2YRBA

Solution structure of the first c2 domain from human kiaa1005 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
156
structure length
156
Chain Sequence
GSSGSSGDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein fantom
publication title Solution structure of the first C2 domain from human KIAA1005 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yrbA01
4IQHA 4PS3A 3T8MA 4FHJA 4EZJA 3QARA 3CSTA 4PS7A 1BDYA 2WXHA 4Y1SA 2WXNA 4LT7A 3F01A 3L4CA 4OVVA 4KITB 3S2AA 2NCEA 3RPBA 4L23A 3OAWA 4XZ4A 2ISDA 2CHWA 5CCHE 4ANXA 4QAMB 3RDJA 2CJTA 2WXKA 2WXRA 2WXFA 1BYNA 1WFMA 1DQVA 3APFA 4ANVA 2ZKMX 2A4ZA 3B7YA 1UOWA 2ENJA 1V27A 1DJWA 3PS6A 4MJJA 3F05A 3CSFA 3LJ3A 3OHMB 2NSQA 3M7FB 1HE8A 4FLHA 3ZIMA 4LDCA 2EP6A 3JZYA 4HLEA 3IM1A 4WWNA 2CHDA 1E8ZA 4EZKA 4FJZA 2DMGA 2WXGA 1K5WA 3NSJA 3IBEA 5JHBA 2B3RA 4DNLA 2WXMA 2R83A 3DBSA 4AJWA 3PRZA 3FBKA 2DMHA 3FDWA 3PFQA 4KZ0A 4QJ3B 1WFJA 2CHZA 3ENEA 4XE0A 3QK0A 5CCGE 2CM5A 3TJPA 2CHXA 1UOVA 3GPEA 5KJ7E 4TS6A 3QR0A 4FADA 2D8KA 2Z0UA 4QJ5B 3APCA 4BGDA 1YRKA 4NPKA 4HVBA 2K4AA 4FHKA 1DJZA 4KZCA 4ICWA 5JHAA 1CJYA 4NPJA 2FJUB 4EZLA 3APDA 4WWPA 3KWUA 3W57A 2KI6A 1DJYA 2NQ3A 2WXPA 1BCIA 1DJXA 2QZ5A 1DJGA 3PYCA 3N5AA 3R7QA 3NZUA 4WEEA 1UGKA 3QJZA 3KWTA 3ZVVA 4LCVA 4BFRA 3NZSA 4DK5A 2CM6A 1DSYA 1RLWA 3QR1A 1W16A 4JPSA 1E7VA 1GMIA 4L2YA 2Y3AA 3DPDA 1E7UA 3TWYA 4WWOA 3MJWA 2N1TE 3TL5A 3HIZA 1E8YA 3L17A 3F00A 2BWQA 3HHMA 3L13A 3ML9A 3ML8A 3ZW3A 2WXJA 4TUUA 3L08A 1TJMA 5G2NA 3SD5A 4IHBA 3W56A 5CCJA 2K45A 3L9BA 4NP9A 3QAQA 1TJXA 1DJHA 3HN8A 4PS8A 3P2BA 2ENQA 3L54A 1QATA 1RH8A 1W15A 4TV3A 4G11A 3R7RA 2LHAA 3L16A 2QZQA 4F1SA 4F93B 4QJ4B 4Y1TA 1RSYA 5G55A 4FA6A 1DJIA 5EDSA 4NS0A 5T8IA 4URKA 4OVUA 4WAFA 4GNKB 2WXOA 4GB9A 4F91B 4F92B 4L1BA 4ANUA 4J6IA 4L1LA 2ENPA 4FJYA 2JQZA 2X38A 2A5UA 2V4LA 5H4YA 4FULA 2K3HA 2WXLA 1QASA 3PREA 1E90A 4ANWA 2RD0A 2YRBA 2CJSA 1E8XA 4XX5A 4V11A 2Q3XA 2WXQA 4ICXA 4A55A 2YOAA 4AOFA 1E8WA 2K8MA 2WXIA 2FK9A 3F04A 5H4ZA 2Q0ZX 2UZPA 1A25A
chains in the Genus database with same CATH superfamily
4MMYA 1CGWA 2HT3C 4K7FB 4CMHB 4Y4KB 1YJDC 2NY4D 4MNQB 2KZ1B 4A7VA 2EDOA 5E2JA 3Q7JA 1NOFA 5L88H 2MNWA 1KCWA 3IFLH 5IBUG 4L18A 4JO4L 3ASWA 4HFUL 3ARXA 2VLMD 4GRWH 2NUTB 1Q0YL 2A9DA 1ACCA 2OL3A 5CFHA 3IVKA 2LLGA 4WEMB 2VZ1A 2K6ZA 4QWWD 5KANI 5C6TH 5AOMA 3QUYD 4J3VA 3JZYA 4M62L 2AVGA 4Y5VA 2G4EA 4MA7L 3CH8A 5CZVL 1KXQA 2WMPB 3DGDA 2NY6D 1IGFL 3BH8B 4FQJL 3COOA 3PFQA 3OKNA 4PWEA 3RWGA 3TP4A 4XC1H 2WCGA 5F9OH 2ATKB 3WTSA 2BVPB 1WT5C 1YMMA 8CGTA 1TSRA 2DJUA 3SDCA 5CJBA 2PETA 3BPOB 4HG4J 3BKYL 3HCVB 2IPKA 3HG1B 5BUPA 4M7ZB 4WWKC 2DLHA 3EJZC 2XVBA 3W2DL 4BK8A 1UA3A 2GJJA 2ZICA 5EUKA 2C9UA 2RALA 4UBDD 4YQXL 5DCCA 3ZR6A 3S36X 3V0IA 5GRJL 3MRFB 5ITBH 2WTPA 4RQQA 3IFNL 2WZAA 4KQ3H 2XN0A 4CRPA 1KN4L 1FNGA 1AGFB 3U6RA 2ZZUT 4PTTA 1UM6H 5G2NA 2IQ9L 1TTRA 3R1GL 1M7IB 2NX5A 5DMKB 4EOWL 3LRGA 4APQB 2MFNA 2YEZA 5FB8A 3MJ7A 5JPNA 1TQBC 1MUJB 3FAXA 4FQQA 3KCWA 4NO0B 1TTUA 2APSA 2RJMA 1UZ6E 2ALWA 1LD9A 2E9JA 3MRMB 2VERA 4NZTH 4U1MB 3U7AA 4AMKL 3L9YA 4AJVA 1J7VR 3WFHA 1H3TA 3T1FA 2WLMA 1T66C 5H4YA 2BDNH 4FULA 4PJDA 1ONQB 1NCCL 5C0NC 1S7VB 4QRUB 4MB1A 3HNTL 1CDUA 3L7EA 2XZAH 4UOQA 2W95A 3MRIB 3EGXB 5LN4A 3D25B 4AOFA 1G9EA 4J3TA 3VGAB 4IBVA 5FYKU 4LFHG 4AENA 1SXBA 2Z4TA 4Y89A 3VA2C 1B6UA 4O2CB 1G94A 4JHAL 5IFAL 1TPXC 4LT7A 5JXAH 3AAZB 1ZWIA 4QYOA 4IIQC 5F7NC 2OCCB 1I7RA 4DK6A 2H3NA 4G6KL 1E2WA 3S4SB 2ZKMX 4LEXH 2CO3A 5LN8A 1DVQA 4C56E 1CE6B 3QG6B 4BHUA 3MA7A 3MNWB 4M56A 1KYUA 2VAAB 2VXSH 1T2JA 3BUYB 2BIIA 3WGVB 4E9TA 3EOTL 1VPOH 4M5YH 4DTGL 4NQTA 2B20A 5GQBA 3P54A 2FJHA 4X5PA 1P5VA 2DBLH 2LU3A 1VDGA 1WK0A 2P5EA 4AEIH 3B3IB 3OX8B 1WAAE 1MPAH 1A6UH 1S46A 1X7TA 3U4BL 2HG5A 3TBYA 3T3PE 5TGBA 5B21A 4HIIA 2FHBA 2MQ3A 2OR7A 1KV7A 3BGFB 3WIHL 1ZVSB 2VISA 4TNGA 3WXVH 2Y6TE 4K8RC 4MAYD 5DVMA 4KK5D 4NT6A 3LN5B 3MRPB 1S9YB 2QSTA 1CYXA 5M95B 1ZT4B 4F7MA 1M1SA 4KVPA 4EUPG 2YRPA 3PPSA 1PW3A 5H2BB 1QWUA 2HTKC 1BIIB 2Z3FA 1OB1A 3V4PH 4CMMA 3X3GH 4HEPG 5DT1H 4JPQA 4K2UL 3TFKD 1VACB 3L5XL 4JGUA 2QHRL 1TMCB 4QI3A 1G9NC 1WCBA 2YGNA 3C8KA 3DVGB 3L3OC 3MXVL 1DQMH 3PNRB 3DJSA 1ADQL 4M6OL 4QHMB 3W5MA 1S78C 4HUWA 3MLSH 5IBLD 4OGXL 3L4UA 2ICES 3TBVA 6TAAA 2QKIB 1CGYA 3WTXA 5EU7C 4AH2A 1YAIA 3CZJA 2FLRT 4XWGL 4NO2B 2ALAA 5E9NA 1YEKL 4JR9H 2IPUK 3FTVA 1R0AH 1RSYA 3E6FA 1U3JA 2WINA 4HZLA 5CGBA 3EBHA 1U95A 4BE5A 3K5SA 2NTSP 4PWGA 1IARB 4J3OD 4I18C 1LEIB 3ZYZA 2HT2D 2XKNA 3GNMH 2F53A 2LU4A 3VI3A 1AIFA 1KB5H 1MEXH 4C56D 5AB1A 4FN0A 1LLAA 4LASH 2RFXB 3P3SA 2WNGA 5DUMH 1HOEA 1ZV5A 2JK5B 5DHDA 3ZKMC 1MFNA 5JMRA 2JLPA 2HVBA 2JKRM 3LRMA 4MCZA 3MREB 4FLQA 1NUNB 4W4OC 2GY5A 2HLFD 3A47A 1C5DB 3S98A 3EYSH 5DZAA 1BVLA 5EO9A 3EFFA 3BISA 1JHLL 1S2EA 2C4XA 5CD5D 1ZHKB 4HD9A 4N0UB 3ME0A 5DK2A 2H9GA 3EFDH 2XN2A 5ECJE 5BS0D 3V52H 4DCQB 4Z3GA 3T0EE 5DQJB 3RPBA 1BLNB 4NQDE 4L23A 4AVKA 1ITBB 2R4RL 4G6FD 2WXKA 3FTUA 3P3RA 3I6GB 2C1PA 1O7SA 2NRDA 4FKHA 4MJIE 5DUPH 2PUQT 1DVYA 4OKVB 5AW9B 2Y36L 1HKLH 1OO2A 1J1PH 3DBXB 3OB0H 4KTEH 5GS2H 4OKDA 2OLDA 4P2QA 2WBKA 4HC1H 1G5AA 