2YQEA

Solution structure of the arid domain of jarid1d protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ARID domain of JARID1D protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Jumonji/ARID domain-containing protein 1D
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2yqeA00
2EQYA 2YQEA 4LJXA 2JRZA 2RQ5A 1RYUA 2EH9A 1KKXA 1KQQA 1IG6A 5K4LA 2JXJA 2LI6A 1KN5A 2KK0A 2OEHA 2CXYA 5CEHA 2LM1A 1C20A
chains in the Genus database with same CATH superfamily
3MR6A 2Y1JA 1PVQA 1K5OA 2KD1A 4K4GA 2K8CB 3H8SA 4OJLA 9ICQA 2WTFA 3RR7A 2A1JB 7ICIA 2AXTU 4EBCA 3BZCA 5AK4A 2W43A 4M6WB 4UQGA 1KL9A 1TAUA 2EH9A 4GC6A 5DDMA 2DPJA 5AKIA 5ALKA 4DL3A 1MC8A 3D2NA 4F2SA 2R8GA 2RLTA 2Y0SC 3WK7A 2ZIWB 3JPSA 2W8KA 4F72A 2XI9A 4TUSA 2E8PA 2F76X 3D2SA 4F5RA 1B4FA 4XQ8A 2LM4A 1SZHA 4DWIA 4F4YA 7ICVA 5AK3A 4YXJA 4Y2RA 4NY8A 4TUPA 5IILA 5DB7A 1F44A 2ZIXB 3QYPA 1FO4A 2PFPA 2W11A 2CPRA 2PXIA 5EE9A 3SEIA 1ZQFA 1YZ7A 4GLXA 2ASJA 1ZJMA 3OHAA 4J9QA 1TKDA 1Z3EB 5L1JA 2OM6A 3PNCA 5FP0A 5BPCA 5AKKA 2W9BB 4OJ5A 1QTMA 1WUDA 4C4TA 1SL0A 1ZRMA 5K4LA 5KL1B 2HI0A 4KLJA 1YT3A 4J9PA 3C5FA 1TK0A 3LK9A 2ZJ5A 4NLBA 3EZ5A 1NJYA 1V38A 5GTIU 4Y2JA 1U4BA 1NK5A 4OJOA 5JRTA 1ZQZA 1ZQRA 3D6JA 3FYHA 3RJKA 5AHXA 2AH5A 4Z6FA 5KFIA 3RF9A 4XRHA 1NKCA 1A0PA 3RBEA 4ED0A 4PGQA 1T7PA 1Q8KA 4AYBC 3KD3A 1D8LA 2LBOA 5DB6A 3EWAA 5KG7A 3UXOA 1EXNA 2KE7A 5IIIA 4B6JA 1TAQA 3OJSA 3WKEA 2M0NA 3RJJA 2YB4A 1JI7A 4U6PA 2XY5A 5J2IA 2Y1IA 3TFSA 3J81j 2EDUA 2KKPA 5KG0A 2ZXIA 1X2IA 1RXVA 4I27A 7ICLA 1L3VA 2JV3A 4OO1J 5AI9A 1NK0A 5CWRA 4JV0A 5KT6A 3QZ7A 2GH1A 5GTHU 1SV4A 2KJ5A 4ECZA 2ISPA 5KG2A 1TE2A 2AQ0A 3B0YA 2WFAA 2Q0ZX 4YMNA 4CGZA 9ICXA 1IG6A 3F5EA 1H38A 2OWOA 1L7NA 4F91B 2AJQA 5KT7A 4CCHA 4M47A 5KG3A 3QUTA 4O3MA 3L3FX 3A0HU 2HHQA 4KLIA 1N62A 1T3QA 3KTQA 4F4XA 2XC9A 4I2AA 1L7MA 2AGPA 5B5EU 3A0BU 1RYRA 3MR5A 4IQWA 1UT8A 3ZDCA 3ZDBA 2R8IA 3F53A 3ICXA 4MF8A 5AI4A 2HHXA 4QZDA 1SL2A 2ASLA 4O3QA 9ICFA 1V97A 4C0ZA 2ZIUB 3HKZF 2KKVA 2K4HA 1PK3A 4EBDA 2LYBA 4KITB 3BS7A 3ZD9A 8ICOA 3HWTA 3FAHA 4NLGA 5J8YA 1ZQUA 2W04A 4J9MA 2PKEA 2NO4A 3UMBA 1RYSA 8ICUA 1KW4A 2LYHA 1C7YA 1S9FA 4DSJA 3ISCA 3RBDA 3T79A 4DSEA 5KL8B 1S0OA 1S8OA 4UAUA 1N60A 3KKAC 2KZ3A 3BZKA 4JMUA 4M9JA 3NTUA 4ACOA 3ISBA 4KLMA 3TFRA 8ICZA 1SGGA 4B9SA 4EEKA 7ICMA 5J0SA 3B0XA 4NLNA 4UBCA 3IRUA 1A77A 2MUTB 1RPLA 2E8MA 1CRXA 4KLQA 1JALA 1D9FA 1HEKA 1ZQBA 1SV0C 2OYYA 4UBBA 2NRZA 2JMGA 3IN5A 3EYZA 2W9CA 5KFYA 1L3TA 3S6JA 5AIAA 3HILA 2BQUA 4O3RA 3WK8A 2C2EA 5EWFA 5G5GA 4UB1A 2QLTA 4ELUA 2KTQA 2DKZA 2EZXA 2ALZA 3UM9A 5HNKA 5J0UA 2RHFA 2MAXA 3WK9A 3MGVA 4DFPA 1XS9D 4P4PA 1KSPA 1K1QA 5KAIU 1NOMA 1VJ5A 5J2FA 4C8OA 1ZQDA 3RH5A 4GIBA 2P6UA 2ZUBA 1KFTA 3PW2A 4I29A 9ICRA 2JEGA 1SKWA 2L5YA 2ZXHA 3LVWA 4EYHB 2WAQC 2BCUA 3QEAZ 3CP8A 1ZQLA 1BPDA 3BDPA 9ICSA 1COOA 3T5HA 2GO7A 1TVAA 1ZQWA 2BQRA 4KLTA 1WCLA 1JMSA 5KT4A 2FMQA 1PK1B 3VC8A 5KFUA 2IA6A 7ICGA 4Y2QA 4NM1A 4Q8EA 2WAQF 4PL2A 4B9LA 3QU4A 3TANA 3MC1A 2YY6A 5EOZA 3N7RC 3KZXA 1SB3C 5CRXA 1DGSA 4EX6A 1L7OA 1KTQA 5ALWA 5KFSA 3HW8A 4IC9A 1ZQQA 2JEFA 4I2GA 3PW5A 4KX5A 3LWLA 8ICIA 4EZ9A 5AKZA 2HBJA 3QU5A 1KRPA 3M9OB 5ALLA 4YR2A 4I2FA 5KNIA 1RDFA 3MDAA 4O3PA 2R8HA 5KFMA 1U48A 1QSLA 2QARA 8ICMA 4ELTA 2IOFK 2NRXA 5KFFA 4DQSA 2R18A 5L1KA 3K1RB 4C8MA 2F8LA 1HJPA 3NRWA 3PO5A 4NV0A 2J6TA 1ZOLA 2IOFA 4OCZA 3KHLA 1Z00A 5ALTA 3G6VA 2ATLA 3MFHA 4NLCA 2G5IB 3ORYA 4CF5A 1KLNA 4MEXA 2KMDA 1N56A 3TADC 4KLUA 3M8SA 2ASDA 4QNLA 4C4RA 4B9UA 4DSLA 4JK1A 4R64A 5DBBA 4GC7A 5J2BA 1UT5A 2JGAA 4DQRA 4ED3A 3PVXA 4R65A 4F5PA 4KMOB 2ISOA 3LWMA 5D4BA 5KT5A 4I2BA 2NYVA 5HR7A 4IR1A 4NWIA 2D3DA 1T4GA 3GFKB 5DGBA 4NL9C 3GQCA 3H7IA 2FI1A 4Y2TA 3WK5A 1KN5A 3TI0A 4MFAA 