2YQEA

Solution structure of the arid domain of jarid1d protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
b'GSSGSSGTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji/ARID domain-containing protein 1D
publication title Solution structure of the ARID domain of JARID1D protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2yqeA00
2RQ5A 5K4LA 2EQYA 1RYUA 2JXJA 2EH9A 1KQQA 2JRZA 4LJXA 1IG6A 2KK0A 2OEHA 1C20A 1KKXA 5CEHA 2CXYA 2YQEA 2LM1A 2LI6A 1KN5A
chains in the Genus database with same CATH superfamily
4DF8A 2ZIUA 3ONNA 4QZCA 5KAIU 5KFVA 4BJQA 4F72A 7ICNA 2KVSA 3N7RC 4K4GA 4GFJA 2EAPA 3H4DA 2QB0B 3M1YA 3ORYA 4B9VA 2LI6A 1L3TA 2W9BA 3SV4A 1RG6A 2ZTCA 5ALTA 3AQEA 1T3NA 5EE0A 2RRDA 4YXMA 2W9CB 2ASLA 3KOOA 5J2JA 4DQRA 2KIWA 5KFQA 2XCAA 2B0CA 3QZ7A 4NL9A 9ICLA 2HHVA 2G08A 3Q8PB 4O3SA 8ICWA 4KMOB 2ZXHA 8ICTA 2R8GA 1J2NA 2DUYA 5ALLA 2RLTA 5KFNA 2XI9A 4K4HA 4YMOA 2G5HB 9ICNA 2A1AA 3GV5B 4QZDA 2JHDA 1NK8A 2NO5A 3KD3A 1X66A 2XO7A 2YMQA 5KFKA 2A19A 3LWMA 4UQGA 4CRXA 4C4TA 5J0TA 3ZDDA 2D3DA 5ALUA 5KFZA 1VLBA 2JEJA 3NVWA 3C28A 3T79A 4OJ5A 1ZQGA 1X9WA 3IM1A 1ZQDA 5J2HA 2HMXA 3FAHA 4Y2JA 3E58A 1JUDA 2ZTDA 4PGQA 2K4HA 2FMPA 3VCBA 4MEYA 3PZPA 3CNHA 5KL8B 4YD1A 4IQTA 4DLGA 3K1ZA 1ZQBA 2OM6A 5K4LA 2W8LA 3WKDA 1Z00A 4C8OA 5J2DA 1X6IA 1LVHA 2F2AB 4GC7A 2C2EA 2JZBB 4OJPA 1RXWA 5DB8A 5KFXA 5DBCA 4RQ1A 7ICGA 4ZH4A 3SENA 3WK5A 2P6UA 1KKXA 2BHNA 2I9GA 4YG2A 5KFWA 3BDPA 4Y2PA 5KFFA 4XUSA 1RYUA 2YN4A 1NZPA 4Y2XA 4PZOA 3JPTA 2W54A 3SZ2A 3B9JA 2I6XA 1IG6A 2ISOA 4O3RA 2JMGA 2W11A 1V85A 1NJWA 3PO5A 3RH5A 1XO0A 4I2FA 2ATLA 1D9FA 8ICUA 9ICSA 3H0MB 1KBUA 1N5WA 1KQQA 4QZGA 1XNSA 3BS5B 4O0IA 2HHUA 3BQ1A 3UQ2A 3C2LA 2DF4B 5G5HA 1X42A 3PR5B 4I2AA 5HMMA 5D46A 3QEBZ 3GFKB 2GH1A 2H3VA 5CRXA 4C4SA 1QH9A 4UAWA 5CP2A 3WK8A 1WWUA 8ICOA 2BKEA 1UCVA 1S0OA 4UB3A 3PVXA 3AU6A 4QWCA 1S9FA 3EW9A 3QU2A 4FO6A 3RB3A 5DDYA 3TAQA 1YZ7A 4UB6U 5KFYA 5KFMA 3V6HA 4MF2A 1ZQUA 3RFAA 4KITB 3PX0A 4DOCA 1UHUA 5HHIA 2VA3A 3K1RB 4F8RA 3O0FA 4M9NA 4KLQA 2H5XA 7ICUA 2UVRA 1URJA 5F3XB 3F53A 1ZD5A 3RJKA 4FZLA 5CWRA 4B9TA 4FZNA 1ZQ1C 8ICIA 3PO4A 1V97A 9ICXA 4M0AA 2KFNA 4EX7A 8ICEA 1CUKA 3OHAA 1ZD4A 5B66U 4RPXA 2E8MA 3M8SA 4IL6U 1N63A 3EPIA 4PH5A 5ALQA 3AM9A 3C1ZA 1ZETA 4F4XA 4M9JA 1ZQWA 3ZI4A 1DK2A 4GC6A 4B9MA 4NLZA 1S0NA 1KTQA 5DBAA 5IIJA 3RB6A 5AK4A 2K4PA 1UA0A 5KFRA 5C5JA 4KX5A 3WKEA 5KG1A 2K4IA 3H0RB 4NXZA 3RAQA 5L1KA 4DQSA 1JROA 3A0HU 5L1LA 4QZBA 1NJZA 5AI0A 3ZD9A 3GIKA 1K1QA 4LZDA 4CDGA 1N5XA 2ZIVB 5ALOA 2H3ZA 5DBBA 3F2CA 5DG9A 4ED8A 3UQ0A 3G6VA 2PI4A 9ICKA 5D49A 2F76X 1SL2A 4QW8A 5KFLA 1F5SA 2AU0A 2P6RA 5B5EU 5CHGA 3H4BA 3F2DA 2JH7A 4KTQA 5DKWA 3OGUA 4ELUA 3NS1A 2WFAA 1L3SA 1L5UA 4QNLA 5J0PA 2XCPA 3JPRA 1N2XA 3HT3A 3N4MB 4M04A 4LZGA 3GV8B 3UXNA 2WF9A 2FPKA 5KT4A 4GXJA 4FFDA 2KZMA 9ICGA 1A0PA 2EZYA 4QZ8A 3RH6A 4GXKA 2BQUA 4RUAA 9ICFA 4IR9A 4HAIA 3PY8A 4P0PB 1B43A 7ICEA 1XU4A 3RH4A 9ICAA 1NK0A 2KKPA 4IQWA 1Y88A 2OXOA 4MEXA 3UMGA 4ZOHC 3C2KA 1D8YA 1OXJA 3OSNA 1JIHA 2CN1A 3HJEA 1RXVA 2EAMA 1NZBA 5HP4A 2HHTA 4IR1A 3BQTA 4Q45A 4B6JA 4UB4A 2BPCA 3TKAA 3MR2A 2KFZA 4RQ0A 2BCVA 2C28A 2AQ4A 3GDXA 7ICRA 2K8CB 1X9MA 1ECWA 4UAUA 5H2FU 3LWLA 1XSNA 2DGZA 4FBUA 9ICUA 3L3FX 2HHSA 5ALIA 4KLTA 1RQNA 3ALRA 4O5CA 2W7PA 4J9LA 1EXNA 1B22A 1ZJMA 3BQ0A 4UAVA 4DFJA 1WG8A 4Z6CA 4WJ3B 4F5NA 1S97A 7ICFA 4JK1A 5EWGA 4R66A 3QX7A 4DQIA 1RM6C 4US8A 3C5GA 4QWDA 4ED6A 1TK0A 1RDFA 3IP4B 3PMNA 2YMMA 1ZRMA 1KW4A 2GOLA 4F5QA 4ELTA 3HKZC 3QE9Y 4UB5A 4KMUA 7ICKA 4IQVA 5AI6A 1KL9A 3JPPA 4I2CA 2KSOA 2P35A 1ZJNA 1ED1A 4P4OA 5KFCA 4QZHA 3KBBA 7ICLA 4Q43A 1SV4A 3OJSA 3MBYA 4UAYA 2FLLA 5L1IA 1JXEA 2OHFA 3MC1A 1KLNA 4DWIA 1Z1VA 2HHXA 1SXDA 1XSLA 5ALHA 5C0YA 