2YQEA

Solution structure of the arid domain of jarid1d protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji/ARID domain-containing protein 1D
publication title Solution structure of the ARID domain of JARID1D protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2yqeA00
2CXYA 5CEHA 1KQQA 2LI6A 1KN5A 2JXJA 2EQYA 1RYUA 2OEHA 2LM1A 5K4LA 2JRZA 2YQEA 2RQ5A 4LJXA 1IG6A 2KK0A 1C20A 2EH9A 1KKXA
chains in the Genus database with same CATH superfamily
5L1JA 3MGVA 2A19A 2HOFA 1MQ2A 1Q3VA 9ICNA 3QU5A 3G6YA 4TUPA 2A1JB 2MA1A 3L4PA 2ZJ5A 5KG5A 1V9PA 3SAFA 1K1SA 5AI5A 4QZGA 4ED2A 3AL0B 3ZDCA 4F4WA 3V6KA 4MHVA 4RQ1A 1XS9D 4F2RA 2I9GA 4ELUA 1N2XA 5CHGA 1ZQRA 5AM1A 1S0NA 4FZLA 3ORYA 1ZOLA 3Q8RB 4P2HA 2W9MA 1SV4A 2W9BB 2MUTB 3LDAA 4RPZA 4FZMA 3HRDD 4PGYA 5J0TA 1KDHA 2GWSA 2ALZA 4HYKA 4X5VA 3K1RB 4ELVA 4M9LA 1QQ5A 5J2BA 2L5YA 3ETLA 1RYRA 4ECRA 5KG0A 2Y1JA 3GV5B 3KKAA 4UAWA 3UMBA 3F5AA 4UATA 9ICVA 2WAQC 1CI4A 2ZUCA 1ZD4A 3NGDA 1IXRA 4DCCA 5DGBA 3BZCA 3V7LA 1NJWA 9ICAA 2AXTU 7ICMA 1O03A 3QU4A 3RJFA 4U6PA 2DGZA 1RXWA 1NKBA 2AHOB 4O0IA 1RQNA 1X9SA 1PK1A 2XIDA 5J2IA 4CF3A 5KG2A 3T5JA 4Y2UA 4RUCA 2AGQA 8ICIA 9ICWA 5IIKA 3THVA 4KLEA 3H7IA 4R63A 1UA0A 5KFLA 3WU2U 4IQVA 2JRZA 1X9WA 2NO4A 2H3FA 3PMNA 3PO4A 2QB1A 4IRKA 2ISOA 1VDVA 4OCZA 1P7DA 4RQ5A 1ZQBA 1KKXA 4KX5A 3IV6A 5KFSA 4MF2A 4UB6U 3UXOA 4JWMA 4LVSA 3H0RB 3A0BU 2HBJA 3AMZA 4KTQA 2BZFA 4EX6A 4JV2A 4CF4A 3PX0A 2HHQA 4DEZA 3ZD9A 4QZBA 5HMMA 1NNLA 2MU2A 2ZTDA 5ALLA 1NZPA 1QSSA 1ZQAA 3C2LA 5F3XB 2P6RA 2FPKA 2PFPA 2EZZA 4BWMA 2KFZA 1AROP 3RB0A 4B9MA 1WYGA 1JXLA 2H3VA 2F8LA 4AYBF 1X9XA 5D46A 5KFTA 3SENA 3F2DA 4ECYA 4UB1A 1Z4NA 2BPFA 2E8NA 1KFSA 2Y0SF 2D3DA 1KFTA 4O5EA 1UQVA 4RQ3A 1S77D 4F4KA 4DSIA 3C23A 1T7PA 3BJYA 2A1JA 3UPQA 5J2FA 1Q3UA 5DDYA 3C1ZA 3OHAA 5AKGA 1RQLA 5ALIA 8ICUA 1OUQA 2HHTA 3QU7A 4RT2A 2FJ6A 5ALEA 3HX0A 4E0DA 4Y2JA 3RJEA 5AM0A 1PUZA 3SZ2A 1UA1A 1Y88A 2ASJA 3SV4A 3KZIU 4OJOA 4ED0A 3RH4A 4RQMA 3WK6A 3RB3A 4EENA 2BPCA 2JH1A 3IG8A 1T3QA 2KKPA 5DG9A 5AKEA 8ICNA 3LVVA 2KJ5A 5JUMA 1VLBA 3MBYA 1DK2A 1MC8A 3WKEA 5DG8A 7ICOA 2ZUBA 5DBAA 2BQRA 4I2JA 1X42A 9ICMA 7ICFA 5KFQA 3PY8A 5CB1A 4ZH4A 5EOZA 2F1IA 3MC1A 3SR6A 3KHGA 4CCHA 4PHPA 2EAMA 2ZXIA 2QARB 3QUTA 5ALTA 4YD1A 2HDOA 9ICJA 2HOQA 1S10A 5J0YA 4JB3A 3I76A 9ICTA 4QNLA 1XC9A 3PW7A 2UVRA 1JI7A 5HMLA 4UB2A 2V9WA 4J9LA 4Y2VA 2WFAA 3NRZA 1UCVA 3RRHA 4DFJA 2PFNA 3D2NA 3F5EA 1A77A 1NK6A 2HHXA 3Q8LA 4AP9A 3RR8A 2PFOA 2EAOA 2VJ4A 5DBCA 3GIKA 3QUBA 8ICWA 3KTQA 3BQTA 2R8GA 2DBYA 5C0YA 4P0QB 5KT3A 2KIVA 4GLXA 3SAGA 2K89A 3GU3A 1Z1VA 1Z3EB 5DDMA 1S0MA 3GILA 4GXKA 4F93B 4IRDA 5ALOA 2C2EA 4EZ6A 4QZIA 1ZQMA 5J2KA 3MGIA 1U49A 3T79A 4YXJA 3FM9A 4B9UA 1Z00B 4IQWA 1YZ7A 7ICSA 4K4IA 4RQ0A 4Q43A 1NK8A 5DKWA 2JGAA 5DB6A 1ZQNA 3RH6A 2KVSA 5KFMA 4O3QA 2BDPA 2BKEA 2IHNA 4QZEA 4DFDA 4F71A 3N97B 2JMGA 2W54A 3OGUA 5HHHA 4IL6U 3N7SC 2BCUA 5EE0A 2H3QA 1JN3A 4I2HA 4BUGA 2NO5A 5HR7A 4ECQA 4Y2QA 5ALWA 4DL3A 2K4PA 2FLNA 4QZHA 1TK8A 3SD7A 1ZQYA 2LKYA 4JMUA 2OXOA 1ZYQA 2KJ8A 2NRWA 2R8IA 5AIBA 1D8BA 2BR0A 2KMDA 4FZNA 1XWLA 2WF8A 3QZ8A 2Y1IA 3NVVA 1U45A 3F2BA 1ED1A 4PZOA 2XY6A 2ZIUB 3TADC 1L7PA 4IRCA 4ED1A 4OJPA 4K4GA 1HJPA 1NK4A 2MRLA 2I1QA 3PW4A 1TKDA 4I2DA 2UVUA 1QQ6A 2HCFA 4EELA 2GH1A 2ODGA 5A0LA 4ECTA 4UQGA 2W7OA 4J9MA 8ICQA 4O5KA 1X6JA 2J6TA 2KJ9A 5ALDA 4DQPA 7ICHA 2DKXA 3WK7A 4RQ6A 4I29A 4FBTA 3UQ2A 1Q8KA 2QARA 3PVXA 3M6KA 5KT4A 4M47A 2PI5A 5BOLA 5KFOA 2K4IA 2BCVA 9ICCA 3C28A 2KNJA 2MAXA 4YCXA 2R8HA 1ZETA 4MFAA 4O3NA 5DBBA 4BXOB 9ICUA 2LI6A 3CW2C 4Y2YA 2LHTA 4J9OA 4GXIA 1SKRA 4TURA 3H0MB 4QWDA 3V6JA 8ICVA 4BDPA 2ZJAA 3RFAA 3AQEA 4ED8A 3D2QA 4R66A 5B66U 2KN7A 2H3IA 5J8YA 2Y9TA 1S0VA 4G3IA 2I5HA 