2YRBA

Solution structure of the first c2 domain from human kiaa1005 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
156
structure length
156
Chain Sequence
GSSGSSGDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first C2 domain from human KIAA1005 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Protein fantom
total genus 13
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yrbA01
4FHKA 1DQVA 4F91B 3T8MA 4XZ4A 3W56A 4FJYA 4WAFA 1W16A 5H4ZA 2CJSA 5EDSA 1QATA 3NZSA 4ICXA 4GNKB 1DJIA 1A25A 2X38A 1DSYA 3NZUA 3ENEA 4NPKA 4LT7A 3ZVVA 1UGKA 4KZCA 1QASA 4G11A 4J6IA 2UZPA 2Z0UA 5CCGE 4AJWA 4ANXA 2ENQA 2V4LA 4HVBA 2K3HA 3GPEA 3HN8A 2R83A 2NQ3A 2Q0ZX 2WXLA 3F05A 4JPSA 5H4YA 4FADA 2NSQA 3ML9A 1DJHA 1E8XA 4L23A 1E7VA 2CHZA 1UOWA 2QZQA 2B3RA 5T8IA 5CCHE 2ENJA 3L17A 3L9BA 2A5UA 1WFMA 3LJ3A 1K5WA 4QJ4B 3TWYA 3IM1A 3F01A 3PRZA 4BGDA 3N5AA 3HIZA 3OAWA 2CM5A 4Y1TA 4EZLA 1DJZA 5KJ7E 4HLEA 1CJYA 1DJGA 2WXPA 3P2BA 3B7YA 2WXKA 1TJMA 3NSJA 2EP6A 4BFRA 3APDA 4L2YA 4LCVA 2DMHA 2K8MA 3PYCA 3R7QA 4OVVA 5JHBA 3R7RA 5CCJA 4PS3A 2WXJA 2WXHA 1E8ZA 1WFJA 2WXRA 4QAMB 4V11A 3RPBA 3SD5A 4ANWA 2A4ZA 2CJTA 3F04A 4WWOA 2Q3XA 4DK5A 3FBKA 4NS0A 2N1TE 2WXNA 3S2AA 4ANUA 4KZ0A 4DNLA 4F93B 3W57A 4FA6A 4F92B 3L08A 3M7FB 3TJPA 1BYNA 4WWNA 1W15A 2CHDA 4LDCA 3APCA 2WXMA 2CHWA 3KWTA 4URKA 3L4CA 4FULA 5JHAA 4FJZA 3L16A 3PFQA 4PS7A 4L1BA 2ZKMX 4OVUA 1GMIA 2RD0A 2BWQA 2LHAA 4QJ3B 1YRKA 2Y3AA 2WXQA 4ANVA 2FJUB 3F00A 4IQHA 1E8WA 4XX5A 2WXIA 3RDJA 2ENPA 4GB9A 2WXOA 4NP9A 2CM6A 4WWPA 4A55A 2DMGA 3OHMB 3QJZA 3TL5A 1E90A 4AOFA 3ZIMA 2D8KA 1V27A 2NCEA 3DPDA 3APFA 4F1SA 5G2NA 3HHMA 3FDWA 3QR0A 4TV3A 3ML8A 2YOAA 4XE0A 2YRBA 3DBSA 3CSTA 1HE8A 2JQZA 3IBEA 3KWUA 2CHXA 4FLHA 1RH8A 3CSFA 3JZYA 1RSYA 4WEEA 3QARA 2WXFA 4MJJA 2KI6A 4TUUA 1BDYA 4FHJA 3QR1A 1BCIA 1E8YA 1DJYA 2K45A 4L1LA 5G55A 4QJ5B 3QK0A 1TJXA 3QAQA 2QZ5A 4KITB 1DJWA 4NPJA 1DJXA 3PREA 4PS8A 1RLWA 4EZJA 4Y1SA 3MJWA 1UOVA 3L54A 2K4AA 3L13A 2ISDA 1E7UA 4TS6A 2WXGA 4IHBA 4EZKA 3ZW3A 4ICWA 3PS6A 2FK9A
chains in the Genus database with same CATH superfamily
5GS3A 1L9NA 1OPOA 2ZOLA 2BRRH 3RDTB 1R33A 1JHKH 5EFIB 5H4ZA 3HG1E 2NDGA 4NYLA 3VSUA 2CDFA 2R1XA 4DPCX 4ZFOB 5DVMA 4PRNA 1EZUA 1NMCB 4JN2B 4PGDA 1TNMA 5FYJU 4G8AC 1HIML 1TT6A 3HC0A 4KNTA 5SWSE 4WNJA 4I77L 1DN2A 3MNZB 1LVEA 1QLEH 2W9EL 3K5RA 3QH3B 3JYCA 1AMYA 2O6EA 3WSQH 4DQOL 1CGSH 2EECA 3LYRA 3CVHA 1B6UA 3FSAA 1VKXA 4XCEB 4NKQB 1YNTF 4EN3C 2QL1A 1DQMH 4Q6KA 1U8IB 1OE1A 1R17A 1RI8A 1VLXA 4H25B 3REWB 2CJUL 5ETUA 4DP5X 3OF6A 3KYNB 2ZYIA 3KGUA 4P3DA 4QXGH 4WK4B 2B16A 3WDJA 1SJEB 4XI5D 5B7FA 3QUHA 3WO4B 2EQDA 2RR3A 4BCYA 2YSSA 3L2NA 2ZCKH 4PPTA 5CKGA 2W94A 1AE6H 1RK7A 3O45B 3HLKA 1J8HB 3FQWB 4Y2OB 4FQPA 5E6IB 3VXQB 3NCJH 2GTWB 3ZT7A 3ZSTA 3CIQA 3DX4A 4WV1B 4AEEA 4OGYL 4XR8C 1AZVA 1I3GH 3N3EA 2IH1B 3K71B 4MHHG 5D96C 1NUFA 2ZP9A 2JCCA 2VDRH 1URZA 1E50A 4NQXA 5LBVA 1YPZB 2HTKC 3KPTA 3OG4B 5IQ9A 5K69A 4X99A 3ZTNH 3C5ZD 2BCKA 3SBQA 3QS2A 1QLRA 4GW5B 5IOPA 1W0VB 2X42A 5HYSB 1H3PL 3C2AL 3EDEA 3RFZB 3BYTA 3GSQA 3AQYA 5LGHL 4WTZA 1MJ7H 4JZJB 5G2NA 4ZDHB 1AXSA 3FDWA 4XNAA 2K1MA 5CAYB 3WAKA 5HDQL 4NLAA 1SF5A 4P57A 1KPRA 2FCBA 2NNRA 4N2CA 3TA3A 2IG2L 1F2XK 3WNJA 2EUWA 1J1OL 4O4YH 3ULSA 4BZ1A 4OGAC 1OWWA 1YY9D 1K2DA 2XXGA 2Q10A 4FKKA 1IEAB 4FYRA 4ANKA 4JO5A 2FT8A 4NQTA 3MGAA 3ARDC 3BUIA 3N42F 2HRGA 2WTOA 3ARVA 1NC2D 4JHWL 3QJOA 5HPMB 1NCBH 1BIIB 3PQYE 3RGVA 3EJYC 5J9PA 4AI7A 1YQVH 4PLJC 3QJHA 4CNIA 5IUCA 3OB0H 3UYRH 5LJYH 2ZUXA 2IDUA 2VERN 4AT6B 5IJKA 1HSAA 3CUPA 3X1FA 4G5AA 2D3JA 2QADD 1OTUC 5A7EA 5A3ID 2CJSA 4PWFA 2QADB 3QJQB 3FQ2A 3UTSD 3N6YA 3QI9D 1A2YB 4E9WA 1YA5A 4OLWL 2FHFA 5TQ2L 5BPPA 1G0DA 4L2LA 3UAJD 4TTDC 2Y72A 4BH7A 4R0LA 2ZOOA 4IU3B 2X1OA 1EZSA 3P4OA 4FXGB 4HDIA 4F9LA 3IDNB 5I1LA 2JK5B 2WZPD 1DBML 1JD7A 32C2B 1A4JA 3EJRA 2DLGA 4NGHH 3KPRB 5C08A 3CFDA 4LLYB 4APQC 4M8QA 5I9QB 1BOGB 1VENA 1JI1A 1ED3B 1L9MA 4CILA 3GLDA 4UOQA 5AB9A 4RRPM 4UQ3A 2Q76A 5KSVA 1SRDA 3KXFE 4V2BA 2PW2A 2ZAHA 4DQOH 4G42B 2PW2B 4TF4A 5L8JB 5E2JA 5AW8B 4ERSL 4JO2L 3SGDI 3Q6FA 3V4VA 4GAGH 3QRLA 2PO6B 2I7OA 2ZAGA 4K3HA 4NKIH 5DYOA 1WBZB 2CDGB 5L2KE 2HT4C 1KPUA 2DWTA 3EFDH 5ALBL 1KMGA 3RL2A 3T0VA 5AVRB 2IV9A 1XSKA 3SCMD 4GKZB 2EDFA 3AAZA 2N7AA 4OBRA 4DPBX 4D9QD 3MNVB 1CXFA 2DOCA 4FNQA 1F8TL 1MHEB 1TO5A 2YRZA 3F7VA 1KCSL 4YHZL 4R97C 3IJHA 3HAEG 3T2NL 4E9QA 4CKVX 1JVLA 1P7QB 1FG2B 4L1BA 2ZKMX 3V0HA 3IAQA 3TIDA 2WAQA 4X4YA 1CD1A 1P7KB 4AQ8C 4TL4A 1T6VN 4TSAH 1JS4A 4QUOA 3UROR 3PABB 5HDOA 1YUHB 2VN5A 5TDNB 1NLDL 4J3BA 4N0YL 2F61A 5DVKA 3DMMD 3QIWD 1HEJC 3QUMA 1SOXA 2H45A 5FM5M 4YSQA 2OCCB 4JDZA 1GC1H 1QNIA 2MWCA 3VUAA 2NY4C 1AIFA 2JJTA 1QMUA 5HD8D 2VDPH 1ZJBA 2YOAA 1AZRA 4D0BA 1J5OH 5D1QD 4PB0L 4KV5E 3UIZA 3O3EB 3I6LE 5FXCH 2ICWI 2WTPA 2YAMA 3EFDL 3DHJA 5ALBH 1HHJB 1L4IA 5TDOB 5TDOA 4DESA 3C75A 1MG3C 2FEEL 4CU7A 1PX3A 3L1OL 3CN1A 2A3TA 3AQDA 4KDWA 4KXCA 4X6DB 1NFDA 1RURH 5EN3A 3SJVD 4Y4FA 3VNZA 1YZZA 2A77H 2EDXA 3ATAA 3WMQA 3QORD 3DVGA 4LP5A 4QDGA 3INUL 5IJDC 2PNDA 1YECH 1NGXB 4HXAH 3IMTA 5CWSB 3MPCA 3B1TA 4DGIL 