2YRBA

Solution structure of the first c2 domain from human kiaa1005 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
156
structure length
156
Chain Sequence
GSSGSSGDETIHLERGENLFEIHINKVTFSSEVLQASGDKEPVTFCTYAFYDFELQTTPVVRGLHPEYNFTSQYLVHVNDLFLQYIQKNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein fantom
publication title Solution structure of the first C2 domain from human KIAA1005 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yrbA01
3IBEA 4WWOA 4F92B 1E7VA 4ANUA 2NSQA 4MJJA 3PS6A 3T8MA 4TV3A 2WXNA 4JPSA 3PREA 4WEEA 3PFQA 3F05A 4ICXA 1TJXA 2Z0UA 4NP9A 4ICWA 4PS8A 4AJWA 4ANWA 3KWTA 4ANVA 2JQZA 3ML8A 3PRZA 2LHAA 2WXOA 1CJYA 4F1SA 1RSYA 2CM5A 4KZ0A 4TUUA 3ZVVA 2X38A 1K5WA 3M7FB 4PS3A 3ZIMA 4NPJA 2CJSA 3L4CA 3QR0A 4XX5A 4EZKA 4FA6A 1V27A 1E7UA 1DSYA 1W16A 3FBKA 3FDWA 1QASA 5G55A 4FHKA 3F04A 1RH8A 3R7QA 5G2NA 2ZKMX 4WWPA 4HLEA 3APFA 2A4ZA 3HN8A 5CCHE 1DJGA 1E8WA 3GPEA 3L16A 4L2YA 4EZLA 3JZYA 3LJ3A 2YRBA 2Q0ZX 4FADA 3DBSA 3L17A 4Y1TA 4NPKA 4L1BA 1UGKA 3TL5A 4DK5A 4XE0A 2WXJA 5KJ7E 2Q3XA 4URKA 2R83A 1RLWA 2CHDA 1DJZA 3NSJA 2ENJA 1YRKA 2CJTA 3KWUA 2ENQA 2WXIA 4LT7A 1A25A 3HIZA 3APCA 3QK0A 1DJXA 4NS0A 4ANXA 4QJ3B 2WXHA 4EZJA 3R7RA 4A55A 4FULA 2FJUB 1WFMA 4DNLA 1E8ZA 3W57A 2NQ3A 1GMIA 4QJ5B 5CCGE 2QZ5A 2WXPA 1WFJA 3B7YA 4QJ4B 3QJZA 1DQVA 2WXLA 1DJHA 3IM1A 3ML9A 3TJPA 3QR1A 4OVUA 3MJWA 2UZPA 3NZUA 3L9BA 4TS6A 3S2AA 2V4LA 4FHJA 4L1LA 5CCJA 2K45A 4KZCA 4XZ4A 3RPBA 4BGDA 4GNKB 4F91B 3OAWA 4GB9A 2EP6A 1W15A 2CHZA 2DMGA 2WXRA 5JHAA 1DJWA 2D8KA 1E8XA 1QATA 2A5UA 3APDA 5H4YA 2WXGA 1UOWA 4L23A 3HHMA 4G11A 1BYNA 4KITB 4LCVA 3F01A 3L08A 4OVVA 4Y1SA 5T8IA 3RDJA 4HVBA 2NCEA 4IQHA 1TJMA 5H4ZA 3QAQA 4IHBA 2WXFA 1E90A 2K3HA 4QAMB 4FLHA 2QZQA 3OHMB 3DPDA 2WXQA 3QARA 3ENEA 3L13A 3PYCA 4AOFA 2ISDA 4FJYA 4LDCA 2K8MA 4WAFA 3P2BA 4WWNA 5JHBA 2YOAA 4J6IA 1HE8A 2B3RA 2CM6A 2DMHA 3NZSA 2BWQA 2KI6A 3W56A 1BDYA 1BCIA 2ENPA 2WXMA 3TWYA 3CSTA 1DJYA 4V11A 5EDSA 1E8YA 2CHWA 2CHXA 4F93B 2FK9A 3CSFA 1DJIA 3F00A 2RD0A 2K4AA 2Y3AA 3L54A 3N5AA 3SD5A 4PS7A 2WXKA 3ZW3A 4BFRA 2N1TE 1UOVA 4FJZA
chains in the Genus database with same CATH superfamily