3RF9A 3QYPA 3OJUA 1SL0A 4ED7A 5KFWA 4Q45A 3Q8QB 7ICRA 3M6ZA 3RJGA 4JK1A 1QTMA 1RM6C 4M6WA 5KFJA 4NJ8A 4B6JA 1OXJA 1A76A 2VA3A 5D49A 5KFDA 3SMVA 4DF4A 2EZYA 2QB0B 1V38A 4ED3A 1Z00A 5ALFA 1XO0A 2BCQA 7ICJA 2HBKA 2YTUA 3EPGA 3WK4A 7ICEA 1KW4A 3TFSA 3TAPA 1TE2A 3BS5A 2FLPA 5IIMA 5KT2A 3F53A 5AM5A 5HP4A 3C2MA 2V4QA 5KNIA 4QW8A 2IBKA 1ZQXA 4P4PA 1UHUA 2ZTCA 2KHVA 2NRZA 1ZQUA 4R8UA 2NRXA 4EBDA 3ISCA 1SWWA 1Z4OA 1ZQJA 1CUKA 4XQ8A 3AU6A 4DL2A 1U47A 4QIWC 4YR0A 9ICHA 5IIJA 2I6XA 5KFPA 4KN4A 1ZQOA 8ICXA 1NJXA 5CJ7A 4QWAA 3B9JA 1B22A 5KTQA 2JR5A 4EBCA 2LYHA 2JHDA 5TZVA 3PW0A 4IR1A 2ZIVB 4MF8A 2VANA 2KIWA 1TVAA 3RRGA 4YR3A 4I2CA 1U9LA 1ZQEA 1L7MA 1SL1A 4UAZA 2YMMA 2G5IB 4DQQA 4PGXA 1L5UA 4Y2SA 3G6XA 9ICRA 5AI8A 3TADA 3HJEA 2XI9A 5KFBA 2R8JA 5AKLA 4EYIB 2LYAA 3IP4B 2CN1A 3Q8SB 1T3NA 2W04A 3ZDBA 1D9DA 3JPSA 4I28A 2ZIXB 1D9FA 2BPGA 4F4YA 1PVRA 3JPQA 4EX7A 3KHRA 3D2SA 5IIOA 3RJJA 2LYBA 2KSOB 3EUB2 5CEHA 2FPLA 3E58A 3ZDDA 4XA5A 4LZGA 2GLEA 2V4RA 4M0AA 5AKJA 4NLBA 1X2IA 5ALSA 3QUQA 2E5SA 2K8CB 5AIAA 4OO1J 8ICEA 4O3PA 3EWAA 8ICPA 1FIQA 4IS7A 1WCNA 2OWOA 1GO3F 3MR5A 1ZQHA 2J6SA 1SXEA 2ASDA 3M8SA 4CRXA 1BPEA 5EWGA 1BPBA 2W8LA 1SXDA 3GDXA 3NVWA 9ICBA 4Q44A 1ZRNA 4NLCA 2VA2A 2FMPA 3WKAA 4M9NA 1ZQLA 4TQSA 1B43A 7ICKA 3M9NB 4NLZA 2YB4A 1BPXA 4F3OA 4KLUA 4TUQA 1HUZA 1LV5A 1L3TA 2C22A 5K4LA 1DOQA 4OJLA 1DGJA 2FPMA 3Q8MA 4JWNA 1HIWA 2ZG6A 1F44A 4KMOB 3WK5A 5GTIU 2K60A 7ICIA 2QB0A 1XSPA 2IOFK 3G6VA 2C28A 4KLQA 4KLTA 7ICLA 4UBBA 4ECXA 3RB4A 4YMMA 4ECZA 4KLMA 1ZRMA 2RRDA 4R64A 5KFYA 2FDRA 2JXJA 1BPDA 2F76X 5J2HA 2PXIA 1IIPA 1QH9A 4J9NA 1XNSA 2ZXHA 1L8OA 3H8WA 3LVWA 3QUCA 4UASA 4NY8A 5JU5A 4M9HA 2W9CB 5H2FU 3F2CA 4F8RA 4RQ7A 3EPIA 4QZDA 4NM1A 2CXYA 1KQQA 2AH5A 4M2YA 2E1EA 5F9NA 2XGQA 3HPOA 2PKEA 2Y9UA 2ZIVA 3CP8A 4Y2RA 2F44A 4RPYA 9ICGA 4B9VA 2ASLA 3S6JA 4GXJA 4I2BA 3FYHA 5ALNA 5AM2A 4J03A 3UM9A 7ICGA 5IIIA 4O3OA 3RTVA 4DFKA 2W9BA 2BHNA 2MUTA 4O9MA 3OSNA 2J6UA 3AN1A 4I27A 2IOFA 1YT3A 7ICQA 1KBUA 9ICXA 2KZMA 5J2CA 2JZBB 2JH7A 4IQTA 5CA7A 3WKBA 3PSPA 3SV3A 3PO5A 4USAA 4NL9C 4DFPA 3KOOA 1SL2A 1QLNA 3RAXA 4P0PB 1WUDA 3BQ0A 4MFCA 2B21A 2E8PA 4QZAA 3ISDA 4QIWF 3QE9Y 1ZQGA 1RXVA 5ALQA 1LB2B 2YMQA 4O3RA 1U4BA 5J2GA 3PMLA 2KD1A 4DL5A 1ZQWA 5DB8A 4DSJA 4EYHB 1NOMA 4YP3A 3C5GA 1SGGA 4BJQA 4XUSA 3IRUA 2W9AA 3RBDA 3Q8PB 3SAHA 4F72A 5AKXA 3HT3A 3BQ7A 5AK5A 3HW8A 5J8YC 3TQ1A 5ALPA 2HHUA 4PHAA 5L1LA 3WKDA 4ECVA 1KSPA 1N60A 3JPPA 3EW9A 4MEXA 4JV0A 2JV3A 3MDCA 3LWMA 3C1YA 1VJ5A 2G5HB 5KFEA 5EWEA 3MR3A 2G0AA 3BDPA 2XY5A 4CGZA 4KMUA 2W11A 5ALZA 4PHEA 4CF5A 2VIXA 2W8KA 4C8MA 4EEYA 5EE1A 1K5OA 4K4HA 3NRWA 4F5PA 4C8KA 1S5LU 4PPXA 2WAQF 1FEZA 4YG2A 1ZQIA 2ZIWB 4I2FA 3LWLA 5KG3A 4ELTA 3DEEA 2BGWA 2F1JA 2F8KA 2RP5A 2OCEA 2ZUDA 5F9LA 4KX3A 2MSNA 2RDIA 3IHQB 2AQ0A 1WWVA 3H40A 2B0CA 1EXNA 3JPOA 3PX6A 2WF9A 2HHVA 2HBMA 4FE3A 1TFRA 1WG8A 5B5EU 1Z19A 1J2NA 4QZCA 2K8BB 4O3SA 1OW5A 5DB9A 1X9MA 3RJHA 2KICA 5KL8B 1N61A 3UMCA 4P4MA 1HUOA 4Z6DA 3MR6A 3FDSA 5DLFA 3MGHA 1L7NA 2KTQA 4F5RA 8ICAA 2W3SA 4DSKA 2WB1C 5ALJA 2C2DA 2CPRA 4J9RA 2EDUA 5KFAA 4M9JA 2AJQA 7ICTA 1SIJA 2DPJA 4DLEA 4YMNA 5IILA 2AGOA 2Q4TA 3UXPA 3L5KA 1RYUA 3IN5A 2XY7A 4FO6A 4FS1A 5KG1A 1PVQA 2KKVA 3CYMA 8ICRA 4DQSA 5FP0A 1J97A 3PW2A 2PI4A 5KFIA 1DRGA 2XO7A 9ICOA 4PJ0U 4FBUA 3KD3A 3T5LA 3PNCA 5J0XA 2DQNB 4RPXA 5ALKA 5J0RA 3BQ1A 4P4OA 4YD2A 2DF4B 3SI8A 5G5GA 1SKWA 2HSZA 5J0OA 5KFNA 4DQIA 8ICLA 4NL9A 2JEIA 1XO1A 3RAQA 3BZKA 2C2RA 2VKQA 3M7DA 5J0PA 5AKIA 4RNOA 1BPYA 4J9KA 3ICXA 7ICNA 3B0XA 4ECUA 3H8MA 2P35A 4IR9A 4PZNA 4RQNA 5ALUA 5KL1B 3C5FA 2EAPA 4ACOA 1ZQ1C 4KLGA 4PHDA 2BQUA 3QX7A 8ICTA 4KLJA 2HBLA 4C8LA 4QZ9A 3A0HU 5DQIA 4C7ZA 1ZQCA 2CRXA 1PK1B 2WF5A 