2YRBA

Solution structure of the first c2 domain from human kiaa1005 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
156
structure length
156
Chain Sequence
GSSGSSGDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first C2 domain from human KIAA1005 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Protein fantom
total genus 13
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yrbA01
1DJXA 1TJMA 3ZW3A 4DNLA 5CCJA 2N1TE 1YRKA 1UOVA 1BYNA 4Y1TA 1E7VA 4KITB 3HHMA 4L1LA 1RH8A 5H4YA 3FDWA 4LCVA 4L1BA 3F00A 3L4CA 4XE0A 4ICXA 3GPEA 3NSJA 3KWTA 3OHMB 4J6IA 2NSQA 4PS8A 3P2BA 4F92B 2WXNA 4ANXA 1QATA 2WXGA 2WXHA 1UOWA 2D8KA 2ENJA 2QZ5A 4LDCA 4EZLA 4QJ3B 1E8XA 3ML9A 3TJPA 3TL5A 2A5UA 2WXPA 3PREA 2YOAA 4BFRA 2Q3XA 4LT7A 2CM6A 2NQ3A 3L9BA 4HLEA 2ENPA 4ANUA 2X38A 1DJGA 1E7UA 4EZKA 2R83A 4F91B 4JPSA 2B3RA 2CJSA 2K4AA 3QAQA 1K5WA 2WXQA 5G2NA 4F1SA 1V27A 4NS0A 4QAMB 3APFA 4Y1SA 2FK9A 2EP6A 2CM5A 3N5AA 4DK5A 4WWNA 3L13A 4TS6A 3PFQA 4FHKA 1GMIA 3KWUA 4L2YA 3HN8A 1BCIA 2DMGA 3CSTA 4IHBA 4ICWA 3SD5A 4ANVA 1WFJA 1DJYA 1TJXA 2V4LA 3APCA 2UZPA 2RD0A 4QJ4B 2CHZA 3IBEA 4AOFA 1E8ZA 3L16A 3S2AA 5H4ZA 2WXOA 3DPDA 3JZYA 2CHWA 4FA6A 3NZUA 3TWYA 1DJZA 2DMHA 2WXKA 3LJ3A 2NCEA 2WXRA 2WXMA 1BDYA 3PYCA 3R7RA 3W56A 4WWOA 4KZCA 3W57A 3QR1A 2QZQA 4XX5A 2WXJA 1DJIA 3R7QA 3APDA 2WXIA 4A55A 1A25A 2KI6A 4FJYA 4IQHA 2JQZA 4EZJA 1WFMA 3RPBA 4HVBA 3ZIMA 4GB9A 3DBSA 3L54A 5CCHE 4QJ5B 5JHAA 4F93B 1HE8A 3QK0A 5G55A 4URKA 4FADA 5EDSA 5JHBA 1DSYA 2K3HA 2WXFA 3F04A 3MJWA 4NP9A 4OVUA 4WAFA 3ZVVA 3IM1A 5KJ7E 4OVVA 2Y3AA 3NZSA 1RLWA 3OAWA 4WWPA 3L08A 1CJYA 2Q0ZX 4PS7A 4TV3A 4FULA 1UGKA 3HIZA 4MJJA 2ENQA 1QASA 4WEEA 2BWQA 5CCGE 2ISDA 3PRZA 2YRBA 2FJUB 2ZKMX 2K8MA 4GNKB 2CJTA 3B7YA 1DJWA 4ANWA 1W16A 3QR0A 5T8IA 1W15A 4PS3A 3ENEA 4AJWA 3F05A 2LHAA 4FLHA 1E8WA 4BGDA 2CHXA 2WXLA 2Z0UA 1DQVA 3PS6A 4L23A 4XZ4A 2A4ZA 4NPKA 3FBKA 1E8YA 3ML8A 3QARA 4NPJA 4TUUA 3F01A 1E90A 4V11A 4KZ0A 4FJZA 3CSFA 4FHJA 3RDJA 3L17A 2K45A 3T8MA 1RSYA 3QJZA 1DJHA 4G11A 2CHDA 3M7FB
chains in the Genus database with same CATH superfamily
3ZL4H 1KLUB 4E41A 4G9FE 2P5EE 2VDML 1YO4A 2CCWA 2CO7B 3BE1L 3EGDB 4GRWF 2ZSVB 4YSQA 4O5LL 2XN9E 1Q1JL 1B0GB 4AEHL 4AQOA 1U3HC 2DYRB 4AX3A 4P2OC 1VFAB 1RL1A 4Y2DA 3BKJL 2YRLA 4XNQB 1UG9A 3LOWA 2PYED 5JW5B 4G7VL 4ETQB 3RJQB 2P24A 3LV3B 4P2RE 1N5AA 5AW8B 5CEXB 5KJRL 3EH1A 1NAMA 3MV7E 2G4EA 3SO3C 2JKTM 4HJ0D 3MRHA 1T89C 1AMXA 3MRGA 5DJYA 4GG6E 2VRKA 1D6EA 4KV5E 5KYUB 3D1MC 5MI0B 1D5BB 1N0LB 5I1JL 4PJ7E 1V27A 3T65A 3RFZC 4FFWC 4HKZB 1CE1H 3MLZH 3P3RA 4FLSA 1F3JA 3WFBH 3FB5A 3A22A 4HH9B 4Y2DD 1BVKB 2ZONA 5A16B 5J1TC 3JV4B 5IIEA 4HK0B 4IJTA 2AK1H 1S2EA 4I0PB 4MNQA 3CPLB 4HISA 2VJXA 3D9AH 4X4ME 4LOUD 2W0KA 4EEEA 2QEJA 4PJFB 2I26N 4JBSA 4NO5B 4XMKL 2EIZB 3WEAA 1QPPA 4HIIA 5C86A 4LCCC 2ZPKH 4ELME 2WTRA 4H26B 1X3DA 1T20B 1AJ7L 3BZFA 3EBGA 2QVFB 3RKDD 3VGGA 1RJZB 4XVOA 1JPTH 3I9AA 3RTQB 1DCLA 5DVOA 3GHPA 3VXPB 4HBCL 1HSBB 3MJWA 3OLEA 4RGOL 5BO0D 5L7XL 5F9JA 3MODH 3FSZA 5F97E 5BS0D 1RPKA 3QE5A 5HI4D 4WEEA 1FNSL 5CEYB 3MBXL 4LLVA 3TEZA 4LIQE 1KPRA 3GF8A 4N22A 1BZ7A 3SJVD 1CYGA 3T3ME 2QHRL 4MNQD 4N87A 3HG1B 3CH1A 2WQXA 3QC6X 3DUUA 4J2QA 2LR4A 3KJ4C 3JYCA 5INCA 5BMFL 1EDQA 4MYWB 4OZ4A 3VFTA 4PRPB 3KR3L 4G1MB 2VMCA 1YQVH 3CLFH 3ZRSA 3S5ZA 3KBFA 2X2IA 5DS1A 5A2LH 3SE9L 3ETSA 1GYVA 2OP4L 2I07A 3WEXB 4DCQA 4LE8A 1ORQA 5BZDB 5D71L 3U48A 1PZ5A 1CIDA 1KTRL 2V5MA 1PCXA 3BCDA 2NY2D 3NIFF 5AKTA 4IGBD 1SN2A 3G6JB 3GSRA 3VXOA 4JM2A 2WO3B 3CJJA 1PBYA 4JN1L 1PZ5B 3DUSA 1W72H 5TE4L 1ORQB 1O6SB 2DQGH 5CBEA 1HCVA 3GTTA 3MJ7B 1CDCA 3QUMB 5I8CA 3OMNB 3DYPA 1D2PA 1U8NA 2W8CA 4G8FA 1H3WM 5DK0B 2X9YA 3BP6B 1TITA 1X4ZA 1HXMA 2FWOB 1AS8A 1CICB 2APSA 3KPMA 2QKSA 5I0ZA 3D7PA 4P3CH 3VFTB 2HTLD 3GI8L 3LZRA 4FFWD 1HOCA 3LD8B 3A4DA 4UDUB 3CH1B 4Y1AE 2WWOA 4KKCC 5CZVL 4RAUB 2WWMD 2J6WA 3RZCC 3U0TB 4FHBD 1KELH 2LU4A 4NZFA 3QI9B 2B4CH 3B3IB 3VB9A 5D4QA 4MMXB 3I9PA 1AQMA 1X5LA 4NYLB 5T3ZL 1FYTE 5I1LB 3TN0D 4AGQA 3CH8A 1TTUA 3S34H 3BUDA 3UTSD 4XODA 4MD0A 2Z31D 1LLAA 1UTDA 3D39A 3QRGH 4P2YA 3KCPA 5D7LE 1CE6B 2HT2C 3RVWD 5KSBF 4XX5A 2ZXBA 2EIZA 2WXJA 2WYZA 5I5JA 3SKUD 1YEDB 4HPYL 4MWFA 1QFWL 3MV7D 5CGMA 1ZCRA 3LHPL 3NCXA 1UH4A 3P69A 4WWKD 1XIWC 3TT1H 4OJAA 3ZIMA 3CPLA 5FLVA 4YHYC 4LOVA 2H26B 2ZCLL 5F7YC 5ID1B 7PCYA 1NGYA 1I82A 4HK3J 1JZEA 4IOSA 3D52A 3L1EA 4PI0A 1LO0L 3ZTEA 2BP8A 4HH9A 2GQHA 1MFDL 4U1JB 2R69A 4L8SB 4KNTA 5DEGB 5E94A 3WDHA 3MN8A 4APXA 3TP4A 3K81A 1KDIA 5E9DA 3AB0C 5FM5M 5C0CD 3T65B 1KN4L 1CBVH 4WWID 3QR0A 1F0LA 2XZAH 5KYUA 1L9MA 4LVNC 1BQHA 1U8KA 5D6DC 3DIDA 5CXPA 5F7FA 4JQVC 1D6EB 4PVLA 2Z0UA 3MRGB 5DJYB 3LRSA 4QGTA 1JBJA 2V9TA 3ZTNH 1R5WA 2BS9A 2KH2B 3MRFB 3A67H 4HHAA 1J1XL 1IFHL 1GYWA 4AQEB 2MTAA 5A2FA 4FZEL 3HMXH 4XNQA 3MBEB 5IMOB 2EYRA 1VFAA 1IM3D 1YRKA 4ZPTA 3ALXA 3EBIA 2NUTA 4KTDL 4OM0H 5E6SB 3PWNB 1R3KB 4FEIA 1KXVA 3WJLA 3ETBJ 5BS0E 2WBWB 3QYMA 1YECL 2Z3FA 3QA3B 2CJ3A 3EO9L 3I75A 1XF4B 2I60H 2CU9A 1SYVB 2NXZB 4M7LT 3ZT6A 4X4MA 2WJ5A 1P7QA 2NUPA 4NZRL 2P8PB 4MNQE 1KFAH 2BNRE 4JO1H 4JCWA 3V95A 1NBVL 