2YRAA

Solution structure of the zinc finger domains (1-87) from human f-box only protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
GSSGSSGCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKTEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Seizure 6-like protein isoform 3
publication title Solution structure of the zinc finger domains (1-87) from human F-box only protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2yraA00
2RLPA 1TPNA 1MD7A 2BZMA 3MQLA 2MCYA 2KMSA 2V8EA 1OJWA 3ZD2A 2WIIC 1GHQB 2XWBF 2QY0A 2YRAA 5HYTB 1H2PP 2JRAA 4B2SA 2RKYA 1H2QP 3EJHA 4K12A 1ZJKA 2CG6A 3GOVA 2XRDA 4J38B 4ZH1D 5JPMG 2CKUA 4C16A 4YNXA 2YBYA 3OEDC 4A5WB 4WJG2 4B2RA 1GKGA 1VVCA 2IZ3A 4LOTA 1TPMA 5HYPA 1LY2A 2RLQA 1OK2A 4AYMA 1OK1A 4PZ5A 2IZ4A 3IX0A 4MUCA 1HFIA 5HYUB 3INBC 3KZJA 2LOJA 2JGWA 5I0QB 1E5GA 3RJ3D 4CSYA 1GPZA 3TVJA 1PPQA 2XQWC 2KRIA 4AYEA 3ZRZA 1G4GA 2B5ID 3SW0X 3R62A 3NFPI 1HFHA 1CKLA 1MD8A 1HCCA 1VVDA 1OK9A 3CALA 2EC3A 2ERJA 2G7IA 4IGDA 4AYIA 3L89M 3ZD1A 1QGBA 1E88A 4ONTD 1FBRA 1OJYA 1TPGA 4KKDA 2UWNA 1NWVA 1H03P 2JGXA 3ERBA 1E8BA 4LOSA 3IU3I 1Z92B 2RKZA 3O8EB 2O39C 4AYDA 1Q3XA 3GXEA 1G4FA 2W81A 3KXVA 1C1ZA 4F4OC 2A55A 2XWJI 4DJZA 1ELVA 4JHSA 1H04P 2EHFA 1UOTP 2XRBA 4FXGG 1GKNA 2W80A 1OK3A 3OP8A 1QO6A 1SRZA 1SS2A 5HZPB 2RL0A 2CG7A 1O9AA 3M7PA 3OXUD 1U5MA 3T5OA 2MCZA 5FO8C 1OJVA 1QUBA
chains in the Genus database with same CATH superfamily
2RLPA 1TPNA 1MD7A 2BZMA 3MQLA 5DN4A 2MCYA 2KMSA 2V8EA 1OJWA 3K3TA 4MSLA 3ZD2A 2WIIC 1GHQB 2I2LA 2XWBF 2QY0A 2YRAA 5HYTB 1H2PP 2JRAA 4B2SA 2RKYA 2Y8SA 1H2QP 3EJHA 4K12A 1ZJKA 2CG6A 3FGRA 3GOVA 2XRDA 4J38B 4ZH1D 5JPMG 2CKUA 3WSYA 4C16A 4YNXA 2YBYA 2Y8TA 3OEDC 4A5WB 4WJG2 2X2ZA 3FGTA 4APLA 4B2RA 1GKGA 1VVCA 2IZ3A 4LOTA 1TPMA 5HYPA 1LY2A 2RLQA 1OK2A 4AYMA 1OK1A 4N7EA 4PZ5A 2IZ4A 3IX0A 4MUCA 3VWOA 1HFIA 3ZLDA 5HYUB 3INBC 3KZJA 2LOJA 2JGWA 5I0QB 1E5GA 3RJ3D 5DN5A 1GPZA 3TVJA 4BWCA 4CSYA 1PPQA 2XQWC 1RLHA 2KRIA 4AYEA 3ZRZA 1G4GA 2B5ID 3SW0X 3R62A 