1F5SA 4Y2VA 5ALVA 5KFJA 3RRHA 3OSPA 1NJZA 4M9GA 2FPKA 2YX8A 4UW9A 2K60A 2RQ5A 3AM9A 3C28A 2FLLA 1TK8A 4LVSA 4RQ6A 4QZ8A 4DSFA 3QU9A 3KBBA 1URJA 9ICBA 3N4MB 1AROP 4ECXA 2W55A 2EZYA 5ALYA 4TURA 4E0DA 3BS5A 5J8YC 3M8RA 2ZIVA 1D8YA 3TKAA 3H4DA 1N48A 2V4QA 1SKSA 2K8AA 5AIBA 5J0QA 1S0NA 3JPNA 2ZTEA 7ICJA 3H8JA 1N5XA 2GLEA 1HIWA 1ZQSA 2F44A 3KKAA 5KAFU 4P0PA 2ZUCA 5KT2A 2HW3A 5AKGA 4FZMA 3OTQA 2EANA 4UB2A 4DFKA 2PMZC 4P0QA 4YN4A 1Z19A 5L1IA 4M9LA 9ICJA 5EE1A 1SWVA 1SV0A 3ZDEA 2HHSA 4Z6DA 4J9RA 2IHMA 3UMGA 3I1YA 3UQ2A 2E1FA 2W54A 2XGQA 1BPZA 3IHQB 2WB1F 2XGPA 2BGWA 1UA1A 2A19A 4YG2A 7ICSA 4IS7A 4WJ3B 1XNSA 1NKBA 4ECQA 4BUGA 4PZNA 5HMLA 7ICFA 3ZDDA 1ZQ1C 1ZQKA 1N61A 3O0FA 1MSWD 3GIJA 1NJWA 5DG8A 1Q46A 3QUBA 4J9SA 1N63A 2ZIUA 5CP2A 1ZQAA 1Z1VA 9ICPA 4DCCA 1VLBA 2FPMA 2EQYA 3K1ZA 7ICUA 2W7PA 5J0OA 1XSNA 2YMPA 1L5UA 5JUMA 4O3SA 5J0WA 1VDVA 1IV8A 4P0PB 3MGIA 2ZG6A 4QW8A 2HHWA 4I2DA 1S77D 7ICEA 4YVZA 1XSPA 4QZCA 4EEYA 2LKYA 4F4WA 3BQ0A 2KJ9A 1HUOA 2QB0B 1L7PA 1DOQA 1ZRNA 5AKLA 3C1YA 3EPIA 1J97A 2VIXA 4O3NA 3AL0B 5C0YA 4M9HA 4DLEA 1ZQIA 2BR0A 5L9XA 2KVSA 1M6YA 3H0RB 4KLEA 1D9DA 3E0FA 4K4HA 4RQMA 3MR3A 4CDGA 4I2EA 1V85A 4F2RA 5DLGA 3ALRA 1ECWA 2HOQA 4HAIA 3C2KA 2KSOA 9ICOA 4PPXA 1O03A 3IM1A 4DO9A 3DDHA 3C5GA 8ICYA 3AMZA 3JPPA 2MA1A 1S10A 1AQ6A 1LB2B 4J9KA 5DLFA 5J2CA 4RNOA 2QB0A 2Y9UA 4I2CA 5AM4A 2I9GA 7ICOA 2BHNA 5KFOA 1NJXA 9ICNA 3QU7A 3HRDD 2UVVA 2J6SA 1LVHA 4F4ZA 1MQ3A 3NASA 4KLFA 5CHGA 2JEIA 2I6XA 2KIWA 4PL1A 7ICRA 4ED1A 4ED6A 3GV7B 5J0PA 2G07A 5HMMA 4IQVA 3IV6A 3TACB 5CEHA 2LYAA 5F3XB 1ZQOA 4DL6A 2YQEA 3JPOA 1XO0A 3E58A 3F5AA 2MRLA 3GV8B 4DF4A 3IP4B 4BGDA 4UATA 3JPQA 4C8LA 2K4IA 3NUQA 3MGHA 5E79U 5TZVA 3RB4A 2HCFA 2F2AB 4IRKA 4NL9A 1S5LU 5AM1A 3GILA 3GZFA 2NRWA 3WU2U 4DL4A 2W9AA 3I28A 3CYMA 4Q8FA 4BX9C 4ECRA 5HHIA 2O6KA 3SQIA 1FFVA 2FMSA 4LZGA 5J2HA 2BPFA 3QU2A 2IHNA 5KFCA 4RQ4A 3WKDA 3T3FA 5ALIA 3OGUA 4NLKA 1J2MA 4F71A 2BCQA 2Y9TA 1X6IA 2Y0SF 3K4GA 3PW4A 3RAXA 3RH6A 8ICRA 5KG5A 4QJFB 5CJ7A 5KFLA 7ICHA 5AI8A 3GV5B 1IXRA 5ALJA 5HR6A 2ZJ8A 1UPHA 2ZTDA 3PO4A 3FC4A 2JRZA 3SAGA 1X40A 1JROA 2H3IA 4TUQA 2P6RA 1X9SA 4BWJA 4ICAA 4ED7A 5KG4A 3PMNA 4XUSA 4FS1A 8ICSA 5IIMA 2XY7A 4C7YA 1TFRA 1X9MA 3BQ1A 1N2XA 5J29A 3OJUA 5AM3A 1HUZA 1ZQJA 3U26A 2W3SA 2RDIA 4UAWA 1PZNA 3GIMA 1QSYA 1FIQA 3WK4A 5JU5A 5J0YA 4YD1A 1NZPA 8ICJA 4YFKA 4PHAA 2C22A 1KQQA 4FO6A 1PUZA 3GDXA 1RQNA 5ALGA 5DB8A 1CUKA 8ICWA 4PHDA 1OW5A 2I5HA 4FBUA 3C2MA 4JV1A 2KZZA 4EENA 3H8MA 1RZTA 3AN1A 2E3TA 4O9MA 2VKQA 5ALQA 2KK0A 2G0AA 2DWQA 2KN7A 2MU2A 3GIKA 1T8EA 4GXJA 5G5HA 4F50A 1J2NA 5EWEA 2BKEA 4IR9A 1B43A 4X5VA 2CRXA 8ICGA 1S0VA 4RNMA 9ICAA 3V6JA 1O08A 3H0MB 5B66U 4QZHA 2JZBA 1B0XA 2BQ3A 3L4PA 3SD7A 4RQ3A 1P7DA 3RB3A 1FFUA 3HT3A 4PHPA 4DLGA 2HVHA 4GFJA 7ICNA 4UB8U 1NKEA 9ICVA 2D8CA 2AGOA 1Y88A 5EWGA 2YTUA 3PR5B 3NVYA 4BJQA 4KX3A 1SIJA 4F5OA 4DS5A 4Y2YA 1ZQVA 1Z1BA 4USAA 4MHVA 1OUQA 3OPXA 3CNHA 2K4PA 1RM6C 2FMPA 2HBKA 4DS4A 2F1HA 1L3UA 3QZ8A 1X6JA 5J0XA 2VA8A 2NO5A 4OJ6A 5ALHA 2YN4A 2KICA 4IL6U 2FLPA 3I76A 1JX4A 2BDPA 3C21A 2K8BB 1XU4A 4IQUA 5KFTA 4YQWA 2HOFA 1JUDA 2QKQA 2DUYA 2YMLA 4QZEA 4F93B 5KFPA 1XC9A 4FBTA 9ICCA 4YR0A 2DFLA 2KFNA 4K4IA 1JXLA 5IIJA 3TQ1A 2PI5A 4EBEA 1ZYQA 5AM5A 3M1YA 2FJ6A 1SWWA 4O0IA 1QQ7A 5IINA 5ALDA 1X66A 2LM1A 4AYBF 2B21A 1RYUA 1ZQNA 1L6NA 2CN1A 4MFCA 4YMOA 1ZQGA 3UXNA 2VANA 5KFKA 3PR4A 3EPGA 2F1JA 5JTIA 3AUOA 2BPCA 4Z6CA 5J0TA 3AEVA 5DB9A 4F8RA 1XWLA 4NXZA 3PMLA 4MEYA 4RPZA 5DQHA 5AM2A 1X9WA 3OSNA 1YZ6A 5KFZA 3RH4A 8ICVA 3NVZA 4C8NA 4CNQA 5EE3A 3QNMA 4KLOA 1ZETA 3KZIU 5KFVA 8ICQA 4RQ2A 1D8BA 7ICKA 4M04A 3M6ZA 2FDRA 5ALSA 2LI6A 1BPEA 4CRXA 1X9XA 5AI5A 3VCBA 4US8A 3LDAA 1CEZA 4QZAA 2R8JA 2BPGA 