2DI9A 2XG5B 5F9WC 3SD2A 1RZIB 4GBXC 3SKNA 2AABL 2RA1A 1HYSC 5A40E 3S8GB 2WJ5A 4TNVF 3GRWL 3UJJH 4JQVA 4M1DH 5AZEL 3RX8A 4MAYB 1L0YA 2F18A 4OJAA 5F1KC 3O3AB 1JYVA 5ISZE 3VVVA 5HYQA 1QR4A 3RI5F 5IFJB 2F5BL 1BQSA 1Q38A 3IJEA 5AW8B 1FL6B 4GXVL 5DZPA 1I8UA 3L1OH 5LQBL 3SDDC 3QQNA 2RQEA 2FB4L 3WHXA 5IB2B 1DJXA 5DK0B 1ID5I 5IB4A 1NSNH 4X4ZA 3GF8A 5ANHA 3R7QA 2FNWA 2OP4L 3GO1L 1BFTA 3UBXI 1UZGA 1AKJD 4JG9A 4RBPK 2CO2A 2NDGA 3KG5A 3HMWL 4L3EA 1HZKA 3QIUD 4M3HA 3AGWA 4DWHA 4YZWA 3QFJE 5JMOC 4WSJA 1JWMB 4KV5F 5H37G 3FULA 3C5JB 2JJSC 4YUEH 3WMPA 3FB7A 4KUCD 3GSQB 3CN3A 3F8UB 3K74B 1EAJA 4M6AA 4IGBB 1SXSA 3T2PA 3X11A 4OZIB 6CGTA 3QUMB 3KM2A 1GC1H 4G72B 3TN0B 2ENQA 5EBMA 1QATA 5B1KA 3GZPA 1V3LA 3OD3A 4K71B 3O3BA 4X8JA 4XBGB 4G8IA 2QADC 2UY7A 1RUAH 3AY4C 3MROB 1Z1WA 3SDXE 3QDGB 3T0ED 4L8SB 4A37A 3LV3B 1S7UB 3T6WA 2ZAHA 3IF1A 4MJID 4ZUUA 4TQHA 4YK4B 3ALWA 1KSRA 1IAIH 3EYUL 3MNZB 2YXVA 2XWBB 3BEVA 3PAZA 2CPCA 4Y2NA 4Y19B 5J12B 4F2ME 1M2OA 1Z2KA 2ZXAA 3QS2A 4KNSA 5BS0B 4UT9A 4R96B 5G4NA 4WI9A 3ZE0E 2BCKB 4PWHA 3RDTC 3T6XA 2WWOA 4LCYB 3DO3A 2PYEA 2IQAA 1U8IA 2BC4B 1FH5H 3LXAA 5DZNA 1RJYB 2QVFB 4Q14A 1MREH 4RMBA 3S97C 2BPBA 2ZUYA 2MOGA 1JZGA 1N9PA 5ISZD 4ZFQA 1L9TA 2X70A 2XJKA 2CG9X 4NCDA 5T5NG 1DVSA 3HR5A 2WXFA 1NIFA 1UYWH 2W81C 3IJSB 1NLDL 4K3JL 1E9PA 3VFMA 4KTDH 1J0KA 3KWVA 3UL4A 1WAEA 3O0RH 4E9LA 3D06A 1T1YA 4L29B 1TO4A 5HD8D 4PP1C 3GKWL 1T7ZA 2FO8A 1LO4H 2Y22A 4NN7C 2QT6A 5L9DH 2ZPKH 1T4KA 3APNA 2B3RA 2C9QA 4Z18A 2R0KH 5IBTL 3QFJD 1U8NA 2IF7A 4KO9A 4AZUA 3A6BL 4FXGA 1HVXA 1S7TB 3LKOA 5I1HL 1S7SB 5M7QA 1KLFA 4LEOA 2BY0A 4E9XA 4NBXB 3N91A 4A2GA 4P5TD 2NSMA 5AYTA 1AKJB 3BMWA 4PTUA 1DBJH 1VERA 3RB7A 5GRZA 1IC4H 4X5XA 1ZXKA 1DQTA 1QUNB 1YVLA 2B7DT 1J1XH 4JMNA 1RIVH 1YPZB 1YEWA 1XR8A 1B9ZA 4N6RB 5GGQL 1QMUA 1DQQB 4W70A 4LPWA 3Q2LA 3ZUNC 1AGEA 4U1SA 4MXQD 2EINB 2CUMA 4OZGB 1O7DC 2ZP8A 5K39B 1A64A 3CVHB 3DVNB 2NNXA 3F5WA 4U3HA 5E9AA 1UCBH 1ZLEA 3WCYA 4A6YB 4ZOEA 2CBOA 1NUGA 2BERA 1MFDL 2BXZA 3KBFA 4Y16A 5F9DC 4EKJA 5K9QI 5I1JH 3UTPE 2O30A 1NIDA 5DFAA 2Q76A 3QCVL 4AGNA 2IDCA 2Q2EB 2CMRH 2RQ8A 3IRPX 5F0JB 1FVDA 4MBRA 3HC0B 2EKSB 1EZVY 3QSKB 1KTDA 3QEHB 4OVUA 5DLMH 4OJFH 5JQHC 3MLXH 4HUKB 1EEQA 5HVHC 1VADA 5EZJA 4DGUA 1RHFA 2YRZA 4UQDA 2WVVA 3QH3A 3UTZB 4B96A 4LBEA 4X6DA 5AAMA 5GJSH 3DX7A 1R9FA 1FG9C 3CC5B 3F7YA 1AZZC 4WK4B 5C0IB 1CGTA 1U3HC 4ODTH 4JDTL 4FE9A 1M05A 1SJXA 1N8ZA 2UY6B 3NFNA 5D1ZB 4ICXA 2UZYB 2APXA 4X9BA 3OKMA 1EO8L 1LMIA 1UXSA 2OI9B 5EUOB 4Q9CA 3BOVA 3BIKA 1A6TB 2CNZA 5FGBA 3K6OA 4OZIF 5F89A 3TOPA 2G9HB 3U1PA 5E2WL 1XF4A 1R3LA 4JFQA 3D08A 1H0DA 3LPGA 3BN9C 4KMTH 3WDIA 1GA2A 4J3OF 2QGBA 2VQTA 5I6KA 4QR7A 5AZ2H 1M57B 5JXEC 2A4ZA 4D9RD 3HZYA 3LRLA 4YE4H 5CLWA 4W9FC 1TTBA 3Q3GB 1EDHA 1U8QB 1V7ML 4KU1A 4LOFA 4JO4H 2CKNA 4AM0B 3RTQB 3OM3B 2Y6SD 4HFUH 4K07A 2EE9A 3VMNA 3RWDA 3DX9B 1VGEH 4PGBB 2DAVA 5C9JB 5BJTB 4YSCA 5CILH 4XVUC 4EIUA 3Q8FA 1X5MA 1HTYA 3IKKA 4XI5D 4P5TB 3LY6A 4S1QL 2X88A 1FF5A 1IGCH 3OKKB 2Q6WB 3T3PF 2ZKWA 1XGZA 4TSAL 4E41A 5I6LA 3N1MC 4V33A 1BJ8A 1ZDSA 3FFOA 4FQJH 3UTOA 1BVZA 2WPGA 1XDTT 1U33A 4N1EA 5IGXH 5DI8B 5HHOE 1D9KD 4CN6A 3RWCA 4D3CH 2OJEA 4IOIA 1ROCA 3WHE1 4ZPTB 3UC0L 1XZWA 4OAWB 4D0BB 1NGPH 2OMYA 3AU1A 1ILUA 2ADGA 3MV11 5D9SB 5GS1B 3KVPA 5J57B 5GJTL 4XT1C 5GGSB 1S7QB 4ZPVB 4F3FA 5GRJH 5H35B 5CZKA 4X8XA 3V0EA 1R3KB 3FO9A 3HNSL 1B90A 3QQ3B 4S1SL 1KN4H 3DECA 4NP9A 4ODWB 3BAWA 4I4WB 4PJGB 5I73B 2CWRA 2F1EA 2Y7LA 2OXHA 1A6VL 4N2CA 1U8PA 1XEUA 4TNWK 4TUKH 4HBCH 3P3YA 4HLZH 3GFUA 5E8DL 2G2RA 2HJLB 5L0QB 4R26L 4FQ2H 3FU7A 5CZRA 2D0GA 3WIIL 4POZC 4FNSA 4X5LA 4Z7UA 4HLZG 4N2GA 4O2FB 1SDDA 2AHIA 4YDMA 4MS6A 3UPCA 1YPZF 2NT0A 5B1AB 3HE6B 5FO9B 3SCMD 1KCKA 1G84A 4KUCF 1QHPA 3IDUA 2GEEA 1PZ2A 2LE9A 3LPOA 3FUFA 4UQ2B 4WEBH 4EI5D 5B4MC 5JDSB 4AKQA 5DURB 5JZ7D 3N3EA 3PFUA 3QR2A 5CUSL 1MJ7H 1NCCH 1KDJA 2M26A 4U6XA 3LQAC 5E6RB 5AOKA 1HJCA 2F54E 3HNTH 4KOBA 3SHSA 1S7XB 3VDAA 2E7LC 6PCYA 5IOPA 4AZ8A 1QLEL 1OCRB 3RWIB 2Z1PA 4MMZC 3ABLB 3KLHC 3MODH 2EXTA 3AXLA 1KBKA 5CGMA 3PDDA 3ZE1E 3GXTA 3V0JA 4X2UA 1Z0NA 3I02A 4JHAH 5IHLB 1TF4A 2BNQE 1KCSL 2K4WA 2X4SA 2XBDA 4TVPH 4NQXA 3TS8A 3PS6A 3QRGH 1EJOL 4G6KH 5INDB 1KV3A 2HN7A 1GC1C 2DEXX 2EJ1A 3SKOB 3GUTB 5I6NA 5CCKH 5BRZD 2Y2YA 4B9KC 4PLKD 3SGEI 4GJTB 4PBVC 5GS3A 2VDRB 3CZNA 1VFAB 2KMWA 3EYQD 4NOFA 3EOTH 4ZFFB 4DTGH 5LBSL 1V5JA 2VM9A 1T3FA 1U91B 1QAWA 3WY2A 5GIRA 4HXAL 5C2UB 5CEXA 3MRQA 2N1KA 4H44C 5E5MA 1KB9K 3BD5A 3BAJA 3LH2L 5IJKC 1MCNA 3B2VL 2NTFA 5EUOF 4W9LC 4XH2B 2K4AA 2B14A 3TV8A 3W9EB 4JW3A 1ZLUH 3TPKA 4OBRA 3CZUB 4L48A 4BELD 3Q8EA 4GEJA 2R23B 4PJBA 4QHLB 4NI6A 4FYSA 4QRPE 4D0CB 5J1AB 4YBLB 3QQ4A 1TEGA 5HYJB 3CFDB 5LG1A 5IM7A 4N68A 4P5KB 5T3ZL 1T0PB 1AZUA 5DJZA 3B37A 4EDXA 2JKXA 4PJFE 4XXDB 4F20A 1JV2B 4I3RL 2X2YA 3CSYA 5KSVA 1IGIL 4RSVA 1YNTA 3GSUB 1MF2L 2DTMH 4OF6A 4WJ5A 3IU4L 4WIQA 4XMKH 2NUPB 3MYJA 1ETZB 3WS6A 1JE6A 3U46A 5MEQB 4DGYH 1ZA3B 1A9BB 4K2UH 3WTYA 4PJXB 4FTVE 2DMCA 4WGKA 1AGBA 4YBQD 1OGTB 3BVNA 3WXWL 1BHGA 4WWID 1X44A 2W88A 3LEYH 4OGXH 2G5BA 1WVZA 2BNRA 3FF8A 5I18L 3V6ZA 