5L88L 2AC0A 5A43C 3BFWA 3MOQA 1D2PA 1SHSA 2G75A 4H8WC 2DYRB 4HPOL 3RU8L 2NXYD 1U3HC 3HMXH 3OKKA 3MGOA 4ZFZA 2HJLB 2C8NA 1L9SA 2HP4A 1BQUA 4CSSA 5F1SA 4DKFL 4GW1B 5HVGB 5LG6A 3AAZB 4AQAA 3JV4A 3Q5YA 4EJ1C 4XPHL 2B1OA 3I75A 4ZNEA 3ZDXF 4YSDA 4OZIF 2VQ4A 3SE8L 2R23B 2XTJD 3ZE0E 3UTTE 4GBXB 4U6VL 1MCJA 2CHZA 2HJKA 4HW6A 4MJ5B 2A6IB 2O5ZH 1TPXC 1Z0NA 1R3JA 2OTPA 2UZXA 4G8GA 3DX1A 1Z9SB 3O2DH 4HJGA 5FIEA 1OM3H 4A2LA 5MENE 1CWVA 4JAMA 4OZGA 4HKJB 4URTB 2BLFA 4XVSL 2YUVA 1VFAB 4JM0A 3NRPA 3SKNA 4PRPD 4V1DD 3X2QB 2ZE0A 1KXQE 5E2TH 2CWRA 2DV6A 5IFAH 1Z9OA 4HAGA 4UMGA 4Z7OE 5LHDA 2GJ6B 2FECL 1LEIA 1JNHB 3LPWA 4V1DB 3RX8A 4GXVL 4R0LB 2VERA 4MX7B 1EEYA 1INEH 4JFYB 1V7NH 3KPQB 5D1XC 7PAZA 4ZT1A 4ES9A 4DK3A 2KLRA 2M8XA 1OTSC 3AU1A 3L5WB 5CNHA 3AUWB 5HYJE 2XQ0A 2ZJSH 1RD6A 2C26A 4PWJA 3W9EA 2CHWA 5ERWB 4XZUB 4D94A 1BAWA 1KTBA 4HUXA 2Q1EA 1NKRA 5KBKA 5CGYD 1U9KA 5T3ZH 4ANVA 2E7MA 4BBWA 3M1OA 3QHZH 5BV7C 1GZPA 3I85A 1ZEAL 4G7RB 4PLJD 1FZJA 1ZS8B 5HDBF 1C5BL 15C8H 4TPRH 4UT9H 4CGUB 2EIDA 3P77B 2C3VB 3DV4A 3DJSA 3KWWA 4TSBL 3EKCA 4GXUM 4W9CC 5CD3B 1JOIA 1RJLB 3LXAA 2QSTA 3RVTD 4RMVA 1KG0A 1DR9A 4R84A 3O3DA 3QB7C 2WXFA 4X5WA 4H7VA 2ATPB 5C2BL 1GRWA 3BQUA 2FATH 2MTAA 4ZX5A 3RFZA 3IDMA 1KXHA 1ZXQA 1CFNB 1SM3L 2WWKT 2WIMA 2Y23A 3BGMA 1BFOB 2NY0C 1MF2H 3V6FB 4U3XA 4YSUA 1CLZH 3DRTB 1TTFA 4GAJH 3ARSA 4PGJA 3VE0B 3QDJE 3U25A 3EOTH 4P07A 3U0PA 4PJBE 4P2QA 3RWFA 5E0FA 1EJ6A 1NC2A 3G6AA 3A4EA 2MQ3A 3GS4A 4KMQA 1FBIL 3T65A 5I2IA 2YPLE 2HLFD 1CFTB 1J11A 3QXWA 2VDPB 4UZUA 2V33A 4KROB 4M3KB 4L48A 1G0XA 1DUZA 4RFNC 4QRTB 4A67A 1MSPA 1H5BC 3C5ZA 2Y0SA 5AW4B 3FO2A 5SX4H 2CA3A 1MCQA 4YHIA 4HVBA 5I1HH 5DS1A 4J6RL 4P5TA 3ARPA 4P23C 1MVUA 3NCJL 3ZQ9A 3QEGL 1EIBA 1I3GL 1YEKL 4PHXA 3MX0B 4QRAA 3IRCA 3T0EC 3T0BA 1MCKA 4WW2F 2PW1A 4Q74A 1B2YA 4EZLA 1TIUA 2IQAA 2H9GB 5KJ7E 4MSWA 4PCTA 3ARZA 4KVNH 2DJMA 3A4AA 2APSA 3WFDH 2IOIA 4OIAA 5F7BA 4BSWB 1JHTB 1WBXB 1FZMB 4LHUA 3DUUA 4ZQTA 1H3GA 2KH2B 4JFDA 4KUZH 1EHNA 5J13C 2WXJA 2BVQB 4FZ8H 5IGXH 3KR3L 1E6JH 1MNUL 4QXVA 3S3JA 1HL8A 2D2OA 2WXNA 4Y5YA 4BWUA 1UJ3C 3GMLA 1Q4NX 4LOEA 4FL4B 3B9KD 3OZLA 3L08A 3OG6B 4JUTA 1EXUB 1TQCC 1ZTXH 3MOBH 4KK8D 3PQYD 2F74A 4OM0L 1ZK5A 3U6XS 1DQML 2FR4B 5BO0D 1A4KB 3DX9A 1U8KA 3N44B 1VZIA 4PJ5D 3QEGH 1UB5B 1QACA 2KZ1B 2A73A 3VDBA 1U3HB 3SKMA 5K1NA 3T8XB 3ZIYA 4EDXA 1E90A 1JXJA 1YG9A 1DVXA 2E7HA 3AROA 3DJ9A 1MWAH 4FP8H 2UX6A 3VQMA 1U3HD 1U3JA 5EDXA 2ICWA 4XNMA 4DIXA 5DEZA 3LNFA 4IDJH 4Y4HB 4V2CB 4XP1L 1NC4A 1AYOA 5D5MA 3MREB 3HLAA 3L1FA 1Z3RA 4DUWA 1KN2H 3AM8C 3CDFA 2G9HA 3EHBB 3MCLH 1VSCA 1S9WB 1WLHA 3UTSE 3BGFB 1S9VA 4Z7VE 3SYAA 1H8NA 3IFPA 4MQXD 4DT2A 3DDGA 4X8XA 1JNJA 4L8CA 5HHOD 4ONHB 1AAJA 1R5WB 2GIMA 5I71C 2W81C 2ZP8A 2ZICA 4UINH 4Y19B 3S37H 5BVJA 1C8QA 1TZIB 5CBAA 3FHAA 1MVYA 3PL6B 1FC2D 2OJZL 3IDJB 3VG9C 4J28A 5DA4A 3LQAL 2YD3A 2DQCH 2IAMD 3POHA 3CQPA 4YHOL 2MTPA 3TVMB 4GO6B 2NQCA 3SO5A 4GW4A 3GMRB 3TZVC 2WQWA 1Z9SA 2NY6B 4HJGB 4E0RA 4JO3H 5CGTA 3S4SA 2B8OT 3K0WA 4ZMWA 3HFMH 4IKNA 5CD5D 3D0LA 4GSDL 2NY7H 5D1XD 5LCVL 4K2UL 3FUDA 3UGUA 4W93A 3BPNB 4QXTB 1HHIA 3ALPA 5DZPA 4PRAB 4N20A 1Q0YH 5MERA 2QFRA 3ZXAC 5IHLB 3IDNA 3IM1A 1OO2A 1IM9D 4N0UE 2J2ZB 5CLXA 3NA9L 5AD0A 4KMLB 3WYRA 3C6LB 3D34A 3LQAH 4GXVH 4YHOH 5JR1H 3MBWA 1DVUA 4M3HA 1IKFL 1YY8B 5E00B 4ZUUA 1I7UB 1WIUA 1PG7X 4NS0A 1NFAA 3K5SA 1VACA 5D2NC 2H26B 4YUEH 1QO3A 3KPOB 4XHJD 4ZYKA 3GRBA 3F2LA 1BD2D 3IF1B 2RALA 2B59B 3T1FB 1HX0A 5C70A 1F97A 2DQGL 4NQSA 4Q0XH 3EOAB 1HWHB 5SX5H 2WGNB 4HH8A 1MIEL 3S96B 1R5IB 3QXTA 1EEUA 1X5JA 2V8MA 3ORJA 5A2KH 4UTCA 5KYXA 3ZDZB 5LGJA 3RVXC 5C0AB 2N56A 4G6AD 3PG2A 1F1GA 3TXAA 2JXMA 3BZDA 3PWJA 1QLFB 1ZLSL 4M4RA 4X5QA 2R1WB 3RVWD 4LB8A 5JPNC 4KKQA 5DDHB 4PJ9D 1B9ZA 4X80L 3NIGE 2M83A 4ZDHA 3O11B 1BEYL 2OXHB 3FAWA 4XN7A 3WFEH 3NK3A 1U93B 3TP4A 5GS1A 2VYRE 2WVUA 5HPOA 2Z31B 3TNNA 4DKTA 4XPTL 5DMIH 5L9DL 3IJYB 4Z8FL 1PZ5A 1J0KA 4JPVH 1HWWA 4FKEA 4PRBB 2CSPA 4RWHA 3QPQC 3QAQA 1S8DB 5JMOC 1DP0A 1HCVA 3DHPA 3TO4C 2Z92A 3MRLA 4Y9CA 5DC4B 3CCHA 1T4KB 5H37H 4XNMB 1WC7B 5EEYA 2WZ5A 4NC0B 1ZA6B 3QUKA 1H3VA 1AXTL 2VJ8A 1UKSA 4YXHH 5ID1A 1IC5H 4N8UA 4IOSA 1N68A 5ICUA 4KTEH 2FBJH 3KZ8A 4PB0H 3UABA 2PWEA 4QRQA 2YSSB 1A6VL 4Y5XA 2YXWA 3TYGH 2F53E 3S37L 5IFAL 1XCWA 1AQDA 1BIHA 1DLHB 1KTRL 3E1ZA 3KLAB 1BGXL 4HCGA 3RZCA 4R4FL 5J12C 2VN3A 5IZ7A 5TQ2H 3GSUA 5I1HL 4D3CL 2BXYA 2TSBA 1S9XA 4IU3A 2Q0ZX 4IYKA 1F1DA 2WVVB 2AEQH 4JG5A 2AJZA 4AX3A 2VLRD 5IVXA 5HYJD 3OKNB 4MCZB 1X7SA 3MLVL 4LCWE 2CXKA 5FR3A 2X4PB 3GSOB 4FMKA 3TFKC 4F7MB 4CJ1A 4BK4A 1AQ8A 4R3SA 1A6TA 4JB9H 1DJGA 1U8LA 2DQEL 1I8KB 1F3DJ 2XQYK 4WI6A 3JVGA 5L8LB 5MHSE 1CGVA 4PRPE 2QV2A 3FCGA 4M7ZC 2RAMA 1PDKA 5F8RC 3V5DA 1KN4L 2VZSA 1M4KA 2NZIA 5IMKB 1W72A 2BWIA 4S1DD 2WLJA 1F42A 4XMLL 5DRNB 2HVKA 5F7EL 1S7TB 3FU7A 5C2BH 3RA7L 4O2CA 2FWOA 2BWQA 4NN7B 5E6UB 1XH1A 5F7MC 4TRPL 3PJNA 3W11D 3HC3L 1NIFA 3H2WA 3LQAC 3NIGF 3EXJA 4ZPTB 5FYKD 1K8IB 5HHPB 1UACL 1NM4A 1JG9A 4PSPA 2VISB 3EDJA 4IEFB 5FM4A 4U7KA 3L7FA 4FERA 1Q94A 2C9UA 2QFPA 2A6DA 4JG1L 3T4AB 2WK2A 2J8UB 1R5WA 3W0WB 3L4VA 3S3CB 