1RQ5A 3CFEB 2ZSWA 1FCGA 2PW1B 4GKOA 4UNUA 5BJTB 4KTEH 3T0EA 3RB7A 4ZUSB 2XWTB 3AG2B 1YEEL 4S0SD 4NWUH 5GS0C 3B2UC 1TZIA 4JZJC 1SJMA 1JJUA 1NCDL 3N43B 3BVNA 4P9HH 4A38A 4O51B 1YJDH 3IXAB 1NIDA 1CC3A 3EZJB 2X6MA 4L29A 4AQ8C 1LP9E 1HZKA 3QZPA 5GSRB 5KSAD 3LNEA 3SZ6A 4ZO7A 3UG3A 1RJYB 3AXLA 2D3LA 3S34L 2GBUA 3TT3H 5DTFA 2ZXAA 3OKDA 3TH4T 3HUJF 4CADA 4RWYH 2BIIA 2FO1A 5BV7C 5AENA 2ENYA 2BIPA 2OAAA 1WEJL 1SLWA 1JF6A 2HTLC 5DD3L 3QR2A 1Q9LB 4S1DC 4E9SA 5A3ID 3MNMA 4P2RA 2WXMA 4UT6H 1UYWL 3MV9E 4CL7A 5F71A 1PEZA 2NX5D 3V0DA 5B8CA 2W81C 3DECA 3EH4B 1DDHA 2J57A 3ARFC 4K5NA 4UV7H 2IV9A 4Y7MA 2B1OA 1G9NL 2P80D 2G2RB 1A22B 2FVNA 4CW1B 1XH3B 1IAIL 1DFXA 3C09C 3DMMC 4G83A 4JHWL 4FFVC 1CGWA 3HG2A 4Y5VC 3GIZL 2BSEA 4NUPA 5I18L 4IOFC 1QYGL 1AP2B 1XBDA 4O58H 4Q6IB 4KI1A 4YUEL 4F58L 1XIWA 2NW2B 2RFXB 1FYTD 5CGYD 1IVLA 2DM7A 2E4FA 2X3CA 4MVBD 4PJBE 5D7LB 4JFPB 4E9VA 2DI9A 2P1YA 3VSQA 4DT2A 3KL3A 3UTSE 1XMWA 4POZD 3LEVH 3GXUB 4HUXB 1K8IA 3VD4A 2OMZA 1WBZB 2ZCKL 3VA6A 2OJZH 1AZZC 3QRLA 2KLRA 3CZEA 4ZO6A 4OB5L 2VJ0A 1T1YB 1BWMA 3QORC 2IWFA 4ZAKD 4HJGB 3JV6B 5AAMC 1QUNA 3HUJE 4JJ5A 2B1HH 1HKLL 3PQYD 4MJ5A 3CFCH 1OAQL 3FUEA 4J12A 1KEGH 3DJRA 2G75A 2XTJC 3WNOA 4EO5A 1N59A 1A6UL 4Q8BA 1N6QL 2I85A 4MDIA 3POCA 2PPFA 5C07B 4CMMB 2NNCA 3ELAT 5EEZA 2CXGA 2QFRA 2WB1A 1SJVA 5EC2A 1IC4L 4IRZL 4KNQA 4RGMB 2X6BA 3VFVA 2BX5A 3O8XB 1AZRA 3MA9L 5E2UL 4F58H 4OGXL 3UEQA 4LRNL 1W0YT 3FSAA 2JIXD 1KXVC 1IGJB 1MQKH 1HJBC 2FGWL 2PTTA 1XF1A 1P1ZB 3E8UH 4Z7WA 4J5VA 2V8LA 4PJDF 3L4TA 1MCRA 3L13A 5I8KH 3C2AH 15C8H 4XMPL 4Q4IA 4GQZA 2KUTA 1K3ZA 2F58H 4P3WA 2EKSA 4ZFGL 5KYYB 5DRZA 4U7KA 5I0YA 1R34A 4OB5H 3BZ5A 4EAEA 1JV2A 1BWWA 1EHAA 5FWRA 3GDBA 5H4ZA 3RQ3A 2ZOOA 4IOIA 2Q8BL 5AVUB 2VAJA 5EO1A 2G60L 1CGSH 3PABB 3R7RA 1URZA 1B4LA 1IL1B 3K1DA 2Y7QB 4PB0H 3GSXA 5CWSA 5E99H 5F3FA 3QZOA 3AU1B 3C60B 2XQ0A 1C08A 1G7LA 2DIBA 2IVFC 5DJ2A 4BZ1A 3WKMH 2MPVA 1CU4H 3DBSA 3L54A 2R23B 4YDIL 4Z9KB 5DMKB 5ICZA 2ZJSL 3RWDB 4Q9RL 2PETA 2WANA 5J13B 2R4RL 1JHKH 4YSSA 3ZBMA 1S9XA 3A47A 4WWPA 4QNPE 4YUEH 1M3JA 3BUBA 4GO6B 2BZ7A 2IFFH 1SM3L 1ETZB 4WUUD 5JHMA 1EGJL 3PGDB 4NHCH 4HEPA 5EF0A 4ZXBB 5FA3A 2B8OT 1NPJA 4DOHB 3HI5H 5EBMB 4S1RL 1QLRB 4DVBA 2WLIA 1YEGH 4ZMWA 1R5VA 2WBXA 3NT0A 4K0OA 3ROLA 5BUGA 4O02H 2HN7A 2VGLM 5K1NA 4YBQD 2LOEA 3UTTE 2DQHH 3K8MA 4HCRL 4XWGH 4U6VL 4FQLL 3WLWC 3ZMRA 4C4UA 1JF1A 2G5BB 3CG8A 4L3AA 1N8ZB 3IGFA 1E5UI 2C9PA 4N0UA 2CD0A 4EBQL 1UH3A 2IH8A 3FO9A 1LEGB 3LXAA 3LEYL 3PGFL 4M93B 4F57H 2F53B 4KMTL 2YSTA 3DTXB 1GJIA 3S36L 1N70A 4YX2H 2WBJD 5AL8A 3BIBX 3VQ1C 4GRMA 3T3PB 3TZVD 2V2WB 4R4FL 1DBJL 3BD3A 5TDNA 2ORBL 1T4KB 4IKKA 2D2CC 2X87A 3S35L 1CGTA 2PW2A 4Y8AA 5LCVL 2ICWA 4JFDE 3V6ZA 4R90L 1FG9C 3F12A 2MCG1 5FGRA 5FYJL 1I9IH 4WGVB 3SKOB 3Q13A 1A14H 3V7AG 3DX8A 4Z7AA 1ET5A 3O4OB 4P2QA 5F0LB 3ZTJG 4U0RC 1KENL 3C5XA 4Q52A 1B9ZA 1LEKA 3V0HA 3VGAC 2QQLL 1EFXA 2EP6A 1GSMA 3IGAA 1WIPA 1YEWA 5DJXA 3TCTA 2YPLE 4JPVH 3SDAC 3WI9A 1SUHA 2C7UA 1CGUA 5GGQH 1VZIA 5C3TA 1AZUA 3QG7H 4NNYB 1YCSA 1RUML 3I3DA 3H54A 4OGYL 2B3IA 5LNEA 4MDJB 3AY4A 4FTVE 1DHKA 4J2XA 2Z0BA 4PRPD 2F8XC 3MLTA 3QJTB 5HDQH 4U0QB 2DQUL 1YDPB 5DRNB 3AQYA 1KJ3L 5F1SA 4U1SB 2AJZA 3GHEL 3S5YA 2GKIA 1GIGH 3QZWG 4MCZA 2MHAA 4YVNA 5JIQA 1UENA 1CDHA 4NC2B 3K6FA 1IKFL 3BYTA 4ZX5A 5BS0B 1W6WA 3LYRA 3WS6A 3HPJB 4NNPL 2YGVA 1GGBH 4OTXH 3T0DA 2GT9A 4A6YA 4EN3B 2ZZUT 4XOEA 3ZMNA 5E08H 4OKDA 4JFQB 2BVTA 1J8HA 2UYLA 3IDNA 1NC4B 2XG4A 5E2WH 3UTTB 1HYSC 2VAAA 1I1CA 1C7TA 4IRZA 3H0TA 3KDMA 3OSKA 3H4HA 4I8DA 4U1GC 2H0PA 1HVXA 4FJ6A 4ODSL 3HZYA 3JZ7A 2BIMA 3NZ8A 4XCFH 2UXTA 2QTEA 2R4SL 1ACYL 1RUKH 4B0MM 1AQDB 4PW4A 5DJ8A 4BIKA 5KUMA 5FFGA 4LSUL 3S3BB 3UXFA 1YMMA 2WLLB 3MBEC 1VACA 4LCIH 4PI2A 1KNOA 4MZ2A 5B3JE 5IUSA 5JR1H 4XNXL 4R2GC 4PJCB 2YGOA 2YD4A 5I8OH 4ENZA 4X6DA 2CR6A 5LAXB 4JRYB 3U25A 1N0XL 2DI8A 4WSKA 2EJ1A 4URTB 1UOVA 1ZHKB 2AEPL 3QNFA 3ZIYA 5H4YA 1I8LC 8FABA 1WZ1H 3L4CA 3WN6A 3KYNA 1TYEB 3HAEG 3B2XA 3DA0A 2FT7A 3KXFD 4QXWA 1NICA 1MFBL 2EDFA 4HUUB 1MUJA 3JWOL 1O75A 3FN3A 4JFXB 1J8HE 5LDUA 2PNDA 4G8IB 3W0WA 5HHOE 2NY6D 5DD1H 4NPYA 2AXFA 2O93L 4PRDA 1RURL 2VR5A 4HAGA 4MCYA 2DLGA 4PRHA 3FZUD 4CILA 2P5WA 2IALB 3F64A 2FEEL 3VQLA 4K15A 2VLMD 3HHSB 5CUSH 4UM9A 1SQ2N 3MNWA 3ARXA 1EX0A 2XA8L 3V4VL 1MRDH 4JMXA 5ESQA 4JY4B 2Y25A 3VTAA 3WNPA 1BM3H 4Q0XH 3PHOB 2YR3A 5FKPB 1TQUA 1T0MA 3HE7C 3D5OF 4WHYG 2DN7A 4K3JL 1K72A 3QW9A 3AW5A 3DV6A 4UIMB 3VW3H 4OI7A 3L5WA 4Y89A 3TN0B 5BV7H 5KVEE 3IS1X 1QO3B 4RIRB 4Z3EA 1ZTXH 4M03A 4HIJA 1WWWX 3BQVA 1IKOP 1OP9A 1U41A 5EO9A 4Z5RA 2A74A 3KLAB 1M4KA 2XN1A 3MRQB 4QWWC 4R84A 3P9WB 4XMPH 5DMIH 5CCHE 3KM2A 1HU8A 4UTBH 2MRYA 3FTXA 2Y1YA 4WU7A 5IW3A 2A73A 1U8MA 3IDYC 5DZOA 1LO2L 2WAHA 2X4QB 3DDGA 5D1ZD 3X13B 4BUGA 5EN2B 3MYJA 1M7DB 2ZF9A 3OV6A 2R4SH 2P28B 2YC1B 3FAWA 1FFOA 3AREB 4RGNC 1HCZA 5AYUH 4NT6B 2XYCA 4XXWA 2Z4QB 4K23L 5EU3B 4HJSA 5D7JA 3V4VH 1AE6L 4JHAL 2O26U 3OAUL 2FX8H 3CFBB 1FZKB 4BGDA 1INEH 3EOAB 1YEHH 3TBCA 2HSIA 1OCCB 4P2OA 1IEAA 4F15B 3PY9A 2IEPA 3VDCA 5DA4A 1AGDB 4TMPA 1TTRA 2AERT 2GY7B 2A9AA 4KI5D 1BFOB 4QXTB 