4WO4C 3UMNA 3C5ZB 3O8XC 1OF2B 1P53A 4XRCA 3D87B 4XWGH 3SKMB 5C08A 3UAFA 2BZ7A 4B0MB 3L3OA 3MRLA 3FTGB 5D2LB 2P43B 3MCKA 1I82A 5DJXB 2VXVH 2BNQD 5EZLB 2X44D 5DO2D 1G43A 3TO4A 3QC6X 4R83A 1RZKC 2JXMB 3LKPB 4ZFOB 1P4IL 4JJHA 4A55A 4ESKA 3FF7A 4UAHA 4TSCH 4ONHA 3HZ3A 3EF7A 1BQUA 4WU5A 4G9DA 5T1MA 3PGDA 3SBQA 2PP7A 1SYSB 3BVUA 4M8RA 5IB3B 3HJ0A 1TQTA 1RXLA 2BOBB 5DA0B 3H2WA 2DLEA 2FBRA 3K6IA 3LCYA 4I18A 5IVXE 4PJGF 3QIWC 1SRDA 2FQDA 5BMFH 1QPXA 1TQCB 1DFBL 4OCRL 2K70A 1OY3B 1NEUA 4QRSB 2FCBA 2J88L 5BRZB 1WFNA 3LNIA 3QBTB 2XZCL 2VDLH 1NJ9A 1U2YA 2HLEB 2R4RH 1AMXA 1A1NB 4FEIA 4N2BA 4C57C 3L4VA 4R4NC 3ARVA 2NW3A 1QZ1A 4KK8C 3WFCL 4GOSA 3NYKA 2Y36H 3JQOB 4ISVA 5FW6A 5IFHH 3BVVA 3QORA 5ALBL 1K5WA 3NJXA 1QO3B 3KYOA 3DGCR 2R2BB 1DO6A 3IETA 2F7OA 3M07A 2R56H 4ODXB 1YY9C 3D2UB 3GRWH 1MH5B 1BQHA 1KPUA 2L7UA 4WEUD 4FTVD 4PWFA 4PV1C 3TPUA 3UJTL 1WGOA 4NQQA 3WNOA 3VD9A 3CDCA 3LVEA 3SYPA 3PIQB 1FZOA 5JHAA 1BP3B 1WBYA 2MH4A 3W0WA 1BOGA 2P80D 3OXRA 1JI2A 2LTQC 4WU7A 3CFKA 1Z32X 3WIFB 2WBWB 2F5BH 3H55A 1XD1A 5FHAL 3H85A 4H20H 4PRNA 4K15A 4PRDB 2HKFH 1NC4D 3CAFA 3FT4B 4FXKC 2DQDH 5A6MA 1N70A 3IJYA 3V4VB 1HT6A 3D9AH 4PJCE 5D6CB 3EJYC 5EU6B 1E4HA 2J8UA 5D5MA 3MGTA 1SJMA 4OV5A 3ALPA 5HJGA 2KH2B 3H3PL 1GGIL 1DUZB 4PG9A 3K71B 1ZS8B 4P4KA 3CLEL 2QV2A 3DROB 1PLGL 4RAVB 3SDDA 4BZ2H 3RZCA 1FYTE 3QEQE 3VSQA 1NWOA 4JFDE 1HH6B 4X6BB 3LS5L 4TQ8A 3VW3H 5F7DA 4LSUH 2XPGB 5TQ2H 1E50A 3W9DB 4G7YL 2Y5EA 35C8H 3CPLA 3D7PA 3M1CA 4P59H 5EPMB 2F19H 3VXME 4ETQB 4HEME 4P06A 5IEHA 2H6UA 1YC8A 4W9EC 3NK4A 5DDHA 5FLVA 3L6FB 1Q9OB 3MUUA 4UAOB 3VTAA 4ZMTA 5HY9A 3UG5A 2VLLB 4R4FL 3JWNC 1IAKB 3T0XA 2ENSA 4EBQH 1PF3A 4DKDC 5JR1H 2ARJQ 1ZOXA 3MUZ1 5JNYA 4OZFB 2CKBL 3JV6B 1IV8A 3ARPA 3CCHB 2GTZB 4KBPA 4YDZA 3T1WA 2CK2A 3ZLQC 3I6LE 3LAFA 3HAEH 4Z7OB 4DFIA 2NNAB 4HSAC 4WI8A 3WU1A 4N8CH 1GGCL 1TTCA 3CWGA 4L4TE 4PJXF 3PHOA 1PZSA 3KXFA 4A2FA 2ZYHA 5IT2H 1UB6B 2XX0A 1KELH 4PFEA 4LLDA 2H26B 3VDCA 1ZHNB 2K6WA 1NAMB 2WLIB 2YPVL 3AW5A 4LOUC 4TPRL 3B7YA 1KT2B 2H3KA 4F33A 5AVYB 1V7NL 1EAPA 1MLBB 2WSDA 1BXUA 3RDTA 4JZJB 5D2LF 4K3JH 1EEZA 4AI7A 3DUSA 1DLFL 3WTWA 1MN4A 2WXMA 3SOBL 2X9YA 3GKWH 4GO8A 4GG8A 3KPRD 4I0PD 2BX5A 1ZRUA 3QXDB 5D4QA 3V5DA 2Y5QA 1E30A 2CHXA 1IGTA 1LDPL 4YEFA 4KRPD 1CF8L 2Y4SA 4P2OB 1KWGA 1NLBL 1ESOA 1EXUA 4HIJA 3S48A 1FYTD 3JV4B 4HVBA 3FQXB 1U93A 1Y1UA 1NC4B 3OLGA 4ZAKD 2AJZA 4QO1A 5TE7L 2DDQH 4JFDD 1IU1A 5E8PB 4KVNL 4ZMYA 4ONGH 3VXQA 3PWPE 2HX7A 4U1HB 4YVNA 2QHLA 4HGWB 3VXMD 3ZZ1A 1KJ2B 1FE8H 2WJ7A 1WBZB 3BXNA 3UP6A 1L9MA 4L9LC 3U0WL 3ARBD 5DFVD 1L6ZA 4CAGA 5I8OH 2JIXA 4FMKA 2ZX5A 4JO3H 5B8CC 1KN2L 1ADWA 3BVTA 1L9RA 5L2JA 2H0PA 5HXMA 4JN2B 4U0QB 1WFUA 4UQ3A 3TT3H 2AV1A 4MDIA 2CSPA 4KJWC 3UTSD 1JK9A 1HINH 4CVZB 1KCBA 2RAMA 4OLXH 3I6LD 2DQUL 3WE6A 2ZUUA 3DPBB 4XP9L 4E2OA 1OQOA 2Y5TA 1MFDH 4L4TD 2F58L 3S8FB 5JA9A 1N6QL 1HHGB 1GIGL 1ICTA 5C0DA 4RFOH 3ZZQA 3KWXA 4WGVB 4EN3B 2CU9A 3QCVH 4AMXA 4YVUA 2XXMB 5B7EA 5CSGA 2FRGP 3BCDA 3T0AA 3CSGA 2I85A 3HE7B 1T04B 5GRVK 2GTWB 5T3XE 3OV6A 1IM9D 3SE9H 4JVPA 2BZCA 2Q0ZX 2NY1C 5J3HD 3T0DA 4OZHE 3UFIA 3MCLH 1UG9A 2R9HD 5E9DD 4JY6A 3O4LA 4Y1SA 1JDAA 5IEKB 5TDPB 1BZ7A 1UKQA 1BEYL 1W72H 2OMZB 3P1VA 1JV5B 1MCPL 2QPEB 5IJVB 3VGEA 1YC7A 3ZE1F 5BQ7B 1U3HA 3MUGA 5LBGA 5LGYA 1W80A 3DX2A 3G5VB 5E2WH 3ARDC 4EIZC 1IC1A 1U8MA 3FTWA 3TBCA 4UB0H 1EZLA 3PWPD 5ICYB 1JZ5A 3U9WA 1JPGB 4IKIA 2VDPH 3US9A 3KPRB 4I0PB 1PYWA 5KVEE 3HHSB 3PWLB 1GGUA 4S2SB 5FM5O 1VZGA 2VDOL 1J8KA 2ZSWA 1D2PA 2GIMA 3PHQB 3FT1A 4QJ3B 1QEWB 2R29A 3T09A 2CHZA 4IEFB 4DVBA 4PW3A 3LZOA 4Q52A 1RHHB 5JXEA 1KB3A 2HRLA 3HW7A 2PLTA 3L9RA 7PCYA 4Z7OF 3NDYE 4AYSA 5DC2A 3RY4A 4G80A 2P8LA 2FJUB 4WCYL 2ZUVA 2I5YH 2Y2TA 5SX5H 3ZSSA 5A6LA 3NH7L 5FGSA 1LO3L 1KGIA 2QFPA 3UG3A 1MIEL 3GMQA 3OAYK 4JO2L 1A6WH 4GT0A 2A74C 1CS6A 2ZG1A 4DZ8B 3EO0B 1CFQB 1Z0MA 1I7UA 3HUJB 3VH8A 3VXNA 4TSBL 3LRHA 1KTKE 3JTTA 4AUJA 3D8MA 3QAZC 2X5PA 1NDTA 3UTSB 2AZAA 3V0FA 2WQWA 2ZJSL 3QIBB 4UQIM 1AQDB 5I16A 2EIBA 3SDAD 4O2EB 4DKFH 5GJTH 1OW0C 3EADA 4H5SB 3FNKA 4OF0A 3QO1B 1CFTB 4EQ2A 2BMKA 5ITFA 5FOBA 3TH4T 2W0KA 1BMWA 4Q9QH 2AGJH 1WHPA 3R06B 3NCCB 4YN3A 3WUWA 2JJVA 4NNYB 5DEGB 1HL9A 3G04B 1A6VH 3OGCA 1T22B 3BFOA 4IOFC 4WNSA 4B9GA 4UTAL 3FQ4A 3FSZA 5EN3A 1FGNL 3KPQA 4BZYA 5E8DH 3V55A 5DJYA 3D0VA 1IGML 3P4OA 2G2NA 3QQ9D 1PKQB 4R26H 2O93L 2AQ1A 4FNRA 4PD4J 2OYPA 2IFFL 3HZKB 4FL4C 3WEBA 3L4WA 3OF6D 2B9BA 3O41B 1UB5B 2YLHA 4CC4A 2N4IA 1WZAA 1JZ7A 4C58B 5E9DB 2JCCB 3BLBA 4G8EB 4N2MA 2C1OB 1GCFA 3IMBA 3P3TA 2EDDA 2ICEC 3VXUB 1FORH 2VITB 2WKOA 3NABH 4OQTH 4UCFA 3WNJA 4C8XA 4I1RA 4ACPA 1LO0L 5I9QB 4ZXBC 1XL4A 5BZZA 3GMMB 1UD5A 3DHUA 5DZJA 1G7MB 5EFIA 1R4XA 1NFDE 4HQQL 4M5ZL 2NXZC 3I9GH 4JCMA 4YDJB 4Z0BH 5KUKA 5D7LA 4QXVA 1T03L 4UDTB 4MXVF 1BEXA 1IAOB 4HCFA 1JF1B 3LN9A 1QBML 2IANA 3GSWA 4U0RB 3K6SA 1J8HA 1MVFA 2PYFA 4ZD3H 3L3DA 3TYFB 5I75B 4EMZA 3O6FD 4OLWL 5IBUB 1P2CB 3VFPA 3X1NA 4L4VE 3OLDA 4HOZA 5E4AA 1EJOH 4MMZA 1QTYT 2FEEI 4WW2A 4QEGA 3VG0L 5C71A 3I6SA 1YEJH 1NEZB 4GRWB 2I32A 3EJTA 3PDOB 5D72L 3PWUB 4LXFA 2MNUA 3EYOB 3QNYA 4GI8A 3KBHE 