4ECTA 4JWNA 3RJHA 3V7JA 2MSNA 1ED1A 5ALOA 3BQ7A 1RQLA 2DL0A 8ICPA 2I1QA 1FEZA 1JN3A 2OH2A 3C2LA 4CF4A 9ICKA 3AU2A 2G5HB 3TAPA 4ECYA 4RT3A 2IBKA 3MBYA 2W9MA 2PFNA 9ICWA 1NNLA 4US9A 5KFGA 3Q8PB 3RRGA 4M9NA 3NS1A 3BQ2A 3H8WA 2N1RA 1U9LA 3SV4A 3SV3A 2ZUDA 2KV2A 1DK2A 4RQ1A 2AGQA 2HBMA 1B22A 3PZPA 1S0MA 4QWCA 2ZIVB 3SZ2A 4OJPA 5CB1A 2DGZA 3ZDAA 2V9WA 1BGXT 1ZD2P 4RQ0A 4RT2A 2UVUA 2KZMA 8ICKA 2KHVA 4YP3A 2H3VA 4RQ8A 5CR0A 1QSSA 4RUAA 5KT3A 4Y2XA 2OEHA 2CXYA 1BPBA 2WF8A 9ICUA 9ICIA 2ZTCA 4YXMA 3V6KA 5DDYA 5C5JA 2LHTA 1F0MA 4DFJA 2VJ4A 1NK9A 5AM0A 2XY6A 2W8LA 4BDPA 1C20A 1JRPA 5AKHA 3ZI4A 5L1MA 3ETLA 1DGJA 4UASA 5ALRA 8ICEA 4KLHA 8ICLA 5DQGA 1WYGA 4ECWA 4QIWF 4F92B 3Q8MA 1Q3UA 5F9NA 4QWAA 2XCPA 4DSIA 4P4OA 3RJFA 2C28A 4LZDA 3UMCA 2QARB 4DOCA 4ECVA 2GWSA 1ZJNA 3AQFA 1TV9A 3QUCA 2A1AA 3C23A 1UHUA 1T3NA 3T5LA 1DRGA 8ICXA 3C29A 3T5JA 1WG8A 2VA3A 4ZH4A 5DBAA 4FE3A 3D2QA 4EELA 1BVSA 3IDWA 4DQPA 1X42A 5KFXA 4RU9A 4RNNA 3Q8KA 3SR6A 5D46A 4YMMA 2IMWP 1NK8A 2KNJA 4C4SA 4DF8A 1PVPA 4DSKA 1NK4A 1CI4A 5F9LA 3M9NB 4UB3A 4FZLA 3Q8LA 3QE9Y 1U45A 2HOIA 2ZIWA 1V9PA 4PGXA 2GOLA 4QZIA 3BS5B 1K1SA 5HHHA 3PY8A 4P2HA 5TISU 3H0LB 5KG1A 3NVWA 4UB4A 3PX4A 2VJ5A 3UXPA 2RDJA 3QX7A 4I28A 2BDUA 2AHOB 2OHFA 3UQ0A 3ED5A 4TQSA 5KFWA 1RXWA 2D6FC 2K89A 2KSOB 4UAVA 2HMXA 2LPEA 4EX7A 4ECUA 4BXOB 4G3IA 5KFDA 3HJEA 1ZD4A 4FFDA 2NRTA 3BJYA 2P66A 2EZZA 2H3QA 3RR8A 4PJ0U 8ICNA 1COKA 2KVCA 2HBLA 3RFAA 3KFUF 1L8OA 2JEJA 2AQ4A 4DOBA 3RB0A 2LMRA 2HHVA 5DGAA 5KFNA 5IIKA 2HSZA 1NK6A 3RB6A 5AK6A 4Y2UA 2M9NA 3ONNA 1SXDA 4QWBA 4DQIA 2KEYA 2A3VA 2JH1A 2DKXA 1Q3VA 3H40A 4A8EA 4NM2A 4RQ5A 2G08A 3MR2A 1Z4NA 9ICEA 2W7OA 3T5KA 1S76D 3PW0A 5AKJA 3R9KA 3MFIA 4JV2A 4R66A 3SAHA 4O3OA 2KIVA 1NI3A 2JXJA 4Q43A 2K4EA 3N97B 5CA7A 2ODGA 1S97A 4DFDA 1PVRA 2ESEA 3RJGA 2OXOA 3EUB2 2JHDA 2B6GA 3V7LA 3KOOA 4Q44A 5BOMA 2G06A 3HX0A 3KHGA 4Y2PA 1KEJA 5ALPA 1JXEA 5ALZA 2ZIXA 2WF7A 7ICTA 3PSPA 2PFQA 2F1IA 5J2JA 1UCVA 3SYZA 3WKCA 4QZBA 4DL2A 3MDCA 1ZQXA 4Y2SA 4KLLA 2J6UA 1BPXA 2E8OA 3TAQA 4TQRA 4UAYA 4UAZA 1UA0A 1TAMA 3AU6A 3K75D 5KTQA 5IIOA 1KFDA 1LKYA 4FZNA 3F2DA 4YR3A 5KFAA 4JWMA 1KDHA 2KHQA 4J9LA 4IQTA 2HHUA 2QB1A 1IM4A 2XIDA 3N7PD 4U7CA 2HHTA 2ZJAA 4J03A 5ALMA 3PX6A 2JZBB 1KKXA 2NRVA 5KG6A 2F3NA 4MFFA 2JH7A 4J9NA 3PW7A 4R63A 3RJEA 1U47A 4KLDA 4UB5A 1QCKA 5J2AA 2KG5A 1A6SA 3OHBA 8ICFA 2YMMA 3TARA 3M7DA 3GIIA 4O5CA 3SAFA 3V72A 4M6WA 4PGYA 3F2BA 4HYKA 4O5KA 2C2DA 7ICQA 1LV5A 4EYIB 4DFMA 2MUTA 2E8NA 4RQ7A 2DF4B 4KN7A 5L1LA 5KFQA 1ZD5A 4DL5A 4NLZA 1XO1A 2WHEA 3LYSA 1TK5A 2H3ZA 3WK6A 3JPRA 2W03A 8ICBA 3PSFA 2H5XA 4G9BA 3TADA 3KHHA 3JPTA 3L5KA 3Q8RB 3C1ZA 4XA5A 5KFHA 2A1JA 1ZQMA 2YB1A 3V7KA 5J2KA 4IRDA 4ELVA 1GO3F 2G09A 4BWMA 4DQQA 2ES6A 1ZXIA 4B9MA 4GXIA 2PI4A 5ALFA 4QW9A 2WB1C 4IRCA 4Z6EA 4UB6U 5AKXA 3PSIA 1SKRA 1QQ5A 4PZOA 2R8KA 2WF6A 5ALXA 4RUCA 9ICHA 4KTQA 1BNOA 2C2RA 4M0AA 4F4KA 5AI6A 1QH9A 2HDOA 2FLNA 5DBCA 4F5QA 1DK3A 3N28A 4C7ZA 5J2DA 1ZQYA 5HP4A 4NJ8A 2WF5A 2E5SA 3G6XA 4CE6A 2W9BA 3FM9A 3HPOA 5A0LA 3SENA 1T94A 5DG9A 2YMQA 3RTVA 1MQ2A 4UARA 3UPQA 3WKBA 3NVVA 3QXGA 4B9NA 4B9TA 2BCSA 4J9OA 2XCAA 2F77X 5KFEA 2FE9A 4ED8A 1SZPA 5DQIA 4CF3A 2RP5A 5J2EA 2DPIA 1N5WA 4YD2A 3BQTA 4M2YA 3AQEA 5ALNA 4RPXA 1U49A 9ICMA 1RG6A 3M6KA 1KBUA 2P35A 3ZD8A 2DBYA 3IG5A 1MA7A 3GU3A 3V6HA 3DV9A 4I2HA 4JUZA 1ZQTA 5AI0A 1UQVA 3RAQA 4DEZA 1OXJA 1BPYA 1MN8A 3IG8A 4R8UB 2VA2A 1XSLA 8ICHA 3ETRA 4C8KA 2EAMA 4KLSA 4GXKA 1Z4OA 4RPYA 4RZRA 2HVIA 9ICLA 3ISDA 1BNPA 9ICGA 5EE0A 2JR5A 1Z00B 1ZQCA 2BCVA 1L8LA 3KHRA 1QLNA 8ICAA 1WCNA 2Z7JA 3G6YA 4QZGA 4YCXA 4F5NA 7ICPA 2XVTA 5KFBA 5J0RA 1NZBA 3NRZA 2KOBA 3THVA 4DL7A 1JIHA 4QZ9A 2E1EA 4C80A 1WWUA 1NK7A 4JB3A 4O5EA 5KFRA 