1V85A 1BNPA 3I1YA 3GIIA 1KRPA 4C8OA 2M9NA 4DSFA 8ICMA 1XSLA 2UVWA 4P0QA 2K4HA 1RPLA 2Y0SC 2G06A 1SZHA 4BGDA 4DOCA 4IQUA 4O5CA 7ICVA 2F1HA 2ZTEA 4QWEA 3JPRA 1TAQA 8ICZA 4Y2PA 2DWQA 2JEFA 4B9NA 2KFNA 3HP6A 2EH9A 4F5NA 3E2EA 2NRTA 3IG5A 2ZIWA 4YN4A 3HKZC 1JALA 1SWVA 4DQRA 8ICKA 2WF6A 5GTHU 1DK3A 4UARA 5AI0A 1D8LA 1JRPA 4KLDA 2KEYA 4TQRA 3DDHA 4BWJA 3H8JA 1S97A 2XCPA 5KFHA 4C8NA 2E1FA 2HI0A 3T5KA 1S8OA 3TACB 1N56A 1COKA 5ALXA 3ZDAA 4I2AA 4NWIA 1L8LA 1NK0A 4WJ3B 5DG7A 4C4TA 1H38A 3TAQA 1PVPA 5JTIA 3PSTA 1JIHA 2F2AB 1BPZA 3N7PD 2DKZA 1X66A 3VC8A 4PL1A 1AQ6A 4Y2XA 5AKYA 1QCKA 1LVHA 3LK9A 4LZDA 4QWCA 3EYZA 9ICPA 3L3FX 2AGPA 1N5XA 9ICSA 3OJSA 5DGAA 4MEYA 3QNMA 9ICFA 4F50A 2W3RA 2PFQA 2FI1A 2K4EA 2NYVA 3BS7A 5KFFA 3RBEA 5J0UA 1RYSA 2ZIUA 5L1KA 4KLHA 3OHBA 2RHFA 2OH2A 1F0MA 3MFHA 1SB3C 2XGPA 4F5OA 4NLNA 5J0WA 5CRXA 1MA7A 1RZTA 4I2IA 4ZOHC 4J9SA 4F91B 3CRXA 4QW9A 2E3TA 2F3NA 2HHSA 1HEKA 5ALGA 2YN4A 3PZPA 5AM4A 3SEIA 1ZJNA 4YMOA 5HNKA 1PZNA 5KFRA 4RQ2A 3AUOA 1KLNA 4B9TA 5EWFA 2M0NA 2QKQA 5DQHA 1U48A 5ALHA 2G09A 9ICIA 3MDAA 2YB1A 4Z6FA 2ZJ8A 2WB1F 1ECWA 2ISPA 3GQCA 1A0PA 5D4BA 2FLLA 4RUAA 3GIJA 3RJKA 1TAUA 4QZ8A 9ICKA 1FFUA 2DUYA 4BXOA 5AK4A 2WHEA 3ZI4A 1T4GA 2ES6A 2XC9A 1L3SA 4KLLA 1CRXA 4NV0A 1ZQZA 4US8A 4QZFA 1QQ7A 1SV0C 1V97A 3KZXA 3C29A 3OPXA 1O08A 2NRVA 4PL2A 5AHXA 3NVYA 4ICAA 4F92B 4YXMA 5KG4A 4F5QA 3IM1A 4GC7A 1XSNA 2LM4A 3NVZA 1FO4A 2PMZC 3MFIA 4CDGA 3PX4A 2ESEA 4PH5A 5J29A 3T3FA 1N62A 4OJ5A 3FC4A 5E79U 3SQIA 2E8OA 1UT5A 4JV1A 2KK0A 5AICA 1C20A 3KBBA 2KVCA 1JMSA 5BPCA 3RB6A 3AQFA 4DSLA 3TKAA 4I2GA 1TK0A 4NLGA 1B0XA 2A1AA 4OD0A 3KFUF 3ALRA 8ICOA 3QU2A 1S0OA 4DOBA 1NKEA 4Z6CA 2BDUA 1MSWD 8ICJA 3PV8A 4ECWA 4UB4A 5DB7A 2EZXA 2KE7A 3GIMA 2FMQA 1NJYA 4Q8FA 2DPIA 3DV9A 5AK3A 2UVVA 2HOIA 2O6KA 4GIBA 4G9BA 5L9XA 3H4BA 3PSIA 1C7YA 3FAHA 5KAIU 9ICLA 3BQ2A 2YY6A 8ICHA 2KG5A 1S76D 4I2EA 3IDWA 2H5XA 2IMWP 2HMXA 1IM4A 3N4MB 3JPTA 3R9KA 4DOAA 3U26A 1URJA 3J81j 3ISBA 4IC9A 4XRHA 4J9QA 4M04A 4DL6A 1N5WA 3D6JA 2IHMA 5KG6A 1BGXT 3HKZF 4GC6A 4F2SA 3LYSA 2IA6A 5T14A 2LM1A 2KHQA 1B4FA 3I28A 1ZQFA 9ICQA 4KLFA 3M9MB 3EZ5A 2XVTA 3ZD8A 2RQ5A 1KTQA 1QSYA 2XCAA 4YFKA 2ZIXA 1L7OA 1TAMA 1T94A 4A8EA 2BQ3A 2YX8A 5CP2A 2DFLA 1KEJA 3VCBA 4DO9A 8ICGA 2KSOA 1ZQPA 5KT5A 2HVIA 5AKHA 4Y2TA 2LMRA 5CWRA 4ECSA 5AI4A 1JXEA 5J2DA 4EZ9A 4JUZA 1BNOA 4UAUA 3PR5B 3JPNA 3UQ0A 2YQEA 3MR2A 3C21A 3WKCA 4O3MA 4RNNA 2VA8A 2OM6A 3AM9A 4RT3A 3ONNA 4RQ8A 4GFJA 1L3UA 5KFVA 3PSFA 4DLGA 4NM2A 2W55A 2IOHA 5TISU 4DFMA 3QU9A 3AEVA 4F4XA 4B9SA 1UPHA 5KFUA 3UMGA 4QJFB 1KL9A 3NS1A 1S9FA 4EBEA 4KITB 2YMPA 2OYYA 2FE9A 5ALRA 1NK7A 2AQ4A 2OHFA 5KFXA 4DS4A 1L6NA 1SV0A 3RJIA 1LKYB 2A3VA 4US9A 4YVZA 3H8SA 2W43A 5J0QA 5AI9A 4YQWA 5ALVA 2JEGA 2H3ZA 4NXZA 2DL0A 4TUSA 4UW9A 4UB3A 2EANA 5L1IA 3NTUA 3WK9A 2FMSA 1ZQQA 4C4SA 3ED5A 5CR0A 4EEKA 4C7YA 1L3VA 3CNHA 3UXNA 4M6WB 5AKKA 5HR6A 5AKZA 2OEHA 3AU2A 2K8AA 2QLTA 3K4GA 5KT7A 2BCSA 4M9GA 3HILA 3ETRA 1NKCA 2BCRA 2LBOA 2Z7JA 8ICSA 5EE9A 5KFKA 1SZPA 1X40A 3MABA 4FS2A 3WK8A 2KZZA 1WWUA 3N28A 4ED6A 1IV8A 3BS5B 3M1YA 4KLIA 3C2KA 3H0LB 1RG6A 1ZQKA 2XICA 5C5JA 5AI6A 2G08A 5DQGA 4RZRA 5J2AA 4PGQA 1ZXIA 5EE3A 4RQ4A 8ICCA 1Q46A 4RNMA 4R8UB 2W9CA 3T5HA 3N7RC 3KHLA 4MFFA 3ZDEA 1NJZA 2GO7A 2PMZF 3QXGA 3NUQA 4OJ6A 3RH5A 2JEJA 1DXSA 2EQYA 3V7KA 3TFRA 5KAFU 1PK3A 4C80A 5KG7A 4KLOA 2NV3A 3Q8KA 1JUDA 3NASA 2WF7A 4LJXA 1ZD5A 2AU0A 7ICUA 5J2JA 2G07A 4UBCA 2E8MA 4KN7A 1WCLA 5KFZA 2R18A 5AK6A 3B0YA 3E0FA 1TV9A 2KP7A 4DL7A 2W7PA 2JZBA 1TK5A 2R8KA 1K1QA 3RR7A 3PW5A 8ICFA 2YMLA 4QWBA 4P0PA 4UB5A 1M6YA 5JRTA 4DF8A 3V72A 3TANA 1COOA 3KKAC 2KOBA 1T8EA 4FFDA 3V7JA 2KV2A 2GOLA 1NZBA 3PR4A 5DLGA 3M8RA 1ZD3A 5J0SA 3O0FA 