1MFMA 3VQ2C 1JXDA 4NO0A 4M3KB 1A7RH 4W9KC 2XTLA 4PG9A 1JG9A 1EHNA 1NMAL 3DARA 1VFAA 4ZXBB 4F57L 4ZUSA 3RU8L 3KPOA 4RETB 3MPCA 1PG7L 5KAQF 1G6RB 1BMZA 2OMBA 5CD3B 5EUOE 4JX0A 1E4WL 4IM8A 5AEAA 3WEAA 3EYOA 2HB0A 1IGML 1NCJA 1V27A 2H0JA 1BECA 4JRYA 4TVUA 1SXAA 3CHPA 1DBML 4NWUL 4L9LB 3I6LD 1IKFL 1TCMA 4MMXB 5I15H 5I1JL 3VXSE 1BD2B 2V37A 4HK3J 1LO2L 3C09B 4NQSB 5E94B 3WLWC 4FERA 4CW1B 4PBDA 2VDNL 3BXNA 4JRFA 3FNKA 5DJYA 2HTLC 3A67L 2ZKXA 3QG6B 3DPBB 3TNMB 4NPKA 4PY8J 4F7EA 1M7DB 3Q6GL 3RWFA 5C08D 1GY2A 3MLVH 5J1TC 4IHOB 4IJ3B 4XNAA 5CD5C 5I9QC 3NMEA 4WI4A 4E9WA 1QUPA 3BH8A 2UY7A 3ETBJ 4IGBB 2DDQH 1RLBA 4N6QA 2C9SA 4NS0A 4YOKA 4R26H 1JPSL 4EZJA 2YPLD 3BP4B 2GTWB 4YS4A 4JGNA 4MCZB 2NNXA 2YN3A 2C26A 3O3EB 5ENWB 1RD6A 3D33A 2P47B 3B3IB 3UZVA 4FC3E 3B7YA 1TVHB 3GJEB 1TTUA 1ADQA 2BH0A 3FSVA 3HKZA 3SDXE 3JV4B 2VE6B 3O6FC 4U6XB 3GHBH 1FFTB 4OJFL 5AW7B 4P23B 3UTSE 2E46A 4HJ0C 2H6PB 3MOAH 1WAPA 4JPKL 4GLRI 1F4XL 3CK0H 2RA1A 2VT0A 3O8XA 4PJDE 2X6CA 2YWZA 3FT0A 3FAWA 3W82A 3EW3B 3CFQA 3HFML 2JJTA 2Z4TA 1CFNB 4PWFA 1KIUA 1T5XB 5CINL 5F96L 5IBUB 4LSRH 4MA3A 3UTPE 4K8RC 4NQCB 2CJ3A 3QAQA 4HS6B 5AVZB 3WTVA 4HQQL 3V4VB 5GGRB 2BWDA 3FTWA 2WM0A 3FC8A 4LKXA 3TO4D 2F18A 4KU1A 1T4KA 5EU7C 3SPJA 5F0PB 3JT0A 3SY0A 5JHBA 1RXLA 3BIAX 3BD4A 3QFGA 2YGOA 3TN0D 3OKNA 1J5OH 3BPOC 1A4AA 4F37F 2V5RA 2X70A 4IDJL 1P5UA 4M5TA 2CHWA 2CHXA 2ZJSH 1XX9C 1IEAA 5B22A 2OZNA 5JPMA 4L4VD 5FKAB 4QWWC 1E3ZA 4QJ4B 3VX1A 3EH4B 2CDFA 3RWHB 1AR1B 3CN2A 4MJ6A 1CGXA 3OPZH 5EF2A 3CE1A 1HSBB 5MEOB 2CR3A 1N12A 3PDOA 4OZHA 4BWWA 3FB8B 3VUAA 4P2AA 4YX2H 2CRZA 4Q9RH 2VXSH 3G6AA 1P2CB 2VXUL 5CD5D 2EEAA 2GG1A 2ZUUA 3CAFA 4XZUA 1QFOA 3Q8EA 2H5UA 2HJLA 5IOPB 4HCFA 5EBMB 4BGLA 3AT0A 1DE4B 12E8H 1S3KH 5D1XD 4M43L 5EZIL 4AX3A 3GBNH 2BNQD 4LPXA 4ECNA 2EDTA 4MKTA 1IC1A 4HX1B 5KVDE 4G8IA 4P06A 4ELKA 3T1FB 3CSPA 2AW2A 4FXTA 2NCMA 1KCWA 3ULUH 3SYQA 5IGXL 2Z92A 2Y2YA 2W95A 3H42H 3BEWA 4KROB 1UCTA 4TNVK 4F8LA 2GCYB 1A6WL 1QFHA 2EXWC 3O6FD 5DZLA 5LO7A 2XACC 1SOQA 3QR2A 3LZLA 4X4YA 4HJ0D 3H56A 3LEVH 4OFKA 4WW2A 3UG4A 4HH9A 3FQUB 4NSKA 3WL9A 4QJ5B 1MCPL 3TP4A 4BE6A 1J10A 3IU3B 1TJHL 4N2NA 1ZSDB 1BQRA 1JN6A 5DK2B 4RAHA 1NCBH 3ZKXB 1VEPA 4K8RD 3C5ZD 5IIEB 1MCOL 4ZS6C 3MV01 2UXTA 3SE4A 2HJKB 4L1LA 5AG9A 4RRPG 1U4FA 1JRHH 3GMPB 3W0WD 2Z6FA 2Y7MA 1NC4D 1FJ1B 1OAKL 1KCSH 3LS4L 2W59A 3C6LB 4X98A 4KV5E 1QR1B 4ZX3A 4HCRL 1X9RA 1A7OH 3MX0A 4QHPA 5DURD 5IMKA 5FUOH 3VSUA 2QVIA 3BCFA 1OAXH 2E75C 4U33A 4EBQH 