4B9VA 3M9MB 4Q45A 5BOLA 2KP7A 3PSTA 2WF9A 4P4MA 1ZQPA 4R8UA 3B9JA 4PHEA 2PMZF 3F2CA 8ICTA 3QUQA 2DQNB 2PFOA 3PV8A 1A76A 1L3SA 2F8KA 3EW9A 3CW2C 3MABA 2AU0A 1ZD3A 4ECSA 2XO7A 2UVWA 1WWVA 3LVVA 2BZFA 1DXSA 2V4RA 2W3RA 4QWDA 2H3FA 1SL1A 4PH5A 3N7SC 5T14A 1SXEA 3QEBZ 3CRXA 4EZ6A 1LKYB 2FPLA 1ZQHA 4QWEA 4MF2A 4ED2A 5AKYA 2Q4TA 4KN4A 5DKWA 2NV3A 5DG7A 3PX0A 4LJXA 2KFZA 5H2FU 2B0CA 3E2EA 4DOAA 3HKZC 5AKEA 4P0QB 2BCRA 4ZOHC 4KLGA 2W9CB 3WKAA 3HP6A 1QQ6A 5AICA 3Q8SB 3RJIA 1KFSA 4QIWC 5D49A 2KJ8A 2IOHA 4QZFA 5ALUA 4FS2A 5ALEA 2EAOA 2EAPA 3NGDA 1ZQEA 5J2GA 4OD0A 4AP9A 4RQNA 4I2IA 4F3OA 2XICA 3H4BA 5AK5A 3FDSA 1IIPA 3SI8A 2UVRA 2OCEA 3SMVA 3Q8QB 4I2JA 4BXOA 8ICCA 4KMUA 9ICTA 2RRDA 3DEEA 1PK1A
chains in the Genus database with same CATH topology
2EQYA 2YQEA 4LJXA 2JRZA 2RQ5A 1RYUA 2EH9A 1KKXA 1KQQA 1IG6A 5K4LA 2JXJA 2LI6A 1KN5A 2KK0A 2OEHA 2CXYA 5CEHA 2LM1A 1C20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  2YQE A;  4LJX A;  2JRZ A;  2RQ5 A;  1RYU A;  2EH9 A;  1KKX A;  1KQQ A;  1IG6 A;  5K4L A;  2JXJ A;  2LI6 A;  1KN5 A;  2KK0 A;  2OEH A;  2CXY A;  5CEH A;  2LM1 A;  1C20 A; 
#chains in the Genus database with same CATH topology
 3MR6 A;  2Y1J A;  1PVQ A;  1K5O A;  2KD1 A;  4K4G A;  2K8C B;  3H8S A;  4OJL A;  9ICQ A;  2WTF A;  3RR7 A;  2A1J B;  7ICI A;  2AXT U;  4EBC A;  3BZC A;  5AK4 A;  2W43 A;  4M6W B;  4UQG A;  1KL9 A;  1TAU A;  2EH9 A;  4GC6 A;  5DDM A;  2DPJ A;  5AKI A;  5ALK A;  4DL3 A;  1MC8 A;  3D2N A;  4F2S A;  2R8G A;  2RLT A;  2Y0S C;  3WK7 A;  2ZIW B;  3JPS A;  2W8K A;  4F72 A;  2XI9 A;  4TUS A;  2E8P A;  2F76 X;  3D2S A;  4F5R A;  1B4F A;  4XQ8 A;  2LM4 A;  1SZH A;  4DWI A;  4F4Y A;  7ICV A;  5AK3 A;  4YXJ A;  4Y2R A;  4NY8 A;  4TUP A;  5IIL A;  5DB7 A;  1F44 A;  2ZIX B;  3QYP A;  1FO4 A;  2PFP A;  2W11 A;  2CPR A;  2PXI A;  5EE9 A;  3SEI A;  1ZQF A;  1YZ7 A;  4GLX A;  2ASJ A;  1ZJM A;  3OHA A;  4J9Q A;  1TKD A;  1Z3E B;  5L1J A;  2OM6 A;  3PNC A;  5FP0 A;  5BPC A;  5AKK A;  2W9B B;  4OJ5 A;  1QTM A;  1WUD A;  4C4T A;  1SL0 A;  1ZRM A;  5K4L A;  5KL1 B;  2HI0 A;  4KLJ A;  1YT3 A;  4J9P A;  3C5F A;  1TK0 A;  3LK9 A;  2ZJ5 A;  4NLB A;  3EZ5 A;  1NJY A;  1V38 A;  5GTI U;  4Y2J A;  1U4B A;  1NK5 A;  4OJO A;  5JRT A;  1ZQZ A;  1ZQR A;  3D6J A;  3FYH A;  3RJK A;  5AHX A;  2AH5 A;  4Z6F A;  5KFI A;  3RF9 A;  4XRH A;  1NKC A;  1A0P A;  3RBE A;  4ED0 A;  4PGQ A;  1T7P A;  1Q8K A;  4AYB C;  3KD3 A;  1D8L A;  2LBO A;  5DB6 A;  3EWA A;  5KG7 A;  3UXO A;  1EXN A;  2KE7 A;  5III A;  4B6J A;  1TAQ A;  3OJS A;  3WKE A;  2M0N A;  3RJJ A;  2YB4 A;  1JI7 A;  4U6P A;  2XY5 A;  5J2I A;  2Y1I A;  3TFS A;  3J81 j;  2EDU A;  2KKP A;  5KG0 A;  2ZXI A;  1X2I A;  1RXV A;  4I27 A;  7ICL A;  1L3V A;  2JV3 A;  4OO1 J;  5AI9 A;  1NK0 A;  5CWR A;  4JV0 A;  5KT6 A;  3QZ7 A;  2GH1 A;  5GTH U;  1SV4 A;  2KJ5 A;  4ECZ A;  2ISP A;  5KG2 A;  1TE2 A;  2AQ0 A;  3B0Y A;  2WFA A;  2Q0Z X;  4YMN A;  4CGZ A;  9ICX A;  1IG6 A;  3F5E A;  1H38 A;  2OWO A;  1L7N A;  4F91 B;  2AJQ A;  5KT7 A;  4CCH A;  4M47 A;  5KG3 A;  3QUT A;  4O3M A;  3L3F X;  3A0H U;  2HHQ A;  4KLI A;  1N62 A;  1T3Q A;  3KTQ A;  4F4X A;  2XC9 A;  4I2A A;  1L7M A;  2AGP A;  5B5E U;  3A0B U;  1RYR A;  3MR5 A;  4IQW A;  1UT8 A;  3ZDC A;  3ZDB A;  2R8I A;  3F53 A;  3ICX A;  4MF8 A;  5AI4 A;  2HHX A;  4QZD A;  1SL2 A;  2ASL A;  4O3Q A;  9ICF A;  1V97 A;  4C0Z A;  2ZIU B;  3HKZ F;  2KKV A;  2K4H A;  1PK3 A;  4EBD A;  2LYB A;  4KIT B;  3BS7 A;  3ZD9 A;  8ICO A;  3HWT A;  3FAH A;  4NLG A;  5J8Y A;  1ZQU A;  2W04 A;  4J9M A;  2PKE A;  2NO4 A;  3UMB A;  1RYS A;  8ICU A;  1KW4 A;  2LYH A;  1C7Y A;  1S9F A;  4DSJ A;  3ISC A;  3RBD