3SPJA 1A6ZA 2R2BA 1WE5A 4IRSD 4X0NA 5KBLA 3JZYA 4F7KA 1I53A 1RSYA 1CUOA 3LZPA 1PZBA 4XMPL 1SXZA 4L0ZA 1BLNB 4F7EA 1QSFB 1AFVH 1IM3D 3QPKA 4GT0A 1KYOJ 3HZMA 1WH0A 2K7PA 3GS7A 4PS8A 4LPXA 1FLRH 3D85B 5JW5B 1DUYA 5CSBA 1LXMA 1BPLB 3PP3H 5DJZA 2AV7A 1ONQA 1BZ9B 4PG9A 4PREA 5FO8B 5GGTA 4WW1A 3NZHL 4PCYA 3FFDB 3JWNE 1GTNA 4GXFA 3HI5H 1KSRA 2MEJB 3MNWA 4EI0A 3FFCA 3H8NA 5C86A 1SJXA 5KVDL 5ESAA 4HS3A 3E0GA 4DAGH 1A6UH 3NJMA 1YSOA 4RVBA 3WLWD 2CLZA 1MAMH 2DIEA 3WLBA 2H1XA 3FTGA 2G2PA 4J3OC 2AJUH 4UV7H 4HC1H 1F3RB 4WO4C 2Z7ZA 2VN7A 1BQRA 2O72A 3NZ8B 3VXOB 4OZGF 3AT9A 3FF8A 2O5ZL 1AFVL 1WSST 2FQEA 3L3HA 3MUZ1 3GMLB 3QNYB 2BVPA 5JOFB 4J5VA 1JZJA 3F01A 3NPSB 2BNRA 4I8DA 1ODUA 2A6KB 4F9LC 3CSBA 3KPMB 3VGDA 1T22A 2P5EB 2QBWA 4LLVA 1OF0A 3VTMA 1HQRA 3EGDB 4HOZA 4ZMZA 1W72L 5F3BA 2AZAA 3OXRB 5KSAC 1U8QA 3B3BA 3APDA 1KPVB 1GS6X 1FAKT 2HXAA 2MMXA 3UYOD 2NUTB 4AGNA 2CJTA 2OL3L 3P9LA 1KB5L 2F54D 3DWTA 4IJ3C 5IY5B 4HX1A 1CFSB 3QUZB 4LF3A 4I2XB 4EUPG 3OAYK 1LQSR 1IQDA 5LQBL 4AMWA 1DFBL 3HS0C 2CRMA 3ESOA 4YHLL 3D9AL 4LAQL 3FU6A 4ZSOE 5HI3C 1C12A 5C0RH 5C71A 2PKDA 1SYSB 1KEGL 4IGBB 4MJIB 3O8XA 4RETB 5IHBA 1KIPB 4KVNL 2NZ1A 2IPKA 4Z95H 4PIBA 3D0VA 1E4KC 1XGQB 4U1JB 5DD1L 5ESVA 3QDMB 1E0OB 1UA6L 4LSPH 5E1AA 4GW1A 2C7FA 3N43B 1IE5A 4H5SA 3V4LA 3D39B 4IOIB 1UXSB 4AYGA 3U4KA 2F9BT 3KPPA 2CRZA 3VH8A 1D9KB 5JOPD 2AANA 3GM8A 5KW9H 4YSOA 3SJVA 4KJPD 3DYOA 3UEZA 3NJXA 1AD0B 5FECB 1ETZA 4J3OG 1HE8A 1Z66A 3QI9C 4ZW8A 4DUVA 3BFQG 5HVHC 1HCFX 2WSDA 4QD2E 4MNGE 2H5UA 2JJTC 1IBZA 5EA0H 4CC4A 5HHQB 2W95A 4XNUH 4Y1AB 5DUBA 2P5WA 3H4FA 2EEAA 4MA7H 1U36A 4UOW1 2ZSWB 2PPDA 2FIKB 4N1EA 2MQ0A 1LO4L 1EEQA 3U0WH 2V5MA 4KKCD 1CYGA 2GI7A 1I9JH 5DJZB 3ROLA 3SDCC 1EAOA 4FQCL 3T1FA 1FUNA 3MXVH 3AGWA 1UB5A 1F4HA 1CYXA 2EEFA 4IBZA 1JVOA 3Q9QA 2I26N 1QRNB 2VABB 1XZ0A 3ZKXC 4TN9A 2X9XA 2AQSA 3G6JA 2YPVH 1XDTT 4JDTL 5B39A 1KCRH 3BDYL 4YDKL 3SCMC 3ZDZF 4CKQA 3V7AE 1IILE 5F7UA 5E9DD 1P53A 1OSPH 3E9UA 4OGAD 3D18B 3DOSA 1XGYL 5GS2H 4DZBB 1S3RA 2FZ3A 4D8PA 3PP4H 2DEXX 2J21A 4XC3H 3WKPA 2OMXA 1EPFA 1WS8A 4TULL 3WCYA 5I8OH 1VZGA 3NUKA 4YZFF 2FIRT 3VWKB 3P69A 2PPAA 1G7JB 5DQDL 5CP7B 3BP5A 1X5FA 4QXUL 1FGVH 2H47C 1UENA 2V2XB 3AABA 3CIAA 4I89A 2DWXA 3OMZA 5HHXH 4LBEB 2QADC 3QHZL 4A04A 4I0PB 4NEHB 3CXHK 3VWJC 4WGVB 2F7OA 1NANI 1OALA 4XVUD 3K46A 4QHUB 4KK9D 1WK0A 2P43B 5D1QC 3TVMA 1N3NA 1SOKA 4AEIL 2VWEE 4K9JA 5FC9A 1QFOA 2ADIA 2J1KA 2VLJA 2YPVL 4FXGC 4JDTH 4NNXA 4UYQA 2C1OA 2ESVB 1MFCL 4X4ZA 4KNUA 5I71B 2H32A 1MI5E 2HG5B 5C09D 2DLFL 3U82B 2A6KA 4H8PA 2FO4B 1C5DA 1LEKA 2OL3H 2EE9A 2FWUA 3BWAA 5CINL 4XN2A 3M1CA 4NENA 3VMOA 3Q8EA 3U0PB 3ZGIA 4LSUL 5ID0A 3W81A 2UYLB 2X4SB 4PJEB 3VRLE 1PAMA 3WOVA 3DUSB 3A6OA 4M62L 4UTAA 1A47A 3P4MB 4P5RA 4GRLD 5FA4A 3BT2H 2J8OA 5AAMC 4YDJB 1M9SA 3L3KA 4NC2B 3B2XA 5A16B 5E1HB 4A7GA 1VRSA 2FE0A 4MA3B 1MCOL 3SKJL 4ZMPA 1S9YB 1FN4B 1WO2A 3WNPA 5F7YC 5PCYA 1I8UA 4FFWC 1T1XA 4QTFA 3C09B 3MACH 2ED9A 4L05A 3STLB 1AZBA 3QUYA 4MKMA 4YDZA 4HEPA 1MLBB 5BOPA 3JWOH 2BIPA 5H37G 5E8OA 5IEHA 1IC7H 1UA3A 3A0OA 3WUWB 1DQLH 3IYLW 3MRMB 3T0XA 1UYWL 2BOBB 1CDIA 1J0HA 1UWXK 1U8MA 5T3XL 2VZTA 3QC6X 4HT1H 1KLGA 3HMWH 3RVVD 4IHOA 4U33A 3BWUF 1BXVA 1M2OA 3B8SA 2XFXB 3SGKA 4G8FA 2Q7NA 3ERXA 4HKZA 3MFGB 4W1TA 2PN5A 5L9DH 5DD3H 3F6LA 3FUHA 3MLWL 1HI6A 5DEFB 1FVDA 4IW4C 1N4XH 1B88A 3FB7B 5E8DL 2JH2A 1MCRA 1CICD 2X9ZA 4W9IC 2O5NA 2F53B 4KI5F 5F1KC 2VDMB 5CJOH 1JNHA 3CFJA 3GZKA 3UMTA 4AY0A 3EYVB 1UT2A 4Q9BA 3RWCA 3H9YA 4YDIL 3U7YL 3RIAF 4UM9A 4DCQA 4YSCA 3SKOB 2F7RA 4AV0A 2HTLD 2W65B 1KBWA 3Q43A 2EXYD 4IBTA 1S7XA 2IANA 3D48R 1MN4A 4I0PA 4PYHA 3KYNA 2HKAA 5JUEL 4Z23A 2P5WE 4TRPH 1XD0A 3ULUC 1MW0A 1UZGA 1ET7A 4UZGA 3VFTA 3CVIH 4J2XA 3N44F 4B3EA 1D5IL 1MWAL 4FP8L 1A9BB 1XHHA 5EUOB 5AG8A 1IAKB 1IKOP 1FF5A 1JGEA 1VGKB 4KJPC 4APQA 3QWRD 4XOCA 4P9HL 4XMWA 2AJYL 5FB8B 3UPRB 1HQRB 3EGDA 4BUHA 5GRYA 2VXQH 3ZT6A 4MTMA 5HJ3B 3Q8BA 5FEBA 1KEGH 3H56A 5T1MB 4KH9A 3MRJB 2H0EA 2G30A 5JIDA 3FB6A 1KCVL 1S7UA 2OI9C 4GYBA 3JWNG 1X9RA 4WHCA 1XGRB 4LBAA 3O6KL 5F1IB 3U46A 1NGXA 3C08H 1OHZA 3GHPA 3LXUX 5I18H 5GSRA 2CR3A 3U9UB 2HLFC 3II3A 1IBGH 1F1AA 1FFOB 3PCYA 3ROLB 5D2NE 4Z3TA 1GOGA 4PBWD 4YGVA 2RTTA 3DSNA 4WEEA 1A7PH 3E8UH 4XPTH 4HIIA 3LS5L 4ZUTA 4NDMA 4GMSH 3U1SL 4P23D 4PJXF 1T83A 4LHUD 2VW6A 2YGNA 3FFCE 3IE9A 4YWGL 2QZ5A 2Z92B 4K2UH 3HI6L 3VMNA 1L0YA 4GRMA 4HC1L 1HQ4B 3H53A 4M00A 1W6LA 3LMJH 3QYCA 3RNKB 1GIGH 2W80C 4YBQC 3PHOA 3MJ9L 1A8JH 2PP9A 1AXTH 4YXHL 2WLZA 1YY9C 5DMGD 5BRPA 3MLYH 2WCGA 4OQ1A 2NX5A 5FYLL 1O5PA 2LGNA 1Q90A 1I85C 2FSEA 3KBPA 5EDSA 2FYVA 4FLRA 1SY6L 3H9SD 3VXPA 5IM7B 1QLEL 4OY9A 4IMKC 5DLML 4I7ZC 3PDOB 2UZPA 4K7FA 1RKRA 4KK5C 3IB4A 4XVUC 5B1BB 2VL4A 4NHUA 3ULVL 2FHCA 3GBMH 2Q5BA 4G6FB 1AGBB 3O41A 4R6UA 4KK8C 4PUBH 4ZUVA 1BD2E 3LDBB 3FFOA 4A6YB 2EDTA 3RUGB 4WW2A 2NY0D 3BAXA 4HHGA 2MKWA 4E42B 1NZRA 1KBVA 4W81A 3UC0L 5AALA 2ZD0A 1M05A 1HDMA 1Y18A 5FO7A 3UIYA 4C4KT 4N0UB 4OUOA 3IS1X 5F9OH 5D5MF 1SN5A 2RQEA 1CR9L 5GSRB 2GUOB 3BPOC 3U6XA 4BJLA 1UA6H 4LSPL 5I0ZA 4R4BB 2MPAL 4BQ6A 3QUXD 4L4VB 2J6EL 4KO9A 3DBXB 