1EEUA 5IB4B 1T2JA 3AG1B 1WA2X 2R69H 1P4BL 5HI5C 2VLKD 2L4OA 4P4RA 4XZUB 5CCJA 1IBDA 4X6DF 5AVWB 1SPDA 3HMWH 4GT7A 3Q9PA 3FB8A 2WD0A 4K55A 4PG2C 1IFHH 1IEAB 2JMRA 3VMOA 2FO4A 4XE0A 3GPEA 1DBKL 2CO2A 1MAKA 3GSOA 3EOAA 5D71H 1G1YA 1P9MC 3FOLB 4RFNB 4RMQA 3QO0B 4XWOD 4U3SB 4I3RL 3HS8A 3T6XA 3V9CA 5D7JB 4IK6A 5DFVC 5EU3A 2C4FT 1KTLA 3EHBD 4JW3A 5C8JB 1PFCA 2XV0A 5CEZL 4OZIB 1SOQA 2B9AA 3GB7B 5A43C 4N20A 5ABZA 1T1XA 1XR8B 3MYJB 2OX5B 2X53A 3FT0A 2VH5L 4TXVB 4PCSA 3TO4A 5E70A 1ZLSL 1BF2A 3MCKB 1JCVA 3N44B 1WA1X 3KE0A 1NMCB 5DLML 5EO9B 3HN8A 2A9BA 3QORA 3T0WA 4NIYE 3T09A 3CC1A 1JHKL 1MRCL 2VDPB 1I9RL 2VMFA 3BP7A 2F19H 4NRZA 2AI0L 2OW7A 2XCMC 3B5HA 3KS0H 1Q1PA 3IRPX 2MKLC 2VTFA 2ADFH 2WO2B 3BPLC 2VM9A 3WIHL 5FDYA 5DD3H 4XX1E 1OOWA 4KDTA 3FT2A 3T1FA 4AC2A 3RX9A 4APQA 5J6SA 2W80C 1SBBA 3CCHB 3BEVA 1TG8A 4IYKA 3WE6B 5A1AA 2IJ0C 3BMWA 1R5IB 2XN9B 4K9EH 3DETD 3DIFA 2E8ZA 2WZAA 3DUHA 5C6TH 2EYSA 1YEHL 4LLYB 3HR5A 1TSHA 4E9WA 1XEUA 4CSZA 2XBTA 4OLUL 3QISA 2XACC 3CFTA 1ZPUA 2F08A 3F6LA 4KC3B 3F05A 3DOSB 3O3BA 4O4YH 4E36A 2WB7A 5CCKH 4XOAA 4JO2H 1JFHA 5KG9B 1WT5C 2OMXB 1E4XH 3KYNB 4CC0A 4WRLA 1CFQA 5J1AA 4G6AD 3WD5L 3HC0B 5IKCA 1HH6A 3TF4A 4JFEB 2JKLA 4POZC 4U1IA 3FT9A 4XMKH 5HHNB 4QHLA 5AW7B 5AD0A 2ZF8A 4UT6A 2H6UA 4APQD 4AQZA 4YMPA 4KJWD 1QBLL 2FJHA 5DHXB 2Q20A 2VXVL 3EJRA 1CFSA 4PJCA 4KUCF 5ICXA 1HQRA 4HQQH 4HS6A 5BZXA 1ZT7A 2HRLA 1NDTA 2G9KA 3BLKA 4JFFB 3IJ8A 4V2CB 4FG6C 4M29A 1R75A 5JW3H 2BDNH 5IROD 1NUNB 5EEXA 1PD1A 1RUAL 4I9WD 1HHJA 3V0VB 4MSWB 5D2NB 4HCGA 4QKXB 4AWJC 4UQIM 1OGAA 5IQ9A 1DBAL 1DQTA 4NKQB 3H55A 4LMQE 1NOFA 3RFRA 4W9ZA 3FF7A 2YAPA 3QS3A 5I5RA 5CJ5A 2VWEC 5DC2A 3NSDA 3U1QA 2A6DB 2P47B 3MACH 3JTTB 2OSXA 5F9WB 4H20H 2FZ3B 3H9ZA 2MIZA 5DJ6A 2CO3A 1QSFB 5C0FA 4I87A 3B8YA 4DERA 4YFEA 1UACL 4W9IC 1ZD6A 5ADPL 3LKSB 1MFAL 2AABL 2ZXGA 3NPSB 5FYLH 1D5RA 3B3BA 5DRNA 2BM3A 4BD4A 5F3HB 3AREC 2GSGA 5AVYB 4ADGA 1H3XA 3KGUA 3SOBL 1F42A 5BXFA 1H5BC 5AB2A 4KI5C 5B1KA 3PDOB 3RWHA 2QQKL 3NYKA 4X42A 1OSZA 5TE4H 4W68A 4H88L 2YRPA 4G72B 5FEBA 2N7SA 2JJTA 2EIMB 2G5UA 4GRLD 5TPWL 1ND0A 2Y5TA 3I6LD 1F90L 4QR7A 1MCFA 4URKA 5LO7A 1CFVH 1KJVA 1FJ1B 3U83A 4FKEA 4GQPH 5EOTB 1G5GA 3TN0C 4FNQA 5FUZL 4PGDB 4YFDB 4CC4C 3EFDL 1QASA 4B60A 3QJSB 3W1ZA 3AY2A 3SKOA 1ZTXL 3BSHA 2VDKL 2C9UA 3S4SB 5DJZB 4NCC1 5DVPA 3SE4A 5TE6L 1UACH 3LPOA 4E9TA 4K5PA 3ZE1B 2ICWB 5KZCB 2X6CA 3MV8E 4NO3A 5FYLL 2MWCA 3PP3H 4JFHD 5KVFL 4JUTA 4G7SB 2ZICA 3H9SB 4PHXA 3ZHKA 2HFEA 2BO0A 3IJYA 3LXBA 5FGBC 3DO3A 4JO8A 3O6FC 4NZ8A 5ABDE 4D3CH 1T7WA 1FZMA 3BC9A 3L17A 2F5BH 5M7QA 2DWEB 3O11B 1IGYB 5DEFB 1FBIL 5AB0A 4PP1C 4WHDA 2OSLB 3EOBA 4DW2H 3O41B 4ALAC 4N0UB 3FQ2A 5FDWB 1FVDA 2IH3A 4ZUVA 1BVNT 4ODVL 4GMTH 5CBAA 5D5ME 3RHWF 3QXUA 3MRBB 1S7VA 2CIIA 4JFUA 1S3KL 1ZTXE 3HNVH 4C55A 2AP2A 5HJDA 2Z8RA 1A47A 4PSRA 4DVBB 5IVZA 3MRRA 2ENJA 4LP8A 1PYWB 3G6AB 4DVRL 3T2LA 5FA3B 3NGBC 5CJOH 3QUXC 4LLQA 5IVXA 3D2UD 3QIWC 3SKJL 4KDWA 3GLDA 3PJLA 1YY8B 1R3IH 2G2PA 1CL7L 1XAKA 2DBJA 1MW1A 4OFVA 1S9XB 4C4KT 4OZIF 1TQCC 1VRSA 3GZOA 3HKFA 1JFQH 2D7MA 3OC8A 4NM4H 4HC1A 2R23A 3D4YA 1UXSA 4Z7VB 4AEIL 2LLLA 1KYOJ 4LCWD 2I7SA 3L4WA 2VXQL 3S3CB 4L3EB 3GRGA 5HYJB 3WTXA 3QHFH 4AV4A 5CWSB 3Q2NA 3MRRB 3PG2A 4NN7B 4PJ8D 5JHDE 2ZAIA 3PABA 2UXVA 3W11C 3T2NH 1KBPA 2RMNA 4FQJH 1TLMA 2QPUA 3D69B 2VH5H 2N3JA 4HUVA 3SGJC 1VKXB 2JF1A 3Q5TA 2WWKT 5CBAB 4P9MH 2BFVH 5A2BA 1BJ1J 1FVDB 1JHTA 4I48A 1WFIA 4J3WA 5LCVA 1S9KC 5B21A 3NIGF 5D72H 5DEFA 2DQJL 2UY7B 3L4YA 4OY9A 5D7EA 2OKMA 1FZMB 2DMKA 2N1KA 5DQDH 4F3FA 4PY8I 1JP5A 1NC4D 3U7WL 4E2OA 2BW4A 4Q74A 4L0PB 1RJCA 2R39A 3SN6N 3T71A 4WK4B 5FO7A 1UD8A 4TNEA 4B95C 1AKPA 3C08H 5KANG 3OXRB 5CKAA 1T80A 2R8SH 4N68A 5I1AB 1JWMA 5E9DD 1WFUA 3GUFA 5C07A 1CD8A 5HYQA 2WQWA 2GHWB 3B2MA 1EGJH 4PGDA 4U6YB 4RAHA 2PYFA 4JANB 3JT0A 3DMMD 3WMSA 2XPZA 4Z7UF 2Z93A 5EOTA 4ZW7A 4F24A 3JV6A 4GXFA 4QYOB 3S4SG 3MBXH 1VCBC 2DZEA 4Y2LA 4L3ED 5DHEA 3UABA 4OV5A 3S37L 1BF5A 3WMQA 1VIWA 3FU0A 5I75B 1ND0B 4DF9A 4R2GD 5GISH 2QL1A 4LMQI 5KTEH 1P2CA 3G5VB 3N1GC 4X7EC 1HT6A 1AR2A 2CRMA 2VSCA 4O4YL 3L6FB 3WELA 5C0DA 3TC9A 5K9JH 4AL8L 1I1RA 4PJEB 2X4UA 2ADJB 1JZ6A 1M71A 5D7LA 1J5CA 3OHMB 1J5IA 5E6YA 3O6FA 5F3HA 2WXHA 3NAAL 1KPVA 1CL7H 3H9YA 3ESNA 3K3QA 3PGCB 3BQUC 3MXVH 4P04A 3DV4B 1JGUL 1IQDB 2AW2A 5I26A 2X1QA 3EUDA 3X11A 4DOHE 3C6SB 3OMAB 3D48R 1UXWA 2MPAL 2BDNL 4HJUA 4HWBA 3BKYH 5KSVA 1WPCA 1HINL 2RQ8A 3COOA 2J12B 1JXJA 2ARJQ 3MLWH 2ADFL 2UZXB 1I3GL 4LRIC 3PWPD 4WSGA 2CIKB 4P59L 1KCVL 1XF2B 3KAAA 1DP0A 4R4ND 2BW5A 2O72A 2GG1A 4Z7NB 4ZXBC 4CMHC 3QDAA 3FTWA 2D03H 2GIXA 3NA9L 1DQJA 5IB3B 1OGAB 2WNKA 4PJ5A 4XGZA 3GMQA 2DQGL 3QIWA 2VLRA 3EBAA 4NOFA 3OKKA 4RRPA 5GGSY 3TWYA 3ZK0A 4Z78A 2VDRH 2DQ6A 1C5BH 4WI0A 4AZ8A 2Z92A 1OALA 3NN8B 3A24A 1BPLB 5DJ0B 3D07A 1XMEB 2YZ1A 3DX7A 3WENA 3VD9A 4PJGB 1JGDA 1HK6A 2Y5EA 1Q8MA 2CDEA 3KBHE 1HTYA 3H3PL 3ZKXB 1PSKH 2K9FB 4WY7L 5HHNA 4KO6A 2DYSB 4NOBA 5GSRA 1BZOA 2H2PC 4JFEA 4KWUA 4L29B 1FO0B 4GY4A 2OI9C 3LS4L 2EEDA 3NCMA 4DGVH 1TZIB 2YMXL 5CD5C 4QYAA 1T0NA 3IXTA 4YR6A 2PO6D 4ZUSA 2UWEA 1CI3M 2YA1A 