5D1ZC 4XAKE 1ZWIA 1MIML 3FCSA 2X2YA 4KY1H 2J8UA 2OAAA 3PV6A 3U7WH 4DP5X 1B0IA 4NUPA 1ED3A 1IM3A 1J48A 4RSYA 5H94B 3AZUA 3DX7A 5T1LA 4PG2A 1JF5A 3N44F 1UT1A 5EOQL 3L81A 5BVJA 4G6FB 4F7CB 5LWYL 4J3VA 2IDTA 4OCSL 1RKRA 1YO4A 4MNQA 5F6HJ 3RILA 2IF7A 2N1TE 4Q7DA 3UMNA 1UXSB 3S98A 5IQ7L 4XXDA 2O5XH 3QXWA 5ISZA 1E4KC 2XIBA 2V7HA 1O5DT 4FOMA 1T2JA 4DIXA 5J9PA 5I2IA 4ZTOH 5KBLA 1GTNA 1QSED 4UQ3A 2XKNA 1NCOA 5B38G 3U2IA 3KPNB 3GDCA 1QPKA 3O2DA 2UZXA 2XYBA 3D2UD 2DJ4A 5DR5L 2DJMA 4HWEL 1QLEH 4LCYB 3FOLB 1WDAA 4ONFH 5JHDE 3ZIMA 5L4MA 5KSVB 3MV8D 5J56B 3OKMB 2VR3A 4XOEA 4ZS7H 3TA3C 4DAGL 4OZHF 5I0YA 5LDUA 4OCRL 3CMOH 3APFA 1FZKA 4YDVB 3VGBA 2J5WA 3IDNB 3WEMA 3QXAB 2TAAA 4FQHB 5TFSL 4HOMA 2NOYA 5D96B 2R0KL 4G8FB 2WXJA 2IBZX 4WI0A 1TEYA 4O2CB 3BWAB 3PWPA 1T89A 1DJZA 1MQKH 3U2JA 3TZVB 2F7PA 4ZS6D 2PCYA 4LE8A 3ZBMA 2WXIA 4OZGB 3QQ3B 2VUOA 1HNFA 1I85A 4GP8B 2E8ZA 1NLBH 3QA3A 4ELME 1Y0LB 3T3PB 4GQ9H 1PL3A 4PN6A 1KIPA 3QJHA 4PCSA 2ZCHH 3D4ZA 5E8PA 4CVZA 2WUCH 3GUTB 1N0XH 2QVFB 2ZX7A 4D94A 2JJVA 1R33A 3AGWA 1DQVA 4NJ9H 3E8UH 3VI3F 1BFOB 2LU3A 3UJIL 5HD8C 5L88L 1G1YA 3LX9A 2EECA 3NTCL 3QHZL 3S96B 5E5LA 1RJYB 4W4OA 4YHIA 2OSYA 4FQIH 4BFOA 5DEGA 4NZRH 1MN4A 2JSFA 3GIZH 1G6RL 3QJFB 3TBWA 1MCWM 3E0GA 1S7UB 3QUYC 4FYQA 3VXSA 4YLCA 3MV9E 1AJ7H 4N0UA 2Q3AA 3SDDA 3JTTA 1KBGL 1R5IA 3O41B 3T77A 1DCEA 5E6IC 5K9KA 3IDUA 2AV7B 2WYIA 3L4WA 3AQZA 4S1DC 5DJ6B 2R2EA 1WGOA 2EADA 4W4NA 1TYJA 4AMKL 1F3DH 5DYFA 3VFOA 4EN2A 5I6XB 4G1MB 1M1XB 3LH2H 3PGCA 1NJ9A 4RGNB 3FSOA 1G0YR 3OD3A 3BKYL 2AC0A 2FWSA 2X4QA 4JREC 4N0YH 5E2UL 4JO4H 5F9OH 1G7MA 1I53A 2F68X 2J8UF 4YNYB 3OTTA 3CSFA 3TFKD 1DJIA 3HE6B 3JZ7A 4M5ZH 4YAQB 1I8MB 4IBZA 1M4KA 1C12A 5EORH 2I7OA 3EH2A 2X4OB 3TA3D 4DVBA 3GGWB 5F0MB 4ZUUB 5HDQH 3QEGL 1RZKH 3PABB 3PREA 4TVPE 1KXTA 3GXTA 5DD6A 3T0BA 3D08A 1QRNE 2H0EA 4LLMB 4PJDA 5D70H 2R69A 1PFOA 2BNUA 3TTYA 3UO1H 2A9MH 1AMXA 5C0RH 2YXWA 3F83A 4XRCB 3X2QB 4WENB 5FFOA 1RK0A 4PTTB 3LZNA 4XPGH 4C54A 2G3MA 2ICES 1S7QA 4BKSC 1IE5A 2CKNA 4M61B 4NLHA 2AXGB 1A6VL 4HMCA 4IRJD 4BSJA 2CR0A 3OPUA 2CLVB 3BKCL 1F41A 3MJ9A 2DJSA 5D6DA 3NACH 1J8HE 2O6EA 3T2NH 5CEYA 3T4AB 4KPHL 5ESQB 3UZEC 5F7YC 3PQYA 2R0WH 3V6OE 4O5LL 3WKNA 2J73A 3SYPA 2DMBA 2HKFL 3AG3B 5JOFA 4I89A 2WLIA 5C86A 5FLUA 5LCVH 3CH1A 3X1FA 3BVWA 3I02A 4PUBL 1GMIA 