ A;  2CXY A;  2LI6 A;  1KN5 A;  2YQE A;  2LM1 A;  4LJX A;  2OEH A;  2EQY A;  2KK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...