4IRZL 5IJKC 2AQNA 1R3KB 2E6PA 4X7EC 5DJ6A 5BJTB 4P4KC 4FNSA 1FJ1A 3D25B 3FO9B 1NJ9B 4P9MH 3G6JB 3JVFC 3APCA 4NKOB 2AITA 1EO5A 1E4JA 4QAWA 2NX5E 1HHHA 1ZJAA 1HSAB 2NXZC 4MGXA 3BLBA 4ILDA 3T2QA 5F3FA 3ZR5A 2ZJSL 1N9PA 3DI3B 2CKBH 2YFNA 4CDGC 3LRKA 4Q6IC 4D0CB 1KB9J 1YMMD 4FZEH 3B9VA 5D9SB 4O4YL 3ZIMA 3UO1H 4G5ZL 4HISA 1XF5B 3RVVC 1GOHA 3W9DA 1QSEA 2JQZA 2GJPA 3CFCH 3Q05A 4NC1C 1NTDA 5IW1B 4OZHB 5C0NC 1E3XA 3IKCA 1ACCA 1AD0A 5FECA 2AERT 3RL1B 1BFVH 5IP4A 3WEMA 3S3SA 1IBGL 1X4XA 1AHWC 4LLQA 3HNTH 1NBYA 2ZF9A 2NY4D 2XPGA 1OEZW 1OE2A 4U49A 5HYSA 9CGTA 2VR7A 1CLCA 4POUB 3VFWB 4R90H 4OI9A 4YO0A 5I0VA 3VDCA 4FQXC 4NN6B 2XXCB 2PR4L 3BVXA 4XPGH 2BW5A 4ODHL 4G8EB 3FQXB 4YXLL 3FPYA 1UKTA 2EXYC 1MF2L 2J5WA 3TNNB 1XX9C 2FH6A 5B3JE 2GK0A 1M53A 5D71L 1FGVL 3UTOA 5FFLA 4NDMB 4JM2D 3EO0B 4U1SB 3ULUD 4FLSA 2ZF8A 3ZYOA 3ZKNC 3MLWH 3WTVA 5J89A 3X1GA 1AOHA 4I13B 5EOCH 4HJSA 3BGFC 4UNUA 2BMKB 4XHJC 3BPCA 4XE5B 3AITA 1RJLA 3QXAB 4W6WB 3K80A 5GS2D 4ZFQA 4C58B 5J57B 5D2NB 4HYTB 3IE4A 5H4YA 3RJOA 4MA8L 3PFUA 1NEUA 4X0KA 5DJ2A 3LZNA 3IWVA 5I8CA 3BMVA 4JG0H 3LKOB 3TESA 1U3NA 4HV8A 2IANE 4UQ9A 3K2KA 2WQSA 2IIJA 3MJ6A 4UNTA 2BY0A 2FO1A 4AQZA 5CSZB 4MZ3A 5SWZA 1E9PA 3SDAD 4PBVC 3J8F7 1A2YA 2YN3A 1RJYA 2J56A 3I2CH 1IGIH 5D7JD 3BIAX 5TE4H 3IJSB 3TZVD 2FJHB 3HCVA 3EYSL 3C8HA 5D93C 2BHUA 2XN9A 3SDXF 4OCSL 5F0PB 1OE3A 3MROB 2ZXCA 4XMXA 4OV6F 3HHSA 4KDTA 4Y9GA 2WKOF 2RHEA 4WI9A 1TVHB 5M95B 4WSJA 4Y2DC 4XOBA 1RSFA 1R75A 1S7WA 3GI9L 3WN6A 3QJHB 4CNIB 4JPWH 2HX9A 2IALA 4WJ5B 1E6JL 1MNUH 1UM5H 1JZHA 4XNXH 2I60H 3GWJA 2YK1H 3LNGA 3QPQD 5KYWB 1RZ8A 1CLVA 1P4BH 1G9EA 4R4BA 1BOYA 1MVUB 3WFHA 2F0CA 3EZ8A 5GSVB 4AG4H 5FO8A 3UTSA 4ZI8A 4XMKH 2F8IA 1P5VB 5JDSB 4KVCH 5GGVY 5BUGA 3L95B 3C60D 1NAML 4N2IA 4NQVA 3GIVA 3QXDB 3FHEA 3KNBB 2NW2B 3NCYP 4NCC1 4YBQD 1HJCA 2KUTA 3PJSA 4FQXA 3QEQD 4OF3A 3ILEA 4EI6B 1XWVA 3GO1L 3TEXA 1SQ2N 5CGYC 2VUKA 4ZMLA 4OLZH 3H3PL 2GIXA 5EIVA 1EFXD 1XSOA 5T5NF 2OSWA 1TTAA 4DHLA 3VG0L 4BK5A 3TFBA 1OCRB 4KKLD 5IFJA 2PF6A 3ZE1F 2X0WA 5D96B 1TJXA 3VXPB 4RH4A 4QWWC 1ACZA 4M62H 1MIEH 5LBSA 1RZJH 3NSCA 1Z3GH 5KVGE 1U93A 2ZUYA 4X5PA 1EAPA 1Y7VA 4X8CA 3L4TA 2GBVA 2WIIA 4RNRA 5DI8A 5E4EB 1G7HA 1JXKA 1KWGA 4ICWA 4D7PA 1A3QA 3OKEB 4WTXA 3DC0A 5EC2B 4K3DL 4NKMB 1JK9A 3WN5A 3RVWC 4AIZA 3IKCB 1KFAH 1BLIA 4ZSOB 4EI5A 4OJEH 2APBA 4PJ9C 3UDWA 3UCRA 5LUMA 4Y4FB 5DRNA 5F7DB 4I2XE 1IFHL 5KVEL 5MI0C 1FYHB 1JPGA 5F93C 3P11H 2YPLA 2YPLB 4GKOA 5IQOA 4A7QA 1AR2A 2ZUVA 3R4DA 1THAA 3UC2A 1DUYB 4L5FE 3AACA 1W9XA 3BWSA 2L3BA 3RWDA 1TMCB 4N90D 2B2XL 1GGIL 1MPAH 4Q6IB 2ZCHH 3CLWA 2M2DA 2OMTB 5B7EA 1DN0B 4EMZA 5ICYA 2VLJE 3MRJA 1FG2A 1MRDH 4GSXA 5EU4A 1P4LA 4WWKA 3GDBA 1FQ9C 3VD4A 4AYDC 5BQ7A 3C2AH 3ARQA 4PRDB 3L2LA 1CZ8L 4NZTL 1X7QB 4N3UA 3UGEA 2C1OB 3EO1A 1QR1B 4JG9A 2DF3A 3QFDB 3EUDA 4NRYB 3UZEA 4CN4A 2WINB 1DCLA 1TKWB 2GFBB 2NYKA 1ZY9A 5J3HD 1XO8A 4UTAH 2HN7A 4M1DL 3EH1A 3L5JA 5ACMA 1A7PL 1ORSB 1TMQA 2JELH 2LHAA 3ABGA 2YXMA 3OHXC 2ICEA 3SDXB 4I5BB 4B9GA 5KZCB 3F00A 3KNBA 1OGTB 3TT1H 3ROOB 1LO4H 3EYOB 4NJ9L 3I6SA 4FZEL 4XO5A 4Y9BA 4XNQB 1VPOL 3I75B 3CFDB 4HWEL 4LLYA 3FSZA 5HI4D 3VXUA 2H6PB 3IWUA 4QTIL 5KS9A 1CE6B 4Y9FA 3MR9B 1DUZB 4EBQL 4QRUB 4U1LA 3VXRE 3K7UA 4GIAA 5T5FH 5FA3B 3VO0A 1J0YA 3LKPA 2DI7A 5D72L 5E70A 1E4XL 1N64H 2WGXA 3T3MF 2EH7L 4KKAC 1XSJA 4TUUA 3SJVE 1I1AB 4Z7QB 4RGMC 3O8XD 4Z7OB 4F7TA 4L1TA 4PM1A 1JN6A 1YJDL 3QXVA 1FHNA 1DL7L 1S7SA 2CA4A 3L6FB 4JRYD 1BQHB 5EBGA 3DYMA 2CO4A 3MJWA 2BW4A 3NDYE 2X4OA 2XDHA 4NJAL 2MH4A 4Z7VB 4AW4A 5HP5A 5I18L 3THMH 3SN6N 1VDGA 3NIFE 4L8BB 5TD4A 1YNTB 3MVSA 2LU3A 4ZO8A 1G6RB 1W16A 2JB5L 3HG2A 4DP7X 4UAOC 1I82A 5I8CB 4H88H 5T3ZE 2DLHA 4ZTPH 5D7JC 1M1XA 1XF1A 5EOCL 1T7ZA 4K0OA 4IKLA 3FTVA 4M48H 3N1GC 2HRPH 5K1VA 4YEFA 1PY4A 1Q72H 5CM1A 1MWAA 4K7PH 1LE5A 4HZLB 2HFTA 4Y2DD 4G8IA 5B1KA 3IBOA 3CZGA 3DIVA 4Z78A 1K3ZA 1S7RA 2X6CA 3MLYL 2CIKB 4JY6A 2D4FA 43CAB 3K74B 5JIMA 2RMNA 5AVVB 4HFUH 1XGUA 1N6UA 3FUMA 4HKXA 1TDQA 3HRPA 1HHGB 2G4EA 3KEHA 5CD5C 5IW6A 4TSAL 1TJHL 4JJ5B 2JB5H 4W68A 1ZLEA 4D9RD 5FLVA 5C07D 3CZFB 4BGLA 1RAMA 5AOMA 1OPGH 1A3LL 3P54A 1NFKA 3EJZC 1QSZA 3ZL4H 5FUOL 3O4OC 1UXWA 5DGQA 1AS6A 1L7IH 3QFJB 1SEQL 1JMXA 3UBXI 1NL0H 5JNYB 2EIBA 3DO7B 5C97A 3IDJA 5J6GB 2EDRA 1TSRA 2E9IA 4TUJB 2V17H 4GBXA 4N2GA 4TL5A 1P6AB 1WCQA 2CKBB 3QJSB 4FG2A 3TL5A 3L3HB 3QNYA 4MCYB 5L4JA 5L0QC 5EZIH 4HUMB 3FUIA 1FVDB 4PGEB 1U8LB 5K59E 3H42H 4R8WH 1GYUA 1NBVH 2X6MA 5MI0B 2G9HB 2NNXA 4M6OL 1L5GA 5D1XE 5DD6A 3HC0B 2UZYA 1RJYB 1IFGA 4OGQC 4P2OB 5BS0B 4MQSB 5I76B 4X4KA 1HSBB 1NIEA 3LHPL 4X6CF 4X6BA 4XP5H 2OFQA 5C3LD 2DWDB 3EFFB 3TH3T 3P4LA 5KN5A 2WQ8A 1RZFH 4YPJA 4WHTA 2IFFL 3R0MA 1GIGL 4OAWB 3TN0A 1ZK9A 4MXWH 3V6ZA 2C4FT 1EO8H 1XMWA 4XNYH 4FNRA 2R0KL 1IC1A 1MHPL 1LE9A 2FIKA 3NABL 1JF5A 3CAFA 3VXTB 7CGTA 3NYKA 1QR4A 1EZVX 3O6MH 3VCLB 1D5IH 5CSGA 4I9WE 4HJIA 4ONFH 5GIRB 1HS6A 3PL6A 2Y5QA 4CL7A 5D7LD 1EGJA 2GUYA 2XBZA 4PGBA 3DTDA 4MMYA 5JHDD 5K9OA 3FQ4A 3ARDA 2YS4A 1LK3H 1FI8C 3QT2A 1T2QH 3I3EA 3FRPA 2JTDA 1ZVHA 5FA3A 4KZEH 1RUMH 4L3CA 3D06A 3E80A 1FPTH 7TAAA 3ABLB 