3HRZC 3LD8B 4HXAH 5I19L 4KXZH 3C60A 4PAZA 5C0GB 3LH2H 5KS9B 3RWEA 3B2VH 4MS8C 1WBXB 5E70A 3CDGB 1GW0A 3W82A 1JS4A 2IBBA 5I66B 3E8VA 2ODIA 1LWJA 4FFZH 2SEBA 5IQ9A 3SDAB 3CDZB 2PR4H 1XGQA 2Q1EA 3WDJA 5GISL 1E5ZA 1KIUB 1SVBA 2MCPH 5D1XA 4RFNB 4NGHL 3IU4H 4JFVA 4LP4A 4PJIE 3DTXA 5BXFB 5HHNB 2IGFL 2KT6A 4R4BB 1M7XA 4OCWL 2YAOA 5JHLA 2Y1ZA 3KPPA 4FFVC 2B59B 2N0MA 5DQ9A 2B0SL 4MD4A 1ZVHA 2OR9L 4EIBA 5KUMA 5IQ7L 4Y2DD 2DI7A 5E6IA 1B2WH 4M03A 1RIHH 2FYYA 2IC2A 5I18H 2D3NA 5CGYC 4APXB 2I27N 1AHMA 4J6IA 3T65A 5I1KL 3NRFA 3D69B 1VEMA 3DLQR 2A2QT 2WZPD 4K0OA 3SSGA 1HILA 4KDTA 2V2XB 2E7MA 3AU0A 4G9FB 5D71H 1U92A 4OCLC 3EBAA 3HI6H 2R1WA 2C4FU 2BHZA 3HUJF 4QOKB 3DO7A 3DC0A 5I8KL 4IRSC 2YOAA 25C8H 4NFCA 4CN1A 1HSAB 3CFQA 3IDNB 3FU9A 1D3CA 4NUMA 4QCIB 4XVTL 3IU3B 3BWSA 3ILQC 1TENA 1AS6A 1P4IH 5AVWB 4R7VA 1G7LB 3ATAA 3E8UH 2V9QA 1JN6B 2AV7A 1NOAA 1MZYA 5CCHE 2D7TH 1Y07A 2TRHA 3HBPA 3L4ZA 1OAZH 1RQ5A 1JF6A 2YA1A 5HHQA 4PY7A 1FSKC 4OCRH 4JCLA 2B4CH 4PRHA 3SE4A 1LMKA 3RGVC 2KHAA 3IGLA 1BQHG 4G2AA 1KGCE 3BAEL 1H8SA 1JHKL 3CFIC 2GJ6E 3IN2A 1U6AH 3SYQA 3NCEB 2VRKA 3QIWA 5D1QE 3TH3T 4BSJA 1BD2B 1INQB 4B97A 4MRCA 5KSBE 4Y4FB 1UOVA 5JW4Q 3D4YA 3GSNH 3UAEA 3HZMA 4LLYA 2GYSA 4PJ6A 2YPLA 1JWSB 3DJ9A 3DVFA 5I30L 2YQ2A 1HL8A 3BC9A 5G5DB 4AVJA 1XIWA 1ZMYA 3MV7E 5A2JH 3KYNA 3UJTH 1WPCA 2X9WA 1AQ8A 4LF3B 3HZVB 1BZEA 1MCHA 1N6VA 4Q6IA 3VG9C 2DWDA 3PABA 5FHAH 1UD3A 1ZVNA 3SPGA 4EUPB 5A16A 1G1CA 4LIQE 4OM1L 1PEZA 2AEWA 3NN8A 4PWIA 5J8OA 1JNHA 2Q86A 3GDCA 1H9DA 1CZ8H 2B2XL 5J11C 4J4PC 3AS0A 4XMXA 3SJVA 5TK4A 1GGIH 5DFWH 3VFGL 2Z8VC 4F1SA 4FXKA 1PLGH 3V6BR 4JN1L 4YHOL 4DGIH 3MRHB 5E8EB 3IBOA 4OD1L 5JW3H 1CUOA 2DKMA 2BRQA 1SY6L 1BM7A 2OMUB 2R0WL 4C4KO 5IB5B 5A1AA 3LS5H 1K3IA 5E51A 2FZ3B 4E42B 2A6DA 3ZHFA 3CU1A 1I9RL 5F8QC 5KSUB 1XGTA 5KYXA 2A9CA 3W39B 1IEAA 2N3JA 2K3HA 5E4EB 3ARFC 3C6LB 3G7TA 2YQ3A 1OK8A 4QLRA 3EHBD 1KGCD 1HH9A 3DDFA 3QPQC 1RP9A 3VWJA 2OMWB 3HPLA 2D31B 4HWEL 5D7IB 5FX3A 2XTJE 2CBPA 4DF9A 1S4IA 5D1QD 1AXTH 2CKBH 5C09B 2LAGB 3QXVA 5SWQA 3BGMB 1I3RB 3FUKA 1OB0A 1BSIA 2ZUXA 5J4MA 1AR1D 2IAMA 1KB5B 3VI4E 1J05B 4OBSA 4OIBA 4Y5YB 1GGCH 5FYLL 1F0LA 1BFOA 2YUXA 3TNNA 1NCIA 3UZVB 3D85A 3MV7D 1OTUC 3P9MA 4XZUA 4POYA 3AGVA 1QSFA 2UVEA 4LDCA 1KNOA 4PY8J 2Z93B 2UX6A 3G5ZA 3P69A 4FI7A 1CTNA 3D34A 2ZCLH 3ECWA 4FTDA 1QA9B 2DB8A 3PRZA 2H41A 3NPZB 4QTHA 1NCBH 3L95B 1WA2X 4PYGA 2VDQB 4P2RB 1QFOA 2WWNA 4PG2A 4KOCA 1L3WA 3GMRB 1O5PA 3QISA 3SOBH 4HPYL 1N10A 3BFQG 3N1QC 3Q1SL 4GT7A 4NZDA 3TT1H 3BT0A 2W5PA 3ZGIA 4DVRL 1N67A 3LN4B 5F9JA 4JHWL 1X7QB 2Y06L 4ZS6C 4BRJA 1CF8H 4ZYKB 3KWWA 1GSKA 1NLBH 2OTWA 1IM3A 3MLUL 4R7NB 2WNKA 3RNKB 1DCEA 5J56B 2A9NL 1A7BA 5TE7H 5K9JL 4MQ7A 3ARZA 3S34L 3ZKXB 3Q6FA 1OAUL 3T4YA 4YL4A 3OVUB 3MVSA 1A3ZA 3GEFA 4IU3A 3F7LA 5E5RB 3STLB 2NXYD 5C0JB 5D2NC 1SPDA 5F1NA 4QRQA 1RLBA 4H4NA 5DHYA 4YPJA 3MOQA 1ASQA 3E2HB 4PBDA 3U0WH 1DVFC 3BZFA 3U79A 1PX4A 3LKNA 3CFBB 5I76B 3DMMC 2V5TA 2FE0A 4X9IA 5IJBC 1G4RA 1I1AB 2XTJD 2YAQA 1AFVL 1C08A 4NZUL 4O02L 5A6IA 4AUUA 1R3HA 4HMDA 4F5CE 1JMZA 1N7ML 1U3YA 2VLRA 2DQUH 6PAZA 5B8CA 2W59A 1N6QH 1UM5L 4GPVA 3ZMEA 2M83A 1R33A 2EXWD 1FZJA 2ZOLB 4G7RB 3RBGA 3ZHKA 3C12A 2H7WA 5EBLB 3RWHB 4KVCL 1HI6A 4PJEE 4NC1E 3RPKA 3PV7A 3UPAA 2UZIL 3PP4H 4I1NB 3F04A 2CM5A 2NX5E 5IK3B 4A2EA 1L4IA 1PZBA 2R4SL 3OSVA 4GQPH 3AY2A 4PRIB 3PL6C 1IZKA 3GJFH 1PEWA 5DWPA 3FPXA 4K5LA 4B9FA 4BSWA 3L8QA 4LLVA 3SPVA 4QAMB 2MPAL 3TA3B 3MRRB 5MP6L 3LZFL 4Y88A 2DI8A 1VA9A 1BEYH 1CT8A 4RZCB 5E4OA 1I8LA 1MCPH 2NZ9D 5A2AA 1J12A 3KPOB 4NRYA 3LZRA 3WIHA 1MCKA 5GGUA 4OSUL 5CEYA 2YEQA 3NUKA 2Z7ZA 4PJDE 3RVXD 1OCCB 2NR6C 4P3DA 1N26A 2YUVA 1XCWA 1RJLB 3DUUA 5HHME 2IJ0C 2J8OA 4X80L 3KS0J 2HVKB 4XXCC 4PJHA 5LAPA 1GAFL 4BHUI 4JJ5A 2CLVB 2P42B 2YA0A 3RP1A 3BIBX 5EEYA 4IRZH 3VH8G 3VRIA 3UYOD 3RGHA 3O2WL 1ADQA 2F9BT 2LT9A 4HWBA 3SDCD 2QQKL 1DBML 4S1DC 4WI7A 1NCNA 2A6IA 3BLPX 1UGKA 5IROC 1OQXA 5BZXA 2GJZA 5T3XL 5DJ0B 3HG5A 5B7MA 5LGJA 1E0OB 4JO2H 1MDTA 2DQEL 1R5WA 2AJSH 3MRJB 4HHAA 4RESB 3O0LA 4OD2A 4ODSL 5TJWK 3WUWG 4TSBH 4PGEB 5C70A 3DJRA 1NBZA 4YAQA 3AJ7A 1RCYA 1ZLWK 5SV4A 5ICXB 4P04A 2ZJSH 3L3KB 5EO1B 3VXSA 3BCFA 4WLCA 1NH6A 3AG4B 3MBXL 2NX5D 1L9OA 2X4TB 4M9PA 4EI6B 1GHFH 1IX2A 1BX2A 3LQZB 5IQLA 3TBBA 4X4YB 3NSFA 2AXFB 3NDZE 4ENZA 5EU4B 2H2PD 1CFSA 1OARL 1U8CA 1DE4A 1FFTB 1M4KA 1ZJAA 2GY7B 1K85A 3IXTB 4PWJA 3L81A 2I25N 4JM2A 3VFWB 4BSVA 1JPTH 4PJ5A 2W07B 4ZS7L 4HSQA 4XPBH 1IGMH 4HX1A 4LSTL 4A66A 4N0RA 1NC2B 4X7SL 2IFFH 1FJ1A 1DDHA 3AZUA 2VQ1A 4XMPH 5HHMD 3VFOB 2GAZA 4PSRA 4PS3A 2JI3A 2J7LA 1IBYA 2JKIS 1SQ2N 2YMTA 1CGSL 2HWZL 1LO0H 5HGDA 3RA7H 2OL3B 4X7FC 3IVKB 3CU7A 5AVZB 4HQQH 5TF1L 4G82A 1A7OL 1XF5A 1ASOA 2ICEA 4PI0A 3GMPA 5GGTA 2HPOA 3FRUA 5CN3A 4Y5VB 3VFUA 1DQLH 3WAKA 5IOKA 2G0KA 1XXDC 4FP8H 4DPRA 5HDBE 4K23H 1UT2A 2NY2B 1H6EA 4JPWH 2VWEE 1ZY9A 3RWGB 1O0VA 4FQLH 3BQUC 3HS8A 2P5ED 1YMMB 2BJMH 4HJ0D 4XP1L 3NCWA 3SDCB 3SGKA 4P3WA 4NWTL 4RSYA 2IPKB 3KH4A 3U30B 3GXPA 5IUCA 2VLJA 5EUKB 3BMVA 1OSYA 2B15A 2J56A 4X7DC 1BQKA 4IYKA 1LP9A 4RQQB 4NBZB 4WNQA 1F2QA 4TN9A 3LKSA 