1RZJL 1E0OB 3QUYD 3HRPA 3KYKL 4H8PA 3VH8A 5BZWB 5K1JA 2FLRT 2WKLA 1QNIA 3B9VA 3KPSB 4AQAB 3ULUC 4A6YH 2E9IA 4BM7A 1OW0A 4EXPX 3FULA 3GS7A 3MJWA 1OB0A 2AJYL 3BUPA 2OTWB 4MS8D 5E6ID 2J55A 3T4YB 1HH9B 5HPMB 4YWGL 4P8QA 1ZLVH 3D39A 5EF0A 2PYEA 2X4RB 4AEFA 1JFQL 3X3FL 4JHZA 3GZQA 4RRPM 3A0OA 3GRWA 4DOHE 5J13C 3OWEA 1KCVL 4PY8I 3GXUB 1CVSC 5FGCB 5KSBB 2Z31C 1FZMA 1KGUA 4EIUA 5F3BB 1DUZA 1S9VB 3GJFB 4EI6A 3QDGD 4AK2A 3QAZB 3GLDA 1C5BH 2C3GA 4JDZA 2Z8SA 4PI2A 2NR6A 3QPKA 4NN7C 3LSOA 5AZEL 3SOTA 1KTJA 3VXOB 4DO4A 4PJFA 1TUPA 2XWJA 5EO0A 3ZQXA 2EIKB 4AIZB 3BO8B 4YDIL 3RGVA 4Z3IA 3JWNG 2DOCA 3NCYP 1S46A 4V2BA 4MDIA 5FR3A 3ARFC 4QHNA 3FT3A 1HYRC 4XNMA 4F92B 3SQBA 4YHLH 3RTQB 1HIML 3GPSA 1H5BC 3EOAB 4JFPA 4RWHA 3STLB 4WEEA 3NYKA 3DUSB 5B39B 4R4FH 1J1OL 2GFBA 3AREB 1MJJA 1F4HA 1PBYA 3CHRA 1FO0A 1E3FA 1H0DB 1TYEB 3PWUB 1A7QH 3EF4A 1MFBL 3KPRD 4B96A 3E3QE 2VNCA 4X5RA 2PTTB 4LAQH 3SDXF 5EC2A 3CSGA 4UUJA 1E7UA 3VFGL 1ZT7A 4XNZC 3R06B 5IW6A 1BVKA 2QQKL 5KSAC 1GXEA 5HJGA 1ZLWK 3QIBB 5DUMH 4J5VA 5I1LB 3A4FA 4PJDF 2MQGA 1DZ0A 4EEEA 2KLRA 3ROLA 4FFWC 2QLVB 3QP3A 1JXFA 2O5YH 2AQNA 3H1ZA 4Q6IA 1JBJA 1M7IA 4EUPB 1F45A 5C8JA 1EMTL 2VLKE 3ULUD 5IHUL 5I18L 1K8IA 2A77L 2X3AA 2QFRA 1X5YA 4PJXE 1INDH 1LE9B 3LMJL 4KUZL 4M8QB 4EI5A 3WDIA 3TFBA 4Z5RA 1F90L 4BZ1A 5KZCD 1KBKA 1H3XA 5AAWA 1UFUA 2OULB 1H3GA 5AVVB 1RJZB 1EFXD 3VD7A 1GGCL 1JOIA 5E56A 3NJFA 4MBRA 3QUMA 2COQA 2XWTB 3GMRA 4N22A 3C8DA 4HCGA 4O00A 1DQDL 3DJSA 1YNTB 5FCSH 3TVMB 1J0JA 4JGJA 3VGHA 1THAA 1X5GA 4OGYL 2DRUA 4TVSa 1Q0EA 1BVOA 4KFMA 3FB6A 1UG9A 4IBQA 5SWSD 3DUUA 1E9PB 4PWJA 3SYAA 3VFVA 5DS8A 2DMCA 5C07E 4HJEA 3S8GB 5D7SL 2BCMA 2FJHB 2WHVA 1ZLDA 3PP3H 1HL5A 4PJEB 3NG5A 4ZW5A 1A7BA 3D3VD 2GY7B 2CUIA 3C5JA 3E6FA 1AGCB 1SDYA 1HOCB 1WQVT 3NSYA 4JHWL 4UAHA 2QLYA 3SKNA 5CAYB 3ARFD 5E6YA 3BUTA 2RCSL 2AJUH 1NGPH 2EEBA 3STZB 4WAFA 4RIRB 1MRCL 4DUWA 5DWPA 2F74B 1I8LA 5J11B 2VDLH 1MEXH 5CJOH 2XZQL 1U8PA 2V8LA 2YMTA 2EE3A 4BELD 2F7IA 3HZYB 3CZSA 1UA7A 4PJIB 4KKRA 1MH5A 5DI8B 1IBFA 4L9DA 5TQ0H 2BVUA 1JZ6A 4PAZA 3SD5A 3X1EA 5IJKA 5FYKE 2DLGA 1SEBB 1EHKB 4N86A 4B9FA 1JTPA 1WUZA 4FF9A 2Z8WC 4PJFF 3K81A 3C9NB 4QRUB 4H20H 4J3UA 1CGSH 2VLJA 3I50L 5CZVL 1GJWA 2AEWA 3EUDA 3TONA 1CYGA 2CKBB 1ZTXH 3DO3A 3UBXB 1MHPL 3L4CA 1T5WB 3QCVL 1DBKL 3MV9A 3KJ6H 2OMZB 