A;  3T79 A;  4DSE A;  5KL8 B;  1S0O A;  1S8O A;  4UAU A;  1N60 A;  3KKA C;  2KZ3 A;  3BZK A;  4JMU A;  4M9J A;  3NTU A;  4ACO A;  3ISB A;  4KLM A;  3TFR A;  8ICZ A;  1SGG A;  4B9S A;  4EEK A;  7ICM A;  5J0S A;  3B0X A;  4NLN A;  4UBC A;  3IRU A;  1A77 A;  2MUT B;  1RPL A;  2E8M A;  1CRX A;  4KLQ A;  1JAL A;  1D9F A;  1HEK A;  1ZQB A;  1SV0 C;  2OYY A;  4UBB A;  2NRZ A;  2JMG A;  3IN5 A;  3EYZ A;  2W9C A;  5KFY A;  1L3T A;  3S6J A;  5AIA A;  3HIL A;  2BQU A;  4O3R A;  3WK8 A;  2C2E A;  5EWF A;  5G5G A;  4UB1 A;  2QLT A;  4ELU A;  2KTQ A;  2DKZ A;  2EZX A;  2ALZ A;  3UM9 A;  5HNK A;  5J0U A;  2RHF A;  2MAX A;  3WK9 A;  3MGV A;  4DFP A;  1XS9 D;  4P4P A;  1KSP A;  1K1Q A;  5KAI U;  1NOM A;  1VJ5 A;  5J2F A;  4C8O A;  1ZQD A;  3RH5 A;  4GIB A;  2P6U A;  2ZUB A;  1KFT A;  3PW2 A;  4I29 A;  9ICR A;  2JEG A;  1SKW A;  2L5Y A;  2ZXH A;  3LVW A;  4EYH B;  2WAQ C;  2BCU A;  3QEA Z;  3CP8 A;  1ZQL A;  1BPD A;  3BDP A;  9ICS A;  1COO A;  3T5H A;  2GO7 A;  1TVA A;  1ZQW A;  2BQR A;  4KLT A;  1WCL A;  1JMS A;  5KT4 A;  2FMQ A;  1PK1 B;  3VC8 A;  5KFU A;  2IA6 A;  7ICG A;  4Y2Q A;  4NM1 A;  4Q8E A;  2WAQ F;  4PL2 A;  4B9L A;  3QU4 A;  3TAN A;  3MC1 A;  2YY6 A;  5EOZ A;  3N7R C;  3KZX A;  1SB3 C;  5CRX A;  1DGS A;  4EX6 A;  1L7O A;  1KTQ A;  5ALW A;  5KFS A;  3HW8 A;  4IC9 A;  1ZQQ A;  2JEF A;  4I2G A;  3PW5 A;  4KX5 A;  3LWL A;  8ICI A;  4EZ9 A;  5AKZ A;  2HBJ A;  3QU5 A;  1KRP A;  3M9O B;  5ALL A;  4YR2 A;  4I2F A;  5KNI A;  1RDF A;  3MDA A;  4O3P A;  2R8H A;  5KFM A;  1U48 A;  1QSL A;  2QAR A;  8ICM A;  4ELT A;  2IOF K;  2NRX A;  5KFF A;  4DQS A;  2R18 A;  5L1K A;  3K1R B;  4C8M A;  2F8L A;  1HJP A;  3NRW A;  3PO5 A;  4NV0 A;  2J6T A;  1ZOL A;  2IOF A;  4OCZ A;  3KHL A;  1Z00 A;  5ALT A;  3G6V A;  2ATL A;  3MFH A;  4NLC A;  2G5I B;  3ORY A;  4CF5 A;  1KLN A;  4MEX A;  2KMD A;  1N56 A;  3TAD C;  4KLU A;  3M8S A;  2ASD A;  4QNL A;  4C4R A;  4B9U A;  4DSL A;  4JK1 A;  4R64 A;  5DBB A;  4GC7 A;  5J2B A;  1UT5 A;  2JGA A;  4DQR A;  4ED3 A;  3PVX A;  4R65 A;  4F5P A;  4KMO B;  2ISO A;  3LWM A;  5D4B A;  5KT5 A;  4I2B A;  2NYV A;  5HR7 A;  4IR1 A;  4NWI A;  2D3D A;  1T4G A;  3GFK B;  5DGB A;  4NL9 C;  3GQC A;  3H7I A;  2FI1 A;  4Y2T A;  3WK5 A;  1KN5 A;  3TI0 A;  4MFA A;  1F5S A;  4Y2V A;  5ALV A;  5KFJ A;  3RRH A;  3OSP A;  1NJZ A;  4M9G A;  2FPK A;  2YX8 A;  4UW9 A;  2K60 A;  2RQ5 A;  3AM9 A;  3C28 A;  2FLL A;  1TK8 A;  4LVS A;  4RQ6 A;  4QZ8 A;  4DSF A;  3QU9 A;  3KBB A;  1URJ A;  9ICB A;  3N4M B;  1ARO P;  4ECX A;  2W55 A;  2EZY A;  5ALY A;  4TUR A;  4E0D A;  3BS5 A;  5J8Y C;  3M8R A;  2ZIV A;  1D8Y A;  3TKA A;  3H4D A;  1N48 A;  2V4Q A;  1SKS A;  2K8A A;  5AIB A;  5J0Q A;  1S0N A;  3JPN A;  2ZTE A;  7ICJ A;  3H8J A;  1N5X A;  2GLE A;  1HIW A;  1ZQS A;  2F44 A;  3KKA A;  5KAF U;  4P0P A;  2ZUC A;  5KT2 A;  2HW3 A;  5AKG A;  4FZM A;  3OTQ A;  2EAN A;  4UB2 A;  4DFK A;  2PMZ C;  4P0Q A;  4YN4 A;  1Z19 A;  5L1I A;  4M9L A;  9ICJ A;  5EE1 A;  1SWV A;  1SV0 A;  3ZDE A;  2HHS A;  4Z6D A;  4J9R A;  2IHM A;  3UMG A;  3I1Y A;  3UQ2 A;  2E1F A;  2W54 A;  2XGQ A;  1BPZ A;  3IHQ B;  2WB1 F;  2XGP A;  2BGW A;  1UA1 A;  2A19 A;  4YG2 A;  7ICS A;  4IS7 A;  4WJ3 B;  1XNS A;  1NKB A;  4ECQ A;  4BUG A;  4PZN A;  5HML A;  7ICF A;  3ZDD A;  1ZQ1 C;  1ZQK A;  1N61 A;  3O0F A;  1MSW D;  3GIJ A;  1NJW A;  5DG8 A;  1Q46 A;  3QUB A;  4J9S A;  1N63 A;  2ZIU A;  5CP2 A;  1ZQA A;  1Z1V A;  9ICP A;  4DCC A;  1VLB A;  2FPM A;  2EQY A;  3K1Z A;  7ICU A;  2W7P A;  5J0O A;  1XSN A;  2YMP A;  1L5U A;  5JUM A;  4O3S A;  5J0W A;  1VDV A;  1IV8 A;  4P0P B;  3MGI A;  2ZG6 A;  4QW8 A;  2HHW A;  4I2D A;  1S77 