3NFPI 3CI0J 2Y8RA 1HFHA 1CKLA 1MD8A 1HCCA 1VVDA 1OK9A 3CALA 2EC3A 2ERJA 2G7IA 4IGDA 4AYIA 3L89M 3F6KA 3ZD1A 3NJAA 1QGBA 1E88A 4ONTD 1FBRA 1OJYA 1TPGA 4KKDA 2UWNA 1NWVA 1H03P 2JGXA 3ERBA 1E8BA 4LOSA 3IU3I 1Z92B 2RKZA 3O8EB 2O39C 4AYDA 1Q3XA 3GXEA 1G4FA 2W81A 3KXVA 1C1ZA 4PO7A 2A55A 4F4OC 3WSXA 2XWJI 4DJZA 1ELVA 4JHSA 1H04P 2EHFA 1UOTP 2XRBA 4FXGG 1GKNA 2W80A 4YIZA 1OK3A 3OP8A 1QO6A 1SRZA 1SS2A 5HZPB 2RL0A 2CG7A 3ZLEA 1O9AA 3M7PA 3OXUD 1U5MA 3T5OA 2MCZA 5FO8C 1OJVA 1QUBA 2ZYCA
chains in the Genus database with same CATH topology
2RLPA 1TPNA 1MD7A 2BZMA 3MQLA 2MCYA 2KMSA 2V8EA 1OJWA 3ZD2A 2WIIC 1GHQB 2XWBF 2QY0A 2YRAA 5HYTB 1H2PP 2JRAA 4B2SA 2RKYA 1H2QP 3EJHA 4K12A 1ZJKA 2CG6A 3GOVA 2XRDA 4J38B 4ZH1D 5JPMG 2CKUA 4C16A 4YNXA 2YBYA 3OEDC 4A5WB 4WJG2 4B2RA 1GKGA 1VVCA 2IZ3A 4LOTA 1TPMA 5HYPA 1LY2A 2RLQA 1OK2A 4AYMA 1OK1A 4PZ5A 2IZ4A 3IX0A 4MUCA 1HFIA 5HYUB 3INBC 3KZJA 2LOJA 2JGWA 5I0QB 1E5GA 3RJ3D 4CSYA 1GPZA 3TVJA 1PPQA 2XQWC 2KRIA 4AYEA 3ZRZA 1G4GA 2B5ID 3SW0X 3R62A 3NFPI 1HFHA 1CKLA 1MD8A 1HCCA 1VVDA 1OK9A 3CALA 2EC3A 2ERJA 2G7IA 4IGDA 4AYIA 3L89M 3ZD1A 1QGBA 1E88A 4ONTD 1FBRA 1OJYA 1TPGA 4KKDA 2UWNA 1NWVA 1H03P 2JGXA 3ERBA 1E8BA 4LOSA 3IU3I 1Z92B 2RKZA 3O8EB 2O39C 4AYDA 1Q3XA 3GXEA 1G4FA 2W81A 3KXVA 1C1ZA 4F4OC 2A55A 2XWJI 4DJZA 1ELVA 4JHSA 1H04P 2EHFA 1UOTP 2XRBA 4FXGG 1GKNA 2W80A 1OK3A 3OP8A 1QO6A 1SRZA 1SS2A 5HZPB 2RL0A 2CG7A 1O9AA 3M7PA 3OXUD 1U5MA 3T5OA 2MCZA 5FO8C 1OJVA 1QUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RLP A;  1TPN A;  1MD7 A;  2BZM A;  3MQL A;  2MCY A;  2KMS A;  2V8E A;  1OJW A;  3ZD2 A;  2WII C;  1GHQ B;  2XWB F;  2QY0 A;  2YRA A;  5HYT B;  1H2P P;  2JRA A;  4B2S A;  2RKY A;  1H2Q P;  3EJH A;  4K12 A;  1ZJK A;  2CG6 A;  3GOV A;  2XRD A;  4J38 B;  4ZH1 D;  5JPM G;  2CKU A;  4C16 A;  4YNX A;  2YBY A;  3OED C;  4A5W B;  4WJG 2;  4B2R A;  1GKG A;  1VVC A;  2IZ3 A;  4LOT A;  1TPM A;  5HYP A;  1LY2 A;  2RLQ A;  1OK2 A;  4AYM A;  1OK1 A;  4PZ5 A;  2IZ4 A;  3IX0 A;  