1QASA 1KCBA 1LEGB 5EIIA 2BSEA 2Z91B 2N0KA 2F58L 1KXHA 1L9PA 5MHSD 2B77A 5L4FA 3MTRA 4JFDB 1Y18A 1S7RA 2VOTA 3O6LL 5IV2B 5E9DA 1WC7B 1AY1H 3H2PA 4WEBH 3EDFA 4PS4H 2N7BA 2MIZA 3FT2B 3MU3A 2XFXB 3RJQB 1T0MA 2V3DA 2Y2WA 3CFEB 3OKEB 3GS4A 5LNDA 3X1NA 2XQYG 4XNYL 3TBVA 4QHUA 5A43C 5FYKU 2VWEC 1U42A 4OIFA 3IMBA 3HI6L 4QHKI 5LAPA 3GM0A 4GSXA 4B60A 3REVA 3WEOA 3HOGA 3QCUL 3CDCA 1A7PH 1AKJA 2XBZA 4RISH 4Y0GA 1JF1B 1M71A 4P2RE 3REWA 5D2LA 3QWOB 3WKPA 1PPIA 1QP1A 4AQZA 1IAOA 1J5IA 4Y4FB 3VXQB 1HHIA 4XC1L 4NQTA 4R5TA 4LK4A 2HFFB 4ZD3L 1Q9OA 4YPGA 5GRJH 5HYFA 5LG6A 1DEEA 1MJ8L 2AJZA 4PCYA 4J1UA 4JZJB 5B4MD 1T22B 4XZ4A 4PQXA 2VMEA 3CQFA 4X7FC 5LN4A 4I77L 5E1HB 3GKZA 4IDLA 1QUNA 2BSSA 3SQOL 2WD0A 4IK6A 4XGZB 3VSQA 5HPOA 2I5YL 2CBQA 1FFOA 3CMGA 1B0GA 3HHMA 4ES8A 3PJSA 1I1YA 4NRYB 1MVUA 3AMLA 4MJIA 2EDYA 5I6LA 4R4NC 1H9DA 3U0PB 1U58B 1KB3A 4PLJD 1SGKA 2PO6A 4IOSA 4JG0L 4OFPA 1JNLL 2NZ9C 1Q0XL 4G5AA 4AG4H 1C7SA 2NLJB 4KI5E 1SMAA 3RTLA 3P4MA 4MS6A 3WTUA 2Y0SA 1A9BA 2D31A 1KTDA 2KUTA 3D34A 3KL5A 3QHFL 2WXMA 2Y06H 3FQXB 1OANA 4GOSA 4HHAA 1JHTA 1USZA 2JELL 3EFDH 2F54B 3VWKB 5JR1L 1T83A 5CGMA 5I8EB 3VU1A 3AWGA 1T2QL 4NT6A 1YN6B 4G8GD 4FFVC 4YC2C 2KYIA 3TBBA 4EKXA 2NW2A 4X5WA 5T3ZD 3O6ML 4E0RA 3BN3B 3MGAA 3GEWB 4LEBA 1FZJA 4LVNB 2BIPA 1VGKA 1R5WB 4M7LH 4BEIA 4LASH 4I87A 1E9QA 4OLVL 2GBTA 5ESVA 3QEQD 3MLRL 3RFRA 4K3EH 1S78C 1JZGA 2WTRB 2X5PA 3LZQA 3MBXL 5F1OB 2IAMA 4YHKH 5GS0D 4FQ1L 1MFNA 4GW5B 4PJCB 2G2RB 3ORJA 1MI5B 1HQRB 3BP5B 2J4WH 3VFUB 2FL5A 1QKZL 1GOHA 3QDJB 4Z7IA 5I71B 4PJHB 4PRPB 4JG5A 4P59H 2N4IA 5I73B 4ZMNA 3LH9A 4ZPTA 3ILQC 1DN0B 1RP9A 4WNSA 4NGHL 1CFQB 2BNRB 3VD5A 1O7DE 5ALBH 1QLFA 4YQXL 2XIDA 3HC0B 1BFVH 3VRLE 1Z3RA 4GI6A 1AG0A 5DGRA 1OGPA 3GZOA 3FCTA 3INOA 4HISA 1S9KC 4TLTA 3T8XB 4F5CA 4LVHC 3TEUA 2OJ1A 4X6EA 2IPKB 2VTFA 4HGKC 1INQA 5GGRY 2R0LL 5E08H 1OZUA 3IMTA 2C9UA 3L3IB 2KZ1B 4YR6B 4MDRA 3WSQH 5IG7A 1IGIH 2YA0A 1A0QL 2GB2A 2O5NA 1MDAA 4GUPB 2Y5TB 5GRVK 1FE8H 4E5XA 1KN4L 2DWSA 3FW6A 3FQYA 1CGYA 1I7RA 4R4ND 1HWWA 1ORSB 2H7WA 3EYVA 4JKKA 5FKPA 2Q86B 4LHUA 3TF7C 1A6AB 5C0AA 4NRXB 2Q8AH 5TPWH 3NRQA 1KTBA 1IAKB 4QO1A 2VL5B 1DUYB 5DTFA 2LU7A 1JJUA 1BYNA 1V3KA 2OMWA 1DVFA 3L5WA 4PJAA 5BO0D 4XP9H 1SHMA 4YGAB 5DVKA 2E6QA 3IRCA 1CU4H 4FFVD 5C09E 2DI7A 4KDVA 4KMQA 1JK9B 1KT2A 3T0VA 1CGTA 