2JI2A 2ISDA 2EDWA 3NSCA 3DOSA 3O3BB 4JRXD 3C09B 1I53A 2B2XL 2FX9H 3D51A 4LSSL 5L2KE 3LQAC 3O2WH 4LBAA 4C54A 5C97A 1BQLH 4M48H 1KTDB 3P2TA 2YFNA 4LLYA 1JUFB 4OZFA 1MVYA 3GS0A 4OF0A 1QWUA 3QA3A 3DIFB 4K7PY 5IMLB 4XAWH 5GISL 4DK6A 3BAXA 3L3HB 5IB1B 1YUKB 4J4PA 3FB7A 5JXAL 2E7LC 1R3KA 1G1CA 3ISRA 1Z66A 5DFVD 2FLRT 4Z7UE 4APQB 3MZGB 4FHJA 3GUTA 2K45A 4ZPTB 5DUPH 3FFOA 3KPLA 4AITA 3D25A 4HWNA 1A6VL 2WCPA 5L4JA 5AQ0A 3BSZH 5F7WC 3O0RL 3ZRCC 1U92B 1SUJA 2CMRH 3U1SH 2DKUA 2W95A 1CU4L 2WUCH 1QW8A 3RX8A 4HSAC 3LRSB 1GW0A 2AMUA 3P3YA 2VMDA 3DGCR 2Y4SA 5J4MA 3MRJB 3BP7B 4Q9CA 1A7RH 2CQVA 2ZX6A 2AEPH 1Q1JH 2A3TA 2X09A 1YY9C 4PD4K 2EXYC 3TBTA 3L3JA 4XWOC 4M5TA 4XP6L 1HJCA 4AC4A 2ZYRA 1KYFA 1XGUB 2JJSC 5D7IE 2B2XH 2FX9L 4ZSOB 2C34A 3TO4B 1AD9A 1MKFA 2R2EB 2BP8B 1OW0A 2P9RA 4ZYKB 4XVTH 5C08E 1CDIA 32C2B 5C9KA 5KVEL 3L4VA 4YPGA 3HI6H 1T7YA 3T5WA 4X7CC 1RULL 1M7IA 1SXCA 3CHXA 3KLDA 3TBVB 5I1DA 2VITB 4Q6IC 1KGXA 1J8SA 4MWFB 2J3SA 3IWVA 5FYKE 5EEUA 2EDHA 4G8GD 4XMVA 1H15B 3S5LA 4U3SA 1HESA 2CHZA 2OMTB 3QO0A 4D2NA 2EYTB 4OD3H 3IDYB 4XCNB 3GSOB 5JOFB 1MRDL 1YC8A 3INUL 1E42A 2WYHA 4LSRH 3MO1A 4YLBA 3V2AR 4V1DD 1SXBA 2BH0A 5GRUH 4PRAB 3L2MA 4KUZL 4R83A 5C0BD 4OUOA 2CLRB 5JMOC 5GHWH 5ENWA 5E5MB 2JCCB 3ZE1E 3ARRA 3F04A 2K7PA 3KPRA 4MX7B 1S6NA 3X3FL 3L08A 4RCAA 1LE5B 4GBXC 4NUJB 1EERB 3LZOA 5D9SA 4UTBL 5LKNA 3PXLA 2FH8A 1G9HA 1KG0B 1UXLA 5CJ8A 5DK0A 2JKNA 4DTGH 2F8IA 1I1YA 2CRYA 4NZTL 3WEBA 4G9FB 3QUMA 4ODVH 2YC1A 2BNRB 1DJSA 1IT9L 4G70B 4V1DA 5GQBA 4L4VD 4NPKA 5DJAA 4ZMVA 1ADWA 5BCAA 4OD3L 5DO2C 3VXOB 4A7GF 2Z34A 4PJ6A 5B7EA 3EDEA 5E8NB 3GXMA 4I4WA 2VR6A 2EZ0D 4OLEA 2A74B 1LQBC 1OHZA 3EYFB 2XWEA 5F88B 1OAJA 5H37H 1GY2A 5E8OA 4NQDA 3CFIC 1IBFA 4NWUL 4RIRA 3ZJAA 2TRYA 1A3RH 2Z7WA 5JPMC 1UJTA 2R59A 4BH8B 2GK0A 5GS0H 2WBJA 3T4YB 1RZIB 3VWJA 1FGVH 3NOIA 4OZ4B 3D39E 1UD3A 2W9EL 3UGUA 2K78A 4JDVA 4TSCH 2H0JA 3HG1A 4I0PD 3LNGA 1UXMA 5EFIB 5ESQB 1ADQA 3IFLL 43CAA 1CICC 3FO0H 4FG2A 4MA8L 1NMBH 3K72A 4JO3L 4JG0H 1TJIL 1YEFL 2CJSA 2EH7L 4PV1C 5F9JB 4E9RA 4XI5C 1JE6A 1CTOA 1PG7W 3H53A 2AQSA 3ATEA 3I85A 2VLLB 1HSBA 1TQSA 5JMRA 4PRHB 2Y7LA 4YHNB 2JI3A 5BW7A 2KL6A 5H2BB 1LEIB 4HKBB 5I73C 2J55A 1DYZA 2AXFB 3DXAD 4MB4A 1NZRA 3B2VL 4GKZA 5DQ9B 1BCIA 5J6GB 1QQDB 2GUOB 2WTRB 3OJMB 4H0LC 5E9AA 1DBML 3A4AA 4HIIB 3RVXD 4MB1A 2A1WH 2R56H 1S8DA 3ZDZE 4A7GA 5JQ6L 3K74B 5T5FA 3EO0B 2HA1A 3MU3A 8FABB 3LCYA 4AE1A 4E0RA 4KZCA 4GJTB 1UQSB 1S3RA 2HKFL 1DJIA 3GXPA 3UTQA 2GFBB 2D7OA 1EO5A 2DIEA 2KS0A 2YLKA 3JWOH 5LAXA 3IJHA 4X5QA 1X5HA 1GCYA 2AK4B 3QFDA 5JA9A 2EABA 1PKOA 5G55A 3QUML 3HE7D 4U7MA 4ILDA 3WIIH 1VACB 5T1KA 4GG6A 4DTGL 4FP8H 4DKDC 2VR3A 4TV3A 5C08D 4GBXB 1AQDA 1KZQA 2JB5H 5DR5L 3C75A 4TRPH 1RU9H 4FFYA 1XB3A 4XP4L 2OYMA 1M57B 4JRLA 2FYYA 2YAOA 1G0YR 3DTDA 4PVMA 2OXHA 1NAMB 3LEXB 4G8GE 5C07E 1MIEL 1EAPA 4WI2A 4EDWL 4ETQA 3IWUA 3RZCB 2GVYA 4W9DC 1QZ1A 5DVLA 3GMPB 4AQAA 1I9JH 3IDNB 3IFNH 1A0QH 4S2SA 3O6KH 4AJ0A 1KN4H 4EN3A 2VM3A 1CBVL 2VDMB 5D1ZC 3OX8A 4S1SL 1INQB 1MHEA 5ES4B 2Y72A 1LMIA 2WZ0A 3BUPA 3WUWG 1AGEB 1KLUA 2OI9B 3NIFB 5C0BE 4MCZB 1E4XL 4MA3B 1FGVL 1R3JB 2DLEA 3A4FA 2N1TE 4NERA 2C9SA 3FUFA 1F4WL 4FDWA 1AIFB 4W9HC 4IBUA 1U2YA 5EZPA 3MV8A 3VI4E 2IWKA 3FDWA 2GBVA 5GXBB 1E43A 2GJ6D 1B2WL 1WVZA 4I5BA 4ELMA 3MUY1 1RZJC 4OGAC 2X4TB 2XX1A 4M02A 5K9QI 1SFDA 2DM4A 1GR7A 4TYUA 3MLWL 5AALA 1G43A 3GSNL 4XPAL 3HI5L 4KTDH 4LF3A 4JM2C 5JPNA 5GGUB 3KXFA 4MAUH 4ZMTA 3SDXA 3PAVA 1A4KB 1EFXB 4PBVC 3QJUB 4KKRA 3UEZA 4JDEB 5DLLA 5KAQG 1AACA 4L4VE 1TSRA 4N26A 1A7NL 2VJ8A 5ICYA 3PCYA 4J28A 3K2UL 4OCRL 3HLKA 2DF3A 4TVSa 3UZEC 3VNZA 4PJ7A 1T5WA 5CILL 1FHNA 3S36H 2MNUA 3S2CA 4X6EB 3HBPA 1U3HB 4P2QE 4TS6A 5EDXA 1ZLDA 1JPEA 3RVXC 3CSTA 2BZDA 3VXUD 3QT2A 4DWHA 5GIRA 5LBSH 1P4BH 2PW2B 2VN3A 2ATPB 3OHXC 4GRLA 4XAKE 5J13C 4X80L 1XZ0B 2IOOA 2ZOLA 3FRUB 3U9UB 5E4OA 1IC5L 5GGTL 1I1AD 1YEKH 1UATA 1I75A 1HHGB 4GRMB 4H44C 1G7QA 3D0VA 4N4YB 4PWGA 5HHOB 3EJPA 2AJXL 2GK2A 3GEWB 3T6QC 4ZG1A 1QR1B 3APDA 3GSNH 4TULL 2F7QA 5T33L 4FJYA 3DURB 4E9LA 3M88A 1WD9A 1BQLL 4M48L 1OTUD 4P3DB 5K59E 4F7MB 5FGSA 2ERJC 1UYWH 2CO1A 1ROWA 5H94B 3O8XD 3D4GA 3O2VH 4DEWA 4KTGA 3K6IA 2D7NA 3ZQXA 5AAWC 4H5SA 1BJMA 1D9KB 2YAHA 2QFPA 4S10A 2F7OA 1I7UB 3M1BA 3EHBB 2K4WA 1QWHA 2EADA 3HS0A 1QA9A 2CJTA 4TUJA 4Z0XB 3AUVA 5KSAC 3VFPA 3V9FA 2B4CL 4TTDC 2H1PH 1BXVA 4R4NC 1A6ZB 4RDBA 3UTPE 2BPBA 3BRFA 3GI9H 4KK8C 3VFSB 5C0EB 4R3SA 4A67A 4BK8A 1WZLA 2BVOB 2DM2A 3GSQB 2AJVH 4OF3A 4RGMC 4HPHA 1CFTB 4WO0A 3SOTA 3MLVL 4M00A 1ZA6A 4PGEA 3FQNB 1ZA3B 4GW4A 2VQ1B 4EKJA 3QXDA 1KT2A 5ICZB 1XB6A 3IT8D 4BKSC 2W0PA 3AAZB 4LARL 3H4FA 4ZFQA 1L0PA 1YMME 1IIKA 4XPFL 1CZ8H 4DNLA 4OZGA 4CMHB 4GRWB 2FJGB 2VZOA 3CBJB 4XNYH 2Y7QA 1NOAA 2OV0A 4G8AC 3H3KA 2P42B 3IDJB 5IW6A 3EFFA 1H0DB 4RFEA 1U8QB 3L3DA 4ZUTA 4AZUA 3A21A 5BOZG 5T5NG 1SDDA 1LO5B 1CK0H 2P5EB 3EAKA 4G71B 2J2ZA 1QI4A 1J0HA 4LL9A 4HIPA 4L18A 4X9IA 1FDLH 4LCWA 1JZ5A 3WBDA 1SRDA 3IPBA 3SDXF 1Q0XH 4UTAL 4M6AA 3GI9L 1CGXA 1EZSA 4FYQA 4L4TD 1O7DE 1NL0H 4BFIB 2WK2A 4FF9A 5FR3A 4NS0A 2XJLA 5F89B 3BLPX 3RUGE 4C57C 5SX4I 