4O5KA 2F1IA 3V7KA 4OO1J 1T4GA 2BCSA 4EYHB 8ICCA 3RJFA 3UXOA 3RRGA 4NJ8A 2K60A 5DLFA 3M7DA 2HHQA 4GLXA 8ICXA 5ALVA 9ICHA 4ED7A 1SKRA 2R8KA 1SV0A 2KG5A 2DPIA 4DFMA 5EE9A 3M8RA 4C7YA 1HUZA 5KFBA 3RJIA 1QSYA 4C8KA 2VIXA 8ICAA 2F3NA 1LKYA 1F44A 3PW4A 5IIIA 2J6UA 2W7OA 8ICRA 1V38A 2WF7A 2J6SA 5J0QA 3WK9A 1TFRA 3ICXA 2MA1A 4JMUA 1ZOLA 3OJUA 3D6JA 1C7YA 4O3OA 5J8YC 5J0UA 4ECTA 1N48A 4RT3A 1NK4A 5GTHU 3RAXA 4DQQA 7ICQA 1JN3A 1ZQZA 3KFUF 4EEYA 2LM1A 2ZJAA 3GZFA 3NGDA 3V72A 2AGPA 3RJEA 3F2BA 4RPYA 4KLDA 3AEVA 5CB1A 4P4MA 4ECWA 4Q8FA 3LK9A 1XO1A 1Z19A 2JV3A 4EX6A 4OJOA 5KFTA 3BS7A 3C5FA 1RYRA 4K4IA 1AQ6A 5CEHA 2EANA 3RTVA 2V4RA 2FMQA 4X5VA 4F93B 2ASDA 3OHBA 2NRWA 3LVVA 1BPEA 1QLNA 4QWBA 1ZQMA 4O3PA 2W43A 5F9NA 5KFPA 4I28A 5AI9A 3RRHA 3FM9A 2KHQA 4ED2A 4QZEA 4IRKA 3EYZA 4US9A 2OWOA 1LV5A 1ZQIA 2KHVA 2G07A 5ALZA 1IV8A 1ZQLA 1Q46A 1C20A 2AGOA 2JEGA 1ZQYA 2K89A 2Q4TA 1ZQXA 1XWLA 1N61A 2HCFA 5AM0A 3QU4A 1FIQA 4DS4A 3TARA 2WHEA 3I28A 4JB3A 2JEFA 4F5RA 3IV6A 2KICA 1J2MA 3L4PA 5TISU 5AKIA 1WUDA 4KLOA 3MGIA 1TVAA 1ZQQA 1IM4A 1LB2B 1K1SA 1VJ5A 5KG4A 1FFVA 4Z6EA 1ZRNA 2JGAA 3RJGA 4R8UA 4QW9A 3RBEA 1U45A 4DL4A 5ALPA 2HBMA 4BXOA 5FP0A 4PHEA 3G6XA 4RQ3A 2H3QA 4J9KA 3NVYA 1PK1A 3UPQA 2LYHA 1ZQTA 4A8EA 4TUPA 3UXPA 3L5KA 2QKQA 3I1YA 3T5HA 3A0BU 7ICVA 1WCLA 1Z4OA 3B0YA 2K8AA 2ZIXA 2C2RA 2B21A 3GIMA 1S5LU 2G5IB 3QU5A 4YVZA 4JV1A 4I2DA 1JI7A 3F5EA 3TFSA 4Y2VA 4RQ5A 2FPMA 4PZNA 7ICPA 1ZQAA 1HIWA 2AGQA 4Q44A 4R64A 1GO3F 4RQ7A 3MR5A 3V6KA 5AKJA 4IRDA 4LJXA 2I1QA 3NRZA 2PFPA 4NM2A 2ZUBA 4XRHA 2VJ4A 5E79U 5JU5A 1OW5A 4RQ2A 4HYKA 3MR6A 3N28A 3E0FA 2XGPA 1L8LA 3WK7A 2ZJ5A 3PX4A 5JUMA 9ICIA 4GIBA 4ECVA 8ICBA 2W8KA 2JEIA 3R9KA 1XSPA 4UBCA 3OSPA 3IG5A 4PGXA 1UA1A 3C2MA 8ICLA 4RNNA 9ICWA 1L7OA 3HP6A 2ZIWB 1U48A 3F5AA 4NWIA 1DGSA 1QQ5A 1S77D 3V7JA 4C0ZA 1TK8A 1COOA 3PW7A 8ICMA 1D9DA 4I27A 4BWMA 1RYSA 5J2BA 4Y2TA 3LDAA 8ICSA 4EYIB 2NRTA 2DBYA 5L1JA 1HJPA 5J2AA 4NLNA 3SI8A 2IA6A 4UB2A 2WB1F 2LPEA 2VANA 3ZDAA 4OCZA 5DGAA 5IILA 1RZTA 8ICZA 2W04A 5J0WA 1L8OA 4J9OA 3ED5A 5HR6A 2JR5A 4F71A 4NLGA 4KLFA 5AKXA 2KJ5A 2QB1A 3UMCA 3TANA 2YY6A 4CF5A 1KFTA 4OJLA 1MQ2A 1X6JA 4IS7A 3NASA 2KV2A 4UB8U 2W55A 4PJ0U 9ICQA 2VA8A 3WU2U 9ICMA 3NTUA 2J6TA 2IHNA 4J03A 5KT3A 3HILA 3RB4A 5J2IA 3SEIA 3CW2C 4DL3A 2Z7JA 1RQLA 4FS2A 2FLNA 2LHTA 3T5KA 4I2HA 3CYMA 3UMBA 1B4FA 3M9MB 3KKAC 5BOLA 4ECXA 4ACOA 4Y2UA 1L7NA 1ZQKA 1BGXT 2ASJA 9ICJA 1BPBA 8ICQA 3BZCA 5KAFU 1ZQNA 4M47A 2NRZA 2HVIA 4DOBA 2KSOB 2NRXA 1DRGA 1L6NA 2MUTA 2CXYA 5DB7A 5KFEA 2BCUA 5EOZA 3MGVA 3U26A 2DKZA 1ZQSA 5KG3A 2VJ5A 3IHQB 5AKEA 2H3FA 3QU9A 4NLBA 4DO9A 2MAXA 4DL5A 4GXIA 4QZIA 4YMMA 2O6KA 4DL2A 5AKGA 3THVA 3M6KA 4EBEA 1TE2A 2YTUA 3HW8A 3HKZF 2EQYA 3KZXA 4FBTA 3FC4A 2CRXA 2YB4A 2OCEA 1PK3A 2W9MA 8ICVA 2WB1C 4JV2A 4YN4A 5KTQA 2W9AA 1NI3A 5AK6A 3RR7A 3MR3A 3RF9A 1IXRA 2W3RA 1NKCA 1ZQRA 5KG0A 1MSWD 2W3SA 4OJ6A 2ZIUB 1L3VA 1KSPA 5AM5A 5KFHA 4TUQA 3WK4A 2DQNB 1JRPA 1SIJA 1B0XA 4QIWF 1WCNA 1LKYB 4RQNA 7ICMA 3SAGA 3H8SA 4YXJA 1A76A 1Z1BA 1XC9A 4YR0A 5EE3A 2V4QA 1NJXA 5KT6A 2W9BB 5J2EA 1RPLA 4TQSA 5HR7A 4DFPA 5AM1A 2PFQA 3T5LA 3K4GA 2Y9TA 2UVVA 2Y1JA 2PMZF 1XS9D 4J9SA 3LYSA 4E0DA 3BQ2A 1IIPA 2XICA 4C8LA 2PKEA 2R8JA 2PXIA 7ICOA 1BPZA 2KZZA 3KHRA 1JX4A 4U7CA 4UATA 2KIVA 5KT7A 1NKBA 1PVRA 1S76D 1V9PA 3RJHA 4U6PA 5IIMA 5ALWA 3ZDEA 2KJ8A 2JH1A 1S0VA 3EUB2 4J9PA 4LVSA 3FYHA 2BZFA 2PFOA 4KN7A 3M9NB 1SKWA 8ICFA 4DFKA 4NL9C 1KDHA 4DSIA 9ICTA 4ICAA 4J9NA 1BPDA 4Z6DA 2EAOA 5KFJA 2DL0A 1J97A 4UAZA 1YT3A 1T3QA 3GU3A 3KTQA 2RDIA 1HUOA 2NV3A 4C4RA 5AM3A 5KFSA 7ICJA 4M9HA 2VA2A 2E8PA 5BOMA 3MGHA 9ICCA 3ZDBA 2Q0ZX 3JPOA 4M9LA 2WF6A 3N7PD 1WWVA 2JXJA 4RZRA 2BQRA 1D8LA 3PW2A 4R65A 2ZXIA 1BVSA 