4NCC2 4NQVB 3RL2B 3SD5A 2ZP0T 3L95A 4OD2B 1KPUB 4TVUA 2DN7A 2VLKA 5H37A 4LVNB 2WLIA 2X1XR 1SLUA 2A7BA 2W9EH 1LNUB 4BWWA 43C9B 5IVNA 5EHFA 1VGEL 5I1CL 3VVWA 1QNZL 4L9LC 3VSVA 4F33B 4L4TD 2OM5A 4AITA 3MZGB 3EAKA 1U8IA 3EYQD 2RBLA 2FRGP 3BZFB 4ZD3L 4B9KC 1DBAH 2R23A 1M3IA 3UBHA 3IU4L 1S7WB 1IC0A 3EBIA 5JHLL 1AKJA 1I3RB 4WUKL 2E56A 5K9KA 3FSVA 1KCUL 1E2ZA 3D4CA 5C0GA 1D5MA 2DI9A 1A7QL 2HVBA 3F7YB 3CFMA 3LVTA 4ZUUB 2FZ3B 4N25A 3FQTA 1YY8A 4BYHA 2X9WA 1PQZB 1ITCA 1UEYA 2J44A 2VH5L 3KPMA 3U2SA 2VOTA 4PRNB 1BFOA 4PJ7E 4YK4B 1J9RA 3MRCB 1ROWA 4GI6A 3D07A 4JPVL 3RY6C 2BWDA 3CXDL 3IDGB 1OF2A 5LXGL 4KKBC 3CSTA 4XB3A 3OMAB 2D3NA 4DPRA 4LEOA 5E2UH 4KKPA 1UM5L 1JHTA 3ETSA 3RI5K 2HPTA 2WP3O 1FYTA 2OR9L 1L9RA 1MCLA 3P4NA 1OGAB 1BG9A 3CX5K 1F6LL 5KVEH 1KYOK 3WEOA 3GMPA 1NBVL 3LPFA 3KXFA 3OJDB 1LP9A 3M1BA 1AS8A 2E76C 2G5BB 5E9NA 2ZSWA 2FB4L 2Z91B 3QUYC 4LSUH 2BXZA 4XBGB 1DJSA 1DQDH 3ZHNA 4HUXB 4HCRA 4AH2A 4ZJ9A 1TEFA 4XCNB 1I1RA 1W0YT 3ULSB 1QFPA 3SDDB 5MEQB 3RFZC 1DVYA 1QSVA 3EFOA 3OB0K 4H20L 3KJ6L 3MGTB 5EPMB 1DZBA 1SBSL 3QRBA 1JCKA 3ILPB 3RWHA 4PBDA 3HE6B 3HUJB 3MYJB 3V4UL 5IB4B 1NGYA 1RZGB 4FMFA 4G6KL 5IB4A 4HIJA 4OCWL 1MCPH 4NOBA 3RX5A 4TOYH 3OJMB 4JPSA 4YXKL 2NSQA 2WSKA 3KG5A 4LVOC 3H3KA 5HVFB 2ZUQC 4ABWA 3US1A 1JWMA 3MV8B 3B56A 2CUMA 4M4RB 3TEZA 1G5GA 1I9IH 1NCWL 5ISZD 4XPBH 2YA2A 3WLWC 5KVFH 4BUQA 2EAEA 4HKJA 1I7ZA 5KSBB 2JKWA 1ULVA 3VXTA 1RXLA 5GRUH 3S34H 1PNCA 3AWFA 1PLGL 2CLVA 2P46B 1NH6A 3MLSH 4R2GD 3SDXA 5LVEA 2FBRA 4OLWH 4TVPE 4K3JH 5ICXA 3B9EA 3HS9A 1C7SA 2ZTBA 4ANWA 4DP1X 2OR8A 4WWOA 1MWOA 3LRSB 2YKKA 4KGJA 3Q2WA 1H9VA 5EBLB 2QQLL 1F58L 4X7CC 4N28A 4EN2A 5KSAD 1IGCL 1WCBA 3MBXH 3I50H 4KOBA 5C0CB 4KZDH 1DEDA 1FN4A 1OAYL 4AZ8B 2AXGA 1FSKB 4XVTH 2Z7WA 1N5AA 1MPAL 2ZCHL 1U92A 3G3LA 1CTMA 1I8IB 4HULB 4U0QB 3A3YB 1DVSA 4EQ3A 4ZG1A 5D1QA 4PG2A 5E6RB 2G0LA 3NCYS 3QORC 2ZXQA 2PETA 5J56B 2OJEA 4R5TA 3S34L 5A6IA 3L9YA 4ODSL 1N70A 5D1ZB 1FNSH 1L3NA 4HJ0D 3L48A 2X3AA 3UTTD 1A9VA 3P3RA 3TU6A 1S46A 1I8LA 3FPXA 3FQUA 3BZFA 5EF1A 5BRQA 3HPJA 3UTTB 1IIKA 4TUJA 5IVZB 5EBWA 3UYPA 5G5DA 5E2VL 4NC1E 1YEFH 3T6QC 2VLJB 1YJDC 1M6UA 3TLRA 1KNOB 4HIXL 5FGBA 35C8L 3RI5F 4JAMB 6CGTA 1MJUH 3R1GH 3RVXD 3KE0A 5E8EB 4K71C 3RJQB 3WEXA 1L9TA 2GTQA 1T1YA 3G5WA 4LO9A 1Z3GL 4MB1A 2LTQB 2WUBL 4ZS6D 4C57C 4RNRB 5DI8B 2I85A 2Q6WA 1WZMA 1YYCA 2VDPL 1SDDB 1MDTA 2XZAH 3X1EA 4FX5A 1FVEA 4XO9A 1ZHNA 4X6CE 3LN4A 4G3YH 2Y7LA 1EANA 4OIFA 1S8DA 3F7VB 2VMJA 4P46B 5HYJB 2CRYA 4OCRH 5I74B 3AADB 4AJWA 2AXWA 3HMWL 4FFTA 2Y2WA 3FOLB 2DLTA 3Q6GL 1INQA 1L6ZA 1SLVA 1UTDA 4M8VA 2IPTH 3D3VB 4JVUA 1SFDA 2PO6A 2G75B 3MRHA 4YDVA 4LCWD 3BD5A 3C5SA 3WBDA 1YAZA 3DSNB 1YCSA 4DEUA 2AXFB 1LO5A 4WI3A 2E59A 2NW2A 1EWHA 1I7TB 2PXYA 2DYPD 3RE0A 2D2CC 2DQFA 3A6CH 1J86A 1P4BL 4BQ9A 4NO2B 1GGIH 5EN2B 1F90H 4DZ8B 4NT6A 4Z7QE 4AE0A 3H7LA 4XMKL 4FA7B 3RFRA 4ERSH 1OB0A 5ETUB 4M48L 1KTJA 1C5CH 1IO4C 4G7YH 4M4PA 2J4WL 1S7UB 4LDEB 1FCGA 4X6FB 1ZLVK 3CHOA 3F6JA 4KK5D 2J55A 3PV6A 5C6TH 2KL6A 1N0LA 3FU9A 3JTSB 3L3OA 2OSXA 2HT3D 2Z9TA 3OPZL 1KJ2L 4JRXB 3FBQA 2BNUA 4M7LT 4POZD 5DD6B 4YN3A 1L5GB 1HINL 4B27A 4MB3A 3SY6A 1WITA 3UPRA 3E1F1 3CNKA 5DMIL 3OV6A 3LSOA 2WPGA 3BAWA 4JRXD 2ESVE 3GS0A 3VM5A 3ULUE 3TT3H 4FQXD 2H1PH 4NQDE 3U4AA 3HN5A 1D7DA 4JFYA 5DJ6B 2ZUUA 4GLRI 4XPFH 1OAYH 5SV4A 5HPMA 3T2OA 1LO2H 5FUZH 3AZUA 3GBEA 1GC1L 2GY7B 2R9HC 2GBUA 2BSEA 4TVSa 3SE3A 3UG5A 4NERA 1ZANL 4U2ZA 2J43A 3KPRE 4OB5H 4YR6B 4A2FA 3ZTCC 1C5CL 1A7NL 5DMYA 2BDNH 4PJCB 1THCA 3NP4A 1NDMA 4L4VE 2P4AB 3V4VB 3AG2B 1NCBL 2Z1KA 1BDYA 3FS9A 2DZEA 3V5HA 1UG9A 4AEHL 2NCMA 4LSVH 4KXZH 4XRCA 4B9IA 1Q1JH 4QKTA 2BHFA 4WFHE 5ANMB 3WXVH 3KCWA 1RPQA 2X3BA 2CO1A 3BIKA 3O3BA 2XN9D 4FYSA 1SMOA 4U1KA 4XBMA 4Y1SA 5DGRA 5E4IA 4EOWH 3U6RB 1IC4H 3ZTJH 2CO6A 2J1ZA 3IGFA 3ZO0A 5I1LB 4JMNA 1YPZA 2LABA 2YR3A 1G94A 3ZW3A 4MAYA 4NQXB 1T3FB 3SDAC 1XH0A 1FNEB 1KLUA 1EHKB 4GP8B 4Q56A 5IW3A 1KLGB 2H3NB 2XVBA 3WS3A 2V3EA 4KQ3L 1F86A 2XJLA 2NX5B 4YE4H 3GMOA 1ZVSA 4M8RA 1V10A 3G6JE 2NX5D 3F7PC 5C0FA 1FNAA 4U4BA 1AGEA 3L7EA 3NVQA 1ADWA 2JIXD 2VE6B 5LAPA 3VMPA 4XCNA 1SJVA 4PJFB 3ECWA 4JN1H 4LU5H 3L9BA 4HIIB 2ZZUT 4JO2H 2EYTB 3L3OC 4AJ0A 2QHRH 5KVFL 2AW2A 1UC6A 4FQLH 4IGBC 3M17A 1CICC 3IMWA 3QZWB 4NO0A 4MQ7A 4U3SB 1JPGB 5M94B 3OJDA 1TZAA 4P3CL 2WMPA 4JQXA 4LQ1A 3HC3H 1Z5HA 1HHHB 4YVNA 1KIRB 2A4EA 2DBLH 2AEOA 4S1QH 1R1CA 4LPVA 4CBPA 4G1MB 3CXFA 4M3JA 3HBGA 2V7NA 3WTWA 2PTUA 4J1UB 5D7LE 4FA6A 1OPGL 1EAQA 4WI2A 4WO4D 4X7TB 5GISL 3T0AA 3QYMA 1UXSA 5BJTA 1HIMH 1KLFA 4PJ7A 4H8UA 4XCYA 1KJVA 4LCCB 2WXMA 3MNVA 3DURB 4BIKA 4M1CD 1S3KH 4MA8H 4S0TD 4PW9A 1FZMA 4OD1L 3GJFA 2KPWA 3KW8A 3TBWB 4OZFH 3MLZH 5CF3A 4ZX4A 5T3ZL 5IJBC 4QHUA 5DMKB 1F00I 3O0RH 4JFDD 4AYSA 5AFAA 2VDNL 3TBTB 2LE9A 4Y1AD 2QKIA 1OSZB 2PWGA 2VMFA 3S4SB 4NNPL 3LD8B 4XMVA 1XTLA 1TJIH 3DOIA 1NFDE 2VC2H 3NIDB 3CFUA 2RJMA 2VXTH 2OR7A 1CGYA 1ZHLA 4MMZC 4Z7VF 4JRYA 4WGKA 3QUZC 1KPVA 2D3LA 2YARA 3DNKA 2VDLH 3G9AB 1E9OB 3BUPA 3EOBB 4QCIA 2DH2A 4JX0A 2EDHA 1Q9KB 4UM9B 4LEEA 4JJOA 1DVZA 1UWEH 1K4DA 2XQBH 4MDJA 1JWSB 3X1NA 2OYKA 3DPBB 