4MUC A;  1HFI A;  5HYU B;  3INB C;  3KZJ A;  2LOJ A;  2JGW A;  5I0Q B;  1E5G A;  3RJ3 D;  4CSY A;  1GPZ A;  3TVJ A;  1PPQ A;  2XQW C;  2KRI A;  4AYE A;  3ZRZ A;  1G4G A;  2B5I D;  3SW0 X;  3R62 A;  3NFP I;  1HFH A;  1CKL A;  1MD8 A;  1HCC A;  1VVD A;  1OK9 A;  3CAL A;  2EC3 A;  2ERJ A;  2G7I A;  4IGD A;  4AYI A;  3L89 M;  3ZD1 A;  1QGB A;  1E88 A;  4ONT D;  1FBR A;  1OJY A;  1TPG A;  4KKD A;  2UWN A;  1NWV A;  1H03 P;  2JGX A;  3ERB A;  1E8B A;  4LOS A;  3IU3 I;  1Z92 B;  2RKZ A;  3O8E B;  2O39 C;  4AYD A;  1Q3X A;  3GXE A;  1G4F A;  2W81 A;  3KXV A;  1C1Z A;  4F4O C;  2A55 A;  2XWJ I;  4DJZ A;  1ELV A;  4JHS A;  1H04 P;  2EHF A;  1UOT P;  2XRB A;  4FXG G;  1GKN A;  2W80 A;  1OK3 A;  3OP8 A;  1QO6 A;  1SRZ A;  1SS2 A;  5HZP B;  2RL0 A;  2CG7 A;  1O9A A;  3M7P A;  3OXU D;  1U5M A;  3T5O A;  2MCZ A;  5FO8 C;  1OJV A;  1QUB A; 
#chains in the Genus database with same CATH topology
 2RLP A;  1TPN A;  1MD7 A;  2BZM A;  3MQL A;  5DN4 A;  2MCY A;  2KMS A;  2V8E A;  1OJW A;  3K3T A;  4MSL A;  3ZD2 A;  2WII C;  1GHQ B;  2I2L A;  2XWB F;  2QY0 A;  2YRA A;  5HYT B;  1H2P P;  2JRA A;  4B2S A;  2RKY A;  2Y8S A;  1H2Q P;  3EJH A;  4K12 A;  1ZJK A;  2CG6 A;  3FGR A;  3GOV A;  2XRD A;  4J38 B;  4ZH1 D;  5JPM G;  2CKU A;  3WSY A;  4C16 A;  4YNX A;  2YBY A;  2Y8T A;  3OED C;  4A5W B;  4WJG 2;  2X2Z A;  3FGT A;  4APL A;  4B2R A;  1GKG A;  1VVC A;  2IZ3 A;  4LOT A;  1TPM A;  5HYP A;  1LY2 A;  2RLQ A;  1OK2 A;  4AYM A;  1OK1 A;  4N7E A;  4PZ5 A;  2IZ4 A;  3IX0 A;  4MUC A;  3VWO A;  1HFI A;  3ZLD A;  5HYU B;  3INB C;  3KZJ A;  2LOJ A;  2JGW A;  5I0Q B;  1E5G A;  3RJ3 D;  5DN5 A;  1GPZ A;  3TVJ A;  4BWC A;  4CSY A;  1PPQ A;  2XQW C;  1RLH A;  2KRI A;  4AYE A;  3ZRZ A;  1G4G A;  2B5I D;  3SW0 X;  3R62 A;  3NFP I;  3CI0 J;  2Y8R A;  1HFH A;  1CKL A;  1MD8 A;  1HCC A;  1VVD A;  1OK9 A;  3CAL A;  2EC3 A;  2ERJ A;  2G7I A;  4IGD A;  4AYI A;  3L89 M;  3F6K A;  3ZD1 A;  3NJA A;  1QGB A;  1E88 A;  4ONT D;  1FBR A;  1OJY