2ZIVA 5J2GA 1NOMA 1NJYA 4F4ZA 4MFFA 2KE7A 5KG6A 1U9LA 3AL0B 4QIWC 5AKHA 4R8UB 1FEZA 2DFLA 1SZPA 2R18A 1Z00B 1T7PA 7ICTA 4BXOB 4J9MA 5DDMA 2KZ3A 2GWSA 3KHLA 4UASA 4YR3A 4OD0A 4YMNA 1Q3UA 4P4PA 3RBDA 2EZXA 3H40A 5CR0A 5AI5A 3QUQA 1MN8A 2HSZA 4PPXA 2PMZC 4PHDA 4F2SA 4F2RA 3GV7B 4JWNA 2ZG6A 4QJFB 1TAQA 2H3IA 5J0XA 4UW9A 9ICRA 3MDCA 3BZKA 4P0PA 5AIAA 5KG2A 4ECZA 2PFNA 3V7LA 3V6JA 3WKAA 3PR4A 4DL6A 4J9QA 4F4WA 1KRPA 2OEHA 3QYPA 3SAHA 3M6ZA 2XGQA 4RQMA 3TQ1A 2L5YA 5HMLA 5J0SA 2XY7A 3PSTA 2IMWP 2ESEA 4EZ6A 2NYVA 1SWWA 2EZZA 1JXLA 3T3FA 1PVPA 4F3OA 1K5OA 4XQ8A 4M6WA 2YB1A 2KK0A 4RQ8A 3EZ5A 3KZIU 5AKYA 4DS5A 7ICHA 1CRXA 4JWMA 4F5OA 2LYAA 4RU9A 2XIDA 4CF4A 2ISPA 3HPOA 1NNLA 4ED1A 4F92B 4RNOA 1ZXIA 2F77X 2XC9A 2YX8A 5CJ7A 4MFAA 4YCXA 2B6GA 4KLGA 2K4EA 1MQ3A 2XVTA 9ICBA 3RB0A 3Q8QB 1QTMA 1SGGA 3AN1A 1KN5A 3H8WA 1KEJA 1QCKA 4YQWA 2A1JA 4I2GA 3AMZA 4IRCA 1P7DA 5KFGA 4PGYA 4ED3A 5IIKA 5L9XA 1SL1A 1DXSA 3AU2A 4DEZA 2AJQA 3D2SA 8ICYA 2BCRA 4DLEA 1X9SA 5TZVA 3LVWA 1MC8A 2G06A 5KFUA 1NK6A 5ALJA 3DEEA 3IG8A 1BNPA 2F1HA 2EH9A 2HBLA 4DCCA 1U47A 1Z3EB 3T5JA 5EE1A 5AKZA 2FMSA 1SKSA 3TFRA 2G0AA 5D4BA 1O08A 4AYBC 1NKEA 2K8BB 3QUTA 4YR2A 4DSFA 2YQEA 3IRUA 5KT5A 1L3UA 4KLMA 3G6YA 2DKXA 1TK5A 1BPYA 3GILA 2D8CA 2KP7A 3WKBA 2Y1IA 4B9SA 5AM2A 4O3NA 5EWEA 4KLEA 1NK9A 3DDHA 4P0QA 4RQ6A 1U4BA 2QARA 1KFSA 3ISDA 7ICSA 8ICNA 5AHXA 4EEKA 2I5HA 2RQ5A 4Y2YA 2F8KA 5AKKA 3JPNA 3D2NA 2LBOA 3KHGA 3PV8A 4C7ZA 3E2EA 2D6FC 4QWEA 1SXEA 4Y2QA 1X9XA 3PX6A 3HRDD 5AKLA 1Q8KA 2MUTB 3PW0A 2C22A 4DFDA 4O3MA 4BUGA 1FFUA 2F8LA 2KNJA 4UB1A 2G09A 3HWTA 5ALGA 5DB9A 4O9MA 5DG7A 1ZD2P 1SZHA 5ALYA 1U49A 1TKDA 5J8YA 3ISCA 3UM9A 5AI4A 4Y2SA 2V9WA 2VKQA 1ZQPA 2NRVA 4KLHA 4F4KA 4BX9C 3ETLA 4NLCA 5KT2A 2HHWA 3GIIA 3BJYA 5AM4A 2YMPA 5KG5A 2XY5A 5JRTA 5KNIA 2QB0A 5DQHA 3SD7A 2ZUDA 4DQPA 2C2DA 3NVZA 1UPHA 2E1EA 4F50A 4O3QA 2HOIA 2W9CA 4EZ9A 4KLSA 3K75D 4P2HA 2KEYA 4DF4A 1DK3A 2WF8A 2LKYA 4F5PA 3TAPA 4CCHA 2FJ6A 2Y0SF 2KTQA 4BDPA 4EELA 2ZUCA 2KOBA 2M9NA 4TUSA 3H8MA 2HW3A 4QZ9A 4M2YA 1ZQFA 3C29A 2E1FA 5L1MA 5JTIA 2WAQF 5AK5A 5AI8A 2E8OA 2XY6A 4UARA 3MABA 2JRZA 3EWAA 5AIBA 2R8IA 2HDOA 5ALDA 3PMLA 5J2CA 5G5GA 1O03A 1A77A 2E3TA 4FS1A 3SR6A 3GIJA 3C21A 1D8BA 3NVVA 2Y9UA 2QLTA 4CNQA 4UBBA 1TAUA 3DV9A 5J29A 4MFCA 1T94A 7ICIA 1COKA 3WKCA 4ECYA 1KFDA 2AH5A 2BDPA 4QZAA 1H38A 4YD2A 2IBKA 3VC8A 2ZJ8A 3FDSA 4YFKA 4B9UA 4RNMA 2HBKA 4IQUA 3B0XA 4KLUA 3QUCA 4KLLA 4PHPA 3ZD8A 1ZQOA 4KN4A 4PL2A 3QEAZ 5AK3A 5ALSA 4TURA 3SAFA 3C1YA 2PI5A 4I2EA 1S8OA 4ELVA 1NK5A 3MDAA 1ZQEA 3IDWA 1Q3VA 2AQ0A 3ETRA 4C8MA 1JMSA 1ZYQA 2EDUA 3S6JA 5ALFA 4BGDA 4F91B 2UVUA 4NY8A 1QQ7A 2JZBA 4PL1A 2F44A 2ODGA 3SQIA 3WK6A 5BPCA 1QSLA 3H8JA 1ZQVA 5HHHA 3Q8SB 3MFHA 5ALEA 1T8EA 2MSNA 3QU7A 4QWAA 2FPLA 2BDUA 2BPGA 4ECSA 2BGWA 5IINA 3JPSA 4KLIA 1UT5A 1X40A 3CRXA 2HOFA 3QZ8A 1PZNA 3M9OB 1AROP 5DGBA 4B9LA 4NLKA 4CF3A 2DPJA 3PSPA 5KFDA 5EWFA 2N1RA 3Q8KA 2LMRA 3OTQA 3QXGA 2HOQA 2Y0SC 4PHAA 3TI0A 2A3VA 1S10A 4MHVA 3CP8A 2WF5A 1PUZA 4IC9A 4Y2RA 2KD1A 5AICA 3HX0A 2ES6A 2KVCA 4C8NA 1A6SA 2R8HA 2WAQC 3H7IA 2BPFA 1MA7A 2IOFA 1BNOA 5KFIA 4Q8EA 3J81j 3BS5A 2HI0A 3AQFA 2LYBA 2P66A 5DQGA 3D2QA 3Q8MA 4ECUA 3I76A 2F1JA 1OUQA 4DSKA 5T14A 3NUQA 2RDJA 3TADC 3SV3A 4YP3A 2HBJA 3MFIA 1N60A 2WTFA 3ISBA 5IIOA 4I2JA 2DWQA 1BPXA 2IHMA 1F0MA 1CEZA 2ZIWA 1SV0C 2BR0A 9ICPA 1JALA 5J0RA 3PSIA 4M6WB 3BQ7A 3KHHA 1CI4A 2KN7A 3NRWA 2OH2A 1S0MA 8ICPA 9ICEA 4ED0A 4XA5A 5F9LA 1M6YA 5ALRA 2BQ3A 2AHOB 1TV9A 3RJJA 2AXTU 4DSEA 4DL7A 4KX3A 5DB6A 4FE3A 4J9RA 5ALKA 2KJ9A 1UT8A 1DGJA 1Z4NA 1N56A 4JV0A 1L7MA 3AUOA 4R63A 4EBDA 8ICJA 4AP9A 4DSJA 3SMVA 5J2FA 5ALMA 4JUZA 5A0LA 3JPQA 1UQVA 2ZTEA 3Q8LA 2A1JB 4I2BA 4Z6FA 4MF8A 