D;  7ICE A;  4YVZ A;  1XSP A;  4QZC A;  4EEY A;  2LKY A;  4F4W A;  3BQ0 A;  2KJ9 A;  1HUO A;  2QB0 B;  1L7P A;  1DOQ A;  1ZRN A;  5AKL A;  3C1Y A;  3EPI A;  1J97 A;  2VIX A;  4O3N A;  3AL0 B;  5C0Y A;  4M9H A;  4DLE A;  1ZQI A;  2BR0 A;  5L9X A;  2KVS A;  1M6Y A;  3H0R B;  4KLE A;  1D9D A;  3E0F A;  4K4H A;  4RQM A;  3MR3 A;  4CDG A;  4I2E A;  1V85 A;  4F2R A;  5DLG A;  3ALR A;  1ECW A;  2HOQ A;  4HAI A;  3C2K A;  2KSO A;  9ICO A;  4PPX A;  1O03 A;  3IM1 A;  4DO9 A;  3DDH A;  3C5G A;  8ICY A;  3AMZ A;  3JPP A;  2MA1 A;  1S10 A;  1AQ6 A;  1LB2 B;  4J9K A;  5DLF A;  5J2C A;  4RNO A;  2QB0 A;  2Y9U A;  4I2C A;  5AM4 A;  2I9G A;  7ICO A;  2BHN A;  5KFO A;  1NJX A;  9ICN A;  3QU7 A;  3HRD D;  2UVV A;  2J6S A;  1LVH A;  4F4Z A;  1MQ3 A;  3NAS A;  4KLF A;  5CHG A;  2JEI A;  2I6X A;  2KIW A;  4PL1 A;  7ICR A;  4ED1 A;  4ED6 A;  3GV7 B;  5J0P A;  2G07 A;  5HMM A;  4IQV A;  3IV6 A;  3TAC B;  5CEH A;  2LYA A;  5F3X B;  1ZQO A;  4DL6 A;  2YQE A;  3JPO A;  1XO0 A;  3E58 A;  3F5A A;  2MRL A;  3GV8 B;  4DF4 A;  3IP4 B;  4BGD A;  4UAT A;  3JPQ A;  4C8L A;  2K4I A;  3NUQ A;  3MGH A;  5E79 U;  5TZV A;  3RB4 A;  2HCF A;  2F2A B;  4IRK A;  4NL9 A;  1S5L U;  5AM1 A;  3GIL A;  3GZF A;  2NRW A;  3WU2 U;  4DL4 A;  2W9A A;  3I28 A;  3CYM A;  4Q8F A;  4BX9 C;  4ECR A;  5HHI A;  2O6K A;  3SQI A;  1FFV A;  2FMS A;  4LZG A;  5J2H A;  2BPF A;  3QU2 A;  2IHN A;  5KFC A;  4RQ4 A;  3WKD A;  3T3F A;  5ALI A;  3OGU A;  4NLK A;  1J2M A;  4F71 A;  2BCQ A;  2Y9T A;  1X6I A;  2Y0S F;  3K4G A;  3PW4 A;  3RAX A;  3RH6 A;  8ICR A;  5KG5 A;  4QJF B;  5CJ7 A;  5KFL A;  7ICH A;  5AI8 A;  3GV5 B;  1IXR A;  5ALJ A;  5HR6 A;  2ZJ8 A;  1UPH A;  2ZTD A;  3PO4 A;  3FC4 A;  2JRZ A;  3SAG A;  1X40 A;  1JRO A;  2H3I A;  4TUQ A;  2P6R A;  1X9S A;  4BWJ A;  4ICA A;  4ED7 A;  5KG4 A;  3PMN A;  4XUS A;  4FS1 A;  8ICS A;  5IIM A;  2XY7 A;  4C7Y A;  1TFR A;  1X9M A;  3BQ1 A;  1N2X A;  5J29 A;  3OJU A;  5AM3 A;  1HUZ A;  1ZQJ A;  3U26 A;  2W3S A;  2RDI A;  4UAW A;  1PZN A;  3GIM A;  1QSY A;  1FIQ A;  3WK4 A;  5JU5 A;  5J0Y A;  4YD1 A;  1NZP A;  8ICJ A;  4YFK A;  4PHA A;  2C22 A;  1KQQ A;  4FO6 A;  1PUZ A;  3GDX A;  1RQN A;  5ALG A;  5DB8 A;  1CUK A;  8ICW A;  4PHD A;  1OW5 A;  2I5H A;  4FBU A;  3C2M A;  4JV1 A;  2KZZ A;  4EEN A;  3H8M A;  1RZT A;  3AN1 A;  2E3T A;  4O9M A;  2VKQ A;  5ALQ A;  2KK0 A;  2G0A A;  2DWQ A;  2KN7 A;  2MU2 A;  3GIK A;  1T8E A;  4GXJ A;  5G5H A;  4F50 A;  1J2N A;  5EWE A;  2BKE A;  4IR9 A;  1B43 A;  4X5V A;  2CRX A;  8ICG A;  1S0V A;  4RNM A;  9ICA A;  3V6J A;  1O08 A;  3H0M B;  5B66 U;  4QZH A;  2JZB A;  1B0X A;  2BQ3 A;  3L4P A;  3SD7 A;  4RQ3 A;  1P7D A;  3RB3 A;  1FFU A;  3HT3 A;  4PHP A;  4DLG A;  2HVH A;  4GFJ A;  7ICN A;  4UB8 U;  1NKE A;  9ICV A;  2D8C A;  2AGO A;  1Y88 A;  5EWG A;  2YTU A;  3PR5 B;  3NVY A;  4BJQ A;  4KX3 A;  1SIJ A;  4F5O A;  4DS5 A;  4Y2Y A;  1ZQV A;  1Z1B A;  4USA A;  4MHV A;  1OUQ A;  3OPX A;  3CNH A;  2K4P A;  1RM6 C;  2FMP A;  2HBK A;  4DS4 A;  2F1H A;  1L3U A;  3QZ8 A;  1X6J A;  5J0X A;  2VA8 A;  2NO5 A;  4OJ6 A;  5ALH A;  2YN4 A;  2KIC A;  4IL6 U;  2FLP A;  3I76 A;  1JX4 A;  2BDP A;  3C21 A;  2K8B B;  1XU4 A;  4IQU A;  5KFT A;  4YQW A;  2HOF A;  1JUD A;  2QKQ A;  2DUY A;  2YML A;  4QZE A;  4F93 B;  5KFP A;  1XC9 A;  4FBT A;  9ICC A;  4YR0 A;  2DFL A;  2KFN A;  4K4I A;  1JXL A;  5IIJ A;  3TQ1 A;  2PI5 A;  4EBE A;  1ZYQ A;  5AM5 A;  3M1Y A;  2FJ6 A;  1SWW A;  4O0I A;  1QQ7 A;  5IIN A;  5ALD A;  1X66 A;  2LM1 A;  4AYB F;  2B21 A;  1RYU A;  1ZQN A;  1L6N A;  2CN1 A;  4MFC A;  4YMO A;  1ZQG A;  3UXN A;  2VAN A;  5KFK A;  3PR4 A;  3EPG A;  2F1J A;  5JTI A;  