4R65A 3K1ZA 1IG6A 2KZ3A 1UT8A 2HVHA 4KLSA 4J9PA 1FFVA 4BX9C 2P6UA 4F4ZA 5KFGA 2F77X 1ZJMA 3GV8B 1XU4A 1D8YA 4UB8U 3GV7B 1N48A 1ZQVA 1ZQTA 3TI0A 3GFKB 3K75D 4Z6EA 4AYBC 1NK9A 2HHWA 4UAYA 4CE6A 1JX4A 2W03A 2D8CA 5KT6A 1ZQDA 1LKYA 5ALYA 4UAVA 2N1RA 2B6GA 1N63A 4RU9A 1JROA 2P66A 4Q8EA 3M9OB 1J2MA 1DGSA 4DL4A 3QEAZ 4CNQA 2ATLA 4C4RA 5IINA 1A6SA 4DSEA 2HW3A 1NK5A 3KHHA 3HWTA 4NLKA 1NI3A 5AM3A 1RDFA 3V6HA 5G5HA 3QEBZ 1SKSA 2Q0ZX 2RDJA 4C0ZA 1ZQSA 1QSLA 1F5SA 1CEZA 4YR2A 7ICPA 8ICYA 5KFCA 1Z1BA 5L1MA 2LPEA 2VJ5A 1ZD2P 5ALMA 4B9LA 3SYZA 1X6IA 1KN5A 3TARA 3H4DA 4U7CA 4DWIA 3OTQA 5J2EA 2D6FC 5HHIA 5BOMA 1KFDA 4DS5A 4HAIA 3GZFA 3QZ7A 3OSPA 1BVSA 8ICBA 1YZ6A 2WTFA 1MQ3A 2RLTA 9ICEA 1MN8A
chains in the Genus database with same CATH topology
2CXYA 5CEHA 1KQQA 2LI6A 1KN5A 2JXJA 2EQYA 1RYUA 2OEHA 2LM1A 5K4LA 2JRZA 2YQEA 2RQ5A 4LJXA 1IG6A 2KK0A 1C20A 2EH9A 1KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXY A;  5CEH A;  1KQQ A;  2LI6 A;  1KN5 A;  2JXJ A;  2EQY A;  1RYU A;  2OEH A;  2LM1 A;  5K4L A;  2JRZ A;  2YQE A;  2RQ5 A;  4LJX A;  1IG6 A;  2KK0 A;  1C20 A;  2EH9 A;  1KKX A; 
#chains in the Genus database with same CATH topology
 5L1J A;  3MGV A;  2A19 A;  2HOF A;  1MQ2 A;  1Q3V A;  9ICN A;  3QU5 A;  3G6Y A;  4TUP A;  2A1J B;  2MA1 A;  3L4P A;  2ZJ5 A;  5KG5 A;  1V9P A;  3SAF A;  1K1S A;  5AI5 A;  4QZG A;  4ED2 A;  3AL0 B;  3ZDC A;  4F4W A;  3V6K A;  4MHV A;  4RQ1 A;  1XS9 D;  4F2R A;  2I9G A;  4ELU A;  1N2X A;  5CHG A;  1ZQR A;  5AM1 A;  1S0N A;  4FZL A;  3ORY A;  1ZOL A;  3Q8R B;  4P2H A;  2W9M A;  1SV4 A;  2W9B B;  2MUT B;  3LDA A;  4RPZ A;  4FZM A;  3HRD D;  4PGY A;  5J0T A;  1KDH A;  2GWS A;  2ALZ A;  4HYK A;  4X5V A;  3K1R B;  4ELV A;  4M9L A;  1QQ5 A;  5J2B A;  2L5Y A;  3ETL A;  1RYR A;  4ECR A;  5KG0 A;  2Y1J A;  3GV5 B;  3KKA A;  4UAW A;  3UMB A;  3F5A A;  4UAT A;  9ICV A;  2WAQ C;  1CI4 A;  2ZUC A;  1ZD4 A;  3NGD A;  1IXR A;  4DCC A;  5DGB A;  3BZC A;  3V7L A;  1NJW A;  9ICA A;  2AXT U;  7ICM A;  1O03 A;  3QU4 A;  3RJF A;  4U6P A;  2DGZ A;  1RXW A;  1NKB A;  2AHO B;  4O0I A;  1RQN A;  1X9S A;  1PK1 A;  2XID A;  5J2I A;  4CF3 A;  5KG2 A;  3T5J A;  4Y2U A;  4RUC A;  2AGQ A;  8ICI A;  9ICW A;  5IIK A;  3THV A;  4KLE A;  3H7I A;  4R63 A;  1UA0 A;  5KFL A;  3WU2 U;  4IQV A;  2JRZ A;  1X9W A;  2NO4 A;  2H3F A;  3PMN A;  3PO4 A;  2QB1 A;  4IRK A;  2ISO A;  1VDV A;  4OCZ A;  1P7D A;  4RQ5 A;  1ZQB A;  1KKX A;  4KX5 A;  3IV6 A;  5KFS A;  4MF2 A;  4UB6 U;  3UXO A;  4JWM A;  4LVS A;  3H0R B;  3A0B U;  2HBJ A;  3AMZ A;  4KTQ A;  2BZF A;  4EX6 A;  4JV2 A;  4CF4 A;  3PX0 A;  2HHQ A;  4DEZ A;  3ZD9 A;  4QZB A;  5HMM A;  1NNL A;  2MU2 A;  2ZTD A;  5ALL A;  1NZP A;  1QSS A;  1ZQA A;  3C2L A;  5F3X B;  2P6R A;  2FPK A;  2PFP A;  2EZZ A;  4BWM A;  2KFZ A;  1ARO P;  3RB0 A;  4B9M A;  1WYG A;  1JXL A;  2H3V A;  2F8L A;  4AYB F;  1X9X A;  5D46 A;  5KFT A;  3SEN A;  3F2D A;  4ECY A;  4UB1 A;  1Z4N A;  2BPF A;  2E8N A;  1KFS A;  2Y0S F;  2D3D A;  1KFT A;  4O5E A;  1UQV A;  4RQ3 A;  1S77 D;  4F4K A;  4DSI A;  3C23 A;  1T7P A;  3BJY A;  2A1J A;  3UPQ A;  5J2F A;  1Q3U A;  5DDY A;  3C1Z A;  3OHA A;  5AKG A;  1RQL A;  5ALI A;  8ICU A;  1OUQ A;  2HHT A;  3QU7 A;  4RT2 A;  2FJ6 A;  5ALE A;  3HX0 A;  4E0D A;  4Y2J A;  3RJE A;  5AM0 A;  1PUZ A;  3SZ2 A;  1UA1 A;  1Y88 A;  2ASJ A;  3SV4 A;  3KZI U;  4OJO A;  4ED0 A;  3RH4 A;  4RQM A;  3WK6 A;  3RB3 A;  4EEN A;  2BPC A;  2JH1 A;  3IG8 A;  1T3Q A;  2KKP A;  5DG9 A;  5AKE A;  8ICN A;  3LVV A;  2KJ5 A;  5JUM A;  1VLB A;  3MBY A;  1DK2 A;  1MC8 A;  3WKE A;  5DG8 A;  7ICO A;  2ZUB A;  5DBA A;  2BQR A;  4I2J A;  1X42 A;  9ICM A;  7ICF A;  