4QZFA 5DQIA 3KKAA 3H0LB 4RUCA 3IN5A 2M0NA 2UVWA 3OPXA 2ALZA 1ZQCA 5DG8A 1TAMA 9ICOA 3QNMA 3SYZA 4NV0A 1FO4A 4CGZA 9ICVA 1WYGA 2KKVA 3ZDCA 4USAA 1HEKA 4C80A 2OYYA 3RR8A 1YZ6A 4CE6A 4RQ4A 4G3IA 1SB3C 3TACB 4M9GA 2KMDA 4G9BA 2FI1A 1ZQJA 1PVQA 5J2KA 4RPZA 4EBCA 4ECQA 2GO7A 5CA7A 1ZD3A 2W03A 4TQRA 3Q8RB 3PNCA 5KG7A 1VDVA 1DOQA 1ZQHA 2E8NA 4DSLA 2YMLA 4ECRA 1QSSA 5GTIU 5DLGA 2FE9A 4P0QB 2IOFK 5ALNA 2QARB 3N97B 1SL0A 2MU2A 5ALXA 2E5SA 3GQCA 1SWVA 1PK1B 4DOAA 4O5EA 2HVHA 4I29A 2LM4A 4B9NA 4RT2A 2BCQA 1X2IA 8ICHA 2FDRA 3PW5A 4EENA 2FLPA 5HNKA 4FZMA 5J0YA 4AYBF 2RP5A 2RHFA 8ICKA 4BWJA 3TADA 8ICGA 3QUBA 5KFAA 2GLEA 2ZIXB 1N62A 3C23A 4KLJA 5KFOA 2IOHA 3PSFA 3N7SC 4I2IA 2MRLA 2CPRA 3EPGA 2NO4A 4NM1A 4F4YA 5J0OA 5KL1B 1QQ6A 1NK7A 1L7PA
chains in the Genus database with same CATH topology
2RQ5A 5K4LA 2EQYA 1RYUA 2JXJA 2EH9A 1KQQA 2JRZA 4LJXA 1IG6A 2KK0A 2OEHA 1C20A 1KKXA 5CEHA 2CXYA 2YQEA 2LM1A 2LI6A 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ5 A;  5K4L A;  2EQY A;  1RYU A;  2JXJ A;  2EH9 A;  1KQQ A;  2JRZ A;  4LJX A;  1IG6 A;  2KK0 A;  2OEH A;  1C20 A;  1KKX A;  5CEH A;  2CXY A;  2YQE A;  2LM1 A;  2LI6 A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 4DF8 A;  2ZIU A;  3ONN A;  4QZC A;  5KAI U;  5KFV A;  4BJQ A;  4F72 A;  7ICN A;  2KVS A;  3N7R C;  4K4G A;  4GFJ A;  2EAP A;  3H4D A;  2QB0 B;  3M1Y A;  3ORY A;  4B9V A;  2LI6 A;  1L3T A;  2W9B A;  3SV4 A;  1RG6 A;  2ZTC A;  5ALT A;  3AQE A;  1T3N A;  5EE0 A;  2RRD A;  4YXM A;  2W9C B;  2ASL A;  3KOO A;  5J2J A;  4DQR A;  2KIW A;  5KFQ A;  2XCA A;  2B0C A;  3QZ7 A;  4NL9 A;  9ICL A;  2HHV A;  2G08 A;  3Q8P B;  4O3S A;  8ICW A;  4KMO B;  2ZXH A;  8ICT A;  2R8G A;  1J2N A;  2DUY A;  5ALL A;  2RLT A;  5KFN A;  2XI9 A;  4K4H A;  4YMO A;  2G5H B;  9ICN A;  2A1A A;  3GV5 B;  4QZD A;  2JHD A;  1NK8 A;  2NO5 A;  3KD3 A;  1X66 A;  2XO7 A;  2YMQ A;  5KFK A;  2A19 A;  3LWM A;  4UQG A;  4CRX A;  4C4T A;  5J0T A;  3ZDD A;  2D3D A;  5ALU A;  5KFZ A;  1VLB A;  2JEJ A;  3NVW A;  3C28 A;  3T79 A;  4OJ5 A;  1ZQG A;  1X9W A;  3IM1 A;  1ZQD A;  5J2H A;  2HMX A;  3FAH A;  4Y2J A;  3E58 A;  1JUD A;  2ZTD A;  4PGQ A;  2K4H A;  2FMP A;  3VCB A;  4MEY A;  3PZP A;  3CNH A;  5KL8 B;  4YD1 A;  4IQT A;  4DLG A;  3K1Z A;  1ZQB A;  2OM6 A;  5K4L A;  2W8L A;  3WKD A;  1Z00 A;  4C8O A;  5J2D A;  1X6I A;  1LVH A;  2F2A B;  4GC7 A;  2C2E A;  2JZB B;  4OJP A;  1RXW A;  5DB8 A;  5KFX A;  5DBC A;  4RQ1 A;  7ICG A;  4ZH4 A;  3SEN A;  3WK5 A;  2P6U A;  1KKX A;  2BHN A;  2I9G A;  4YG2 A;  5KFW A;  3BDP A;  4Y2P A;  5KFF A;  4XUS A;  1RYU A;  2YN4 A;  1NZP A;  4Y2X A;  4PZO A;  3JPT A;  2W54 A;  3SZ2 A;  3B9J A;  2I6X A;  1IG6 A;  2ISO A;  4O3R A;  2JMG A;  2W11 A;  1V85 A;  1NJW A;  3PO5 A;  3RH5 A;  1XO0 A;  4I2F A;  2ATL A;  1D9F A;  8ICU A;  9ICS A;  3H0M B;  1KBU A;  1N5W A;  1KQQ A;  4QZG A;  1XNS A;  3BS5 B;  4O0I A;  2HHU A;  3BQ1 A;  3UQ2 A;  3C2L A;  2DF4 B;  5G5H A;  1X42 A;  3PR5 B;  4I2A A;  5HMM A;  5D46 A;  3QEB Z;  3GFK B;  2GH1 A;  2H3V A;  5CRX A;  4C4S A;  1QH9 A;  4UAW A;  5CP2 A;  3WK8 A;  1WWU A;  8ICO A;  2BKE A;  1UCV A;  1S0O A;  4UB3 A;  3PVX A;  3AU6 A;  4QWC A;  1S9F A;  3EW9 A;  3QU2 A;  4FO6 A;  3RB3 A;  5DDY A;  3TAQ A;  1YZ7 A;  4UB6 U;  5KFY A;  5KFM A;  3V6H A;  4MF2 A;  1ZQU A;  3RFA A;  4KIT B;  3PX0 A;  4DOC A;  1UHU A;  5HHI A;  2VA3 A;  3K1R B;  4F8R A;  3O0F A;  4M9N A;  4KLQ A;  2H5X A;  7ICU A;  2UVR A;  1URJ A;  5F3X B;  3F53 A;  1ZD5 A;  3RJK A;  4FZL A;  5CWR A;  4B9T A;  4FZN A;  1ZQ1 C;  8ICI A;  3PO4 A;  1V97 A;  9ICX A;  4M0A A;  2KFN A;  4EX7 A;  8ICE A;  1CUK A;  3OHA A;  1ZD4 A;  5B66 U;  4RPX A;  