5F7KC 2ZXEB 4HJIA 5ESAA 4Z7UE 2C7UA 2QSVA 3H7BB 4F9PC 3QORC 2QQQA 1RVFH 2H9GB 3II1A 2ICEC 2W0KA 1DVXA 1S78D 1UACH 3PHAA 1KXVA 3QUXA 4ZNEA 1S7VB 3WCYA 2FEDC 3ARRA 4AYDC 3QXUA 5EG6C 4H88L 1TQBC 1FL5B 3N5AA 4HC1A 3DSFL 1SUJA 2P49B 4PJGA 5F6IB 5AVXB 1TZIA 5TGBB 5I19H 5JW4Q 1VCBC 3C60A 1GHFH 5IP4A 1LD9B 4FEMA 3N42B 1D9KB 5CWSB 5EH1A 2A0LD 3AJ7A 3ILQD 4ZTPH 3MUJA 4JQIH 4QOKD 1CR9H 4S2SB 3W3BA 3WIHH 2NNAB 1S7SA 3BW9A 1OT4A 3P9MB 3M1CA 4M1DH 4FYTA 3AMKA 1HESA 4KAQH 3NCBB 2EDOA 4JFVA 1ZVYA 4K7FB 2AK4E 3PAYA 3LQAL 4UM9B 2A9DA 1GA2A 1KJ3L 3GSRA 3KYNA 1OAJA 5D7LB 1ERNA 1WFTA 1YEHH 1ND0B 5AW4B 4DO5A 4NC2B 4OFDA 3IDIB 3DA0A 1V7NH 3GQFA 2WVSA 5HVHB 4Z3HA 3E8VA 1KTLA 4KKPA 1KN2L 4TUOB 1J87A 1GIGL 3SDCB 3K71A 1GGUA 4XN1A 3IAGC 4KNQA 4GRLA 1ZHBB 1AXTH 4JRYD 2DQGL 1WRFA 4YFDB 3UTQA 2IBZY 1U3ZA 2PP8A 4APXB 1YEDB 2GABA 3RAJH 1UM6H 5FUZH 1XZ0B 4QRBA 5GIRA 4FD0A 1KF9B 4MQXC 1U2YA 4J4PA 4YXKL 1TJIL 5CR1A 2OMUB 4G1EA 3PWLB 1MCCA 5F7HA 2ZOKB 1TITA 1ZS8B 1MCJA 1PNCA 1Z9SB 3VXRB 5LDSA 4PGZA 4HHGA 4LRIC 1JPFA 4UT6H 3IFNL 2B5IC 5TDNB 5HDWA 4GNKB 4OGXH 1MCFA 5E7BA 4LEXH 3EG9A 2D7TH 4OCYH 2DLTA 4AZ8B 2EEXA 5KVMC 1C08A 4I3GA 3LXBA 2B0SH 4LBEB 5TDPA 2FDBP 3SGEI 4JFEE 3LD8C 3BUYB 4TUJB 3D18A 3KPQA 3V5DB 1GS8A 3G9AB 2J44A 4OKDA 4WUUE 3RL1A 1RPQA 5L8KB 1SVZA 3D0LB 4Q6KA 5EEUA 2FEDD 1GKOA 2OMXA 3NSFA 1MCKA 2EDFA 4FQJH 4N0FA 1E9OA 4OCWL 1ZLVK 2ZSVB 1GOGA 2Y7QA 2CDGA 3O3DB 3M45A 3MLTB 4L0YA 4MA7H 3EHBC 3V4UL 4R5VA 2H47C 4O02H 4KTGA 1FH2A 2X10A 4G7QB 3O8XD 4AQ1C 4E9TA 2P80A 2V2WB 3IF1B 4RX4A 1OGTB 3S48A 1H9VA 4K5NA 4DN3H 4KOCA 4PU2A 4WFGE 3UTTB 2ATKB 3TPKA 4S11A 5H35A 5FUCE 4NXSA 4PS7A 4IBVA 2V33A 5KVDH 4NPYA 3VRJB 1Q9KA 4PJ5D 2AKRA 5DRZA 1PZ5A 1ZLSL 3ECVA 1G9NL 1U8CB 5FM4A 1JDDA 4UQEA 1NCAL 4UIMA 1BXAA 4F3FA 5BMFL 5CGTA 5HHNB 4A7QA 3NFSH 2VR6A 4MXVF 1P1ZB 3M17B 4OV6F 4ZODA 3FO1A 1ZVHA 2OR8A 4W68A 2R7EA 5HHOB 4LRNH 4I9WE 3BT2L 1QA9A 4XMLH 1RMFL 3N9GH 3FAXA 5IB1A 3OXRB 4MQXD 1FGVH 1TFHA 1IAMA 2AK1L 2ILLA 4XPAH 4O2FB 3SE9H 3AB0C 4R7NA 4NHUB 3A47A 3LN5B 3P73B 4LNVA 3ARXA 5L0QC 3NBNA 1IGFH 3MRBB 4LAJH 4WJG3 2FJSA 3VNYA 2J7LA 3QW9A 3ULAB 2CLZB 2UWEE 3HMXL 5D2NC 3TWCL 4HH8A 1U3HB 2Q6WA 3UAJC 3U9WA 2L04A 1FGNL 4QYAA 3P4OA 3BVNA 1KJMA 5EZPA 5BXFA 3CZJA 1F56A 4C47A 1TPXB 4GW1A 2HX7A 1T20B 3GBLA 3MRKB 2BY2A 1RZQA 