1XCTA 5EZIH 4MAYA 4TM9A 3GLZA 3ME0A 4J8QA 1GJUA 5C7XH 5JYMA 5D96C 4A2MA 3KWUA 3QUYD 2R0WH 1CQKA 4U3HA 4KY1L 1ONQB 3DK0A 2YMOA 4H4NA 1EVUA 3TBBA 4CMMA 1A9EB 5I16A 5HGDA 3AROA 4I7ZC 1J0ZA 3NGBB 2BOBB 2DTML 2I69A 1H6UA 3CAFA 2J1XA 3SY0A 3ARFB 4MJ5B 3LZFH 3UFIA 4LEEA 1KB3A 5EH1A 4FLRA 3VG9B 5AB9A 2LGNA 4AG4L 1EAJA 3BZEB 1F4HA 4FFZH 3OR6B 4MYPA 2VDRL 4TOYH 4CKQA 5DD0H 4KZDL 4FNLH 3Q5OA 3QSKB 5J12C 2Q3AA 4N24A 4JDZB 3SPVB 4PJFE 2AJSL 5F7DA 5HHXL 5IWLC 1U91A 3HIZA 1NM9A 4X4YA 5A6IA 4K07A 3HC4L 2W91A 5PAZA 3OJVC 3TNNA 3L2LA 3MRPA 2DH2A 4P2QD 2HRPH 5DQDL 2R4RH 2B20A 4U4IA 2X9ZA 5KYXA 2VDNL 2CWRA 1N0XH 2AK4D 1AP2A 3PWVB 3L3KA 4CDHA 4Y5YC 5TDOB 5FOBB 3G08B 4KY1H 4WTQA 1E8WA 1OB1A 3WFCL 3V4LA 1ZT1B 3KPNA 3PS6A 4GI9A 4TNWK 4JM0A 3KEDA 4LAQH 4N28A 2W0LA 4Y9GA 4NCC2 4I77H 1GGYA 3QIUB 4YHIB 4EDXB 3HAEH 3SYQA 1MFEL 2G2RA 3K71A 4TRPL 1KCUL 3SEPA 5EBWB 2GJPA 1UB5B 3SE3C 1A4AA 2PABA 3H56A 4XMLL 1VA9A 5F7AA 4GEIA 1GPOL 3AQXA 2C3GA 1UZ6E 2QR0A 3SDDD 4F2ME 2LLGA 3W39A 4NXKA 1FNSH 4ZOAA 2WKLA 1PFOA 2X4NB 1F2QA 1Q9LA 1L9SA 2RBLA 5C0CB 1Z32X 1BQSA 1QATA 4MMYB 5JZ7C 5H37A 1ECZA 4WKZA 3V52L 2NYZA 1ZVSA 4X4XA 2WXPA 1BX2A 2J8OA 1BD2A 2WMPA 3QUXB 4RQQB 4LHUD 3F84A 5FUOL 2XFXA 4K2UL 4HKXB 3UYPA 2GYSA 3GHEH 3AUWB 5F0MB 4L3CB 3VRIB 4LBEB 5BOPA 2H32A 4Q9QH 2EDQA 4H40A 4I1RA 4FXGA 4QRQA 3RU8H 1XD0A 3BSZA 4NX0A 2VSKB 2KZKA 2H0FA 4FQ2H 2IGFL 2AQRA 5JORA 3AC0A 1DLHA 2AQ2A 3BH4A 2IG2L 3ET9F 2DIAA 1P4LA 1SJEA 1KIUB 3CFEA 5BJTA 3F7YA 1MF2H 1YMMD 2VRQA 2R7EB 5EHFA 2BSBA 5CJXA 4MJIE 4N2IA 2E27H 1BZ9A 4R8WL 4GBXD 4MRBA 5ESAB 5HDBE 3BPOB 3VTMA 1U8HB 3MRIA 1WGVA 3WO4C 3BYYA 3WIIL 2IV8A 2BWIA 4S1QH 3MXWL 3P77B 3GS7A 2VW6A 5D93B 3DO7A 2J71A 2WBJC 5TQ0L 3UPAA 1KY6A 1A4CA 3VTTA 1EVTC 4LHUA 5D2NC 4ORZC 5L9DL 1HHKB 5F8QC 4F8TA 5E7FA 5FECA 1Z3GH 2VDPL 4LCIL 1U95A 1DUYA 1JK8B 3VXNB 3MV9B 2XNAB 4UZSA 4QRSB 2ESVA 4GEJA 5L6YH 1A3QA 2AKRA 3JTSA 5IHBA 4DZBB 2IAAC 1HHIA 5JYLA 5TH2A 4L4TE 1P84J 1QACA 5F7EL 3ULVC 5SWZA 3FHEA 3NUKA 2VXSH 3LIZL 4M1DL 4UI2A 1E4HA 1EWHA 3QXVA 5T8IA 3MRNA 2LVEA 5I19L 1MFEH 3DYOA 1TQWA 5I71C 2NY2B 1GZHC 5FB8A 3HKZA 4RMTA 4Y2OA 3VI4B 1DBKH 4YL4A 4LSSH 3TJEH 3H9HA 4G2AA 3RNQB 1OE2A 2A77H 5E99L 4JG1H 4UT9L 2XXMB 4ESKA 2R1WA 1RK1A 3D3VE 1CYWA 4OLYL 1ZWIA 3EFOA 4P23C 3NPSC 4LPYA 3UTSA 3V4PB 1GC1H 3JWDH 2LVCA 4L1HA 3LQZA 2VNCA 1CE6A 1G9MC 4PJBA 3ZPDA 5L6YL 3E1F1 3EG9B 3SQOL 1TETH 3D39B 4GQ9L 4XHJD 3SGDI 2X1XR 5E5RB 3CVIH 5IESL 4I85A 3BWAA 4K3JH 1WLHA 4KX7A 4YHZH 1PKQA 3SJVB 1CYXA 1PZ3A 5IJVB 3IMUA 3DBXA 4NYLA 4NKIL 3OTTA 3O4LE 3EXJA 4YHOL 3EOTL 5ABAA 2YS4A 1FNEA 9PCYA 2H9GB 3SDXE 4JO2L 4XVJL 3DPBA 1RUPH 3EGSA 3ZOAA 4IMKC 5IFJA 2YZ8A 3V0EA 4PH8A 4PWIA 1JGEA 4L9LB 3T0BA 3SBPA 1CPUA 5B4MD 3KHOA 3KLQA 2H6PA 3CBKB 3CVDA 2D3JA 4L37A 4YDLC 4OAWA 2AAAA 4HUMB 4LCYB 4XNZC 4RZCB 4FI8A 1NKRA 3DVNB 1E9OB 3STLB 3WN5C 3FT4B 1PEWA 1TLKA 3FRPB 3TBWA 4W9LC 3T4AA 2DMGA 3BP6A 2YJQA 1UZ8B 1VGEH 3APCA 3N41B 2RD0A 5DI8A 3ZR6A 5CS7A 3L4ZA 4KXCA 2D0GA 1E27A 3IFPB 1XZWA 2E6JA 1Q0XL 1O6SA 4OUUB 1U9KA 4AL8H 2YQ2A 5I1CL 3PL6D 3LKPA 4MNHA 4Q0XL 1MCBA 3G6JA 4PUBL 2KQMA 2OMUA 5HGAB 4ZFZA 3VH8G 4P4KD 1FNHA 1IKNC 4J3OF 4BRJA 3PDDA 4H8WH 1GGIL 1A25A 3C9NB 4QHMA 2WZPA 5L8LB 4ADIA 4M62L 1IM9A 2YPVH 4NO2A 1L9TA 1S7WB 3ULUH 5FUCE 2ICES 2OZ4L 3BZ4B 3CZJA 1JXFA 3FN0H 4TQEL 3V6OA 4FYSA 4MLIA 4XPBL 4P07A 5IEKB 3DYMA 3MLVH 2Z8VC 2X6AA 3FZUC 4RA0C 2BIOA 4Z18A 1IJ9A 3ZHFA 5LGKA 2OXGA 3DKHA 4RWHA 3KM1A 1MHHA 1FE8L 3UIZA 4UT9A 1KLGB 1KUMA 5JW4M 3P11H 5I74B 2AEOA 1NFIB 2VQTA 4I2XB 4ES9A 2Z31B 3BDYL 3VXSB 3QRGL 1CD0A 1EBPA 2XVKA 5EO0B 3N85L 1F4XH 1JRHL 3BZDA 3O6ML 4D0DB 3VDBA 3MNDA 3ULVD 1KB5A 1CGYA 4WU5A 5BRZD 4K3DH 3TOPA 1G6VK 3RTQA 1U93B 4GUQA 4P5MB 1CLYH 1FFRA 4AH2A 4HX1B 4JDTH 1H3PH 1RIHL 3N06B 1CXLA 1QLEL 1BAWA 4P2RD 3POHA 1E7VA 1CXEA 1X5XA 5DLMH 3T6ZA 5LWYH 4NO5A 4WY7H 3HNSL 2ED7A 1Q9OA 5IHLB 1IEBB 1TQBC 1ZY9A 3UP6A 1FYTB 3IBOA 4I0PA 4MNQB 5HDRA 2FTAA 1F58H 2IBBA 5GPRA 5IIEB 1IMHC 1AKJA 3LVTA 1UH2A 2IPUK 2QZ5A 4FQCH 1C7SA 1NDMA 5D7IB 1TO4A 1H3UA 3TS8A 4HA1A 4UQCA 5KN5A 1J9RA 5TF1H 4LVEA 4RRPG 2HFFA 1F3JB 1ZLUK 4WHCA 1MDAA 3LQMA 5IOPA 1VZGA 2SEBA 2WNGA 5FOJA 2C9QA 4PP2B 2J1KA 3FQXA 1NGWA 1EV2E 4MD5A 1A21A 3SGKA 4HJEA 1A1NB 1BGXL 2DD8L 1MCSA 3K0WA 3LZFL 2KPWA 4NQSB 2PCPA 4YSEA 3F6IA 1GS7A 4FQHA 1X7QB 1YNTB 1IE5A 4OF5A 4BSWB 5D2LE 1A7NH 5CJOL 1W72A 3H85A 4HS3B 4JPKL 2PCYA 3WIAA 1T3FB 2NNXA 2P24B 5IBUG 2VL4A 4FCHA 3WO4B 3SPCA 2GHZA 2HJLB 3CZFA 3GKWL 4GIPD 1EHKB 1UCTA 2BP0A 5EU6A 4QHNB 1XBRA 1OAYH 3HE7A 1XL6A 3MREA 1L0YA 3UCQA 5EULV 1RZPA 2F8OA 3AS3A 1XGYH 2CO7A 3B2DC 1NGPH 4QOKE 3WN5A 2CO4A 3X14A 3X12A 3ULUE 4A68A 1NIEA 1JWUA 5IP4A 3LKRA 1AO7B 4HUWB 4YXHL 1R3LA 5J89A 4Q7DA 4LPUA 4WTZA 2ZWYA 2AGJH 1JFQL 1WBYB 4AVHA 2G3XA 5AOJA 4YSOA 5DO2D 1DR9A 1AHWB 2AEQH 4FNTA 3SBWA 5IBTL 1HNFA 2AFNA 2FECL 4KRPB 5AOKA 5AVZB 4YEEA 5TFSH 4U6HB 5HI4C 4Y19D 3WKYA 4AIZA 3IFOB 4U2YA 4A04A 2JIXA 3NZHH 1M9SA 4FQ1L 4BDVA 3CVHB 3HZKB 4F7CA 1BM7A 3MOAL 2ZXEB 3G5ZB 1CT8B 4NKMA 4Z3FA 5C2UB 2VL5B 2G60H 1RU9L 1MWOA 3LN5A 1T4WA 3OJDB 4MJ6B 4U1GB 