2E8M A;  3M8S A;  4IL6 U;  1N63 A;  3EPI A;  4PH5 A;  5ALQ A;  3AM9 A;  3C1Z A;  1ZET A;  4F4X A;  4M9J A;  1ZQW A;  3ZI4 A;  1DK2 A;  4GC6 A;  4B9M A;  4NLZ A;  1S0N A;  1KTQ A;  5DBA A;  5IIJ A;  3RB6 A;  5AK4 A;  2K4P A;  1UA0 A;  5KFR A;  5C5J A;  4KX5 A;  3WKE A;  5KG1 A;  2K4I A;  3H0R B;  4NXZ A;  3RAQ A;  5L1K A;  4DQS A;  1JRO A;  3A0H U;  5L1L A;  4QZB A;  1NJZ A;  5AI0 A;  3ZD9 A;  3GIK A;  1K1Q A;  4LZD A;  4CDG A;  1N5X A;  2ZIV B;  5ALO A;  2H3Z A;  5DBB A;  3F2C A;  5DG9 A;  4ED8 A;  3UQ0 A;  3G6V A;  2PI4 A;  9ICK A;  5D49 A;  2F76 X;  1SL2 A;  4QW8 A;  5KFL A;  1F5S A;  2AU0 A;  2P6R A;  5B5E U;  5CHG A;  3H4B A;  3F2D A;  2JH7 A;  4KTQ A;  5DKW A;  3OGU A;  4ELU A;  3NS1 A;  2WFA A;  1L3S A;  1L5U A;  4QNL A;  5J0P A;  2XCP A;  3JPR A;  1N2X A;  3HT3 A;  3N4M B;  4M04 A;  4LZG A;  3GV8 B;  3UXN A;  2WF9 A;  2FPK A;  5KT4 A;  4GXJ A;  4FFD A;  2KZM A;  9ICG A;  1A0P A;  2EZY A;  4QZ8 A;  3RH6 A;  4GXK A;  2BQU A;  4RUA A;  9ICF A;  4IR9 A;  4HAI A;  3PY8 A;  4P0P B;  1B43 A;  7ICE A;  1XU4 A;  3RH4 A;  9ICA A;  1NK0 A;  2KKP A;  4IQW A;  1Y88 A;  2OXO A;  4MEX A;  3UMG A;  4ZOH C;  3C2K A;  1D8Y A;  1OXJ A;  3OSN A;  1JIH A;  2CN1 A;  3HJE A;  1RXV A;  2EAM A;  1NZB A;  5HP4 A;  2HHT A;  4IR1 A;  3BQT A;  4Q45 A;  4B6J A;  4UB4 A;  2BPC A;  3TKA A;  3MR2 A;  2KFZ A;  4RQ0 A;  2BCV A;  2C28 A;  2AQ4 A;  3GDX A;  7ICR A;  2K8C B;  1X9M A;  1ECW A;  4UAU A;  5H2F U;  3LWL A;  1XSN A;  2DGZ A;  4FBU A;  9ICU A;  3L3F X;  2HHS A;  5ALI A;  4KLT A;  1RQN A;  3ALR A;  4O5C A;  2W7P A;  4J9L A;  1EXN A;  1B22 A;  1ZJM A;  3BQ0 A;  4UAV A;  4DFJ A;  1WG8 A;  4Z6C A;  4WJ3 B;  4F5N A;  1S97 A;  7ICF A;  4JK1 A;  5EWG A;  4R66 A;  3QX7 A;  4DQI A;  1RM6 C;  4US8 A;  3C5G A;  4QWD A;  4ED6 A;  1TK0 A;  1RDF A;  3IP4 B;  3PMN A;  2YMM A;  1ZRM A;  1KW4 A;  2GOL A;  4F5Q A;  4ELT A;  3HKZ C;  3QE9 Y;  4UB5 A;  4KMU A;  7ICK A;  4IQV A;  5AI6 A;  1KL9 A;  3JPP A;  4I2C A;  2KSO A;  2P35 A;  1ZJN A;  1ED1 A;  4P4O A;  5KFC A;  4QZH A;  3KBB A;  7ICL A;  4Q43 A;  1SV4 A;  3OJS A;  3MBY A;  4UAY A;  2FLL A;  5L1I A;  1JXE A;  2OHF A;  3MC1 A;  1KLN A;  4DWI A;  1Z1V A;  2HHX A;  1SXD A;  1XSL A;  5ALH A;  5C0Y A;  4O5K A;  2F1I A;  3V7K A;  4OO1 J;  1T4G A;  2BCS A;  4EYH B;  8ICC A;  3RJF A;  3UXO A;  3RRG A;  4NJ8 A;  2K60 A;  5DLF A;  3M7D A;  2HHQ A;  4GLX A;  8ICX A;  5ALV A;  9ICH A;  4ED7 A;  1SKR A;  2R8K A;  1SV0 A;  2KG5 A;  2DPI A;  4DFM A;  5EE9 A;  3M8R A;  4C7Y A;  1HUZ A;  5KFB A;  3RJI A;  1QSY A;  4C8K A;  2VIX A;  8ICA A;  2F3N A;  1LKY A;  1F44 A;  3PW4 A;  5III A;  2J6U A;  2W7O A;  8ICR A;  1V38 A;  2WF7 A;  2J6S A;  5J0Q A;  3WK9 A;  1TFR A;  3ICX A;  2MA1 A;  4JMU A;  1ZOL A;  3OJU A;  3D6J A;  1C7Y A;  4O3O A;  5J8Y C;  5J0U A;  4ECT A;  1N48 A;  4RT3 A;  1NK4 A;  5GTH U;  3RAX A;  4DQQ A;  7ICQ A;  1JN3 A;  1ZQZ A;  3KFU F;  4EEY A;  2LM1 A;  2ZJA A;  3GZF A;  3NGD A;  3V72 A;  2AGP A;  3RJE A;  3F2B A;  4RPY A;  4KLD A;  3AEV A;  5CB1 A;  4P4M A;  4ECW A;  4Q8F A;  3LK9 A;  1XO1 A;  1Z19 A;  2JV3 A;  4EX6 A;  4OJO A;  5KFT A;  3BS7 A;  3C5F A;  1RYR A;  4K4I A;  1AQ6 A;  5CEH A;  2EAN A;  3RTV A;  2V4R A;  2FMQ A;  4X5V A;  4F93 B;  2ASD A;  3OHB A;  2NRW A;  3LVV A;  1BPE A;  1QLN A;  4QWB A;  1ZQM A;  4O3P A;  2W43 A;  5F9N A;  5KFP A;  4I28 A;  5AI9 A;  3RRH A;  3FM9 A;  2KHQ A;  4ED2 A;  4QZE A;  4IRK A;  3EYZ A;  4US9 A;  2OWO A;  1LV5 A;  1ZQI A;  2KHV A;  2G07 A;  5ALZ A;  1IV8 A;  1ZQL A;  1Q46 A;  1C20 A;  2AGO A;  2JEG A;  1ZQY A;  2K89 A;  2Q4T A;  1ZQX A;  1XWL A;  1N61 A;  2HCF A;  5AM0 A;  3QU4 A;  1FIQ A;  4DS4 A;  3TAR