1FWXA 4XPFL 3G5XA 3B8YA 5LQBL 3VA6A 3ZT6A 2BIIA 2EXTA 2YXMA 3O45A 3NJLA 3BAYA 5GGSY 1B0RA 3DSNB 5J12C 4PIRF 4TTDC 1Z32X 4JKNA 5SWZD 4BQBA 2KT6A 3IGLA 1BF2A 3BP6B 3G04A 1TFPA 2QSCH 2BHUA 3GS0A 1HXMA 3H9ZA 3MMEA 4HCRA 4P9ML 3S35H 3WJJC 3LIZA 3DOIA 2OTUB 3DX1A 1KEML 3E1F1 5L4JA 1BPVA 4Z7WE 4PD4J 1NBVL 2DQDL 2QVTA 4JR9L 4DGYH 3QIUA 1LHZA 2VZTA 3L13A 4DWHA 4Z7OF 1A3RL 3QYMA 2EVIA 3QBTB 2VZ3A 1NIEA 3O4LE 4NKDA 1DBAL 3ZDXE 1AGEA 1OM9A 1EXUB 1P7KB 2ODHA 3ULSB 3PJNA 3WKQA 1NOFA 3VYOA 1UA6H 1XGPB 3H3PL 3H9HB 4HHWA 1IKNC 3C87A 3DRQB 3PP3K 4K2UH 2W91A 3FFDB 4QY8A 4DK3A 1JZ3A 2F7RA 3O4OC 3BWUF 3A6OA 3QS3A 5TH2A 3PY9A 2ZOOA 4G9FB 1JZFA 5BQDA 2BERA 4W9HC 4C58B 4LSVL 4NJAH 1KULA 3INUL 3FRPB 3MBEB 3W9EB 2EKJA 1IM3D 2ZOLB 2VSDA 1IQWL 3MRJB 3EYFA 5T1LD 4Q56A 3LNFA 4XVSL 4PS8A 1HWGB 4BQ8A 3KWWA 5GZNA 4DCQA 1OD7A 1WIOA 3I3BA 2E76C 4ZRGA 4F15C 2BIMA 2IQAA 5DRXB 1JS4A 4QRSA 2DYPB 4Z3GA 3SJVE 3MFFA 4OFVA 4NZUL 5C6TL 4F7KA 1CF1A 3KLHD 5EU5B 2HVKA 4DW2H 3U30B 1KC5H 1XF3B 1YEEL 3AW5A 2GBAA 3GMOB 4FNSA 4MAYA 4MBOA 5FDYA 5ISZD 4OZFA 3WNNA 3LRMA 1TLMA 1GZPA 1KNOA 4D8PB 4GAJH 5IB4A 2VR5A 1NFDE 1BREA 4MXWL 3ARBC 1J18A 5GGQH 3QNYB 1ZEAL 4LSSL 4OIIL 4D7BA 1X4ZA 3DROB 3P0GB 3FQ1A 2WVVA 4XCNA 2YZ1A 1X5MA 3VVWA 1W2KT 5BRQA 2F08A 3U46B 2LW3A 1PY0A 2XPGA 5JZ7D 1S7TB 3B5TA 2PF6A 4JHAH 2RQEA 4BH8B 2NY5L 3DXAA 2TSBA 1KYDA 4KI5F 5EOTB 2BP0A 4CAGA 4A55A 4XP4L 2FHCA 4IIQC 1JHLL 1WWWX 1G5GA 2CO6B 4HG4J 1R3HB 4OQTL 1R0AH 4MYWB 4HJGA 4KRMB 3F7YA 4X6DE 3HI1B 4TTDD 5GPRA 5GJSL 3QJZA 4ODTL 1JNJA 1RJLA 3VRIB 2NY4B 3BUBA 1J5DA 4N90E 1BZ9A 1J9QA 1PDKA 5I8KH 1LO0L 1D5RA 2NY3B 3MCYA 1PF3A 1NCGA 3GMQB 3TU6A 3HR5B 4XO8A 1I8KB 2BOCA 5FS5A 2YWYA 1XEUA 3QJRB 5HHMB 5TK4A 2X6UA 2VZSA 1OSZB 1BZ8A 1CIUA 1QD0A 1G6RA 3HS9A 5MERB 1CZ8H 5DQDL 5AVUB 1I7UB 4TVPH 3FSAA 1FVCB 4PJ6A 5IQ9B 1A4JA 1TZGL 2F8IA 4JO2L 1O5PA 1YN7B 4RWYH 1ZS2A 2EO7A 1QTPA 4UAOC 3QZPA 3SO3B 1UT2A 5HHPA 4N2CA 2X2HA 1R3IL 4L9LA 4MMXA 3CXDL 4FXKB 3H8NA 4BBWA 4IRSC 3WBDA 3VMNA 4YDKL 4ZO6A 1RUAL 4G7RB 1S5IH 5A2KH 1HINL 5HGHA 2DLHA 3TNMA 3QG6A 3VG9C 2H6UA 4CGTA 3VXSD 5FYJD 4K94C 1PD1A 4LCWE 2YD8A 1M6OB 3QQ9C 4B9KC 3QO0B 1FNGA 4PH8A 4FLOA 3F6LA 4GG6B 3P0YH 5DHDA 5LGHL 5IHHA 2FBRA 5IK3B 5FYLL 1P9MA 4MCZA 3B2VH 3CFKB 3ETSA 3O3EA 1TJXA 5ENWA 4OIBA 1T7XA 2VDOH 2GBVA 1TVHA 4NENB 