5KFQ A;  3PY8 A;  5CB1 A;  4ZH4 A;  5EOZ A;  2F1I A;  3MC1 A;  3SR6 A;  3KHG A;  4CCH A;  4PHP A;  2EAM A;  2ZXI A;  2QAR B;  3QUT A;  5ALT A;  4YD1 A;  2HDO A;  9ICJ A;  2HOQ A;  1S10 A;  5J0Y A;  4JB3 A;  3I76 A;  9ICT A;  4QNL A;  1XC9 A;  3PW7 A;  2UVR A;  1JI7 A;  5HML A;  4UB2 A;  2V9W A;  4J9L A;  4Y2V A;  2WFA A;  3NRZ A;  1UCV A;  3RRH A;  4DFJ A;  2PFN A;  3D2N A;  3F5E A;  1A77 A;  1NK6 A;  2HHX A;  3Q8L A;  4AP9 A;  3RR8 A;  2PFO A;  2EAO A;  2VJ4 A;  5DBC A;  3GIK A;  3QUB A;  8ICW A;  3KTQ A;  3BQT A;  2R8G A;  2DBY A;  5C0Y A;  4P0Q B;  5KT3 A;  2KIV A;  4GLX A;  3SAG A;  2K89 A;  3GU3 A;  1Z1V A;  1Z3E B;  5DDM A;  1S0M A;  3GIL A;  4GXK A;  4F93 B;  4IRD A;  5ALO A;  2C2E A;  4EZ6 A;  4QZI A;  1ZQM A;  5J2K A;  3MGI A;  1U49 A;  3T79 A;  4YXJ A;  3FM9 A;  4B9U A;  1Z00 B;  4IQW A;  1YZ7 A;  7ICS A;  4K4I A;  4RQ0 A;  4Q43 A;  1NK8 A;  5DKW A;  2JGA A;  5DB6 A;  1ZQN A;  3RH6 A;  2KVS A;  5KFM A;  4O3Q A;  2BDP A;  2BKE A;  2IHN A;  4QZE A;  4DFD A;  4F71 A;  3N97 B;  2JMG A;  2W54 A;  3OGU A;  5HHH A;  4IL6 U;  3N7S C;  2BCU A;  5EE0 A;  2H3Q A;  1JN3 A;  4I2H A;  4BUG A;  2NO5 A;  5HR7 A;  4ECQ A;  4Y2Q A;  5ALW A;  4DL3 A;  2K4P A;  2FLN A;  4QZH A;  1TK8 A;  3SD7 A;  1ZQY A;  2LKY A;  4JMU A;  2OXO A;  1ZYQ A;  2KJ8 A;  2NRW A;  2R8I A;  5AIB A;  1D8B A;  2BR0 A;  2KMD A;  4FZN A;  1XWL A;  2WF8 A;  3QZ8 A;  2Y1I A;  3NVV A;  1U45 A;  3F2B A;  1ED1 A;  4PZO A;  2XY6 A;  2ZIU B;  3TAD C;  1L7P A;  4IRC A;  4ED1 A;  4OJP A;  4K4G A;  1HJP A;  1NK4 A;  2MRL A;  2I1Q A;  3PW4 A;  1TKD A;  4I2D A;  2UVU A;  1QQ6 A;  2HCF A;  4EEL A;  2GH1 A;  2ODG A;  5A0L A;  4ECT A;  4UQG A;  2W7O A;  4J9M A;  8ICQ A;  4O5K A;  1X6J A;  2J6T A;  2KJ9 A;  5ALD A;  4DQP A;  7ICH A;  2DKX A;  3WK7 A;  4RQ6 A;  4I29 A;  4FBT A;  3UQ2 A;  1Q8K A;  2QAR A;  3PVX A;  3M6K A;  5KT4 A;  4M47 A;  2PI5 A;  5BOL A;  5KFO A;  2K4I A;  2BCV A;  9ICC A;  3C28 A;  2KNJ A;  2MAX A;  4YCX A;  2R8H A;  1ZET A;  4MFA A;  4O3N A;  5DBB A;  4BXO B;  9ICU A;  2LI6 A;  3CW2 C;  4Y2Y A;  2LHT A;  4J9O A;  4GXI A;  1SKR A;  4TUR A;  3H0M B;  4QWD A;  3V6J A;  8ICV A;  4BDP A;  2ZJA A;  3RFA A;  3AQE A;  4ED8 A;  3D2Q A;  4R66 A;  5B66 U;  2KN7 A;  2H3I A;  5J8Y A;  2Y9T A;  1S0V A;  4G3I A;  2I5H A;  3RF9 A;  3QYP A;  3OJU A;  1SL0 A;  4ED7 A;  5KFW A;  4Q45 A;  3Q8Q B;  7ICR A;  3M6Z A;  3RJG A;  4JK1 A;  1QTM A;  1RM6 C;  4M6W A;  5KFJ A;  4NJ8 A;  4B6J A;  1OXJ A;  1A76 A;  2VA3 A;  5D49 A;  5KFD A;  3SMV A;  4DF4 A;  2EZY A;  2QB0 B;  1V38 A;  4ED3 A;  1Z00 A;  5ALF A;  1XO0 A;  2BCQ A;  7ICJ A;  2HBK A;  2YTU A;  3EPG A;  3WK4 A;  7ICE A;  1KW4 A;  3TFS A;  3TAP A;  1TE2 A;  3BS5 A;  2FLP A;  5IIM A;  5KT2 A;  3F53 A;  5AM5 A;  5HP4 A;  3C2M A;  2V4Q A;  5KNI A;  4QW8 A;  2IBK A;  1ZQX A;  4P4P A;  1UHU A;  2ZTC A;  2KHV A;  2NRZ A;  1ZQU A;  4R8U A;  2NRX A;  4EBD A;  3ISC A;  1SWW A;  1Z4O A;  1ZQJ A;  1CUK A;  4XQ8 A;  3AU6 A;  4DL2 A;  1U47 A;  4QIW C;  4YR0 A;  9ICH A;  5IIJ A;  2I6X A;  5KFP A;  4KN4 A;  1ZQO A;  8ICX A;  1NJX A;  5CJ7 A;  4QWA A;  3B9J A;  1B22 A;  5KTQ A;  2JR5 A;  4EBC A;  2LYH A;  2JHD A;  5TZV A;  3PW0 A;  4IR1 A;  2ZIV B;  4MF8 A;  2VAN A;  2KIW A;  1TVA A;  3RRG A;  4YR3 A;  4I2C A;  1U9L A;  1ZQE A;  1L7M A;  1SL1 A;  4UAZ A;  2YMM A;  2G5I B;  4DQQ A;  4PGX A;  1L5U A;  4Y2S A;  3G6X A;  9ICR A;  5AI8 A;  3TAD A;  3HJE A;  2XI9 A;  5KFB A;  2R8J A;  5AKL A;  4EYI B;  2LYA A;  3IP4 B;  2CN1 A;  3Q8S B;  1T3N A;  2W04 A;  3ZDB A;  1D9D A;  3JPS A;  4I28 A;  2ZIX B;  1D9F A;  2BPG A;  4F4Y A;  1PVR A;  3JPQ A;  4EX7 A;  3KHR A;  3D2S A;  5IIO A;  