5AAWA 1EHLL 3QPXL 1DSFH 3P0GB 3AS1A 3F83A 3FT0A 2P80A 1BYPA 3VXUD 3C60C 4RZCA 1OAUH 4J3TA 2DIJA 3VXMA 2CCWA 2XFXA 4G1MA 4Z3JA 1L6PA 4LOFA 1TJGL 2OP4L 2UY7B 4Q8BA 3KCPA 3R8BB 5DUPL 1EBAA 1OK8A 4FDWA 3SQOL 4ZFFA 1W91A 2JJSC 2M1KA 3MLSL 1EK3A 4R5VA 1W8NA 5SWZB 1YAIA 4K8RD 4WGWB 1QPPA 1HH6B 5CS7A 5GGTH 3H3BC 1CE1L 3GSUB 5KJRH 5CJQH 1O75A 4P2RD 5GGRY 5HHVL 2OZ4L 5C0JB 4HUUA 2FJFB 5IHZA 4A2DA 3LKNA 2B3RA 2CJUH 4MVBC 3SE4C 1T4WA 3GMPB 4QWWD 4HJEA 3IJ8A 5JQIB 1DQDL 5A2LH 3MI6A 4JQVC 5E9DA 1AY1H 4BFNA 4C47A 4GP5B 12E8L 1JTOA 3HZYB 1OB1B 1KIQB 1NINA 2A9NH 2A83A 5DJDB 4NNYB 4ZTOL 1M71A 3ARGD 2X4QA 1OP3H 4XO3A 2EDNA 4JZJA 1YVLA 2E27H 4LMQI 4JO4L 3LXCA 3ZU8A 1SBSH 3X14B 2ARWA 1BYOA 3HPLB 1JDDA 4S2SA 5I75C 1ZE3C 2UZYB 5L2KA 2W0KA 2DJUA 4DWHA 2VR4A 5AB0A 4BE5A 1O9ZA 4WTQA 3NJJA 1T80A 3QG7L 5DVNA 3KDMB 4S1RH 3FB8A 3H7BA 1F4WL 1KIUB 1HINH 4KY2A 4JDEA 4PS7A 1P1VA 1U2YA 1P2CB 5FM8A 4PIRF 3S2CA 3JWDH 3C87A 1H3PH 3DETD 2CNYA 3EH3B 5J1AA 5D4JA 1QYGH 2G4GA 4KWUA 1AY1L 2JCCF 3DVNB 4L0PB 5A2FA 3PQYA 3EDFA 2NDFA 3LIZH 4L9DA 4WW2C 1FNGB 3DIDA 4ONGH 3WTXA 2RQ8A 1J1OH 1N6QH 3PWPE 4KK9C 2Z65C 2ID5A 2VDQH 3TO4B 4AM0A 4TNFA 5I19L 1ZLWK 4JNXA 4EI5D 3MLTB 5F44A 4PLNC 4FQQB 5KAQG 4JRYE 5FGBC 5IOKA 1U8OB 1G9NH 4KO6A 3T3PF 2E6QA 1H8OA 3LMJL 2GC4C 5SWQA 4LHJB 2ADJB 3IMSA 4G7VH 1HEZB 5GRJL 3TN0D 2Z93B 3BOVA 3DOSB 3ISYA 2ZPKL 4QMEA 3C6LA 3L3OB 3EO9H 4MFHA 5JW3H 3TYFA 2PTTA 4FG0A 1U8HB 3QDJD 1YMHB 2JQMA 4FTVD 1QX1A 4RMWA 1TYRA 4ELKB 4CC4C 2R56H 4QTHB 2V7NB 4HZLA 5IBTH 2BZDA 4L4VA 1AD9A 3O2WL 3TFKD 3TA3D 3Q8FA 5DJYB 5G4MA 2W5PA 1A25A 1AR1D 3HNVL 4NPKA 5I16A 4RMBA 2CQVA 1RUML 3AREA 3FCSA 4Z7UE 4ABVA 4BXVA 2Y5TA 3VRLF 1O7DE 3NACH 3G08A 1AR1B 4JFXA 1RZKL 4MQ7B 4KKAD 1QWNA 4LNVA 3AB0C 3NEEA 3OKYA 4YE0A 3O8XC 4M43L 5C6TL 3OF6D 2QZQA 4WFGE 3WFDL 4UMSA 4X42A 2P5WB 2R69A 2YLHA 1AGCA 3MJ7B 4XPAH 3ZE1E 5IB2B 3CDCA 3ZKND 1B3JA 3T09A 1VFMA 4JDZB 4M1CC 3RAJH 4XN1A 3D0AA 1QKZH 3QUMB 4PU2A 5I1EL 1MRCH 1B3IA 1S7SB 1SYVB 3SPGA 1O7DC 5D6DA 2Z31A 1TLMA 3LX9A 1CCZA 4AQEA 1ZHNB 2A9NL 3Q48A 3W11C 4UUJB 3LV3A 3OKDB 5SWSA 1M7DA 1XR9B 1JWSA 2DWYA 4KZ0A 4JCMA 3QA3B 3OQRA 3MUHL 3B9DA 4Z0XB 3MR9A 2VLRE 3RNKA 3FU7B 4KAQL 3BJLA 4NNXB 4Z7UB 3SE8H 2NY1D 3K6OA 2CGZA 1OAXH 1MFDL 1S3KL 1SJEA 4FOMA 4OVUA 4Y4HA 5I6NA 5HHNA 3P9MB 1EJFA 1ZCRA 4LSDA 2E4FA 2NY1B 4IRSC 4OH2A 1PAZA 4P49A 1Q0XL 1T7VA 4FNLL 5CN2A 3VAEA 1CXIA 4M02A 1G9MC 4PV8A 1I1YA 3WGVB 3TWCH 1BVZA 2WNWA 2X4NB 2P49B 2ZAIA 4Q9RL 4KH2A 1G7IB 2ENPA 4JKPL 1ITBB 2XI9A 2CK0L 2B59A 1KYUA 1NBCA 3GBLA 3DX6A 3FRPG 5HHMD 5BVPL 1V27A 4WFGD 5B3NA 5I16B 3ZDYF 2ITDB 2YN5A 1WEJH 3N55A 2GTZB 4N8PA 3FF7A 4N5EC 4NKOA 3QQ3B 4JHVA 3N1FC 4PJGF 4X6CA 3N40F 1A1OB 1P4LB 4WWKB 4JBSA 3QEUA 3MV7E 1DSWA 3PAZA 3QCUL 4DP4X 2F1AA 5BQDA 4FHJA 4EBQH 1UWEL 4ZAKC 1BVLA 4UINL 3L9EA 5L7XH 3N42B 2ICEC 2X4QB 1TITA 1PQZA 3S3BB 4TOYL 4M8UA 3M8OL 1SMAA 2IJ0C 4RAVB 3RZCB 1WV7T 3DARA 1A1NA 5IFHL 2H0FA 4GPVA 2AJ3A 3M86A 2NUPA 1J8HD 4HSCX 4LLUA 3V5KA 4NBYB 3CDZB 3MBED 5T1LA 2N7SA 2O1AA 4N2EA 4QHNB 4X8JB 1XF2B 1MREL 1PJ9A 4FQ1H 2KQMA 4FQQA 4HUUB 4HWBA 2XX0A 1TETH 2GY5A 1R5VB 4JCLA 1EUUA 1U30A 4E42A 3UTQB 1FFTB 1XCQA 2C1PB 3M6DA 4TLSA 1W8OA 1U2HA 2WNXA 3ZDXB 2QEJA 2Z31C 4YHIB 3A67L 4B6ZA 3C5ZB 1KCSH 1Y6MR 3K2UH 3EYQC 4WUUB 3H9SA 3B7UX 4DVBA 4L3CB 4EOWL 1AGEB 3L7EB 2AP2A 2QKSA 3RVUD 4MWFB 4U6YA 1A4CA 4LKXA 1WZLA 2L7UA 3C5SB 1OZTG 4NZRL 3RBGA 1ZAGA 1RZKH 3CU1A 5BV7L 4WVRA 2FJSA 1TR7A 2AAVA 4L8CB 5DFTA 1EO7A 1U6AH 4PP2A 2VZ3A 2A1WH 3WNIA 3WFBH 2FGZA 3GXTA 1T0NB 3ILPA 5IFHH 4MDJB 5PAZA 3EXLA 3AWEA 1NUNB 1F56A 2IV8A 3CLFH 2GABA 5GIRA 5C7ZA 1HQ4A 1UM4H 4GS7C 4J27A 3FRUB 4YK4C 1UA7A 2EKJA 4E41D 3GMNB 2DTML 1A6WH 4GRWE 4OFYD 1IQDB 3CVBA 2YO3A 3PGDB 4L5FH 5M7QA 4PR5B 4JN1L 3BCFA 4K3GA 2GSIB 2G5BA 1BWMA 1OSZA 3F65A 1NOLA 3PL6C 3K6FA 4ELMA 4K7PX 2UXTA 4Z7NF 1AO7D 4FQLL 5FGCB 2VDOL 4EF3A 4NQCE 2YAEA 4LLUB 4TQIA 3DX9B 1KC5L 1M7UA 4GMSL 4HPOH 1T89A 5BXFA 4LLDA 4X80H 5DJYA 1DQKA 4G43B 3FULA 1PY0A 4Z5RA 4YIQA 2DWDA 1RUAL 3Q5OA 4TTGA 2EYRB 3H3PH 1O9VA 1W2KT 3Q44A 4A7TA 2FX9H 5DRWB 4TLTA 1A1OA 4HPHA 5KVGH 3K6NA 3NJGA 2K70A 3FC8A 4G3YL 1NCUA 2A9DA 1NAMA 3RY6A 2IDQA 4MNGB 2MOGA 1NAMB 3F7YA 4U6TA 4ODBD 3UFIA 1RP9A 4A2GA 3QHTC 3CK0H 4GUPA 5DRZB 1X5IA 1E42A 2F15A 3QR2A 3EHBD 4OZIB 2NXZD 3FFCB 5FOBA 3E8VA 2JKRM 2NXZB 2WAHA 3EH2A 1F45A 3Q1SH 1Q9WB 1FLRL 1IKNA 3QO0A 2DQHL 5EORH 1O6SB 1TJIL 4QT5B 5EU7E 1PSKH 3DO4A 3NH7H 3FONA 3RUGF 3IXTA 4QRTA 3O9WC 1JNLL 3HZMB 4G8GB 1H15B 4Z9KB 2N3JA 4LL1A 1MH5A 3D12B 3I02A 2GSIA 3O4LD 4K5NA 4DPAX 1PG7W 3ZHDA 1LGVA 1JV5B 2CLRA 2NY6D 5ESQA 5KSBA 3MRRA 4U2YA 4CAGA 3B5HA 3OR7A 3L8QA 1UD2A 1KEMH 4FADA 4WFFD 1BFTA 5F7NC 5CMAB 4GG6F 5GGUB 2QPUA 5ILTL 2PYFB 4WKZA 3I6GB 2P7TB 4LSTL 3BGAA 1CL7L 3M46A 4KQ0A 4RLDA 3IMVA 2V9UA 1T0NA 1QVOB 1NSNL 4LRNL 1BM7A 2AXJA 1TJGH 2OV0A 3Q01A 3ZE2E 3L5XL 3IFOB 1B0IA 3HUJA 1FVCA 1UHVA 2KMWA 2X6AA 3DHMA 3JSSA 5E6SB 5EORL 1CXEA 1HAWA 4O2EA 1M71B 3S8FB 3UG4A 3FUFA 3L3GB 3NCWA 2BNQD 5TK2A 4XWGH 4YOKA 3ARXA 4P8QA 4HOXA 5DD5L 5F7EH 1M7IB 4XXDB 4CVUA 3L4ZA 2Q8AH 1QQDB 