3CN0A 3FTSA 3HC3L 4H8UA 4KK8D 5EU5A 5EC1A 2A38A 1FZJA 1IX2A 3VA2C 3T1WA 5D4IA 3ARWA 3TESA 5KVGH 4WV1A 4X6CA 3TBSB 1KY7A 2PP8A 2HH0H 3ESUF 1SVCP 1TJMA 3RVWC 2CA4A 4CUCA 1D5ZA 2HVBA 1OM3L 2IDQA 2EXSA 3HJ0A 2HCZX 3RWCA 4E42A 2W07B 1JGLH 5E9NA 3UTOA 4HS8L 4UT7H 1MY5A 1OPGL 1PNCA 2ARJB 3BVTA 4LOEA 1ODAA 4C58B 3L5IA 5I1GH 3WDJA 4QJ3B 1OEZW 2QQKH 3QXAA 5I17B 4LASH 1GA2A 4PW9A 4LT7A 4WI8A 2APFA 2DV6A 1EH9A 4QY8B 1NCHA 3N9GH 4M6ML 3EJTA 3U30B 1E6OL 4QOKB 4GI8A 3FSWA 2PP9A 3NESA 3F65A 2FX8L 4HEPG 4WW2A 4IK7A 3RWJB 3KNBA 4K8RH 2OFQA 3GNMH 5ALBL 2HJKB 1ETB1 3ALPA 4K4KA 3T8VA 4IEFA 4CU7A 4JZNA 1HL8A 4J3XA 1ASQA 2E59A 3SE3A 2ILLA 5DMGC 4Z3IA 4K8RD 3LTVA 3MACL 1IQWL 5MENB 4BXVA 4WFFD 2NY5H 4ZQKB 2V4LA 2VDMH 2WLJA 2X2JA 3GZQA 1S7SA 3HMWL 1F97A 1OM3H 4N3UA 3ZGIA 3QHZL 4NHUB 3WXWL 2GJZA 2EH8H 5DFWH 4KQ3L 4PWHA 1KTJA 5IROC 3LDBC 3CXDH 2K0RA 3Q5YA 4JQVA 4U6XA 1KIQA 4X7SL 1JPSH 4NFDA 2EDOA 2BIHA 1U8OB 1EO8H 4Y4KB 1RZQA 4JJOA 5F1IB 1N6VA 1UC6A 2DYPB 1VPOH 2X89A 4ZS7H 3TFBA 3HCVB 1EXUB 4DN3L 5B8CC 2AJXH 5KBMA 3TF7C 2BSSB 3EYOA 1I3RA 4FXGC 4N2AA 2YAEA 1XWVA 5IHWA 5D8JL 4LLDA 3OKEB 1HYSD 4PJ9A 2K8QA 5IF0A 4NQVA 1T21A 2NZ1A 2D3NA 4GAYA 5JIPA 3MCYA 3HLAA 1L7IL 3GMNB 1U6AL 3OB8A 1DEEB 4WHTA 2HVKB 1HAUA 1MI5B 3HFMH 1NWOA 4NZRH 2PTVA 5EF3A 5KW9L 1IILE 1E9PA 1S4IA 1JV5A 2MQGA 3ML8A 5CD3B 2X1PA 1J9QA 1L5GB 1SY6L 3BDXA 3F01A 4ZX4A 3G6DH 1C5DA 1DANT 4DGIH 3PL6B 4UILL 1AO7E 2HG5B 3B7SA 3BVVA 3GSVB 4ABWA 1RV6X 1NC2D 3W81A 3GBDA 3LPGA 1FL5A 2A6JA 1WCBA 3GBML 4BJLA 4HF5L 1JGUH 1QUPA 1DTUA 1IGTA 5EA0H 4XO8A 4HKJA 4BWWA 5DF0A 1SXSA 1C5CL 1YJDC 5DQJB 3IYLW 1N18A 2DQCL 5EU4A 4Y1AA 4U0RB 1M53A 4JFVA 1U8PA 3HE6C 1S7RB 1A1MB 4Y19E 3VI3F 2MCPH 1ZLUH 3VWJD 3GSUA 1JPTL 4BWTA 1TVHA 2UXGA 2BFVL 2F61A 4LEXH 3D85A 2BHFA 3B56A 4HLEA 4IOFD 3RAJL 2IWEA 2O6DA 1WE5A 4A7SA 3B8SA 3E0GA 1JZHA 5IGXL 4WWKB 4N8VG 5AW5B 1J9SA 5D96B 5JUEH 3S8FB 1XH1A 4HZLA 3ISYA 5B39A 1XD1A 5IFHL 3QIBD 5TK4A 1VGKB 1IZKA 2FJSA 3IFNL 4FQQB 2FL5A 4NJAH 4F8QA 3MLRL 5C0AB 1OAXL 2IANA 4FQCL 5E1IA 4F7TA 2BSRB 4P5TA 3QHZH 4ZDHB 3DMMA 2FL5B 2FO8A 5LBGA 5K9QG 2EH8L 1WZ1L 2HAZA 4YE0A 3P3SA 2IGFH 5ISZB 3O8XC 3GMOA 1YMHA 1PMYA 3P54A 3I6KA 5EIIA 3R06B 4WWKA 3KYMB 1OV8A 4LP5A 1SLVA 1MFBH 3HB3B 5EA0L 4GG8A 4HD5A 3CHOA 3RPIA 1TVHB 2C3XA 3B7TA 3CK0L 3HS9A 4A2GA 2IAMD 4F9LA 5B3JF 5JDJA 4DUWA 2EO9A 4LCUB 4OD2A 1G6RB 1UT9A 1ADQH 2N4IA 5AOZA 3P11L 2YEZA 4HXAH 5HYSB 3H8NA 5CINH 4G6JH 4WO4D 1P5VA 2VDKB 4GQQA 2WIIA 4PS4H 2WXFA 5C9JA 5I66B 1IGTB 1PJ9A 1EEZB 1TTGA 3GI8H 5FF6B 4PGJA 3PWLB 2Q0ZX 2PN5A 5D1QC 3W0WD 3BO8A 5C0ND 5DD0L 2FJUB 2GCYB 2VDQH 4ZUUA 3SKMA 1ZK9A 2PWFA 3GSVA 4WNQB 4MAZA 2E7MA 4JG9A 3ARDC 1K8DB 1IC0A 3VFOA 2XT1B 1JK9A 4KK9D 4L05A 3NEOA 4D9QD 3UYRH 1KEML 1B88A 3V8CA 7PAZA 4FQPA 1PDKB 3KPSA 2MCAA 4PRIB 2WOBA 5DUBA 3CMOL 2HVKA 1D9KC 3BX7C 4QTFA 2CBMA 4BZ2A 4KFZC 5IJDC 2QADD 5IVNA 1IKNA 3QJFB 4YXKH 3HLAB 2D7QA 2V7NB 1GY1A 4B9CA 3VCLA 2KDYA 4JFEE 4NO0B 2AXGB 4OCSH 4W1TA 3G9AB 1UJ3A 3SE8H 4LLDB 4I77L 5E8EB 4R0LC 3MOAH 4UQ3B 4HDIB 3Q1SH 2BSSA 1F4AA 3CUPA 1MCLA 1PF3A 3QULA 4W9CC 1BD2D 5LBSA 1EXUA 3TEYA 1A9VA 1A02N 5DD5L 3WLBB 2DYPA 1KPUB 3QEGH 2ZUTA 2FT6A 2PKDA 5IK3A 1JZFA 4BFGA 2MMXA 2CLVA 4XMXA 4TVPL 3ABLB 2NZIA 4XCFL 1G84A 3AJ7A 4F33B 3BMVA 5LG1A 1LDSA 1S46A 3VGDA 3TLRA 1SJHB 1U3JA 2ED9A 1MIMH 4PREB 3CFQA 4QRPB 4TQIA 4JO4L 1GHFH 3I6GA 1TQVA 2XZAL 3OB0H 1H9VA 3AT8A 3PL6C 4QHUB 4YAQB 5SV3A 4B3EA 5B38A 4YHOH 1SZNA 3IJSA 1IBYA 4UNVA 1WF5A 2OR9H 4QO1A 3G5YB 4PJHF 1SF3A 1DN2A 4Y4FA 5ANHA 5EU7E 3WXVH 3V5KA 5FK9B 4PJXE 1MY7A 1AO7D 3GO1H 1HXKA 4FKKA 1L0QA 1XGYL 1XGPA 3LQAH 4EOWL 1JAEA 4JZNB 1MPAL 2GSIA 4LKCB 2V5SA 1NKGA 2HJKA 2J44A 3TVMA 3Q3GA 3KNBB 1GGCH 4UOJA 5F7NC 4GW1A 5JHDA 5KSUA 3TJHC 3HRZB 3C8DA 2WC7A 5GRJL 5J3HD 1S78D 1SMAA 1J1XH 3UGEA 4D9RD 1SYSB 4BUHA 1BDYA 2P8MA 3TZVB 2NY7H 3OQ3B 4FTDA 4BH7B 2WWMC 4BK5C 1KWKA 4P5TC 4KTYA 5IJKC 1MLCB 4EN2A 1I3VA 5J11C 3BD4A 2ARJA 4D7BA 3S96B 3B9KC 5JHAA 4XB8A 3JV0A 3AU0A 1OHQA 3ATDA 2W07A 4Q14A 3WKNA 3IDGA 4XN8A 4N2EA 1FDLL 3FQWB 1BZEA 1KCBA 1KBVA 3MV7A 5D1ZB 2NY0B 3GT6A 1DVFA 2MOVA 3IAPA 5FA4A 3UZQB 1OK0A 4AEFA 4JAMA 2DQIH 3FOMA 3E8VA 5BQ7A 1GKEA 1I85C 2V7HB 1CGVA 4I89A 1Z9NA 3IVKB 3FTVA 3HN3A 3V4VA 1YPZE 1HDMA 1HXYA 2W9DL 3O3EB 1NCDH 4KK6D 1Z6JT 3CFUA 1E6JL 1QWNA 4G3YL 4J3SA 4JHBA 2DL9A 4I2XE 1AY1H 4OZHB 3MNVB 4ZAKA 4CRPA 4NN6B 1DZBA 5D70H 1AYOA 3FU5A 1KZYA 1P7KA 3RDTA 2NY1D 4IS6A 2ATAA 1QEWA 2NY6C 2JIXB 2UUDK 3BGAA 3GLEA 3FFCD 5EWIL 3U30C 1OTSC 4BDVB 4X7DC 1W72L 4Z77B 2ZKHL 3CVHL 3C6LD 2R27A 3BFQG 4WQOA 4ZMYA 1S7QB 4IBLT 2Q2LA 4YBHA 4EDWH 1GAFL 2YGPA 4YLQT 1XTLA 3V79C 2QGEA 2P44B 3LKRB 4JFFD 4WUKL 1I8LA 4BWUA 2QVKA 1UKSA 3G6DL 4N8UA 1OK8A 1NSNH 3CSGA 1M56B 1P0SE 4MMZC 4AIEA 5HDQL 3MI6A 4MS6A 3IE9A 3ZO0A 1INEL 4M43L 2EE3A 4BZ1H 2CM6A 3AWFA 3EH2A 1UJ3C 3OVUB 1TZHB 1A4BA 5EUOF 5EMYA 2WINB 1KJ2L 5CLTA 3RDTD 1ZAGA 4D9QE 5L2JA 2EVHA 2E9GA 3SD2A 5GHWL 4IHOA 3OXSA 3QI9C 5BRPA 3T08A 1H3VA 4HS3A 5L8KB 3PAUA 1BXUA 3N41F 4ZFFA 4GS7C 4U3CA 1PZCA 3CTTA 3JXAA 4IRSD 3CLEL 1WFJA 1P69B 5AAPA 3S3SA 4MD5B 