A;  2WHE A;  3I28 A;  4JB3 A;  2JEF A;  4F5R A;  3IV6 A;  2KIC A;  1J2M A;  3L4P A;  5TIS U;  5AKI A;  1WUD A;  4KLO A;  3MGI A;  1TVA A;  1ZQQ A;  1IM4 A;  1LB2 B;  1K1S A;  1VJ5 A;  5KG4 A;  1FFV A;  4Z6E A;  1ZRN A;  2JGA A;  3RJG A;  4R8U A;  4QW9 A;  3RBE A;  1U45 A;  4DL4 A;  5ALP A;  2HBM A;  4BXO A;  5FP0 A;  4PHE A;  3G6X A;  4RQ3 A;  2H3Q A;  4J9K A;  3NVY A;  1PK1 A;  3UPQ A;  2LYH A;  1ZQT A;  4A8E A;  4TUP A;  3UXP A;  3L5K A;  2QKQ A;  3I1Y A;  3T5H A;  3A0B U;  7ICV A;  1WCL A;  1Z4O A;  3B0Y A;  2K8A A;  2ZIX A;  2C2R A;  2B21 A;  3GIM A;  1S5L U;  2G5I B;  3QU5 A;  4YVZ A;  4JV1 A;  4I2D A;  1JI7 A;  3F5E A;  3TFS A;  4Y2V A;  4RQ5 A;  2FPM A;  4PZN A;  7ICP A;  1ZQA A;  1HIW A;  2AGQ A;  4Q44 A;  4R64 A;  1GO3 F;  4RQ7 A;  3MR5 A;  3V6K A;  5AKJ A;  4IRD A;  4LJX A;  2I1Q A;  3NRZ A;  2PFP A;  4NM2 A;  2ZUB A;  4XRH A;  2VJ4 A;  5E79 U;  5JU5 A;  1OW5 A;  4RQ2 A;  4HYK A;  3MR6 A;  3N28 A;  3E0F A;  2XGP A;  1L8L A;  3WK7 A;  2ZJ5 A;  3PX4 A;  5JUM A;  9ICI A;  4GIB A;  4ECV A;  8ICB A;  2W8K A;  2JEI A;  3R9K A;  1XSP A;  4UBC A;  3OSP A;  3IG5 A;  4PGX A;  1UA1 A;  3C2M A;  8ICL A;  4RNN A;  9ICW A;  1L7O A;  3HP6 A;  2ZIW B;  1U48 A;  3F5A A;  4NWI A;  1DGS A;  1QQ5 A;  1S77 D;  3V7J A;  4C0Z A;  1TK8 A;  1COO A;  3PW7 A;  8ICM A;  1D9D A;  4I27 A;  4BWM A;  1RYS A;  5J2B A;  4Y2T A;  3LDA A;  8ICS A;  4EYI B;  2NRT A;  2DBY A;  5L1J A;  1HJP A;  5J2A A;  4NLN A;  3SI8 A;  2IA6 A;  4UB2 A;  2WB1 F;  2LPE A;  2VAN A;  3ZDA A;  4OCZ A;  5DGA A;  5IIL A;  1RZT A;  8ICZ A;  2W04 A;  5J0W A;  1L8O A;  4J9O A;  3ED5 A;  5HR6 A;  2JR5 A;  4F71 A;  4NLG A;  4KLF A;  5AKX A;  2KJ5 A;  2QB1 A;  3UMC A;  3TAN A;  2YY6 A;  4CF5 A;  1KFT A;  4OJL A;  1MQ2 A;  1X6J A;  4IS7 A;  3NAS A;  2KV2 A;  4UB8 U;  2W55 A;  4PJ0 U;  9ICQ A;  2VA8 A;  3WU2 U;  9ICM A;  3NTU A;  2J6T A;  2IHN A;  4J03 A;  5KT3 A;  3HIL A;  3RB4 A;  5J2I A;  3SEI A;  3CW2 C;  4DL3 A;  2Z7J A;  1RQL A;  4FS2 A;  2FLN A;  2LHT A;  3T5K A;  4I2H A;  3CYM A;  3UMB A;  1B4F A;  3M9M B;  3KKA C;  5BOL A;  4ECX A;  4ACO A;  4Y2U A;  1L7N A;  1ZQK A;  1BGX T;  2ASJ A;  9ICJ A;  1BPB A;  8ICQ A;  3BZC A;  5KAF U;  1ZQN A;  4M47 A;  2NRZ A;  2HVI A;  4DOB A;  2KSO B;  2NRX A;  1DRG A;  1L6N A;  2MUT A;  2CXY A;  5DB7 A;  5KFE A;  2BCU A;  5EOZ A;  3MGV A;  3U26 A;  2DKZ A;  1ZQS A;  5KG3 A;  2VJ5 A;  3IHQ B;  5AKE A;  2H3F A;  3QU9 A;  4NLB A;  4DO9 A;  2MAX A;  4DL5 A;  4GXI A;  4QZI A;  4YMM A;  2O6K A;  4DL2 A;  5AKG A;  3THV A;  3M6K A;  4EBE A;  1TE2 A;  2YTU A;  3HW8 A;  3HKZ F;  2EQY A;  3KZX A;  4FBT A;  3FC4 A;  2CRX A;  2YB4 A;  2OCE A;  1PK3 A;  2W9M A;  8ICV A;  2WB1 C;  4JV2 A;  4YN4 A;  5KTQ A;  2W9A A;  1NI3 A;  5AK6 A;  3RR7 A;  3MR3 A;  3RF9 A;  1IXR A;  2W3R A;  1NKC A;  1ZQR A;  5KG0 A;  1MSW D;  2W3S A;  4OJ6 A;  2ZIU B;  1L3V A;  1KSP A;  5AM5 A;  5KFH A;  4TUQ A;  3WK4 A;  2DQN B;  1JRP A;  1SIJ A;  1B0X A;  4QIW F;  1WCN A;  1LKY B;  4RQN A;  7ICM A;  3SAG A;  3H8S A;  4YXJ A;  1A76 A;  1Z1B A;  1XC9 A;  4YR0 A;  5EE3 A;  2V4Q A;  1NJX A;  5KT6 A;  2W9B B;  5J2E A;  1RPL A;  4TQS A;  5HR7 A;  4DFP A;  5AM1 A;  2PFQ A;  3T5L A;  3K4G A;  2Y9T A;  2UVV A;  2Y1J A;  2PMZ F;  1XS9 D;  4J9S A;  3LYS A;  4E0D A;  3BQ2 A;  1IIP A;  2XIC A;  4C8L A;  2PKE A;  2R8J A;  2PXI A;  7ICO A;  1BPZ A;  2KZZ A;  3KHR A;  1JX4 A;  4U7C A;  4UAT A;  2KIV A;  5KT7 A;  1NKB A;  1PVR A;  1S76 D;  1V9P A;  3RJH A;  4U6P A;  5IIM A;  5ALW A;  3ZDE A;  2KJ8 A;  2JH1 A;  1S0V A;  3EUB 2;  4J9P A;  4LVS A;  3FYH A;  2BZF A;  2PFO A;  4KN7 A;  3M9N B;  1SKW A;  8ICF A;  4DFK A;  4NL9 C;  1KDH