3RJJ A;  2LYB A;  2KSO B;  3EUB 2;  5CEH A;  2FPL A;  3E58 A;  3ZDD A;  4XA5 A;  4LZG A;  2GLE A;  2V4R A;  4M0A A;  5AKJ A;  4NLB A;  1X2I A;  5ALS A;  3QUQ A;  2E5S A;  2K8C B;  5AIA A;  4OO1 J;  8ICE A;  4O3P A;  3EWA A;  8ICP A;  1FIQ A;  4IS7 A;  1WCN A;  2OWO A;  1GO3 F;  3MR5 A;  1ZQH A;  2J6S A;  1SXE A;  2ASD A;  3M8S A;  4CRX A;  1BPE A;  5EWG A;  1BPB A;  2W8L A;  1SXD A;  3GDX A;  3NVW A;  9ICB A;  4Q44 A;  1ZRN A;  4NLC A;  2VA2 A;  2FMP A;  3WKA A;  4M9N A;  1ZQL A;  4TQS A;  1B43 A;  7ICK A;  3M9N B;  4NLZ A;  2YB4 A;  1BPX A;  4F3O A;  4KLU A;  4TUQ A;  1HUZ A;  1LV5 A;  1L3T A;  2C22 A;  5K4L A;  1DOQ A;  4OJL A;  1DGJ A;  2FPM A;  3Q8M A;  4JWN A;  1HIW A;  2ZG6 A;  1F44 A;  4KMO B;  3WK5 A;  5GTI U;  2K60 A;  7ICI A;  2QB0 A;  1XSP A;  2IOF K;  3G6V A;  2C28 A;  4KLQ A;  4KLT A;  7ICL A;  4UBB A;  4ECX A;  3RB4 A;  4YMM A;  4ECZ A;  4KLM A;  1ZRM A;  2RRD A;  4R64 A;  5KFY A;  2FDR A;  2JXJ A;  1BPD A;  2F76 X;  5J2H A;  2PXI A;  1IIP A;  1QH9 A;  4J9N A;  1XNS A;  2ZXH A;  1L8O A;  3H8W A;  3LVW A;  3QUC A;  4UAS A;  4NY8 A;  5JU5 A;  4M9H A;  2W9C B;  5H2F U;  3F2C A;  4F8R A;  4RQ7 A;  3EPI A;  4QZD A;  4NM1 A;  2CXY A;  1KQQ A;  2AH5 A;  4M2Y A;  2E1E A;  5F9N A;  2XGQ A;  3HPO A;  2PKE A;  2Y9U A;  2ZIV A;  3CP8 A;  4Y2R A;  2F44 A;  4RPY A;  9ICG A;  4B9V A;  2ASL A;  3S6J A;  4GXJ A;  4I2B A;  3FYH A;  5ALN A;  5AM2 A;  4J03 A;  3UM9 A;  7ICG A;  5III A;  4O3O A;  3RTV A;  4DFK A;  2W9B A;  2BHN A;  2MUT A;  4O9M A;  3OSN A;  2J6U A;  3AN1 A;  4I27 A;  2IOF A;  1YT3 A;  7ICQ A;  1KBU A;  9ICX A;  2KZM A;  5J2C A;  2JZB B;  2JH7 A;  4IQT A;  5CA7 A;  3WKB A;  3PSP A;  3SV3 A;  3PO5 A;  4USA A;  4NL9 C;  4DFP A;  3KOO A;  1SL2 A;  1QLN A;  3RAX A;  4P0P B;  1WUD A;  3BQ0 A;  4MFC A;  2B21 A;  2E8P A;  4QZA A;  3ISD A;  4QIW F;  3QE9 Y;  1ZQG A;  1RXV A;  5ALQ A;  1LB2 B;  2YMQ A;  4O3R A;  1U4B A;  5J2G A;  3PML A;  2KD1 A;  4DL5 A;  1ZQW A;  5DB8 A;  4DSJ A;  4EYH B;  1NOM A;  4YP3 A;  3C5G A;  1SGG A;  4BJQ A;  4XUS A;  3IRU A;  2W9A A;  3RBD A;  3Q8P B;  3SAH A;  4F72 A;  5AKX A;  3HT3 A;  3BQ7 A;  5AK5 A;  3HW8 A;  5J8Y C;  3TQ1 A;  5ALP A;  2HHU A;  4PHA A;  5L1L A;  3WKD A;  4ECV A;  1KSP A;  1N60 A;  3JPP A;  3EW9 A;  4MEX A;  4JV0 A;  2JV3 A;  3MDC A;  3LWM A;  3C1Y A;  1VJ5 A;  2G5H B;  5KFE A;  5EWE A;  3MR3 A;  2G0A A;  3BDP A;  2XY5 A;  4CGZ A;  4KMU A;  2W11 A;  5ALZ A;  4PHE A;  4CF5 A;  2VIX A;  2W8K A;  4C8M A;  4EEY A;  5EE1 A;  1K5O A;  4K4H A;  3NRW A;  4F5P A;  4C8K A;  1S5L U;  4PPX A;  2WAQ F;  1FEZ A;  4YG2 A;  1ZQI A;  2ZIW B;  4I2F A;  3LWL A;  5KG3 A;  4ELT A;  3DEE A;  2BGW A;  2F1J A;  2F8K A;  2RP5 A;  2OCE A;  2ZUD A;  5F9L A;  4KX3 A;  2MSN A;  2RDI A;  3IHQ B;  2AQ0 A;  1WWV A;  3H40 A;  2B0C A;  1EXN A;  3JPO A;  3PX6 A;  2WF9 A;  2HHV A;  2HBM A;  4FE3 A;  1TFR A;  1WG8 A;  5B5E U;  1Z19 A;  1J2N A;  4QZC A;  2K8B B;  4O3S A;  1OW5 A;  5DB9 A;  1X9M A;  3RJH A;  2KIC A;  5KL8 B;  1N61 A;  3UMC A;  4P4M A;  1HUO A;  4Z6D A;  3MR6 A;  3FDS A;  5DLF A;  3MGH A;  1L7N A;  2KTQ A;  4F5R A;  8ICA A;  2W3S A;  4DSK A;  2WB1 C;  5ALJ A;  2C2D A;  2CPR A;  4J9R A;  2EDU A;  5KFA A;  4M9J A;  2AJQ A;  7ICT A;  1SIJ A;  2DPJ A;  4DLE A;  4YMN A;  5IIL A;  2AGO A;  2Q4T A;  3UXP A;  3L5K A;  1RYU A;  3IN5 A;  2XY7 A;  4FO6 A;  4FS1 A;  5KG1 A;  1PVQ A;  2KKV A;  3CYM A;  8ICR A;  4DQS A;  5FP0 A;  1J97 A;  3PW2 A;  2PI4 A;  5KFI A;  1DRG A;  2XO7 A;  9ICO A;  4PJ0 U;  4FBU A;  3KD3 A;  3T5L A;  3PNC A;  5J0X A;  2DQN B;  4RPX A;  5ALK A;  5J0R A;  3BQ1 A;  4P4O A;  4YD2 A;  2DF4 B;  3SI8 A;  5G5G A;  1SKW