2O26U 5CJOH 2EUXA 2DIJA 3K72B 4P99A 3GLAA 3JZ7A 3VVWA 4JX0A 4YZFE 4F8QA 3G6DL 1CO1A 1Q94A 5T5NF 5I0VA 3NJKA 3U6RB 4UANA 4K5OA 4PTTB 1ZJBA 2WVTA 2ZX7A 3NZHH 3JBG7 3TBWB 3VQLA 4N4YB 5JPNB 4DUWA 5FB8B 3MJ7B 3EBGA 1XMEB 3I74A 2WAHA 4FQQB 1G7JA 1HZHL 1AYOA 3L16A 3WG7B 1OGAA 4JFFA 4L8DA 4MNGA 1F8TH 1WD8A 2QMJA 4NNPL 4IMLA 2FVNA 1LDSA 1LD9B 1E4XI 2NLJA 5BOPA 4LSSL 5ALCL 3NK3A 2MTAA 3OB8A 3K4AA 2B0SH 1DLHA 2OSXA 3WFHB 3T1FB 3MQIA 5F1SA 4DERA 2ZOUA 1XCXA 4IBSA 4WY7L 1B88A 4YHLH 1AGDB 2EIMB 4M7JL 3EBIA 3V0WL 2XV2A 4HFWA 5I1KH 2EVJA 2F53D 3CV5A 5F93C 1B3JA 2WV3A 2JKTM 4LPUA 3HA0A 1PDKA 1NBYA 2EECA 3K80A 3JWOL 3MV9A 3AC0A 4AENB 3R4RA 3ZQWA 4DKTA 2WXIA 4RAUA 2Y7SA 3EDKA 5DS1A 3BZEA 2W9EH 5I8KH 3ILEA 3QZPA 1S9VA 2WXHA 2V5YA 3IMRA 5GXBB 4PGJA 2AZUA 1YNLL 5LXGL 4QYOB 1UA7A 4QXUH 2CPUA 3GMNA 1I7RB 5A7EA 4XVTH 3OAWA 2H3NB 3WUZA 3T3ME 1JBJA 1A22B 3KW8A 3GD1C 3MA7B 2R15A 4HWUA 4IRSA 2WZ6A 4UM8A 1ULVA 2BP8A 3ZRFC 1K4DA 5PCYA 1AI1L 1G1YA 5JW4N 1P5VB 4GP4B 1XVSA 1BAFL 4LU5H 2P5EB 3NESA 3MBED 1TYRA 4YX2L 2EYSA 4HIPA 2ZT9C 4LLMB 4P2QD 4DT2A 1ZCRA 2HG5B 3L3GA 2IWGA 4J8QA 1L6XA 4X6FA 3TBYB 5TGBB 2JI1A 4HIIB 1F2XK 2EXYD 2W65A 3KLAA 5FUCC 2PYEE 2VISB 4XVJL 1HX0A 2G2PA 5ANMA 5KSAC 4TOYL 4NT6B 1UXLA 2ITDB 4P46A 1NEPA 3SO3C 3IB4A 1A4JA 4IK7A 4LK4A 1A4KA 4KJPD 2WYIA 3GI8L 3LQMA 5CZXC 2A73A 4IDJL 1BCIA 5I1EL 1EDYA 3BIAX 3PYCA 4Z7WA 2V9TA 4ACTA 4ZX4A 2X2IA 1OB1B 4LCVA 4CMMB 1MAML 1LNUA 2Z35A 3F84A 2I9TA 4MLIA 4IRJC 1OGSA 3NA4A 2AMUA 1WCBB 3C8KB 3ZKNC 4JKKA 2XY1A 4HUWB 1RZ7H 3TBVB 2D9QB 1QD0A 3CH1A 4RGNC 4AH2B 1H5BC 4YXKL 3WE1A 1X9LA 2C4FT 4F27A 2JKLA 2V7HA 4LCCA 3F6IA 2B08A 4KXDA 1ZTXL 2JELL 3QZMA 2B2XH 2EE6A 3LXUX 3WOVA 2HFTA 4CSTA 1KB9J 3GHBH 4F7EA 4WF7A 3X17A 1K72A 3E6FB 3L5WA 4FLOA 4FKEA 2WINB 5GRXG 4PIRF 1X6NA 1XH3A 4B41A 1XSOA 1U95B 2ZXBA 3AQXA 1WC7A 4ZTOH 2W8CA 3ZTCC 4W9IC 1N0LA 4OIIH 3INUL 3QUZC 4OD1H 1QFHA 4NUGH 3VI3B 1AIFB 2A5UA 5F9AC 5ABZA 3H9HA 1E5AA 1SBSL 3N1PC 4AIOA 3TZVC 4YIQA 1IKNC 2B1HL 3EJRA 3JWNG 4MCZB 3BP5A 3VXOA 1BYPA 3OAZH 1QWNA 1BVLB 5EO9B 1QBAA 3ARWA 1PD0A 3EFFB 4GEIA 3WJMA 5IWLC 1JZ6A 3ME0B 3IKCA 2H9GB 4N2AA 4K94L 5DK2B 1R19A 2A6KA 4ORZC 4ZJ9A 1WH0A 1OTSD 3MXWH 4HWEH 5DZ9A 3VB8A 2PYED 4LPTA 1P7HL 1JZHA 1ZLDA 2C1PB 2HPTA 2IDSA 1OSEA 2WXRA 1HWWA 3ARFA 4O5LH 1CTMA 5FGCB 4QRRA 4CU8A 5JQ6L 4FCAA 2X3CA 1NL0L 4G43A 4NAMA 2XPYA 1AOZA 4EXPX 4P2QB 3RWFA 1A0QL 3DSNA 5FYLH 5F7UA 3ARGC 3H4HA 4HA1A 3SKNB 2D7NA 3QZNA 2ADYA 1LEGA 4PJDF 1ORSA 1U3ZA 5K59E 1M7UA 4TQEL 1XGPA 2ITCA 2VJ0A 4AEHH 3TCXA 5GRYA 2NZ1A 5KYWA 5HYQB 2CDEA 1KXVC 5K5YA 3IJEB 1XD0A 2NNFA 4IBQA 3EZ8A 1N3NA 3O3DA 5EIIG 2EVGA 1CD9B 1KY7A 2VDLB 3BAIA 3STBA 5AKRA 3QUXB 1KPRA 3WHXB 3CMOL 1H3UA 4XN1A 3VJ6B 3X3FH 2X6CA 4HALA 5IB4B 2ZKYA 4HPYH 3NPSC 3Q1SH 4N8VA 5F3FA 4DIXA 3VM7A 4POUB 1VKXB 1QEXA 3MGOA 4C83A 2MMXA 3Q05A 1PZ3A 4LEBA 5AW6B 4I77H 4L3EB 4TUJA 4N2IA 2ATAA 2YAPA 2FL5A 3ESUF 3QEGL 3TIEA 3MLUH 1RLWA 1W16A 3U82B 5F44A 4XCFL 1KFGA 4LDLB 4AYDC 4Z95H 2WTRA 43CAA 4OTXL 1CK0H 5DK3A 3X11B 5LNDA 3ZT6A 2OMTA 4L1HA 1Y18A 2AXGA 2XXCB 5I71C 3C5XA 5EBMB 5HHVH 5E08H 4TM9A 4BEIA 3IJ9A 5IB1A 2CRZA 4M29A 2HKHH 3ARRA 3KJ4B 3O3BB 4TV3A 4X8JB 3UPRB 3EJQA 1TJGH 5FA4A 2WQAA 4NFBA 2DH2A 3WJLA 2GC4C 3B83A 2VC2H 2IO5A 1WA1X 3IF1B 4O02H 3FU5A 4ZUUB 4LSQL 3FH8A 5FM8A 3X13A 3K0YA 4KKBC 4LRIA 1EQWA 4BWWA 5FO8A 3QJOA 2VXQA 4GSDL 2DLFL 3DMMA 4PY8I 1JTTA 3TVMD 5B7FA 3VNZA 3TEZA 2L7EA 1UM5H 3BRFA 5D7JA 2XKSA 1SOKA 3MBWA 4NN5C 5E1QA 2H32A 3QUKA 4UOJA 5MI0B 1EEUA 1U8IB 2IQAB 4QT5A 3CFNA 1ZS2A 2ATPA 4K4KA 4H7VA 2XWZA 4FHJA 2WQVA 3O2DL 4BM7A 2X70B 3GUFA 2AEOA 2V2WA 3H42L 4OVVA 3HR5B 2WGXA 2CK0H 3BPLC 3BVXA 3DIVA 5D93C 4R5XA 1E9PB 4F7PA 3FMGH 1GPOL 4XB7A 3QUML 5E8OA 3J2PA 1UWXH 5LBSA 5AAWA 2E27H 5DEFA 3SGDI 1BF5A 1J0YA 3ZQXA 3QZLA 3LB6D 4LOEA 4Z7UE 1T1YB 2DWYA 5B22A 3ZGHA 3MLYL 3CSFA 3NACL 4LVOB 2MPAH 2APFA 3NZ8A 5MP6H 4X5WA 1HE7A 1VZIA 3QG7L 3IDYC 4HWBH 4JHBA 4RMVA 1T4KB 3VI3F 4YFDB 1UXMA 5EOCJ 3WLWC 4TULL 1E4KC 3QS3A 4LSRH 3S37L 3GINA 5PAZA 4NQVA 1T1ZB 4BQCA 4FXGB 4YHZH 2HT3D 3BSGA 5DGRA 3FPYA 4Y1AA 1MAJA 1U0QA 1KLFB 1UJ3A 4LEOB 2A77L 3NEOA 2E46A 5J9PA 3BVWA 4D7BA 2QBWA 5IHWA 2RGSA 4LCWE 4W6YB 2P5WA 4PTUB 3F7PC 3GBMH 1KCVH 1GAFH 2EDBA 1DO5A 1SYVB 2YGPA 4JLRA 4X5XB 2XQBL 1HN1A 2NR6A 4KZEH 3KAAA 4B9PA 3KPSB 4O9HL 3Q06A 4NHCL 1XR8B 5T1JA 4M6NL 4C54A 4CW1A 3O2WH 4GY4A 1AGEB 4U1SB 1KPVA 4C56A 4LARL 1SGKA 3HI5L 3VA6A 3S88L 3MUHL 2IADA 2WM0A 2J1WA 3FFDB 3O3EA 2VABA 2IH3A 3F5WB 4U6YB 3GGWA 4P4RA 3FN9A 2EAEA 4RISL 3CC1A 2VJXA 3LHPL 3LXBA 5I1LB 1BYOA 4TVUA 4YHNA 4YHYC 3BKML 5FECA 1QSEA 1WAAA 4MXWH 4S10A 4Y16B 3FO0L 3FCGA 4KHXL 2PKDA 4ODSH 2NY0B 2Q76B 4WSGA 4WWKD 3EJZD 1EAOA 4ODUA 3WNPA 4CBZA 1WIOA 4JE0A 1FVDB 2G60L 2CBTA 1SLWA 1T0NA 4U6VH 1B0RA 4XNMA 4DGVL 2GFBA 3GSRB 1BFVL 5EZJB 1E2ZA 1V3MA 3K6DA 5L4FA 2WVVB 1UASA 3QH3B 4DW2H 1UACL 3T77A 4YS4A 2RCSL 2K9UA 1DL7H 4X6DB 3ATFA 4KO6A 4JCWA 5FYJE 3OKLA 5DU7A 3H9SE 1M05B 1N8ZB 2C7UA 2FR4B 1OARH 3NFNB 3W5NA 1A14H 3ZBMA 4PJAA 1JDCA 3TCLA 1YECL 3SYCA 1I7TA 1UXSB 4R90L 3RHWF 4G6JL 3BIKB 4G8GE 