4GRLC 4Z7NE 2JELL 4OUUA 1XF5A 4LLMA 1J0JA 3D50A 2NW3B 2WTRA 3AM8A 1G87A 1T0PB 3EOAA 4I1NB 1HH6A 3S35X 3L16A 3O3EA 1OP5K 1I31A 5CU9A 4RWYL 3KS0J 4AEHH 5CILL 1DBBH 4N22A 3EGXB 5JIKA 1OGAA 3ZTNL 3ARBA 3F3HA 2BVQA 1MQKH 2BFGA 3GSWA 3O4OB 4QPEA 4A63A 3NA9H 4MDRA 4I3RL 1CS6A 4XX1G 2LTQC 3IVKA 1ZVSB 2VDNH 5JA8B 3TA4D 4F9PA 3RB5A 4F1SA 2BIOA 3GJEB 4I0PC 3PWVB 3ZKMC 5CIPA 3MFFB 4KRPD 1E9PB 4F27A 5EULV 5FAAA 1XR8A 3PXHA 1WFUA 4NSKA 4OKVA 5ESVB 4BH8A 1UCBH 1MCWM 3RTLA 1I8LC 4ZFGH 3C5ZC 3RIFK 1JGUH 2GSGB 3N04A 2V9RA 5AVQB 3ZYIA 3HR5A 4DGVL 2Z31D 2QDVA 2UUDH 4DZ8A 2K8QA 3RX9A 1LP9E 4QRRD 2DQCL 1TF4A 1T7WA 4OT1H 3BKYH 2HJKB 4ZW3A 1AVAA 1CDCA 3TPKA 1UXMA 1HKLH 5F9WB 1OP4A 4NQQA 4RFOL 4F91B 5DWPA 4ADIA 5A2CA 2AK4E 3J2PA 1PEWA 5BOJA 2R7EB 1QHPA 2HTLC 3HNSH 3IETA 1O7VA 5F3BB 3EJYD 4KZCA 4OQTH 3E3QE 1UGNA 1BZ7A 4KKLC 2DQIL 4LCCA 2OMUB 4PRHB 2OXGA 5IIEA 4UUJA 2D4DA 3IPBA 4KBPA 5EO0A 1FVEB 3HE6A 3MYJA 4KC3B 1V3KA 3ATDA 4IIQA 5DEGB 5CEXA 5IB5A 4PJGE 1NBYB 3O3DB 1OGSA 2ITCB 2ZOKA 3HC4L 3PWPA 4BFFA 3GLAA 1A0QH 2F54E 1QLFA 2XVLA 1TSHA 3BE1H 3FSWA 4BCXA 5INDB 4HEPG 1M1XB 4TTDD 3ARYA 5GZNA 3WY4A 2H8PA 3K6SB 3H54A 2C5DC 1I1FB 3HNVH 4PGCB 4WU7B 3GTNA 4XBGA 4L3EE 5C0BE 2DMHA 2R39A 4CMHC 3KLDA 5EIIA 1FV1B 3GSRA 1FAIL 1FV1A 3T77B 2K6WA 1ZT4B 4JZNA 3TTYA 5EZOH 4X8JA 1XF2A 1J9CT 5B3JF 4NNPH 4E9YA 2WZAA 3V2AR 2OI9B 5KZCD 3AREB 3FCSB 3OJ2C 4NO2A 1XTMA 3PE9A 3V6OE 3VD9A 5DD0H 1OM3L 1CB4A 4QHLB 1CLOL 4N8CL 3DTUB 2W92A 1UD5A 1JZ7A 1YEDB 4LARH 3ATFA 4KRNA 2AEIT 2QV4A 1F58H 5CZRA 1B0GA 1EJ8A 4Y5YB 1B2WL 1N8ZA 1SN0A 3A5VA 3IDIB 3IN2A 1JXDA 5IQLA 4G6JH 3VB9A 4GB9A 3NJHA 5CN3A 2OPCA 2A4CA 4R97B 2EVHA 1EAJA 4N26A 1EGJH 2VDRB 1LILA 4ZNCD 1RZPA 1SOSA 4P2QD 5HGGS 4X83A 1P7HL 4PRAA 4Y5VB 3K71A 3TBBA 3O9WD 1NKOA 1U8OA 5JQHC 3MJGX 1FFNB 2NLJA 5EV7A 4F37K 4HX1B 3W2DL 2IFFH 2BVUA 4Z7NB 4OZIE 3BFOA 3S4SG 5AYTA 3CSYB 2BM3A 4FJ6A 4EZJA 3VGFA 1QSFD 1TKWA 2VXUH 3RA7H 2X89A 4DKEL 5EH1A 1RMFH 1G9MH 2FL5B 4NAJA 4TS6A 3SD2A 2DQHH 4A38A 3WFHB 1QFUH 1F4YH 1O6TA 3S48A 1TCRA 2D7QA 3EW3B 3CPLB 5D7HA 5AAWC 3SQBB 5J8OA 4OKVB 3CZFA 4BH8B 4NM8H 4PJIE 5D1XA 2HFGH 1E4WH 1OCZB 4CA4A 1WD8A 5DSCA 2P8MA 4PJ5E 4R7DB 1BMWA 2OJEB 2AKRB 5HYSG 5J1SC 2OMYA 1PBYA 4JFED 1SHXA 2QSCL 4ZMVA 4PY8I 1PZAA 3P9WB 1XF4B 4F7CB 3HN8A 1S6NA 2WXLA 1ZGLB 4ZMAT 4M43H 4AVIA 1MXGA 3SY0A 1KJ3H 5T8IA 4Q2ZA 1F4WH 1PZDA 1F13A 3BQUB 1VF5C 1JYVA 1DE4A 4BZ2L 2WQXA 1LE9B 5FHBH 5HY9A 2Y69B 3P0VL 4MMXB 1BBDL 2IPUG 3KLAA 1J1PL 1KC5H 4XN4A 1TTUA 3MOAL 5DLMH 2P5ED 4M29A 5I1JL 5E2WH 4OCYL 4WZ9A 2DQ6A 1WUZA 1NCNA 2PUQT 3B1UA 3FB5B 4HS6B 2HCZX 3BP6B 2Q8AL 5J1TC 3WV0A 1AE6L 3FB6B 3OKOA 5IB5B 2CU9A 5CEXB 2ROXA 2IGFL 1RQ5A 4LSRH 1MHCA 1IJNA 2JQAA 2P1YA 1W0VA 2FEEI 4GO8A 1EXGA 3K4ZA 1XD1A 2M26A 4FULA 4OLXH 1P4IH 3GB7A 4DP9X 5ECJE 1ORQA 3WSQL 5E5RB 2IBGA 1ZHBB 2FJUB 4O2FA 1I1AA 3K1DA 4IGBD 1VGKA 2XUWA 4MZIA 1BJMA 1NPUA 1OTSD 2GK2A 1BJ1H 5F9WC 5ANMA 4IOIA 1J88A 5D1XB 1NIAA 1VADA 2LU4A 4YPGB 3H6AA 1SHWA 2ENSA 4PYGA 4HCIA 2HX7A 2SODB 4HJJH 4RMRA 1T21B 5F9AC 2COVD 3N9GL 2GG1A 5DFAA 1S7TA 3JT0A 1SXNA 4OFQA 3MRNA 5I15H 4YHPA 2CHXA 4K8RC 4YHPB 3KL3A 4TSCL 3TO2B 4XN8A 2WBJC 1FRGH 2WANA 1O5DT 4XP6L 5G5DB 2B9AA 5JOEA 5C9JA 3WJMB 1OSEA 2QKIB 2JF1A 1SGKA 4RRPA 2XICA 2BNQA 4HWBH 4N0FB 2FX7L 4HJ0C 3QFGA 1UWGH 4A39A 2XKNA 3MFFA 3SGDH 3D6GA 1E65A 1TO4A 3B2UC 5CJXC 1DDHB 1SLXA 2EO7A 2YD6A 1S7VA 2AV1A 3JTTA 4GAJL 3RVTC 3ZMRA 4DGWC 4EVNB 5KVDH 2N1KA 4NBZB 3CV5A 3SGEH 1CURA 1KTKE 1MRCL 1MFBL 2D7TH 1MJ8L 3QDGA 3HNSL 2J3SA 1G9ML 3FO9A 43CAA 1NAKH 1G7QB 2VM3A 5D7LB 1F4YL 1MHCB 4Y2LA 5AD0B 4NYLB 4EZMA 5JXEC 8FABA 4HWUA 5HI5D 3SODB 4BKTC 3U4BH 2B77A 4ZS6C 5JQ6H 4UANA 1JUFB 2PCXA 2AVFA 3VNYA 4KMTH 4ZUWB 2P8LB 3CSGA 2QVIA 1HHIB 5DHMC 3HVNA 2VXSH 2O6PA 2VQTA 2PXYB 3PUUA 1G7IA 3TBVA 1H5BB 1FZJB 1UCTA 4ELME 4WNSA 4XN5A 4ZO6A 2VLKD 4HJUA 3VTTA 5CBEB 5DJ0A 3T0EA 1EUTA 5HXMA 2V17L 3CCHB 3EYFB 4OVVA 2XU9A 4LP4A 4DVRH 4XP4H 3PXLA 1PU0A 4Y4HD 4ANUA 1SOQA 2Q7YB 1F41A 4JFSA 5ANHA 4R26H 2P28B 5IWLA 1NCCH 3MRBB 4YNYA 5FKAB 1A7OL 3VG9B 5FYKL 5ESQB 4JDVB 1SXCA 2BFVL 3E2HB 4KHXL 4JPQA 5BMFL 1J8RA 5DT1H 2J8UA 2GJ6A 4EXPX 1LEIB 3H2PA 3O6FB 2OBGA 4CBZA 1E8WA 5HBBA 2QQNL 3TOPA 4XNQA 3ZDYE 2HKHH 3RWIA 1QBAA 5LGJB 4PJAA 3CH1B 3HI1B 1PKQA 2GITA 4K4KA 4U1GB 2XPYA 1AACA 4GP4B 2C1PA 2ZKWA 3EBGA 4I2XA 4PBXA 5B21A 4XP1H 3O0RL 4I9WD 5CEZH 4XWOC 5DHVA 1V8HA 1NDMB 4UBDD 3CFCL 3V6ZB 1FFOA 4X5LA 2EXTA 2DWEB 3CPUA 4MJJA 4OJCA 2NY3C 4P2AA 1E8YA 2OMXB 1HL4A 4NRZA 2VDLB 4WNQA 3NJKA 2XTSA 1HZHL 1OVZA 2V3FA 3NCEB 3DX8A 4WTZG 4KO7A 4NPJA 2BC4A 3JV0A 2X6VA 3H0TA 4UNVA 1J0IA 2QGBA 5E6ZA 3VM7A 2JKTM 1QHOA 3HJEA 1PZ3A 5SV3A 4E9SA 3UTZA 2WHVA 3HHSB 3MYZA 3Q8CA 1LK3L 5D2LB 1XV8A 3PNWB 3ARFD 1WWBX 1D5MB 1XGYH 1NCTA 3DVGB 1KB5H 2Z4QA 3AW5A 4R96A 2Y25A 4U1IB 3D33A 3MV9B 4PTUB 4JW3A 4NQDD 1PG7H 1NA8A 1PD1A 3VWJA 1SF3A 1KGXA 3QG6B 3CFEA 4N0CC 3VFUA 1MJ8H 2W0FB 3D0LB 4LQFL 2CIIB 1VERA 1MCDA 2C9XA 3EJQA 3SQOH 4WW1B 4QRPB 2NOYA 4QRPE 1VGEH 5I1CH 1G4MA 2DM7A 1AH1A 3TONA 4U05A 1IEAA 2BP0A 2TRHA 1Y6KR 4QRPD 1K5WA 5FHBL 5EN2A 1V3JA 2KKQA 