3AGWA 4Q9BA 3OG6B 3P73B 1I4FB 2I5YL 3HI6L 1BD2E 1T5XB 4BHUA 1LK3H 4RGND 5C09D 3SPJA 4WTXA 4HSQA 3WFHB 3NCBB 1U58A 2YPVA 3ULUC 1KF9B 1L4IA 1VGEL 2VKWA 2PCFA 4PJIA 4XP4H 3TCLA 5HYEA 2PWGA 4LQFL 5JPMB 1XCXA 2EE9A 3MRLA 2Q8AL 1AG0A 3O4LB 4JFSA 4G43A 3TA3A 3DVGA 3FUHA 4NGHH 4NKOA 3D18A 4GKNA 4OBRA 3KYKL 4IJ3B 4ZOCA 1ZEAH 1IEBA 3MSPA 3QCUL 3UZVA 3CIQA 3C6LB 3MUGA 4KVCL 3UG5A 2FGZA 2H5UA 2ZUQC 5E1AA 1DE4A 3DHMA 1UM4H 4PCTA 1CTMA 2WKOA 3DTUB 4FNRA 3WY1A 2Q5BA 4YXHH 3O4LA 1B4JL 1S7XB 4LVHB 1U93A 2ZYHA 5AKSA 2AGJL 5T3XD 4YNYB 3T77B 1AY1L 4PJIB 5KWYC 3ABKB 4ANWA 5BRZA 2P5PA 3VO0A 4XXWC 3P3TA 1QEXA 3QQ9C 3ARFD 2M26A 2V17H 3VXSA 2BSED 1OY3B 2J6EH 1HHHB 1RURH 2O6EA 3D2TA 4X99A 3KYOB 1UWEH 1KIRA 1JZGA 1Q72L 2APXA 3TT1L 3ARGA 4KJQD 3WL9B 2Y07L 1TFHA 2XWZA 3RURA 5IB2A 4XVUC 2EEBA 2WVSA 1XFPA 1URLA 4G9FD 3Q6FB 4TUOA 1KJ2A 1ZEAL 1Y1DA 1QRND 4PV9A 1FV1B 1O0VA 4D0CA 4DO6A 2MOGA 3FT3B 3L1OH 1CLCA 1RHFA 5C92A 4QRRA 4K5MA 1HI6B 3TNMA 1G5AA 1K2DA 4ZW3A 1OAXH 1A6WH 1W0WB 3BPCB 4LCCA 3ZDYF 1Q9WB 3LZQA 3ML9A 1P9MA 1EAQA 2IWGA 2IDFA 2VDQB 3ECBA 4OQTA 3FTGB 3EYUL 3N6YA 4P23D 4U1NA 1KN2H 1DEDA 3NIGE 3V6FA 4YXLH 1R46A 2GJRA 3QEQA 1RP8A 5FYKH 4F91B 3FUIA 3UAAA 4XPHL 3QWOB 1YEKL 3LKOA 1S7QA 1C16B 2GITB 1E4KA 4B9YA 3RGVB 1JHLL 4WVRA 4Z77A 4L0ZA 3TO4C 2YSSA 4XBPA 3R4DA 4L2YA 4EUPG 5DWUL 1I8MA 2PO6A 3C5ZB 4JG1L 1D7FA 1WFNA 4IHBA 4UT9H 3R0MA 3RL2B 1QHQA 5B22A 1ZV9A 4N0YH 4L37B 2AQTA 1RZ8B 3WUWA 2IQAA 3VXMB 2XWCA 3FW6A 2K7QA 4JCLA 4KJYB 3SO3B 3NSYA 2ZNWA 2EEXA 2GB2A 1HDMB 1S7UA 3HN5A 4GP8B 1RZFH 2WXRA 3K6NA 1T2QH 2H9GA 3PHQA 3V4VB 2IPKA 1R17A 1FPTL 1J8RA 1HNYA 3O6KL 5I6XC 5DSCB 4ZPVA 3O0LA 4AM0A 3DNKA 3OPUA 1MPAH 2V37A 4AVJA 1PKQB 2BJMH 4UTAH 4BQ6A 3ILPB 3MV7B 1WAAE 4HAFA 4L4JA 3ZVVA 3FRPG 4U49A 3WEMA 1MJJB 2IOIA 3W9DA 1JDCA 1QZNA 4N1CA 3U4KA 4APQC 1JWSA 4M8QB 5L4MA 1ZWIB 1H6TA 3EFOB 4YEFA 2H0EA 2VISB 2R1WB 1MLCA 1ODUA 2ALWA 2HUHA 4MXWL 1PX4A 3MPCA 3QHFL 4R96A 3WY2A 4ONGH 1HILA 1JNLL 2VDRB 3SJVE 3FT1A 1OZTG 2Y7SA 4X0NA 5D8JH 4EI6A 1PG7H 2R1YB 3FUJA 3H9SE 4HPOL 4R0LB 1URIA 1OTTC 4QXUL 4WWKC 3L3IB 3HRZA 4FAAB 5HJBA 5C09E 1UOLA 3CHPA 3ESVF 3MOQA 2CKBB 4IKLA 3T0EC 3EGXB 5HJ3A 1Z1WA 3TGXA 4LKCA 1AOHA 2Y6SC 5E23A 1ZV2A 3ZT5A 4X7TB 3NVQA 4UQ2A 4Q2ZA 1L7TH 3NJLA 3M7FB 1UWXK 1ZLSH 1QW9A 12E8L 1HL9A 4PGCA 2XTSA 1NPUA 1IAIH 3UTZA 4LLWA 1T2XA 2H3KA 1E3XA 3BH9A 3G5YA 4YDJB 1I8AA 1HHIB 4PB9H 2YIHA 4G8GA 3TPKA 1LL1A 2ZP8A 2A9NL 4HW6A 2QKIC 4XCYA 1RUQH 5FECB 2FJFB 3ARDA 3PREA 5DVMA 4DKEH 4BFRA 3QWRD 4EE2A 4YS4A 2CGRL 3L95B 4DJMA 3L2NA 1EDYA 5GSVB 3ZX1A 4L8CA 1U8HA 3BDYH 2A4EA 2A9CA 4YC2C 4QAMB 3FB6B 4DO5A 4ISVB 5I71B 3Q44A 3VCLB 4YGVA 2V7NA 5D6CB 4FFZL 3VI4F 3LN9A 1ACYH 1RUKL 4AYDC 1IGIH 3EUUA 4X6DE 4FXGB 4KXBA 1CDYA 4ODUA 4KNSA 1L6ZA 2IMMA 3HNSH 4XPGL 1WZAA 4YDIH 1S9YA 2CUIA 5L88L 4Y4KC 3MLSL 1OZUA 4AW4A 1MJUH 1LXMA 3BGFB 5D4JA 5IT2L 1JNJA 3ESMA 2G3NA 1CXFA 4UM8A 4MMYA 1BW8A 4ZUUB 2VDNH 1XV8A 1T1ZA 1TQCB 3ZLQC 4CBZA 5FO8B 2Y7OA 1G7PB 1F41A 1P4IL 2OL3A 4P4KA 5KVGE 5JPNC 3PP4H 2BSDA 1F11B 2I5YH 4QTHB 3BW9A 1HZHL 3DWTA 5H35A 2COQA 2ZXDA 3QQ4A 1CI5A 4YDVA 4R7DA 2ENQA 1AYRA 1KBWA 3HE6B 4MASA 2MOQA 4ORGA 4DAGH 5AEAA 1PQZB 5C0CE 4GW5A 1G7HB 4EIGB 1J9CT 3FQRB 3ZHLA 4BQBA 4F8NA 4QKTA 3HG1D 4E5XA 5CAYB 1NBVH 1DQVA 2BNQB 1RP9A 3FH7A 2VLKA 3MJ8A 3O6LH 4L23A 4TPRH 5F1NA 3T04D 5E00B 5FOBA 5TDOA 4ELMF 2JKIS 3PPEA 4GO9A 2JJUA 4DHLA 2YJLA 4HZ1A 1N7MH 2CBPA 4MXVE 5KYXB 4ZDHA 1NSNL 3QO1B 3CBRA 3GKZA 3HR6A 2FSEA 4F7TB 3QIWD 4UANA 1KXQE 5TGBB 3TH3T 3ZZQA 3BFOA 3ULSB 4X4YB 3OKOA 1LDPH 1OWWA 3PHSA 2F8VA 1WHPA 2YMXH 4CSPA 4DGIL 3PP4L 2NXYD 2Z6FA 1HWGB 5L0QB 1LP9A 2OW6A 1D2OA 1SY6A 3REWB 3BN9C 3SE8L 3GYRA 2EXYD 4X8JB 3WNJA 3L9RA 1J5HA 4HEMA 4X6CF 5E03A 5I23A 4DPAX 1R6VA 2CO6B 4NN7C 1H5BA 1WYJA 4FQ1H 4PRID 5EU4B 3QIBA 3QEHB 2BOBA 3S6CA 1EZVY 1Q9KB 4XO3A 4FQLH 3K6OA 5TF0A 2QT6A 4IM8A 2NSMA 2E8YA 1JL8A 3IEAA 3INOA 5HJGA 5DYFA 4HFWA 5JIMA 1TEGA 5A2AA 2ITEA 2HT4D 1LD9B 3JWDC 5HHXH 5AAMA 5CJQL 3D09A 1E9QA 5IFHH 2F1EA 4J4PD 3V0WH 4OU3A 3ARBB 2QTVA 1AS7A 2W92A 4YHZL 1RI8A 2NTFB 4QMEA 1F4WH 2WXOA 4N0UE 3RWGB 2CAKA 2IAMA 3QC5X 43C9A 5HHPA 1AFVL 1JGLL 4YHKH 2DEWX 3IDMA 5CN3A 1U8JB 4QPEA 1OPGH 5KYNA 4MCNA 4WWOA 3MV9D 2CLZA 5ID0B 1HFUA 1WDAA 3RIAK 2NX5E 4KVPA 1L9NA 4P5KB 3TA4D 3VDAA 1U8QA 4PJ9B 5IF0B 3CDZA 4QJ5B 3JVGC 4PJAE 4GG6F 3IPFA 3FL7A 1PNDA 3KLLA 1YUHB 4X6BB 1ZS8B 2E3VA 3S37X 3T0EE 4PBWD 3B9KD 1BMGA 4BBWA 3HCVA 1HH9A 1MH5B 2BC4A 3MV8D 5D2LB 1XF3A 1F6AB 1MCKA 4ZFOB 1FG2A 4ZT1A 2V5RA 2Y07H 1WIOA 4GW4B 3TO2A 4POYA 2EDRA 1QSZA 1XCQB 2GJZB 3KLHC 4TVUA 2BY3A 2ICWJ 4NHUA 3HPLB 3PU7A 4FLHA 2VN5A 3QJOA 4JJHA 4RNRA 3K5SA 3RUGB 2C5DC 2GJ6B 1A6ZA 1F3DH 1BFTA 5ECGA 2HFGL 2CGZA 1QFOA 3CFJA 3WTUA 1SMDA 4L9DA 3ATBA 2J5LC 3SCMD 5LAPA 3ARYA 4N8CL 2HT3C 2QJDA 3H7BA 3NZSA 1X5IA 4IKJA 2NYYD 4JQIA 4AEIH 3NFPA 4GAJL 3J8F7 3E80A 4TL4A 1RZJH 1ET8A 4WW2B 3RWJA 4LCVA 1NBYA 4U1MB 5MERA 4QOKA 1CCZA 4ODWB 4F7MA 4WFGE 3ASNB 3MAWA 2Z8SA 4B27A 3QDGD 1CG9A 1JD7A 4KJPD 3DURA 5F72S 4WJKB 1Z5LB 3VD3A 1A8ZA 2R0LH 4JY6B 3UDWC 2KLSA 1I7TA 1CS6A 4ZS6C 4QRUB 