1OP3H 4ABVA 1FFOA 3MV01 1RFDL 1NDMA 5F89B 3TBSA 5AB0A 1CL7L 1XCQA 1X3DA 3BH9B 4X7SH 3AREB 4EO5A 2W38A 1R3LB 4GRLC 4JFPA 3ZU8A 2FWOA 3NJMA 4A6YL 1T1WA 3MCG1 4N2OA 4YMPA 5I8CA 4ZW8A 2FGWL 5CD3A 1DEEB 5JHMA 3OJVC 1DQVA 2AF2A 4XO8A 4XNZC 3KPLA 3ZTJH 1BREA 1T66D 3BHBB 4CA4A 5LCVL 2HWZH 1KGJA 1RVFL 3QDJA 3MLTA 4PJ9C 5C0ND 3RWDB 2HB0A 4AUYA 5EU7E 4A7GA 3LZQA 1TJHL 1S6NA 3CVIL 5KVGH 4L8BA 3FFCB 1EHAA 1JPSL 1MI5E 5ERWA 1A7OH 3KDMA 5TF1H 5C0RH 2Q9OA 1BQLH 5K9OB 2AK4E 2DM3A 1VB9A 4JQIL 4JO1L 2H0EA 5MENE 2GSMB 4YHKL 4E41B 3DIFA 3CX5K 1DUYA 2ADFH 3PDGA 3PJLA 3KHOA 4UINL 5K1NA 2OKMA 1XX9C 5GHWL 2OSWA 4KXBA 3RWCB 4GG6E 2OJEB 3QJUB 1ET5A 3G6AA 4IOIB 4XP1H 3T0EA 4NQDA 4NWTH 1QR1A 5EWIL 4MJIA 3AU1B 2ZUSA 1Z66A 2ADGB 2JLLA 4HUMB 3RUGE 3H3KA 3G5XB 4L1TA 4NP4L 4F3FB 1P1ZA 1PQZB 3WFEH 3RL1A 5FYJD 3F00A 3GLZA 4FFYL 4JHVA 3H9SD 5CR8A 3L3IB 2HKAA 3E3QC 4OU3A 5IHUH 3QRFM 1F6LL 4XB3A 3G6DH 1G7HA 1BLIA 5GSVA 3WKPA 1KLUA 4QMEA 3NIFE 4K8RD 3P2BA 1U8PB 2ADJA 1CTOA 1CIDA 3OMIB 4G8GD 4R7LA 2DQIH 5HGHA 2Q3AA 2G2RB 5ISZA 3TBTA 3QZWA 4DFHA 4HJ1A 3FU7B 1FNEA 2R2HB 3BDXA 5F7KC 3ZHNA 1TCRA 5T8IA 4XN2A 1E3XA 3W37A 1QNIA 1HZHH 1MW0A 3HC4L 2YKLH 3ZTNH 2FIRT 4BXVA 1SDDB 4UNIA 2YIHA 3RE0A 2JCCE 2HJKA 8PAZA 4FI6A 5ALCH 3GSXB 4LLAA 5DMIL 3WTTA 2CALA 3JWDL 1S78D 1V05A 3I6KB 5GSRA 2ERJC 4XCNA 5C0CE 4Z7NB 2VT0A 3QFJA 3DURA 5T5FL 4W9CC 2YPVA 5CEZH 3L4YA 2V5RA 3IWVA 3LMJH 4U6XB 3V0WH 1MI5D 2KQMA 3G9AB 4IHOA 3S2CA 4JB9H 5IOPB 5GS0L 4HUVA 4AZ8B 3OZ9L 2AK4D 4C4UA 5EIQA 5MEND 1MCDA 3UBXA 4ZX6A 4UDUA 5F97E 1RPQA 2HT4C 3KPNA 2CHWA 2DWEA 5AWNH 2E75C 3I02B 4B9CA 4GUCA 3M8OL 1GOFA 1AZNA 4Z7QB 3DSFH 1FLTX 2X4SB 4G7SB 4NQXB 4NENA 4WUKL 2A7BA 1AC0A 2P24A 3SDXA 3KLDA 4EXKA 1P5UC 4ES8A 3N0AA 3TC9A 2HN7B 3KYKL 1RULL 4LLQA 4MX7A 4KK6C 3WN6A 2V3EA 3ZKMD 3FUJA 1PZCA 4X6DF 1OT4A 2A83B 4HIXL 4P2AA 4BA8A 3VD1A 4FQHA 5DD5H 2XU9A 5HSFA 1OPGL 1AI1H 4F2MA 2EDRA 5D96B 5GIRB 4N0YH 4YR6A 4PB9H 5GGVH 5E5MB 2I7SA 2DV6A 2HSIA 2BWIA 3Q2CA 5T33L 3DOSA 2C3WA 4O51B 3K2MC 4R2GC 3P73A 4WFFE 3PHAA 3VGHA 1M7DB 3GMOB 2BVQB 2ZONA 3HFMH 4YO0A 3KXFE 4XXWC 4PJBB 1X5FA 3CMGA 2NQ3A 4XVJH 1ZPLA 3QQ4B 4BFFA 4A7TA 1RY7B 1OCOB 5IM7B 5IJDC 4EDXB 4EF3A 3UH8A 4MAUL 1ZSDA 3SOTA 1C8QA 2ZXCA 4GBXD 1R3JA 4PMFA 5KSVB 1YNTB 4WJ5B 1YLBB 5I1EH 4OCYL 1HYSD 4H8WH 4HZAA 4J7RA 4RLDA 4XMVA 3KCPB 5KSAA 1TKWA 3U46B 1MAMH 2EEAA 3CHSA 1FLRL 3L13A 3SODB 1AGBB 2QPDB 4H25A 4YSTA 2X3BA 3BVNB 2UWEB 1D5BA 5C0CD 1JYNA 3BPNC 3QPXL 4JVUA 3FN0L 2BNRB 2G5BB 1CLYL 1N59B 3V6ZB 3WKQA 3BYTA 3SDDD 2VDRL 4Y4HC 4YXKH 2DQFA 3RZCD 1EFXA 4XRCB 1I8AA 1BXXA 5E2TL 5C08B 3OKEA 1FG2B 3SBWC 3QEUA 5LG6A 1ZTXH 1Z5HA 3L3OB 4PREA 5K93A 3MRLB 1M3IA 2NY5L 1RI8A 1K8DA 2J6EL 4KRMB 1BBDH 3RY6A 3O9WC 2KDYA 4ZOAA 3DNKA 2YEVB 5G4MA 3QO0A 5ESQA 3LZNA 1B4JL 2F1BA 2EXSA 2Q7AA 5BZWA 3TO4B 3ZE2B 3GQFA 1QASA 1KIPA 5DHXB 3VSVA 1E5BA 4GS7C 5JOFA 2X6UA 4JFTA 4NYLB 1RUQH 2CR6A 5T1MB 3R8QA 3PGDB 3RIAK 3UEQA 3V6OC 8FABA 3TASA 1CQYA 2B1HH 1J48A 1XV8A 5D7KE 4I18B 2QADD 5A2KH 2ITEA 5F7HA 1JGDA 4Y5XC 3DI3B 2GBVA 4WFFD 1YUHA 3TWCL 1X4YA 2UXGA 4EVNA 5BRPA 4DEPC 4BFBD 3ROOB 3TZVA 3KXFD 5FAAA 2UVFA 4F7CB 1O7DE 2C9AA 3AUVA 3UX9B 2O5YL 1NJ9B 2ZF8A 1IBDA 4MJJA 2HG0A 4Z7UF 1UH3A 1JD7A 2FWLB 1YEGL 1CBJA 3B8SA 5H8DA 3U4KA 2YZ8A 3KLSA 5IWLA 4ISVB 1KYOK 3B5HA 2PXYC 3NMEA 3QORB 5E2VH 4CNIA 2JH2A 1LVEA 3KYOB 4XR8C 3RDTD 1A0QH 3IETB 4HETA 5LUMA 4OCXH 2PCXA 3PGFH 4JRLA 4Z7NF 3QWOA 4N8VG 4JJOA 1BQHB 5L4MA 4TQEH 4LVNB 1OAXH 1X4XA 3TPUB 3LDBC 5DD1L 3MRKB 3QYCA 4Z1PA 1Q9KA 3FO1B 1FZOB 4ZFOL 4Z8FH 1LEKA 1WBYB 1TZGL 4YGVA 2QTVA 2D3JA 3LPFA 3W0WB 1BOGB 3WO4B 3OXRB 1G6RL 4WU7B 3CFKB 2PTUA 4F15C 2XIIA 3D52A 3TU6A 3C09B 3FCSA 4HJSA 3H7BA 5IVNA 3FKUS 4BK5A 1KGUA 4AQ8C 4PP1D 3CMOH 1IAIM 2QGEA 3R0MA 3IJYB 1X9RA 5E99L 4NJAL 2J8UB 5D5MB 3MGTB 4K9EH 5HP5A 1MRCH 3QI9C 1CLZL 3E80A 4OV5B 3N9GL 4WWOA 4XC3L 3SCMA 5BVJA 3FSVA 3GM0A 3MLZL 2EIEA 4PG9B 4P4KB 4HUXA 1AGCA 1AD0B 4EI5A 3RZCB 4UTAA 5KANG 3ESPA 4I89A 2JIXD 2VXQH 1WG3A 4XCFH 4P3CH 4AQAB 1S5HA 4NJ9L 4WK0B 4LVHB 2WUCL 4JL2A 4XNXL 5F7DB 4OTXH 3P30H 4HIQA 2NCMA 2NY7L 2R59A 4OLZH 4BZ1L 3M17A 3H2PA 2BWDA 1Q9WA 3CPLB 5D7KD 5I1AA 1Q0XL 4B9YA 3S8WA 5IEHB 4NQCE 4F57H 2PO6C 4PJBF 3WSQL 5HHOA 4ATTA 4CADA 4LBAA 1URIA 2PPAA 4BUHA 5HY9B 3T6QC 2ENPA 1NPJA 5J7CC 2WSKA 4Q9BA 4KPHL 3IEAA 4WKZA 5JNYB 4FQXA 1OWRM 3UAJC 2FUQA 4LSQH 3FTZA 1KZQA 2MCMA 1YNTF 3CUPA 1EAQA 5DXWA 4HF5H 5ICZA 5ACMA 3GT6A 2DLFH 3CZFA 4MWFB 4PJ8C 3V4VL 3REVA 4J39A 3H3BC 5E03A 2EIKB 1EK3A 3ZRCC 1CD1B 5HI4C 1YNKL 5I1GH 3WS3A 3ULSB 1KBVA 4LLDB 4FEMA 1ZK5A 3KEHA 5DMGD 4CMHC 5K9QG 3LPWA 4Y4KC 2QV4A 1F3DJ 3O2DH 4K3EH 4F33B 1EAPB 4DEWA 2OMVA 3H42H 4WHYH 5TH2A 1U3NA 4LGSB 5CP7A 1OAQL 3RDTB 3FW6A 2AEPL 1EEZB 1U3HD 3ZT7A 3QUMH 1EO7A 1HCYA 3QRLA 4K3HA 4J3OH 4PQXA 3BEWB 4KJQC 4PUBL 4RVBA 4GG8B 4ZSOE 1A7PL 3RX9A 3GRGA 5GRWA 1KJVA 1H6TA 4BH7A 1DBBL 4YSOA 2EDTA 1TQUA 1EXUB 1ZK9A 1QHOA 2FAUA 1DQKA 4HIJB 1A7NL 5DS8A 4GP8B 3BN9D 5AYQA 3W11C 2AJZB 1WRFA 4QO1B 1T7YA 3MDJA 2F54A 2W9LA 3QHFH 3VXQB 2A77H 5JXED 2X87A 3WBDA 4XMZA 4U1IA 3HS0A 5A7BA 3GK8H 