A;  4DSI A;  9ICT A;  4ICA A;  4J9N A;  1BPD A;  4Z6D A;  2EAO A;  5KFJ A;  2DL0 A;  1J97 A;  4UAZ A;  1YT3 A;  1T3Q A;  3GU3 A;  3KTQ A;  2RDI A;  1HUO A;  2NV3 A;  4C4R A;  5AM3 A;  5KFS A;  7ICJ A;  4M9H A;  2VA2 A;  2E8P A;  5BOM A;  3MGH A;  9ICC A;  3ZDB A;  2Q0Z X;  3JPO A;  4M9L A;  2WF6 A;  3N7P D;  1WWV A;  2JXJ A;  4RZR A;  2BQR A;  1D8L A;  3PW2 A;  4R65 A;  2ZXI A;  1BVS A;  2ZIV A;  5J2G A;  1NOM A;  1NJY A;  4F4Z A;  4MFF A;  2KE7 A;  5KG6 A;  1U9L A;  3AL0 B;  4QIW C;  5AKH A;  4R8U B;  1FEZ A;  2DFL A;  1SZP A;  2R18 A;  1Z00 B;  1T7P A;  7ICT A;  4BXO B;  4J9M A;  5DDM A;  2KZ3 A;  2GWS A;  3KHL A;  4UAS A;  4YR3 A;  4OD0 A;  4YMN A;  1Q3U A;  4P4P A;  3RBD A;  2EZX A;  3H40 A;  5CR0 A;  5AI5 A;  3QUQ A;  1MN8 A;  2HSZ A;  4PPX A;  2PMZ C;  4PHD A;  4F2S A;  4F2R A;  3GV7 B;  4JWN A;  2ZG6 A;  4QJF B;  1TAQ A;  2H3I A;  5J0X A;  4UW9 A;  9ICR A;  3MDC A;  3BZK A;  4P0P A;  5AIA A;  5KG2 A;  4ECZ A;  2PFN A;  3V7L A;  3V6J A;  3WKA A;  3PR4 A;  4DL6 A;  4J9Q A;  4F4W A;  1KRP A;  2OEH A;  3QYP A;  3SAH A;  3M6Z A;  2XGQ A;  4RQM A;  3TQ1 A;  2L5Y A;  5HML A;  5J0S A;  2XY7 A;  3PST A;  2IMW P;  2ESE A;  4EZ6 A;  2NYV A;  1SWW A;  2EZZ A;  1JXL A;  3T3F A;  1PVP A;  4F3O A;  1K5O A;  4XQ8 A;  4M6W A;  2YB1 A;  2KK0 A;  4RQ8 A;  3EZ5 A;  3KZI U;  5AKY A;  4DS5 A;  7ICH A;  1CRX A;  4JWM A;  4F5O A;  2LYA A;  4RU9 A;  2XID A;  4CF4 A;  2ISP A;  3HPO A;  1NNL A;  4ED1 A;  4F92 B;  4RNO A;  1ZXI A;  2F77 X;  2XC9 A;  2YX8 A;  5CJ7 A;  4MFA A;  4YCX A;  2B6G A;  4KLG A;  2K4E A;  1MQ3 A;  2XVT A;  9ICB A;  3RB0 A;  3Q8Q B;  1QTM A;  1SGG A;  3AN1 A;  1KN5 A;  3H8W A;  1KEJ A;  1QCK A;  4YQW A;  2A1J A;  4I2G A;  3AMZ A;  4IRC A;  1P7D A;  5KFG A;  4PGY A;  4ED3 A;  5IIK A;  5L9X A;  1SL1 A;  1DXS A;  3AU2 A;  4DEZ A;  2AJQ A;  3D2S A;  8ICY A;  2BCR A;  4DLE A;  1X9S A;  5TZV A;  3LVW A;  1MC8 A;  2G06 A;  5KFU A;  1NK6 A;  5ALJ A;  3DEE A;  3IG8 A;  1BNP A;  2F1H A;  2EH9 A;  2HBL A;  4DCC A;  1U47 A;  1Z3E B;  3T5J A;  5EE1 A;  5AKZ A;  2FMS A;  1SKS A;  3TFR A;  2G0A A;  5D4B A;  1O08 A;  4AYB C;  1NKE A;  2K8B B;  3QUT A;  4YR2 A;  4DSF A;  2YQE A;  3IRU A;  5KT5 A;  1L3U A;  4KLM A;  3G6Y A;  2DKX A;  1TK5 A;  1BPY A;  3GIL A;  2D8C A;  2KP7 A;  3WKB A;  2Y1I A;  4B9S A;  5AM2 A;  4O3N A;  5EWE A;  4KLE A;  1NK9 A;  3DDH A;  4P0Q A;  4RQ6 A;  1U4B A;  2QAR A;  1KFS A;  3ISD A;  7ICS A;  8ICN A;  5AHX A;  4EEK A;  2I5H A;  2RQ5 A;  4Y2Y A;  2F8K A;  5AKK A;  3JPN A;  3D2N A;  2LBO A;  3KHG A;  3PV8 A;  4C7Z A;  3E2E A;  2D6F C;  4QWE A;  1SXE A;  4Y2Q A;  1X9X A;  3PX6 A;  3HRD D;  5AKL A;  1Q8K A;  2MUT B;  3PW0 A;  2C22 A;  4DFD A;  4O3M A;  4BUG A;  1FFU A;  2F8L A;  2KNJ A;  4UB1 A;  2G09 A;  3HWT A;  5ALG A;  5DB9 A;  4O9M A;  5DG7 A;  1ZD2 P;  1SZH A;  5ALY A;  1U49 A;  1TKD A;  5J8Y A;  3ISC A;  3UM9 A;  5AI4 A;  4Y2S A;  2V9W A;  2VKQ A;  1ZQP A;  2NRV A;  4KLH A;  4F4K A;  4BX9 C;  3ETL A;  4NLC A;  5KT2 A;  2HHW A;  3GII A;  3BJY A;  5AM4 A;  2YMP A;  5KG5 A;  2XY5 A;  5JRT A;  5KNI A;  2QB0 A;  5DQH A;  3SD7 A;  2ZUD A;  4DQP A;  2C2D A;  3NVZ A;  1UPH A;  2E1E A;  4F50 A;  4O3Q A;  2HOI A;  2W9C A;  4EZ9 A;  4KLS A;  3K75 D;  4P2H A;  2KEY A;  4DF4 A;  1DK3 A;  2WF8 A;  2LKY A;  4F5P A;  3TAP A;  4CCH A;  2FJ6 A;  2Y0S F;  2KTQ A;  4BDP A;  4EEL A;  2ZUC A;  2KOB A;  2M9N A;  4TUS A;  3H8M A;  2HW3 A;  4QZ9 A;  4M2Y A;  1ZQF A;  3C29 A;  2E1F A;  5L1M A;  5JTI A;  2WAQ F;  5AK5 A;  5AI8 A;  2E8O A;  2XY6 A;  4UAR A;  3MAB A;  2JRZ A;  3EWA A;  5AIB A;  2R8I A;  2HDO A;  5ALD A;  3PML A;  5J2C A;  5G5G A;  1O03 A;  1A77 A;  2E3T A;  