A;  2HSZ A;  5J0O A;  5KFN A;  4DQI A;  8ICL A;  4NL9 A;  2JEI A;  1XO1 A;  3RAQ A;  3BZK A;  2C2R A;  2VKQ A;  3M7D A;  5J0P A;  5AKI A;  4RNO A;  1BPY A;  4J9K A;  3ICX A;  7ICN A;  3B0X A;  4ECU A;  3H8M A;  2P35 A;  4IR9 A;  4PZN A;  4RQN A;  5ALU A;  5KL1 B;  3C5F A;  2EAP A;  4ACO A;  1ZQ1 C;  4KLG A;  4PHD A;  2BQU A;  3QX7 A;  8ICT A;  4KLJ A;  2HBL A;  4C8L A;  4QZ9 A;  3A0H U;  5DQI A;  4C7Z A;  1ZQC A;  2CRX A;  1PK1 B;  2WF5 A;  1V85 A;  1BNP A;  3I1Y A;  3GII A;  1KRP A;  4C8O A;  2M9N A;  4DSF A;  8ICM A;  1XSL A;  2UVW A;  4P0Q A;  2K4H A;  1RPL A;  2Y0S C;  2G06 A;  1SZH A;  4BGD A;  4DOC A;  4IQU A;  4O5C A;  7ICV A;  2F1H A;  2ZTE A;  4QWE A;  3JPR A;  1TAQ A;  8ICZ A;  4Y2P A;  2DWQ A;  2JEF A;  4B9N A;  2KFN A;  3HP6 A;  2EH9 A;  4F5N A;  3E2E A;  2NRT A;  3IG5 A;  2ZIW A;  4YN4 A;  3HKZ C;  1JAL A;  1SWV A;  4DQR A;  8ICK A;  2WF6 A;  5GTH U;  1DK3 A;  4UAR A;  5AI0 A;  1D8L A;  1JRP A;  4KLD A;  2KEY A;  4TQR A;  3DDH A;  4BWJ A;  3H8J A;  1S97 A;  2XCP A;  5KFH A;  4C8N A;  2E1F A;  2HI0 A;  3T5K A;  1S8O A;  3TAC B;  1N56 A;  1COK A;  5ALX A;  3ZDA A;  4I2A A;  4NWI A;  1L8L A;  1NK0 A;  4WJ3 B;  5DG7 A;  4C4T A;  1H38 A;  3TAQ A;  1PVP A;  5JTI A;  3PST A;  1JIH A;  2F2A B;  1BPZ A;  3N7P D;  2DKZ A;  1X66 A;  3VC8 A;  4PL1 A;  1AQ6 A;  4Y2X A;  5AKY A;  1QCK A;  1LVH A;  3LK9 A;  4LZD A;  4QWC A;  3EYZ A;  9ICP A;  3L3F X;  2AGP A;  1N5X A;  9ICS A;  3OJS A;  5DGA A;  4MEY A;  3QNM A;  9ICF A;  4F50 A;  2W3R A;  2PFQ A;  2FI1 A;  2K4E A;  2NYV A;  3BS7 A;  5KFF A;  3RBE A;  5J0U A;  1RYS A;  2ZIU A;  5L1K A;  4KLH A;  3OHB A;  2RHF A;  2OH2 A;  1F0M A;  3MFH A;  1SB3 C;  2XGP A;  4F5O A;  4NLN A;  5J0W A;  5CRX A;  1MA7 A;  1RZT A;  4I2I A;  4ZOH C;  4J9S A;  4F91 B;  3CRX A;  4QW9 A;  2E3T A;  2F3N A;  2HHS A;  1HEK A;  5ALG A;  2YN4 A;  3PZP A;  5AM4 A;  3SEI A;  1ZJN A;  4YMO A;  5HNK A;  1PZN A;  5KFR A;  4RQ2 A;  3AUO A;  1KLN A;  4B9T A;  5EWF A;  2M0N A;  2QKQ A;  5DQH A;  1U48 A;  5ALH A;  2G09 A;  9ICI A;  3MDA A;  2YB1 A;  4Z6F A;  2ZJ8 A;  2WB1 F;  1ECW A;  2ISP A;  3GQC A;  1A0P A;  5D4B A;  2FLL A;  4RUA A;  3GIJ A;  3RJK A;  1TAU A;  4QZ8 A;  9ICK A;  1FFU A;  2DUY A;  4BXO A;  5AK4 A;  2WHE A;  3ZI4 A;  1T4G A;  2ES6 A;  2XC9 A;  1L3S A;  4KLL A;  1CRX A;  4NV0 A;  1ZQZ A;  4US8 A;  4QZF A;  1QQ7 A;  1SV0 C;  1V97 A;  3KZX A;  3C29 A;  3OPX A;  1O08 A;  2NRV A;  4PL2 A;  5AHX A;  3NVY A;  4ICA A;  4F92 B;  4YXM A;  5KG4 A;  4F5Q A;  3IM1 A;  4GC7 A;  1XSN A;  2LM4 A;  3NVZ A;  1FO4 A;  2PMZ C;  3MFI A;  4CDG A;  3PX4 A;  2ESE A;  4PH5 A;  5J29 A;  3T3F A;  1N62 A;  4OJ5 A;  3FC4 A;  5E79 U;  3SQI A;  2E8O A;  1UT5 A;  4JV1 A;  2KK0 A;  5AIC A;  1C20 A;  3KBB A;  2KVC A;  1JMS A;  5BPC A;  3RB6 A;  3AQF A;  4DSL A;  3TKA A;  4I2G A;  1TK0 A;  4NLG A;  1B0X A;  2A1A A;  4OD0 A;  3KFU F;  3ALR A;  8ICO A;  3QU2 A;  1S0O A;  4DOB A;  1NKE A;  4Z6C A;  2BDU A;  1MSW D;  8ICJ A;  3PV8 A;  4ECW A;  4UB4 A;  5DB7 A;  2EZX A;  2KE7 A;  3GIM A;  2FMQ A;  1NJY A;  4Q8F A;  2DPI A;  3DV9 A;  5AK3 A;  2UVV A;  2HOI A;  2O6K A;  4GIB A;  4G9B A;  5L9X A;  3H4B A;  3PSI A;  1C7Y A;  3FAH A;  5KAI U;  9ICL A;  3BQ2 A;  2YY6 A;  8ICH A;  2KG5 A;  1S76 D;  4I2E A;  3IDW A;  2H5X A;  2IMW P;  2HMX A;  1IM4 A;  3N4M B;  3JPT A;  3R9K A;  4DOA A;  3U26 A;  1URJ A;  3J81 j;  3ISB A;  4IC9 A;  4XRH A;  4J9Q A;  4M04 A;  4DL6 A;  1N5W A;  3D6J A;  2IHM A;  5KG6 A;  1BGX T;  3HKZ F;  4GC6 A;  4F2S A;  3LYS A;  2IA6 A;  5T14 A;  2LM1 A;  2KHQ A;  1B4F A;  3I28 A;  1ZQF A;  9ICQ A;  4KLF A;  3M9M B;  3EZ5 A;  2XVT A;  3ZD8 A;  2RQ5 A;  