A;  1TPG A;  4KKD A;  2UWN A;  1NWV A;  1H03 P;  2JGX A;  3ERB A;  1E8B A;  4LOS A;  3IU3 I;  1Z92 B;  2RKZ A;  3O8E B;  2O39 C;  4AYD A;  1Q3X A;  3GXE A;  1G4F A;  2W81 A;  3KXV A;  1C1Z A;  4PO7 A;  2A55 A;  4F4O C;  3WSX A;  2XWJ I;  4DJZ A;  1ELV A;  4JHS A;  1H04 P;  2EHF A;  1UOT P;  2XRB A;  4FXG G;  1GKN A;  2W80 A;  4YIZ A;  1OK3 A;  3OP8 A;  1QO6 A;  1SRZ A;  1SS2 A;  5HZP B;  2RL0 A;  2CG7 A;  3ZLE A;  1O9A A;  3M7P A;  3OXU D;  1U5M A;  3T5O A;  2MCZ A;  5FO8 C;  1OJV A;  1QUB A;  2ZYC A; 
#chains in the Genus database with same CATH homology
 2RLP A;  1TPN A;  1MD7 A;  2BZM A;  3MQL A;  2MCY A;  2KMS A;  2V8E A;  1OJW A;  3ZD2 A;  2WII C;  1GHQ B;  2XWB F;  2QY0 A;  2YRA A;  5HYT B;  1H2P P;  2JRA A;  4B2S A;  2RKY A;  1H2Q P;  3EJH A;  4K12 A;  1ZJK A;  2CG6 A;  3GOV A;  2XRD A;  4J38 B;  4ZH1 D;  5JPM G;  2CKU A;  4C16 A;  4YNX A;  2YBY A;  3OED C;  4A5W B;  4WJG 2;  4B2R A;  1GKG A;  1VVC A;  2IZ3 A;  4LOT A;  1TPM A;  5HYP A;  1LY2 A;  2RLQ A;  1OK2 A;  4AYM A;  1OK1 A;  4PZ5 A;  2IZ4 A;  3IX0 A;  4MUC A;  1HFI A;  5HYU B;  3INB C;  3KZJ A;  2LOJ A;  2JGW A;  5I0Q B;  1E5G A;  3RJ3 D;  4CSY A;  1GPZ A;  3TVJ A;  1PPQ A;  2XQW C;  2KRI A;  4AYE A;  3ZRZ A;  1G4G A;  2B5I D;  3SW0 X;  3R62 A;  3NFP I;  1HFH A;  1CKL A;  1MD8 A;  1HCC A;  1VVD A;  1OK9 A;  3CAL A;  2EC3 A;  2ERJ A;  2G7I A;  4IGD A;  4AYI A;  3L89 M;  3ZD1 A;  1QGB A;  1E88 A;  4ONT D;  1FBR A;  1OJY A;  1TPG A;  4KKD A;  2UWN A;  1NWV A;  1H03 P;  2JGX A;  3ERB A;  1E8B A;  4LOS A;  3IU3 I;  1Z92 B;  2RKZ A;  3O8E B;  2O39 C;  4AYD A;  1Q3X A;  3GXE A;  1G4F A;  2W81 A;  3KXV A;  1C1Z A;  4F4O C;  2A55 A;  2XWJ I;  4DJZ A;  1ELV A;  4JHS A;  1H04 P;  2EHF A;  1UOT P;  2XRB A;  4FXG G;  1GKN A;  2W80 A;  1OK3 A;  3OP8 A;  1QO6 A;  1SRZ A;  1SS2 A;  5HZP B;  2RL0 A;  2CG7 A;  1O9A A;  3M7P A;  3OXU D;  1U5M A;  3T5O A;  2MCZ A;  5FO8 C;  1OJV A;  1QUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...