4FS1 A;  3SR6 A;  3GIJ A;  3C21 A;  1D8B A;  3NVV A;  2Y9U A;  2QLT A;  4CNQ A;  4UBB A;  1TAU A;  3DV9 A;  5J29 A;  4MFC A;  1T94 A;  7ICI A;  1COK A;  3WKC A;  4ECY A;  1KFD A;  2AH5 A;  2BDP A;  4QZA A;  1H38 A;  4YD2 A;  2IBK A;  3VC8 A;  2ZJ8 A;  3FDS A;  4YFK A;  4B9U A;  4RNM A;  2HBK A;  4IQU A;  3B0X A;  4KLU A;  3QUC A;  4KLL A;  4PHP A;  3ZD8 A;  1ZQO A;  4KN4 A;  4PL2 A;  3QEA Z;  5AK3 A;  5ALS A;  4TUR A;  3SAF A;  3C1Y A;  2PI5 A;  4I2E A;  1S8O A;  4ELV A;  1NK5 A;  3MDA A;  1ZQE A;  3IDW A;  1Q3V A;  2AQ0 A;  3ETR A;  4C8M A;  1JMS A;  1ZYQ A;  2EDU A;  3S6J A;  5ALF A;  4BGD A;  4F91 B;  2UVU A;  4NY8 A;  1QQ7 A;  2JZB A;  4PL1 A;  2F44 A;  2ODG A;  3SQI A;  3WK6 A;  5BPC A;  1QSL A;  3H8J A;  1ZQV A;  5HHH A;  3Q8S B;  3MFH A;  5ALE A;  1T8E A;  2MSN A;  3QU7 A;  4QWA A;  2FPL A;  2BDU A;  2BPG A;  4ECS A;  2BGW A;  5IIN A;  3JPS A;  4KLI A;  1UT5 A;  1X40 A;  3CRX A;  2HOF A;  3QZ8 A;  1PZN A;  3M9O B;  1ARO P;  5DGB A;  4B9L A;  4NLK A;  4CF3 A;  2DPJ A;  3PSP A;  5KFD A;  5EWF A;  2N1R A;  3Q8K A;  2LMR A;  3OTQ A;  3QXG A;  2HOQ A;  2Y0S C;  4PHA A;  3TI0 A;  2A3V A;  1S10 A;  4MHV A;  3CP8 A;  2WF5 A;  1PUZ A;  4IC9 A;  4Y2R A;  2KD1 A;  5AIC A;  3HX0 A;  2ES6 A;  2KVC A;  4C8N A;  1A6S A;  2R8H A;  2WAQ C;  3H7I A;  2BPF A;  1MA7 A;  2IOF A;  1BNO A;  5KFI A;  4Q8E A;  3J81 j;  3BS5 A;  2HI0 A;  3AQF A;  2LYB A;  2P66 A;  5DQG A;  3D2Q A;  3Q8M A;  4ECU A;  3I76 A;  2F1J A;  1OUQ A;  4DSK A;  5T14 A;  3NUQ A;  2RDJ A;  3TAD C;  3SV3 A;  4YP3 A;  2HBJ A;  3MFI A;  1N60 A;  2WTF A;  3ISB A;  5IIO A;  4I2J A;  2DWQ A;  1BPX A;  2IHM A;  1F0M A;  1CEZ A;  2ZIW A;  1SV0 C;  2BR0 A;  9ICP A;  1JAL A;  5J0R A;  3PSI A;  4M6W B;  3BQ7 A;  3KHH A;  1CI4 A;  2KN7 A;  3NRW A;  2OH2 A;  1S0M A;  8ICP A;  9ICE A;  4ED0 A;  4XA5 A;  5F9L A;  1M6Y A;  5ALR A;  2BQ3 A;  2AHO B;  1TV9 A;  3RJJ A;  2AXT U;  4DSE A;  4DL7 A;  4KX3 A;  5DB6 A;  4FE3 A;  4J9R A;  5ALK A;  2KJ9 A;  1UT8 A;  1DGJ A;  1Z4N A;  1N56 A;  4JV0 A;  1L7M A;  3AUO A;  4R63 A;  4EBD A;  8ICJ A;  4AP9 A;  4DSJ A;  3SMV A;  5J2F A;  5ALM A;  4JUZ A;  5A0L A;  3JPQ A;  1UQV A;  2ZTE A;  3Q8L A;  2A1J B;  4I2B A;  4Z6F A;  4MF8 A;  4QZF A;  5DQI A;  3KKA A;  3H0L B;  4RUC A;  3IN5 A;  2M0N A;  2UVW A;  3OPX A;  2ALZ A;  1ZQC A;  5DG8 A;  1TAM A;  9ICO A;  3QNM A;  3SYZ A;  4NV0 A;  1FO4 A;  4CGZ A;  9ICV A;  1WYG A;  2KKV A;  3ZDC A;  4USA A;  1HEK A;  4C80 A;  2OYY A;  3RR8 A;  1YZ6 A;  4CE6 A;  4RQ4 A;  4G3I A;  1SB3 C;  3TAC B;  4M9G A;  2KMD A;  4G9B A;  2FI1 A;  1ZQJ A;  1PVQ A;  5J2K A;  4RPZ A;  4EBC A;  4ECQ A;  2GO7 A;  5CA7 A;  1ZD3 A;  2W03 A;  4TQR A;  3Q8R B;  3PNC A;  5KG7 A;  1VDV A;  1DOQ A;  1ZQH A;  2E8N A;  4DSL A;  2YML A;  4ECR A;  1QSS A;  5GTI U;  5DLG A;  2FE9 A;  4P0Q B;  2IOF K;  5ALN A;  2QAR B;  3N97 B;  1SL0 A;  2MU2 A;  5ALX A;  2E5S A;  3GQC A;  1SWV A;  1PK1 B;  4DOA A;  4O5E A;  2HVH A;  4I29 A;  2LM4 A;  4B9N A;  4RT2 A;  2BCQ A;  1X2I A;  8ICH A;  2FDR A;  3PW5 A;  4EEN A;  2FLP A;  5HNK A;  4FZM A;  5J0Y A;  4AYB F;  2RP5 A;  2RHF A;  8ICK A;  4BWJ A;  3TAD A;  8ICG A;  3QUB A;  5KFA A;  2GLE A;  2ZIX B;  1N62 A;  3C23 A;  4KLJ A;  5KFO A;  2IOH A;  3PSF A;  3N7S C;  4I2I A;  2MRL A;  2CPR A;  3EPG A;  2NO4 A;  4NM1 A;  4F4Y A;  5J0O A;  5KL1 B;  1QQ6 A;  1NK7 A;  1L7P A; 
#chains in the Genus database with same CATH homology
 2RQ5 A;  5K4L A;  2EQY A;  1RYU A;  2JXJ A;  2EH9 A;  1KQQ A;  2JRZ A;  4LJX A;  1IG6 A;  2KK0 A;  2OEH A;  1C20 A;  1KKX A;  5CEH A;  2CXY A;  2YQE A;  2LM1 A;  2LI6 A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...