1BM3H 5AENA 3X12A 1T03L 2IQ9H 3ZHKA 1LD9A 4Z0BL 4RRPG 3KAAA 3NSJA 4HH9A 2WLYA 3MMEA 2XBTA 2DQTL 3QUKB 5ID1B 3PYCA 3G04B 4PJ9B 2BRRL 3D3VA 1ZKAA 1XVSA 3JQOB 1H3UA 1U91B 3KWXA 4NUJB 3T2NH 3BH9B 5C0CE 3V9EA 3S9DB 3QDMA 5E1AB 4U6YB 3BP4A 5HI4C 1NQBA 4DKDC 3PY9A 4C56E 3MGTA 4F1ZA 4GKZA 5L4FA 2JKLA 3V4VL 3NQIA 3GSVA 5I24A 3S37X 5CCKH 3WUWA 4EIZC 2D7NA 1JHLH 1TQUA 3ME0A 3O6LL 1L6XA 3T0EB 1YRKA 2JKXA 4CADA 1R5VA 4L3FA 2FWOB 1YNLH 4U1MA 3BXNA 4OB5L 2DICA 3CVDA 3IXTB 3MBEC 3FONB 4FFYL 5TDPB 2JXMB 3PWJB 1GHFH 1D9KC 1LO3L 4Z76B 4W4OC 1X9LA 3KHQA 1ES0A 3CN3A 1UWXH 15C8L 1NANH 1R9FA 5AZEL 4JUSA 2YRBA 3NAAH 3FTXA 1Q1JL 4H20H 3DHUA 3QJFA 1WFIA 3HZ3A 1J12A 2P48B 4G6AC 3FQ1A 2KI6A 3MV7B 5L88H 3DRQB 5IT2L 2YD8A 3PPSA 4DUXA 1OL0A 2NY1C 3NCXA 3VG0H 5KVEE 4RCAA 1T6BX 2NRDA 3V4VH 5DHYB 3B2MA 1KEML 4IRSA 1YNKH 1MFDH 2CKNA 3SDCB 1OAKH 2QJDA 3FTYA 1WBXA 4LHUB 3FTGB 4M6NL 3F7RA 2WXGA 1AMXA 5C7XH 5K9KB 4AT6A 3QUZD 1JGLH 4NO5A 3ZHLA 2ERJC 5GRJH 3P30L 4JFFB 5LN4A 4I88A 2EZ0C 1MFBH 4MNQB 1YN7B 1OOWA 1KFAL 1XF3B 1HEHC 2A6JA 3DX0A 3VXSA 4F5CE 2Y7SA 4GNKB 3ZLQC 1ET5A 4H1LB 4TMPA 5C1MB 4LLMB 4ADGA 1GPOH 1LK2B 3BQVA 3LHAA 4OCYH 1HILB 2P8PB 1TCMA 4ORGB 1ZWIB 2X44D 2R29H 3QFJA 2DYPB 4A2MA 1ZSDA 1L9PA 3KYOB 5LLIC 5GS1C 3MHZA 3BPCB 1MUJB 2VM9A 1PG7L 4MKTA 5HYFA 1FH2A 1WFMA 4QJ4B 5IROA 3WI9A 5EF0A 1FVCB 4JHWH 1A0QL 4N4YB 2AQ1A 4E5XB 2EE2A 4A68A 4YSPA 1CFVL 1MFVA 5LGKA 1PLCA 3ARUA 4F2ME 1EDHA 3BT2L 5DEFA 5I0YA 3IMRA 1ZA3A 4LPYA 2VO8A 4D2NA 1E5YA 5L2KB 1GGTA 2DLIA 4ODTH 2CG9X 1PX4A 4P46C 1IVTA 5MEND 2I60L 4OV5B 4ELMF 3AS2A 2A2QT 4AG4L 1SVBA 4FQXB 4NN6C 3KGRA 1NCJA 2YIHA 1KCVH 3K2UL 4JFXB 4M9PA 3RVUC 5CD3A 3HG1B 4QT5A 5ABDE 5C0AA 2YMXL 2WMPB 2X1QA 4ZS7L 1KV3A 4RIRB 1QW9A 4PJEE 1HN1A 2J72A 4TSBH 4NQUA 2HKHL 4MQTB 4S1DC 2UXGA 1S7QA 4YHYB 3WEBA 5E5MA 3CLFL 5F6HI 4A7UA 3OLGA 4I85A 2NUPB 4MA1B 4PCKA 4PJAF 5AW3B 3WDIA 1OAZH 1A4KA 1KTDB 2XZCL 3TEWA 3ARFC 3MKGA 3MLUH 2XN9B 2QSQA 3WIIH 2X4SA 4QRRA 2NY6C 3HCVB 2BJMH 2DD8H 1KN2L 4FFYA 3VXME 2Q8BL 3WFCH 3UTZB 3K6DA 5FV1L 1BCIA 4HPYH 5EO9A 2EDOA 3RYMA 2CKBA 3Q6GH 1F11A 3TH2T 4LSQH 1CGTA 4G80B 1WTLA 4PB9H 2VLMD 3ZR6A 3V0DA 5AVTB 3WU1A 4S0HA 2IAAC 5I8KH 3C8KB 3QULB 2R9HD 5EF2A 4DGUA 3TF7C 1CGUA 2CDGA 3QIBC 2OTWB 3UAJA 5EEVA 3NEOA 1MCWW 3ETBF 5L0QB 1XBRA 4MYWB 2DQEH 3TIEA 4IOFC 3ENEA 4JO3L 3W39A 4JO1H 4BK5C 2AK1H 1PKQE 4K8RH 1T4KA 1AGDB 3LIZA 2OK0L 4GRLB 5DU7A 3FRUA 1WAEA 1IGYB 2YD2A 2X12A 3EO1B 5GZND 3MV8A 1QR1A 1W0WB 3QJVB 5L6YH 4UB0L 3M7OA 2H2PC 4MJID 3VXRB 4HG4J 1ERNA 2JIXA 4KKZA 2MNWA 1CTOA 1V54B 3VGHA 4K5OA 4J3OD 2EP6A 1DEEB 2JKIS 3QWRA 1B2WH 4PD4J 1JZ6A 3MOAH 3QI9A 4LOVA 4B9YA 2J1WA 1TQBB 4ZX6A 5C8JA 3F04A 1H0DB 5C0IB 1A4BA 4P2CG 5D7JB 3EGXA 2OLDA 4KO5A 1U8MB 3NSXA 1JZ8A 3UL4A 3B8YA 4KMTL 4CVWA 2XYCA 2ICWB 3CVHL 4E36A 5HD8C 5I28A 2EXSA 4OFIA 1A1MB 3SBPA 3VB8A 3LIUA 4GKNA 3VDAA 2VL5B 2PP7A 1JHLL 3ZE0B 5JO5B 2E6JA 2ARJB 4EN3B 3EJSA 4KXBA 2BIMA 2AABL 4XVJH 5DZLA 1HL9A 3L6FA 5IWLC 1OZUA 3OAZH 1SXSA 4FLOA 3C60B 1SY6H 4X6BB 1NJ9A 5AW9B 5HI3D 5DRXB 4O58H 4YX2H 3DROA 3PAUA 3QXUA 5CLTA 5HDQH 3VXUE 4B97A 1MFCH 2YUZA 1ID5I 2GEQA 3H42L 4R8WL 3IJHB 1EEZB 2ZXDA 1JPSH 5C3TA 5IQ9B 4R90L 1WT5A 2A9MH 4F2MB 1W0WA 1HEZA 3B7RL 3T9WA 5JHLH 4YFDB 2E7CA 4M03A 5GZOC 1MAML 3MUJA 4JPWL 4PRID 4AVHA 1WZKA 2QVTA 1NFDF 4Z77A 3MRRB 3C5JA 3BWAB 1AQKL 1MXDA 3RP1A 4RWYH 1R6VA 2QQKL 4XRCB 1H19A 4O00A 3V7AG 5AZ2H 5KANG 1CGSL 1J7VR 2VRQA 4WHYH 2DKSA 1AJ7H 5AG9A 1GOFA 4AIOA 5TE6H 5I6PA 4OZHA 1MIMH 2WO4A 3LNEA 4HXBH 2EIZA 3T8MA 3QJXA 5IJVA 2X4RA 2W65A 5BUPA 3WENA 4I0PD 1FL6A 3KPRA 4LAJH 5C08B 3SKOA 4RQQA 5EZJA 1CTNA 3KBEA 1DANT 2YXFA 4Y4FD 2CBOA 1JPSL 4G80A 4UZSA 2EC8A 4WJ5A 1CD0A 3JUZA 2A9ML 4Q52A 4X9HA 5CIPB 1ZTXE 4OZHE 1F4AA 1MCFA 4X2UA 3HE7A 1T7YA 4ONFL 4LSRL 4GUPB 5DRZA 4O2FB 5E8NA 4Y16A 4JRLA 3MNZA 2D31B 4GRWH 4TUKL 1CIDA 2OULB 5F96H 5GHWL 5GRWA 2YJLA 1JPTH 3DSFH 2ZX8A 4XGZB 4UOJA 1QHQA 4ZMXA 4KHTL 2JI3A 2ZX6A 1GGYA 2YKLH 5J11C 4EUPA 4Q4EA 3TV3H 5FW8A 2WVVA 4NO0B 4LPTA 5J9PB 2OMZB 3GI9H 4BFEA 1FSKC 1FGNL 2WVSA 1P7QD 1KG0B 5FDYA 4YEEA 1ZHKB 4LPCA 4NKDB 5HGBB 2FQFA 5I1KL 2F7QA 2I7SA 4AEIH 3PP3K 2WYHA 3E6FA 4DTGL 3E6FB 4MBOA 1M7IA 4U3CA 4XAWH 4WWNA 5INCA 3BUQA 1Q9LB 2DQIH 5EEWA 3G6JF 2CHDA 4G59C 1KPRB 2DEYX 4NHCL 1II4E 1BM3L 4NBXB 1KBGL 2BNRE 1QUNA 2G2RA 1DDTA 5H35A 5CINH 3AT0A 4PMEA 5BMFH 3BH8B 1UZ6E 2L7EA 3CC1A 2IEPA 4ZUVB 4HIHA 5GHWH 4FL4C 5AKVA 1JV2A 2YD5A 1T04A 2YGPA 4XBPA 5DHVH 2X4UB 5FA4B 1H0DA 4EXKA 5TE7L 2VNCA 2VH5H 1X5AA 1NDGB 5KYUB 3OZKA 4DH2A 1J05A 5DHDA 2XJKA 5HYJA 5H94B 4F7PA 2GQHA 4G9FE 1MOEA 4RZCB 3ARTA 1GKEA 3NIDF 1CD1B 4LVHB 4YO0B 1QFHA 3T04D 1WAAA 4IBLT 3SO3B 1TVBA 4FLHA 3L1OH 1C5BH 4WFHD 5AL8A 3JWNC 3CGTA 3IFLL 4LKXB 4P05A 2JI2A 5JHMA 3D0VB 3O45A 4Y8AA 5EU6D 4PJDF 3DETC 3MOBL 1Z0MA 5DD0L 1Q0YL 3SKNB 4UTAL 5HHVH 4L4VD 1EJOL 3RGBA 3H9HB 3MLXL 2YUXA 3SCMA 1A6VH 3L13A 3FL7A 2H2PD 1H9DA 3CDGB 1NMCC 2CCVA 4UOW0 4FFWD 1FFNA 2NLJB 3UTTA 3NIFF 1JGVH 1FP5A 4ETYA 4AMKL 2VR5A 3EHBC 3OR6B 2Z6FA 2GJRA 2VQ1B 3B2VL 4PJ6A 5FHAL 4JVWA 2GFBA 3MV9A 1HI6B 4PTUA 2MKLC