4R5XA 2YQ3A 5CP3H 3HG1E 5LXVA 2QDWA 2XRAH 4PJGE 5TJWK 1KGCE 4Y5XC 4PPTA 3VGHA 3TIDB 1HL5A 4UDTA 2DLFH 4H8VA 1CXHA 2ZKYA 3WS6C 5JHDD 2XV3A 2FK9A 4HCFA 5FV2A 1M2VA 1F1GA 3TVMD 4PCYA 2B5IB 5LB1A 5F3BA 3UC0L 1C1EL 1SEQL 5T1DH 3UYOD 1W8OA 3HZVB 1J18A 1B6UA 4NKDA 5ITFB 1Z0MA 4CAGA 1E40A 1Q0EA 3K80A 5EC1B 1D7BA 5IVXE 5HHQB 5IMKB 2EVJA 5A6MA 4AL8C 1ZANL 2EE2A 4N0CC 4J1UA 1EDHA 4S1RH 1AHMA 1CICD 1C12A 2VLJA 4TUKL 4MKMA 4DZ8A 5LJYH 2M1KA 5ERWA 1LK2B 4J6RH 3EW3B 3WTTA 2NY4D 4JREC 5E2TL 4WENB 1BG9A 4GKSA 4DIXA 1XGRA 3QQDA 2QSCH 4JFYB 4UU9B 4EZJA 1MVUB 1N26A 3DVFA 5D5MB 3VXRA 3CX5K 5CSZA 3QK0A 3PGFH 4LOFA 1WS8A 2H1LM 1Y0LA 1TKWA 3AM8C 3N85H 5I76B 1D9KD 4RBPK 4QHPA 1PW3A 4XH2B 1MQ8A 1R3JA 1WH0A 1P5UB 3EJJX 5JLZA 2JQAA 5CN2A 3WN5B 4RFNC 3X12B 3X14B 1E28B 2C7FA 2ZOKA 1L7TL 1OAKL 3MUHL 3RVVD 1RZKL 1ZHBA 4KZEL 1MHEB 4OCXL 3MREB 1VADB 12E8H 2O5ZL 3FPXA 5F7EH 2P52A 1O9ZA 1LE9B 4L9LC 2R69L 3ZTJH 1A1OB 4LLUB 1XGQB 3UTTD 4NZDA 4KUCD 4AEHH 2AABH 1WWAX 2CHDA 4F7EA 5HYJE 1L6XA 5EPMB 2AZUA 1ZLVK 2J8HA 4AG4H 5D7SH 3C5ZC 3WFDL 1BVLA 3CFMA 4HZAA 2XSKA 1BYNA 5IQNA 1NFDB 5GS0D 4KITB 2ZUWA 3U9PH 5I2IB 4NRXB 5F7HA 5FPIA 3NA9H 4QI3A 2YXFA 4ZO9A 2E7DA 3KPTA 1WIUA 3IN0A 4KOCA 4UBDC 4A6YL 1BLNA 2CR0A 5IOPB 3E6HB 1ZDQA 1T89A 2M2DA 2GJJA 4B97A 4PWEA 1EA9C 1Q38A 2R9HD 1RIUH 5IFAH 1OSPH 1LJMA 3ZE2F 4XNMB 3ULVH 4D7PA 3BQUD 4HG4J 3PIQA 1S7TB 2N56A 1KV3A 2ALAA 3MNZB 3THMH 2EDEA 4FG6D 2YBRB 1U0QA 4K5LA 4Y19B 5DQ9A 2QSQA 4AH2B 2VN4A 3NCYS 3A5VA 4PY7A 4QRFA 5DZNA 4MQTB 4HKBA 4D3CL 1P6WA 3FONB 3SODB 4XCEB 5T3ZD 2Y9RT 1OLZA 4M8VA 5HPMA 3ECUA 2PUQT 2LTQB 5C3IA 2AV1A 4D0BB 2YLHA 1FZOA 1BQKA 2EDYA 2E7BA 3T0XA 4H13C 3U7YH 4FTVD 3GJFA 4OGQC 4PRPE 4U6TA 5DD5H 5CEZD 2FYVA 4M7KH 4XHJC 3F62A 1B4RA 3SSGA 4YSAA 5AVXB 4A55A 1YN7A 2QGBA 3NFSH 4Z95L 4N3TA 1IM3B 1WHOA 4YN3A 2OXGB 2A6IA 4TVPH 3W9EA 1LGVA 2EE6A 2WBJB 4MVBC 4XE5B 1AKJD 1L9QA 2GK0B 5E6ZA 4JRXE 1L6PA 4IBQA 4JS7A 3UAFA 5IHHA 1H3PL 5T5FH 3CZUB 4FLQA 1X6NA 1TEYA 4MHHI 5DK2B 3HAEA 3NJGA 3B43A 1PD0A 5F88A 4AK1A 5BUAA 1S7WA 4PJIF 4X2UA 3AG4B 2KERA 4YZFF 1KBGH 4HSCX 2XPGB 3C6LC 2BXYA 2X6VA 2HH0L 3DDFA 5CN1A 2RQEA 2WLZA 5DC9B 1GKOA 3TV3H 3V4UL 1QBMH 5HPMB 4XCEA 4J27A 4PV8B 3HOGA 1CXKA 4ZQTA 1OIOA 3V5HA 1Y18B 3G6JE 4G9FA 4K7PX 1I1YB 3RRQA 3MNZA 5HBBA 2PPAA 4B50A 3TBWB 3PIQB 4WO4B 1E9OA 2ZWKA 3STLA 3U6RA 3DVNA 1UUNA 3OAYH 2OMWA 4PGZA 4DN3H 1Z3GL 2J6EL 2VDPH 4QRRD 4F2EA 4NUJA 4B5EA 3JYBA 4P46C 4RZKA 2CDGA 5DRXB 3R1GH 3VVVA 4CU8A 3VXQB 1AZVA 4M4PA 3KPRB 4DP8X 2R29H 5IM7A 1M7XA 5ETUB 4JLRA 1RERA 4HT1L 2QLYA 4L9LA 2IFGA 3LXCA 3NJFA 4AMWA 1KDJA 4Z7OE 2CLRA 4X5XA 3ALWA 3EGSB 3DIVA 3MGTB 5J1SC 1MCWM 2UZYA 3L7FB 4FOMA 4K5OA 5I0XA 5I2IA 5IREA 1X9LA 3MFGB 1NFDA 4RX4D 3EBHA 1U42A 1J8HD 2A74C 2RGSA 1UA3A 2WV3A 4HF5H 5DJDB 1V7ML 4BK4A 5MENE 5JDSA 1FWXA 2EYTA 1WTGT 1QFUH 3BAKA 5I1HH 4MD4B 3LQZB 2ITDA 5CO1A 3WGUB 4DPRA 5J9PB 3DX9A 3DOHA 5HDLA 1UEYA 2C1OA 1LWRA 2BVQB 4WEBL 1CWVA 2VE6A 2QELA 3SOBH 5D93C 4TSBL 4ZTPH 2RJMA 32C2A 3BCFA 3X1GA 4LEXL 2OYLA 4DUXA 4KGJA 2HTKC 5GS1C 3KBPA 4IU3A 1COBA 5J12B 1E28A 2ZOKB 4Y16A 5B3SB 4ZSOA 5IEHB 3KL5A 4XH2A 1XGUA 5FO9B 5JO5A 3VD0A 3KBEA 1DQQB 3QNZB 1W91A 3S37H 3TIEA 2YWZA 1FYHB 1K3IA 1FF5A 1D7CA 1OCWH 3WHXA 1I8IB 4Y4KD 2BHZA 3KDPB 4O2EB 3OKYA 1CD1A 1DVYA 2XZQH 2DQDL 4OH2A 5CSZB 2ZXWB 3QYNA 3S3JA 3FMGL 4XNUL 3RGVD 2B1HL 4L4TB 5HI3D 4JFYA 2ADGB 4XO5A 5JHBA 3NTCL 2K3HA 2BP5M 2AK1L 2NLJA 2X4RA 5AYQA 5EZIL 3VVWA 1M7UA 1U92A 1UT1A 4CGUB 1IAOA 6PAZA 1SY6H 4PFEA 3BJ91 3QQNA 2VLJB 4AQ1C 4DZ8B 5I1HL 2E76C 3CVCA 5I6MA 3V6OC 2IH1B 2X42A 3UJIH 3EJYD 1BQUA 4L8BB 5T3ZE 3LB6D 3ZTNL 5IW1B 2DY2A 2ESVE 5MP6L 5J11B 5CNHA 2WSDA 3FB7B 3MBWA 2J8UF 5IMLA 4G9DA 2HVJB 1ZOXA 3MUUA 1MXDA 4LP4A 1MQKL 2UZIL 4NM8H 4H88H 3VWKC 1NMBL 4JO3H 1KTDA 1OF0A 25C8L 5E95B 5HD8D 1IEHA 1KCSL 3N1PC 4M3KB 3RDJA 5IUCA 4OFKA 4F7PA 4K8RL 3L48A 3VH8A 2K6WA 1P4LB 4ONHB 4KRNA 4P46D 3TWCL 5FW6A 1KBBA 2KKQA 2NZ9D 4KZDH 3EF7A 4IU2A 1QSFD 1TCRA 2VLKE 5HHVL 3D39D 5T1MA 2OL3L 1JOIA 4BSJA 3LNDA 3ARDD 2F0CA 2X10A 4AJYV 4LVOC 4ICXA 3MRCB 3VRIA 3BP5A 4ETYA 3IMTA 2VDKH 4HKXA 3CE1A 4Q97A 2CDEB 2XC8A 2Z1KA 1ED3B 1QNZL 1BX2B 5MERB 2VERN 2WXGA 5BVJA 1NBYB 2WCGA 4U1MA 1HX0A 1DFBL 5CIPB 4HD9A 5F93C 1WC7B 2OZNA 4M6NL 4ZW5A 1TTFA 1XO8A 3Q8BA 4U1KA 2JXMB 1A3LH 2ITCA 2H32H 3U9WA 4NENA 3W39B 3GMQB 3UADA 1PS3A 3I3EA 4ELKA 2FIRT 3T3MB 5I6KA 3MRDA 3RUGA 4XXCA 5EIIG 3KJ6H 4XRCB 1E6OH 1UB5A 4U7SA 1VEMA 4XN9A 3HFFA 3OGCA 2JB5L 2UZXA 3KPQB 5DR5H 4C56A 4ZI8A 1T7VA 5L4FA 3T3PE 5F2FA 3CD4A 2QQNH 5C7ZA 4ZMNA 3QIUA 4YHIA 2DH3A 3EJZC 4NQCA 4KO7A 4HOZA 1XSKA 5EBLB 4ZFOA 4L5FE 1J48A 3QJVB 3S8GB 3A6CH 4GPVA 4XPTH 1QFPA 3V52H 3L3KB 4MZ3A 2DBLH 5H8DA 3LKQB 3QUZA 5C09A 4N6RB 2QZQA 4PJDA 4X6BA 3T0VA 2BRRL 5HI3C 2QMKA 4H1LH 3P9LA 3QXTA 3UDWA 3MGOB 4JVPA 1UCBL 3MCLL 3QDMA 2ZX9A 1HE8A 4FXKB 5F7DB 1QBBA 3UJIL 2HTKD 2CLZB 4J3OG 1QVOB 1EFXD 1FRGL 3UO1H 3IMRA 1Z9SA 5C0DB 1TYRA 3D85D 5T5NF 3BUYA 5EZLB 4W70A 1P2CB 3IDMB 5LCVH 4G8EB 3Q05A 5HHPB 1FSKC 3PRZA 2AEWA 4XVTL 3DK2A 1ZDSA 3RWGA 3MUZ1 3WV0A 4HGKC 2XKNA 1T66C 4GNKB