1E4KA 5L7XL 1GR7A 3BPOC 4R97C 3ZDXB 3ULVL 4FG0A 1JFQH 2CH8A 4BQ8A 2CJUH 3BXNB 3QFGA 4M7ZC 4NQCD 4XX1E 2BNQA 5FKPA 1HEJC 4BRVA 4O9HH 4Z3IA 4X4ME 2JIXB 4GKSA 4NHCH 1SJEA 1NAML 4XVUD 2JJTC 3HBQA 4M6NH 4CSZA 3JWOC 3P02A 3TF7C 3II2A 5L2JB 3GIZL 3EO1B 4IKLA 2X2UA 3HI5H 4UQ3B 3S88H 3WNLA 2AV1B 4MDIB 4WJKB 1JK9B 4PYHA 3HJEA 3WE6B 1XTLA 3D50A 4XAKE 4CGTA 3BW9B 5F96H 1WZ1L 1CQKA 3FONA 4EKXA 3I2CL 3IPBA 2Y5TB 5DWUH 4N20A 1WZMA 5C0DB 1TLMA 3MCYA 1IAII 2H1PH 4APQC 1IGYA 2VN4A 1OT1A 4I3SL 2CA4A 4QRPA 2WP3O 3C2SA 4PIBA 1T0MA 3QHTC 4H88H 4MQTB 4GMTL 5KN5B 4U6HA 3PJSB 1P4BH 2WXLA 1JHTA 4PJFA 4R6UA 3FQTA 1D7FA 1UACH 2J8UF 5D5MF 2RCSH 5BW7A 4N3TA 2P8MA 4N3UA 3NAAL 2VO5A 2E7BA 3SQOL 3ZIYA 4KI1A 5GS2D 2OQJA 5BV7H 4JY6B 2CDFA 3O4LB 1SVCP 1YECH 4OCSL 3T2QA 1A8JH 4IJ3B 3VGAC 2LR4A 2KS0A 4R90H 4XOAA 1I9IH 2NCEA 3HG4A 3Q48A 1RFDH 4G5ZL 4H8WC 3UEZA 3ZXAC 2P80A 1CLCA 1U3HB 3MUGB 4YBHA 1CL7H 1AJ7L 1GL4B 3FT9A 1X5XA 3CVHH 1MNUL 4M3JA 4PV9A 4G3YL 5KZCB 2CCLA 4R7DA 1A6ZA 4A6YH 1WQVT 3MSPA 1PYWB 4H1LA 3WEXB 2AJYL 3QXUA 1Z5YD 4UM9D 2IAND 1EUUA 1XO8A 2CHDA 3GTVA 3LIZL 4L05A 2ZSWB 4CSSA 1BVOA 1NKOA 5B4MD 4DZBA 1RVFH 3KW7A 4GRLA 5H94A 2O61A 3IRZA 1JRHI 4DVBB 3LNGA 1OWWA 1TJHH 4ZO8A 5C3IA 1MWAH 1YEFL 3L9RB 3KLHD 2WCSA 4G80B 4LDOB 5HPOA 2P8LB 3BZ4B 2OX5A 3U1SL 1ZHBA 3S3DB 5KVFH 4YHKH 4XAKD 1NAKL 3DA0A 4H2CA 3BGFC 5IVXA 4UINH 1AHWA 4OGZA 4XPAL 2CR0A 5ENWA 4UV7L 4K8RL 4DEPB 4GXUM 1I7UB 4UT6H 5DHVA 4U1NA 3VH8B 3VXNB 5HDWA 3JTTB 4PRHE 3UZQB 4BKLA 3OQ3B 2QSCL 2ZP0T 1SY6A 2VGLM 3QZWG 5FFLA 5AG9A 5I16B 1ZLVH 4RGOH 2CBQA 4K94C 4KMLB 2BMKB 7FABH 3VGDA 1G9NL 4PLOB 4AX3A 1B4RA 2QKIC 1SM3L 1GGBH 2GI0A 1FQ9C 1EHLL 5DJDA 3D07A 1QYGL 3WUWB 2DQGL 2R69A 4UF7C 4K7PY 4N9GA 4M1CC 3F64A 4F9LA 1L7IH 3KBPA 3KPQB 5DJYB 3D0VB 1T2QH 3P4OB 2IOMA 1GOHA 2XWXA 2NYZA 5HBBA 4N0CC 1OP5K 1KENL 4F7TB 4HCRA 3ZDXF 5FC9A 1Z6JT 3D3VE 5DYOB 1Y1DA 4ODVL 3M6DA 3OTTA 4MVBC 2EC8A 4PJCA 1N0XL 3VE0A 3UBXG 3RIFK 4Z78A 3QVAA 1IFHL 2EIZB 1CR9H 4FS0A 4HHGA 1SLXA 3BSZL 4RNRA 4TNWF 3C8DA 5DMIH 3OKOA 2E56A 2O5NA 4GI6A 2BSSA 4HSCX 1JSYA 1D7CA 2EC9U 3DV6A 4GSRA 3HNVH 1IKFL 5T5FH 2VAJA 5EFIB 5D8JL 5IQOA 2LU5A 2P48B 3QEQA 4M4RA 4WHCA 1T7VA 3IGUA 4JAMA 4ZAKA 1TZHA 4JFDA 1M9SA 4K9EC 3D5OF 1OANA 5D7LB 3UACA 4F8LA 5GS0H 1CDJA 1X5IA 3Q1EA 5EORL 3OZ9H 2XT1B 4DN4H 5LVEA 3HI1A 1UWEL 1SLVA 5A2LH 2IANB 3GSWB 3K6SB 1J8HB 2PYFB 1A66A 4ODHL 1PG7W 3L3DB 3VXMA 4HEMA 3V79C 4N26A 3VFPB 3OMNB 3Q9PA 4J1UA 4ZUWA 2KPWA 3A67L 4MMZB 5J1SC 3IBEA 1HIMH 4ATWA 3KYKH 4K3GA 4PRHD 4WW2B 1MCSA 3WO3B 3LXCA 1YO4A 5DR5L 1AHKA 4LEEA 4NIKB 2N7SA 4HIXH 4WUUE 4KKAC 2J57A 2KZBA 3QIWD 4NZRL 4MAYC 3BDYL 4O58H 4XCYA 3DGGB 3QNYB 1VLXA 2NW2A 3FB6A 3C60B 3T04D 3RLSA 3APDA 3WNIA 4L4TA 3RWEB 5T33H 1E4JA 4XBEL 1TJIH 2DL9A 2OBGA 3EOAA 1G0XA 2PWGA 3UGUA 1A2YB 3NZUA 3F12A 4R4ND 1I1YA 4U49A 2SEBB 5IQ9B 3P11H 4KK8D 1XGQB 1BJ1H 5JHDA 4FQ1L 2DD8H 1AY1L 4MAUH 5ILTH 4H0GA 1BVKA 1VRSA 4NOBA 5D1XB 5I17A 5IG7A 1YY9D 3D3VD 3K8LA 2XWTA 4GAJL 4OCYH 4QHNA 4XXWA 3VRJA 3ARYA 5I6XB 2Q3ZA 1TQWA 2VR8A 1IM9A 4M5TA 3ZY7A 1JXGA 3MJGX 2EACA 1QSVA 3D05A 5DHMC 1F1DA 3KPPB 4XOEA 1FLRH 1H8OA 3UTTE 3OG4B 5DQ9B 1OAYH 4IGBC 2QQLH 3LX9A 3IFLL 1NMBH 3QPXH 1A65A 1NGQH 3FN0H 5E6IB 3TN0C 1KJMA 5BUAA 3SZKC 2FYYB 3FS9A 4XNUL 3RZWA 1CLYH 1NGZB 2QVMA 3ZL4H 4B9ZA 1JZ3A 2MIZA 4K71C 2BZDA 3HMXL 2AFNA 1O6VA 2IG2H 3T65B 1PG7L 1UVQB 1JYXA 2PCYA 4JPVL 1A9VA 3EJYD 1AS8A 2YC1A 2IWEA 5FUZL 1ACYH 5C6TL 1NCOA 1VJSA 1U92B 2NY5H 4L8SC 2J6EH 3I85A 2R1WB 2XV0A 3ZDYE 5CLTA 4YK4C 3DO7B 3K2UL 4Y4HA 1B4JH 5J12C 5F9OL 2EH7L 1GJIA 3FXIC 4UU9A 2CBMA 4K55A 2CGZA 4TRPL 2I24N 4NXKA 3II1A 2WLHA 4X6CE 3VWJD 2AJXL 2XFXA 2X1OA 2V33A 5FYJU 2OZ4H 2JTYA 2DTSA 1H9VA 2KLSA 4XPGL 4XMWA 3CZEA 1C16A 4BWTA 2VLRE 1A47A 3ZYJA 2IAMD 1DJWA 2QQNL 5HHQB 4PY7B 3AMKA 3S5ZA 2DICA 3D4ZA 4QGYA 4DO6A 2WQUA 2YGVA 2MQGA 4KQ3L 4ELKB 1F4XH 3QW9A 1F56A 3WHE0 5C0FB 4FLSA 4TVPE 5IMOA 2HA1A 1PY9A 1ECYA 3BWUC 4H2AA 4JY5L 5DO8A 2H3XC 4Q56A 5L2KB 3HZMB 4LLYB 4HGMA 3PWJA 4WV1A 2YPLB 1FN4B 2WKOF 4AGPA 5I5RA 4AGOA 3AG3B 2HCZX 4XGZA 4OZHA 1HCVA 2I9LA 3E1F1 4LOUD 4ORGB 1XIWB 3ABZA 2BO0A 2JB6A 3KYNB 4LRNH 1VENA 4NHUA 1BGXH 3JYBA 4NZTL 3BQVA 4JS7A 1TZGH 3CHPA 5CFAA 2DQJL 4NZJA 3TO2A 3V0AC 4Q6IB 2BDNL 3PABB 1E67A 5A16B 3OF6A 1ND0A 1CMOA 3KMDA 1JNHB 2Q86B 4RGMB 1HDMA 2XZAL 1E8YA 4UOW0 3AS3A 4HS6B 4PHXA 4IBZA 1HWGB 1CLZH 3HHRB 4NRZA 3SJVB 4HOMA 2NDFA 5E7BA 4WW2F 3QAQA 1JAEA 1RMFH 5DMYA 5I15H 3T2NL 1Q1JH 1FL5B 3LIUA 4FXKB 4H26A 3ISRA 4L2LA 1P1VA 1SUJA 5JXAL 4UQCA 1GH7A 1EJFA 4NC2B 3GBNL 1WEJL 4NJ9H 3IPEA 2WUCH 2A6DB 4F92B 5ADPH 4L1BA 4BZ1H 1XGTB 5KYXB 1Q0XH 1IEAB 2VXSL 2WYTA 2VLRD 4M5YL 2PWDA 5F8RC 1O6SA 3KGUA 3CD4A 4PWKA 2FHCA 3WSQH 5F7EL 4HIHB 1D5ZA 2DBLL 4MSWA 2HRPH 2G5RA 4BIKA 4AEIL 3L2LA 1HH9B 1MPAL 3VWJB 4D7PA 1A6UL 3HPLB 3WKNA 1NCUA 3PV6B 4KJWD 3J7HA 4ZOBA 4TVPD 5J13B 5SWQB 5D1ZC 2B1AH 5C0BE 4JMXA 2IBZX 5TK2A 3VFRA 3WXVL 1WV7T 2E3VA 5FK9A 4E0RA 2IAMB 5EU5A 2YD2A 2OI9C 2F5AL 3CE1A 1SJHB 1ZPUA 2WN3A 1TETH 3NIDE 1BFOB 1EMTH 1KOAA 3TNNB 2X9ZA 3HB3B 1AO7A 4JM4L 3D85B 4XZUB 