3AUO A;  2BPC A;  4Z6C A;  5J0T A;  3AEV A;  5DB9 A;  4F8R A;  1XWL A;  4NXZ A;  3PML A;  4MEY A;  4RPZ A;  5DQH A;  5AM2 A;  1X9W A;  3OSN A;  1YZ6 A;  5KFZ A;  3RH4 A;  8ICV A;  3NVZ A;  4C8N A;  4CNQ A;  5EE3 A;  3QNM A;  4KLO A;  1ZET A;  3KZI U;  5KFV A;  8ICQ A;  4RQ2 A;  1D8B A;  7ICK A;  4M04 A;  3M6Z A;  2FDR A;  5ALS A;  2LI6 A;  1BPE A;  4CRX A;  1X9X A;  5AI5 A;  3VCB A;  4US8 A;  3LDA A;  1CEZ A;  4QZA A;  2R8J A;  2BPG A;  4ECT A;  4JWN A;  3RJH A;  3V7J A;  2MSN A;  1ED1 A;  5ALO A;  3BQ7 A;  1RQL A;  2DL0 A;  8ICP A;  2I1Q A;  1FEZ A;  1JN3 A;  2OH2 A;  3C2L A;  4CF4 A;  9ICK A;  3AU2 A;  2G5H B;  3TAP A;  4ECY A;  4RT3 A;  2IBK A;  3MBY A;  2W9M A;  2PFN A;  9ICW A;  1NNL A;  4US9 A;  5KFG A;  3Q8P B;  3RRG A;  4M9N A;  3NS1 A;  3BQ2 A;  3H8W A;  2N1R A;  1U9L A;  3SV4 A;  3SV3 A;  2ZUD A;  2KV2 A;  1DK2 A;  4RQ1 A;  2AGQ A;  2HBM A;  1B22 A;  3PZP A;  1S0M A;  4QWC A;  2ZIV B;  3SZ2 A;  4OJP A;  5CB1 A;  2DGZ A;  3ZDA A;  2V9W A;  1BGX T;  1ZD2 P;  4RQ0 A;  4RT2 A;  2UVU A;  2KZM A;  8ICK A;  2KHV A;  4YP3 A;  2H3V A;  4RQ8 A;  5CR0 A;  1QSS A;  4RUA A;  5KT3 A;  4Y2X A;  2OEH A;  2CXY A;  1BPB A;  2WF8 A;  9ICU A;  9ICI A;  2ZTC A;  4YXM A;  3V6K A;  5DDY A;  5C5J A;  2LHT A;  1F0M A;  4DFJ A;  2VJ4 A;  1NK9 A;  5AM0 A;  2XY6 A;  2W8L A;  4BDP A;  1C20 A;  1JRP A;  5AKH A;  3ZI4 A;  5L1M A;  3ETL A;  1DGJ A;  4UAS A;  5ALR A;  8ICE A;  4KLH A;  8ICL A;  5DQG A;  1WYG A;  4ECW A;  4QIW F;  4F92 B;  3Q8M A;  1Q3U A;  5F9N A;  4QWA A;  2XCP A;  4DSI A;  4P4O A;  3RJF A;  2C28 A;  4LZD A;  3UMC A;  2QAR B;  4DOC A;  4ECV A;  2GWS A;  1ZJN A;  3AQF A;  1TV9 A;  3QUC A;  2A1A A;  3C23 A;  1UHU A;  1T3N A;  3T5L A;  1DRG A;  8ICX A;  3C29 A;  3T5J A;  1WG8 A;  2VA3 A;  4ZH4 A;  5DBA A;  4FE3 A;  3D2Q A;  4EEL A;  1BVS A;  3IDW A;  4DQP A;  1X42 A;  5KFX A;  4RU9 A;  4RNN A;  3Q8K A;  3SR6 A;  5D46 A;  4YMM A;  2IMW P;  1NK8 A;  2KNJ A;  4C4S A;  4DF8 A;  1PVP A;  4DSK A;  1NK4 A;  1CI4 A;  5F9L A;  3M9N B;  4UB3 A;  4FZL A;  3Q8L A;  3QE9 Y;  1U45 A;  2HOI A;  2ZIW A;  1V9P A;  4PGX A;  2GOL A;  4QZI A;  3BS5 B;  1K1S A;  5HHH A;  3PY8 A;  4P2H A;  5TIS U;  3H0L B;  5KG1 A;  3NVW A;  4UB4 A;  3PX4 A;  2VJ5 A;  3UXP A;  2RDJ A;  3QX7 A;  4I28 A;  2BDU A;  2AHO B;  2OHF A;  3UQ0 A;  3ED5 A;  4TQS A;  5KFW A;  1RXW A;  2D6F C;  2K89 A;  2KSO B;  4UAV A;  2HMX A;  2LPE A;  4EX7 A;  4ECU A;  4BXO B;  4G3I A;  5KFD A;  3HJE A;  1ZD4 A;  4FFD A;  2NRT A;  3BJY A;  2P66 A;  2EZZ A;  2H3Q A;  3RR8 A;  4PJ0 U;  8ICN A;  1COK A;  2KVC A;  2HBL A;  3RFA A;  3KFU F;  1L8O A;  2JEJ A;  2AQ4 A;  4DOB A;  3RB0 A;  2LMR A;  2HHV A;  5DGA A;  5KFN A;  5IIK A;  2HSZ A;  1NK6 A;  3RB6 A;  5AK6 A;  4Y2U A;  2M9N A;  3ONN A;  1SXD A;  4QWB A;  4DQI A;  2KEY A;  2A3V A;  2JH1 A;  2DKX A;  1Q3V A;  3H40 A;  4A8E A;  4NM2 A;  4RQ5 A;  2G08 A;  3MR2 A;  1Z4N A;  9ICE A;  2W7O A;  3T5K A;  1S76 D;  3PW0 A;  5AKJ A;  3R9K A;  3MFI A;  4JV2 A;  4R66 A;  3SAH A;  4O3O A;  2KIV A;  1NI3 A;  2JXJ A;  4Q43 A;  2K4E A;  3N97 B;  5CA7 A;  2ODG A;  1S97 A;  4DFD A;  1PVR A;  2ESE A;  3RJG A;  2OXO A;  3EUB 2;  2JHD A;  2B6G A;  3V7L A;  3KOO A;  4Q44 A;  5BOM A;  2G06 A;  3HX0 A;  3KHG A;  4Y2P A;  1KEJ A;  5ALP A;  1JXE A;  5ALZ A;  2ZIX A;  2WF7 A;  7ICT A;  3PSP A;  2PFQ A;  2F1I A;  5J2J A;  1UCV A;  3SYZ A;  3WKC A;  4QZB A;  4DL2 A;  3MDC A;  1ZQX A;  4Y2S A;  4KLL A;  2J6U A;  1BPX A;  2E8O A;  3TAQ A;  4TQR A;  4UAY A;  4UAZ A;  1UA0 A;  1TAM A;  3AU6 A;  3K75 D;  5KTQ A;  5IIO A;  1KFD A;  1LKY A;  4FZN A;  3F2D A;  4YR3 A;  5KFA A;  4JWM A;  1KDH A;  2KHQ A;  4J9L A;  