1KTQ A;  1QSY A;  2XCA A;  4YFK A;  2ZIX A;  1L7O A;  1TAM A;  1T94 A;  4A8E A;  2BQ3 A;  2YX8 A;  5CP2 A;  2DFL A;  1KEJ A;  3VCB A;  4DO9 A;  8ICG A;  2KSO A;  1ZQP A;  5KT5 A;  2HVI A;  5AKH A;  4Y2T A;  2LMR A;  5CWR A;  4ECS A;  5AI4 A;  1JXE A;  5J2D A;  4EZ9 A;  4JUZ A;  1BNO A;  4UAU A;  3PR5 B;  3JPN A;  3UQ0 A;  2YQE A;  3MR2 A;  3C21 A;  3WKC A;  4O3M A;  4RNN A;  2VA8 A;  2OM6 A;  3AM9 A;  4RT3 A;  3ONN A;  4RQ8 A;  4GFJ A;  1L3U A;  5KFV A;  3PSF A;  4DLG A;  4NM2 A;  2W55 A;  2IOH A;  5TIS U;  4DFM A;  3QU9 A;  3AEV A;  4F4X A;  4B9S A;  1UPH A;  5KFU A;  3UMG A;  4QJF B;  1KL9 A;  3NS1 A;  1S9F A;  4EBE A;  4KIT B;  2YMP A;  2OYY A;  2FE9 A;  5ALR A;  1NK7 A;  2AQ4 A;  2OHF A;  5KFX A;  4DS4 A;  1L6N A;  1SV0 A;  3RJI A;  1LKY B;  2A3V A;  4US9 A;  4YVZ A;  3H8S A;  2W43 A;  5J0Q A;  5AI9 A;  4YQW A;  5ALV A;  2JEG A;  2H3Z A;  4NXZ A;  2DL0 A;  4TUS A;  4UW9 A;  4UB3 A;  2EAN A;  5L1I A;  3NTU A;  3WK9 A;  2FMS A;  1ZQQ A;  4C4S A;  3ED5 A;  5CR0 A;  4EEK A;  4C7Y A;  1L3V A;  3CNH A;  3UXN A;  4M6W B;  5AKK A;  5HR6 A;  5AKZ A;  2OEH A;  3AU2 A;  2K8A A;  2QLT A;  3K4G A;  5KT7 A;  2BCS A;  4M9G A;  3HIL A;  3ETR A;  1NKC A;  2BCR A;  2LBO A;  2Z7J A;  8ICS A;  5EE9 A;  5KFK A;  1SZP A;  1X40 A;  3MAB A;  4FS2 A;  3WK8 A;  2KZZ A;  1WWU A;  3N28 A;  4ED6 A;  1IV8 A;  3BS5 B;  3M1Y A;  4KLI A;  3C2K A;  3H0L B;  1RG6 A;  1ZQK A;  2XIC A;  5C5J A;  5AI6 A;  2G08 A;  5DQG A;  4RZR A;  5J2A A;  4PGQ A;  1ZXI A;  5EE3 A;  4RQ4 A;  8ICC A;  1Q46 A;  4RNM A;  4R8U B;  2W9C A;  3T5H A;  3N7R C;  3KHL A;  4MFF A;  3ZDE A;  1NJZ A;  2GO7 A;  2PMZ F;  3QXG A;  3NUQ A;  4OJ6 A;  3RH5 A;  2JEJ A;  1DXS A;  2EQY A;  3V7K A;  3TFR A;  5KAF U;  1PK3 A;  4C80 A;  5KG7 A;  4KLO A;  2NV3 A;  3Q8K A;  1JUD A;  3NAS A;  2WF7 A;  4LJX A;  1ZD5 A;  2AU0 A;  7ICU A;  5J2J A;  2G07 A;  4UBC A;  2E8M A;  4KN7 A;  1WCL A;  5KFZ A;  2R18 A;  5AK6 A;  3B0Y A;  3E0F A;  1TV9 A;  2KP7 A;  4DL7 A;  2W7P A;  2JZB A;  1TK5 A;  2R8K A;  1K1Q A;  3RR7 A;  3PW5 A;  8ICF A;  2YML A;  4QWB A;  4P0P A;  4UB5 A;  1M6Y A;  5JRT A;  4DF8 A;  3V72 A;  3TAN A;  1COO A;  3KKA C;  2KOB A;  1T8E A;  4FFD A;  3V7J A;  2KV2 A;  2GOL A;  1NZB A;  3PR4 A;  5DLG A;  3M8R A;  1ZD3 A;  5J0S A;  3O0F A;  4R65 A;  3K1Z A;  1IG6 A;  2KZ3 A;  1UT8 A;  2HVH A;  4KLS A;  4J9P A;  1FFV A;  4BX9 C;  2P6U A;  4F4Z A;  5KFG A;  2F77 X;  1ZJM A;  3GV8 B;  1XU4 A;  1D8Y A;  4UB8 U;  3GV7 B;  1N48 A;  1ZQV A;  1ZQT A;  3TI0 A;  3GFK B;  3K75 D;  4Z6E A;  4AYB C;  1NK9 A;  2HHW A;  4UAY A;  4CE6 A;  1JX4 A;  2W03 A;  2D8C A;  5KT6 A;  1ZQD A;  1LKY A;  5ALY A;  4UAV A;  2N1R A;  2B6G A;  1N63 A;  4RU9 A;  1JRO A;  2P66 A;  4Q8E A;  3M9O B;  1J2M A;  1DGS A;  4DL4 A;  3QEA Z;  4CNQ A;  2ATL A;  4C4R A;  5IIN A;  1A6S A;  4DSE A;  2HW3 A;  1NK5 A;  3KHH A;  3HWT A;  4NLK A;  1NI3 A;  5AM3 A;  1RDF A;  3V6H A;  5G5H A;  3QEB Z;  1SKS A;  2Q0Z X;  2RDJ A;  4C0Z A;  1ZQS A;  1QSL A;  1F5S A;  1CEZ A;  4YR2 A;  7ICP A;  8ICY A;  5KFC A;  1Z1B A;  5L1M A;  2LPE A;  2VJ5 A;  1ZD2 P;  5ALM A;  4B9L A;  3SYZ A;  1X6I A;  1KN5 A;  3TAR A;  3H4D A;  4U7C A;  4DWI A;  3OTQ A;  5J2E A;  2D6F C;  5HHI A;  5BOM A;  1KFD A;  4DS5 A;  4HAI A;  3GZF A;  3QZ7 A;  3OSP A;  1BVS A;  8ICB A;  1YZ6 A;  2WTF A;  1MQ3 A;  2RLT A;  9ICE A;  1MN8 A; 
#chains in the Genus database with same CATH homology
 2CXY A;  5CEH A;  1KQQ A;  2LI6 A;  1KN5 A;  2JXJ A;  2EQY A;  1RYU A;  2OEH A;  2LM1 A;  5K4L A;  2JRZ A;  2YQE A;  2RQ5 A;  4LJX A;  1IG6 A;  2KK0 A;  1C20 A;  2EH9 A;  1KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...