3P9MB 1MFVA 1QSFB 3H0TA 3OKDA 2ZX8A 4JRYE 4LSPH 3QDMA 1KNOB 3X3GL 4BGLA 5DT1L 1OF0A 1JUFA 2ZWYA 4XN8A 1UUNA 3DOHA 2JE8A 5LNGA 2EDEA 1U8KA 4PJ5E 1DQML 2APTA 1WTGT 5AVTB 3MLSL 4OT1H 3RTQC 2OMBA 4QTHB 2NY1D 3GHEH 4WI3A 5DFTA 2LGNA 1FV1A 1COBA 3I3DA 3DX6B 4ZUTA 2IXQA 4P5TC 4DKEH 4B50A 1R0AL 5F9JB 1BZOA 3NCXA 1DBBH 4X4XB 3ULUF 2FO1A 1TDQA 3KWWB 1F3JA 2OTWB 4Y2DA 1IM3B 3ARDD 1HKFA 2KZWA 1NFDA 1KBBA 4BJLA 4MQ7B 5EIIB 4CU6A 1KTBA 2BSCA 3Q6FB 1UJTA 3JWDC 1KB5L 1MEXL 1KTLB 5JPMB 4IU3B 2WMPA 5F1NB 4LASL 4QRQB 5CKGA 1LO2L 1AMYA 2EDFA 4F37K 4JDZA 1E9OA 1IKOP 2ATKA 3EJSA 3LKNB 4P07A 4L4VA 5GS1C 1IBBA 5GS0C 1NAMH 3H9ZA 3EYSL 3Q13A 1LL1A 4HW6A 2Z1KA 4MZ2A 2JFCA 2QLYA 2W60A 4CUCA 5E2UL 1L0PA 3V52L 4IMKC 5LB1A 1VESA 1R3HB 4L5FL 2CO7B 5I73C 5C0BD 2AQPA 4AQZA 5F71A 4M7KH 2VDQL 3L3JA 1NFIB 5C97A 1WZ1H 5DUPL 4HPOH 3I2CH 3Q43A 4N87A 5L0QC 4MTMA 3TIDB 1J1PL 2GSIA 4KTEL 1OPOA 3B1UA 2OMXA 4EDWH 4FJYA 1NM4A 2GUOA 4OFDA 4HC1L 2PP8A 1AGFA 3Q44A 4JPIA 4I3SH 4E9VA 1HI6B 1XB8A 3ELQA 4MCYA 3UJJL 3EZJB 1F4YH 4KHTH 1MFBL 3HRPA 4GMTH 5E1AA 1E8WA 2VDMH 4PJ5D 4FZEH 4APQA 3HE6C 4E9WA 1JGUL 3S5LA 1V3JA 4NO0A 12E8L 4BSWB 3FRPA 3NAAH 4LLVB 1KJ2H 5F6HI 5BVPL 4Y2OB 4PJIA 1HOCA 3CDYA 3L1OL 3SPVB 3SQOH 4IOFD 3TX4A 1OGAE 4DN3H 4H1LG 4MNGE 4FA7B 3D4CA 1L7TH 3EFOB 5LHDA 4U1MA 2YWYA 4MA8H 1NSNL 1CT8B 2GEQA 5F3HB 1ONQA 4ZMPA 5GGUB 1EGJH 5F1OB 5CEYB 1EPFA 1KIQA 4FMFA 4P3DB 2GQHA 3DUUB 3U9UA 1GZHC 1QFPA 2BP3A 3IPFA 4YUEL 5IW3A 4YFEA 4PLJC 4PJHB 3TJHC 1P9MC 4ZXBD 3ENEA 4O2CA 1PJ9A 1KF9B 1KFAL 5TQ0L 4JJ5B 5KOVC 3GM8A 5C07E 2NXZD 4GW4B 5FW8A 5KW9H 3VRIB 1QFWL 3S4SA 2NY5C 1RUAL 4PV8A 5AD0A 3SY0B 2VMJA 1Z9LA 1MLCA 1V55B 5IMMA 2EVFA 2E76C 2A6IB 5CMAB 3KGTA 4YDIH 4P57A 3OKYA 5AG8A 2GJZB 1I1RA 1NAKH 2VLJD 3MX0A 4NQEE 3S37X 1ORQB 4YBLC 4JNXA 3B3IA 5C2BH 3RPIB 1R5WB 4HHAB 1THAA 2GUYA 2JWYA 4KKCC 5D55A 3NP4A 4OD2B 4EIGB 1NBZB 3CLWA 3G6JE 4M8QA 4YAQB 3ZW3A 2GJ6A 1ZVSA 4XNDA 1PMYA 1G7PB 2QSCH 5D1QA 3VXSB 3UAAA 3LN5A 3MRPA 1MREL 5KSBA 2A0LC 2CIIA 3PG2A 1N68A 3CFEA 3CK0H 2HYMA 2HJFB 4R84A 3NRQA 1TITA 5B1JC 1UYWL 4IU2A 1N6UA 1CLOH 4KTDL 2FX7H 5FOJA 1OGAD 3C5ZC 3CBKB 1EHLH 1U8CB 3PP3H 1DE4B 2MCG1 3O0RL 3WI9A 3Q5OA 5JO5A 3MV7A 4XBPB 5D6DA 3UZEC 4JM2B 4KROB 2BOCB 4BSVB 3DVGA 1T5KA 3WY3A 5JIPA 2RD0A 2ZPKL 4JDEA 3AUWB 3SE3C 3PXLA 2R0KL 1KENH 4GAAA 1WO2A 4Q58C 4MRBA 4AE0A 5EB9A 1FJ1B 3ZDZB 1DDHB 4YSAA 2VQ1B 3G5WA 2HZHA 2ZWLT 3FUMA 5TD4A 2HP4A 1HQ4B 1UKSA 4XVOA 1RKRA 1IFHH 1FO0A 3BSZH 4D2NA 5DJ2A 2WXNA 1UXWA 4NUQA 5HGDB 4PR5B 5C07D 1MCLA 5CGYD 1IC4L 1IKFH 2VXUL 3BD4A 1J1XL 1OD9A 5D8JH 1RIVL 3FFCE 2KL6A 2XLLA 5GRUL 2EYTA 1Z7JA 5CO1A 1XF5B 4XNQA 1TQCC 3GMPB 3RAJH 1EJ6A 3FRUB 4UNVA 3HS9A 5EORH 2WLLA 1DN2A 2JK5A 4N0FA 3JV5A 2E0PA 2XWRA 3OPZH 4IRSD 4U1GB 4ODHH 2UV3A 5LGKA 2P45B 4NQED 1MFCL 1C5DA 1UCBL 4JKMA 3D39E 2OS7A 1WCQA 3M7OA 4AYBA 3ILQD 4ALAL 3D0LA 1A3QA 5I5JA 4X8CA 1BLNA 2HUHA 2JQMA 5TPWH 3H2QA 3QCUL 3WL9A 3BP6A 1UATA 4IBYA 2VLJB 5DS2A 1OALA 1IC7H 5DLML 3KH3A 3VI4A 1UM4H 2J1KA 1LP9B 4QRRE 4WNQB 1A4CA 1J5DA 4GSXA 3RGVD 2P4AB 4H13C 5IJCC 3RFZA 1NPNA 5GJSL 2YZ1A 2YFOA 5KYUA 4ODTL 3EXJA 2OL3L 3S3CB 1FI8C 4TLUA 3L08A 2HAZA 3VWKC 2V7NA 2NY3B 1TJXA 4PJHF 1R75A 1EV2E 1G7JB 3CX5J 4GAJH 1XH1A 1NDGA 1UKTA 3MUJA 4JFFB 4L8CA 4XP5H 4GSQA 3SEPA 2EC9T 1BM3L 4IMLB 4KX7A 3EO9L 4QDGA 2NLJB 7TAAA 4KMTL 3OC5A 2PP9A 1A3LL 5AZ2L 4IBWA 4KY1H 4YE4L 1DLHB 2X4NB 3CHQA 5JW5A 1IQWL 3AQZA 2G5UA 4L4JA 3U2IA 2X42A 4XNUH 1TU2A 1LO5A 1HCFX 2H47C 4JANA 2G30A 4OJYA 3HMXH 5HPMB 3C5JA 4HFWB 3VFNB 1PG7H 1VGEL 4UAOC 3NOIA 4J4PD 4JPVH 3WJJC 2Y2WA 4UUJB 5CILL 4OF8A 2DN7A 5FUZH 1PDKB 1NBYB 2BY1A 5DJ6A 3MV9B 4CC1A 1NM9A 4RAUB 4Z7AA 1RAMA 1IGCL 2X4RA 2VR5A 1UH2A 4ANUA 3BZEB 3IYLW 3K2UH 3D39D 1GW6A 4LAJH 4EAEA 2CRIA 1GYVA 2VTFA 3C6SA 4XP6H 2VH5H 1KYFA 2X7LA 3GMNB 1O9VA 5IGXL 2EH7H 3GSOA 4D3CL 4HUUA 3QDGA 2F0CA 4L8SA 3K5RA 4HOWA 4TRPH 2H1XA 4ZDHB 2X28A 1RERA 1S7UA 3SGJC 5I0WA 3ULVC 3DX3A 1Z3GH 3FCBA 2UXTA 5D2NE 5ETUA 2AJXH 4IRSB 1RPUA 1KXHA 3VGGA 4F5CA 1ZVYA 4UM8B 2BP8B 1OXYA 2PWFA 2D7MA 2Y25A 4XPGH 1NGPL 4ZQKA 1QLRA 3ARFD 4FLHA 4QRRD 4UTBA 1GVIA 1WD9A 3VRLF 2QQNH 3IM1A 3OJDA 5AEAA 2W91A 2W92A 2LOEA 4JM2F 3QPQD 3PCYA 4H0IA 2BCKA 1QSZA 1QPPA 3L3GB 4JZJC 5JORA 1JMXA 5D4IA 2X4UA 3KLAB 4PJEA 5A2BA 3BP4A 3S96A 5IHZA 5ANMB 4QXWA 3KYAA 3ZDZF 4DPCX 5DRXA 5B1CA 1QW8A 1VIWA 2WB7A 4P46B 2HX8A 4TUKL 1A4JB 1TMQA 4HBCL 5D7IA 4JY5H 2XFGB 1A4KB 3VNYA 1EA9C 1C5BH 1RZFH 1ZTMA 3CFCL 4NPJA 4FQ2L 4P2OC 3R18A 4MAZA 2Z34A 2R7EA 2G0LA 2AK1L 4Z7WB 1OTUD 1JNLH 1AQMA 2FLMA 3WV0A 3ARUA 4E36A 3D6GA 1LNUB 1PPIA 2Z35B 3AXHA 4NM8L 2EYRA 3CVCA 2EQDA 4BFIA 4GP5B 1GYAA 5JUEL 1NUFA 2V8LA 2DQJH 3JT0A 4J3WA 1MG3C 3VXRE 3V4UL 1S7TA 1PLAA 3UTQA 4WEBL 1S7SA 4ZRGA 3BRGC 1MJ7L 4LCCB 4MBOA 2YD8A 3PF2A 4Y1AE 4S1RH 3NCMA 5T3ZE 2NY4B 3RJQB 5FV1L 1HFUA 4ZS6D 2AW2A 4L3CA 3L5WB 2BRRL 3AABA 3FB5A 3UGXA 2P5WE 4ADJA 3MODL 3SBRA 1QUNA 1XH3B 4ZZKA 3CXHK 2YAMA 1WC7B 1N0LB 3T2NH 3QJTB 2XPZA 3B9AA 4GB9A 4G70B 4TVPL 3B9KC 2FSDA 3QRGL 1QNZL 1R6VA 3GBNH 1WEJH 3QUYB 3R0NA 4OZGA 4ZMVA 1MCBA 1XAUA 2JKWA 1LP9