4IQT A;  2HHU A;  2QB1 A;  1IM4 A;  2XID A;  3N7P D;  4U7C A;  2HHT A;  2ZJA A;  4J03 A;  5ALM A;  3PX6 A;  2JZB B;  1KKX A;  2NRV A;  5KG6 A;  2F3N A;  4MFF A;  2JH7 A;  4J9N A;  3PW7 A;  4R63 A;  3RJE A;  1U47 A;  4KLD A;  4UB5 A;  1QCK A;  5J2A A;  2KG5 A;  1A6S A;  3OHB A;  8ICF A;  2YMM A;  3TAR A;  3M7D A;  3GII A;  4O5C A;  3SAF A;  3V72 A;  4M6W A;  4PGY A;  3F2B A;  4HYK A;  4O5K A;  2C2D A;  7ICQ A;  1LV5 A;  4EYI B;  4DFM A;  2MUT A;  2E8N A;  4RQ7 A;  2DF4 B;  4KN7 A;  5L1L A;  5KFQ A;  1ZD5 A;  4DL5 A;  4NLZ A;  1XO1 A;  2WHE A;  3LYS A;  1TK5 A;  2H3Z A;  3WK6 A;  3JPR A;  2W03 A;  8ICB A;  3PSF A;  2H5X A;  4G9B A;  3TAD A;  3KHH A;  3JPT A;  3L5K A;  3Q8R B;  3C1Z A;  4XA5 A;  5KFH A;  2A1J A;  1ZQM A;  2YB1 A;  3V7K A;  5J2K A;  4IRD A;  4ELV A;  1GO3 F;  2G09 A;  4BWM A;  4DQQ A;  2ES6 A;  1ZXI A;  4B9M A;  4GXI A;  2PI4 A;  5ALF A;  4QW9 A;  2WB1 C;  4IRC A;  4Z6E A;  4UB6 U;  5AKX A;  3PSI A;  1SKR A;  1QQ5 A;  4PZO A;  2R8K A;  2WF6 A;  5ALX A;  4RUC A;  9ICH A;  4KTQ A;  1BNO A;  2C2R A;  4M0A A;  4F4K A;  5AI6 A;  1QH9 A;  2HDO A;  2FLN A;  5DBC A;  4F5Q A;  1DK3 A;  3N28 A;  4C7Z A;  5J2D A;  1ZQY A;  5HP4 A;  4NJ8 A;  2WF5 A;  2E5S A;  3G6X A;  4CE6 A;  2W9B A;  3FM9 A;  3HPO A;  5A0L A;  3SEN A;  1T94 A;  5DG9 A;  2YMQ A;  3RTV A;  1MQ2 A;  4UAR A;  3UPQ A;  3WKB A;  3NVV A;  3QXG A;  4B9N A;  4B9T A;  2BCS A;  4J9O A;  2XCA A;  2F77 X;  5KFE A;  2FE9 A;  4ED8 A;  1SZP A;  5DQI A;  4CF3 A;  2RP5 A;  5J2E A;  2DPI A;  1N5W A;  4YD2 A;  3BQT A;  4M2Y A;  3AQE A;  5ALN A;  4RPX A;  1U49 A;  9ICM A;  1RG6 A;  3M6K A;  1KBU A;  2P35 A;  3ZD8 A;  2DBY A;  3IG5 A;  1MA7 A;  3GU3 A;  3V6H A;  3DV9 A;  4I2H A;  4JUZ A;  1ZQT A;  5AI0 A;  1UQV A;  3RAQ A;  4DEZ A;  1OXJ A;  1BPY A;  1MN8 A;  3IG8 A;  4R8U B;  2VA2 A;  1XSL A;  8ICH A;  3ETR A;  4C8K A;  2EAM A;  4KLS A;  4GXK A;  1Z4O A;  4RPY A;  4RZR A;  2HVI A;  9ICL A;  3ISD A;  1BNP A;  9ICG A;  5EE0 A;  2JR5 A;  1Z00 B;  1ZQC A;  2BCV A;  1L8L A;  3KHR A;  1QLN A;  8ICA A;  1WCN A;  2Z7J A;  3G6Y A;  4QZG A;  4YCX A;  4F5N A;  7ICP A;  2XVT A;  5KFB A;  5J0R A;  1NZB A;  3NRZ A;  2KOB A;  3THV A;  4DL7 A;  1JIH A;  4QZ9 A;  2E1E A;  4C80 A;  1WWU A;  1NK7 A;  4JB3 A;  4O5E A;  5KFR A;  4B9V A;  3M9M B;  4Q45 A;  5BOL A;  2KP7 A;  3PST A;  2WF9 A;  4P4M A;  1ZQP A;  4R8U A;  3B9J A;  4PHE A;  2PMZ F;  3F2C A;  8ICT A;  3QUQ A;  2DQN B;  2PFO A;  3PV8 A;  1A76 A;  1L3S A;  2F8K A;  3EW9 A;  3CW2 C;  3MAB A;  2AU0 A;  1ZD3 A;  4ECS A;  2XO7 A;  2UVW A;  1WWV A;  3LVV A;  2BZF A;  1DXS A;  2V4R A;  2W3R A;  4QWD A;  2H3F A;  1SL1 A;  4PH5 A;  3N7S C;  5T14 A;  1SXE A;  3QEB Z;  3CRX A;  4EZ6 A;  1LKY B;  2FPL A;  1ZQH A;  4QWE A;  4MF2 A;  4ED2 A;  5AKY A;  2Q4T A;  4KN4 A;  5DKW A;  2NV3 A;  5DG7 A;  3PX0 A;  4LJX A;  2KFZ A;  5H2F U;  2B0C A;  3E2E A;  4DOA A;  3HKZ C;  5AKE A;  4P0Q B;  2BCR A;  4ZOH C;  4KLG A;  2W9C B;  3WKA A;  3HP6 A;  1QQ6 A;  5AIC A;  3Q8S B;  3RJI A;  1KFS A;  4QIW C;  5D49 A;  2KJ8 A;  2IOH A;  4QZF A;  5ALU A;  4FS2 A;  5ALE A;  2EAO A;  2EAP A;  3NGD A;  1ZQE A;  5J2G A;  4OD0 A;  4AP9 A;  4RQN A;  4I2I A;  4F3O A;  2XIC A;  3H4B A;  5AK5 A;  3FDS A;  1IIP A;  3SI8 A;  2UVR A;  2OCE A;  3SMV A;  3Q8Q B;  4I2J A;  4BXO A;  8ICC A;  4KMU A;  9ICT A;  2RRD A;  3DEE A;  1PK1 A; 
#chains in the Genus database with same CATH homology
 2EQY A;  2YQE A;  4LJX A;  2JRZ A;  2RQ5 A;  1RYU A;  2EH9 A;  1KKX A;  1KQQ A;  1IG6 A;  5K4L A;  2JXJ A;  2LI6 A;  1KN5 A;  2KK0 A;  2OEH A;  2CXY A;  5CEH A;  2LM1 A;  1C20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...