1ZANL 4Y4KA 5F7MC 1SHWA 4OCXH 3N41B 1MWAH 3SPCA 2FJGB 3JV4A 4I3RH 2VE6A 1BVNT 4R3SB 4CU6A 3FYIB 2PCFB 4JRXE 3ARYA 3WXVH 4P23A 3SEPA 3DX8B 2WIIB 2FBJH 2FX7H 2H6PA 4HUMB 3H9SE 3U2SA 3NQIA 3X3GH 1E67A 1OGAE 2C4FT 3OJMB 4M6OH 4KVCH 1KBVA 1SHSA 3L9RA 5C08B 4AKPA 5CJQL 2ZG3A 1CFNA 4QRRE 3SKMB 1T1YA 5GGTL 5BS0E 5PCYA 1JZ8A 4Z8FH 4XWGH 4HULB 3V52H 4DVRH 4BHUI 3NCCB 1WYJA 3GSNH 5L2KA 2WAQA 2DQHH 5GGRA 4JUTA 2YPLB 3G08B 1OSPL 4HKXB 5ICXB 3V4PB 4JG1L 5FFGA 3P4LA 4Z7UF 3EDKA 1FPTH 1NAMH 1CL7L 1XHHA 3MLYH 5JQIB 2EEDA 5ACLA 5JW4N 4BZ2A 4DHLA 4FXLA 3QEUA 5CBAB 2DWXA 2BVPB 4GG8B 3L5JA 3S5LG 4E9XA 3L4YA 4L3EE 4LLAA 4JVPA 4GY4A 4M00A 4JRWA 2K70A 3GDBA 2BS9A 2NTFB 4ISVA 3G5WA 3RWHA 4AC2A 1HHJA 2G2PA 3HLKA 2R1WA 1UHVA 5FOJA 3RVTD 5TQ2H 4D3CH 3WE6B 5MEOA 5LGYA 4Y5XB 4YDMA 3TIEB 1ONQA 3WG7B 2YRZA 2ARJB 4BUGA 3GXPA 3WHXA 4RFOL 4BYHA 6FABL 5IUCA 5LXGH 3DI3B 4Y9BA 1P2CA 3ES6B 5KANG 3BAJA 3TO4B 5IOPA 2L7EA 3QQ9D 1GGIH 2H41A 3VJ6A 1TEFA 4JFHD 3EYQC 2R56L 4TQ8A 1YDPA 2A6IA 1IBBA 4JPVH 4N8UA 3TN0B 3D39D 4XPBL 4GIAA 1Q9LB 3LHPL 1LNUB 2DIAA 5JA8B 2PYED 3LKNA 4KK9C 4R2GC 6PAZA 4PHZA 1CDCA 3TIDA 4F7MA 5EU6E 1W72H 2A6DB 4JLRB 4L4VB 3SBWA 4TOYL 3K4DA 5HVWA 2H32B 4M1GL 3VMPA 3WOVA 1XEDA 1QYGL 1J0ZA 3FT4B 4HS8L 4ANUA 1PY4A 2HRHA 2MQCA 4GRMA 1I9JL 4JO1L 5KW9L 5C6WH 2GUYA 5LN8A 2IPTH 1N6QH 3FQUA 4YMPA 2XFGB 3BZ5A 5I9QB 2NR6D 3IU3A 3OGCA 5JORA 1JERA 1ET7A 3UACA 1L0PA 2X1XR 3CU1A 3NPZB 1BQHG 3LCYA 4HLZH 3RGVD 2BWIA 5DWUH 2I26N 3SPGA 3VD3A 2HJKA 1NEPA 4U7MA 1WBZB 3DURA 1A4BA 3QNZA 5D1XB 2VW7A 2BNQB 4DETA 1RIUL 1ASPA 1FJ1A 3TT3L 4Z7WA 2A4ZA 3MRFB 1DBBH 2EIZA 4PRAB 2X0VA 1YYCA 3B1TA 1QFUL 2DQUH 1SYSA 1A6PA 1EHAA 1KIRB 4A1RA 4FMFA 4LEOB 3O6FB 5E99H 5K33A 2KS0A 5AVSB 4ZMOA 2VITB 1L5GB 3D5OF 4I3SL 1XV8A 5H94A 1FNAA 3FF7A 4Z7QE 1QI4A 3ZLQC 2NSMA 2WSDA 5JYMA 5DJ8A 3IMVA 3EYSH 1AS6A 1SQ2N 3N3EA 2L7QA 3C5ZB 2IGLA 4R96A 1MCBA 5IB5B 4F7CA 3MGTA 4OTXL 4ZW7A 4K7PX 1FDLH 4EIGB 1TZHB 4M7JL 4OJAA 3W0WB 3NZHL 1NC4B 2EC9U 3VXUA 1KYOK 2FT8A 1UXSA 2IBGA 4HZAA 1CFTB 2RBLA 4XXWC 4UTBH 3EOTH 3DKHA 3EYQD 4YSOA 1J0IA 4S10A 3N0PB 3BPOB 1PD6A 3BKJH 4EI5D 5DURB 5FYKH 4QLRA 2D2OA 4KK9D 4PV1C 4CADB 2F19H 4LCYA 3FOLA 4WO4A 5J6SA 4BZYA 5KSVA 1Z5LB 2AJ3B 1NFDA 3CPLB 5DVOA 5DMYA 3OKMA 4RNRB 4JFOA 2H1PL 1HNYA 2WW8A 4DGIH 1I1FA 3KR3L 2DQIL 4RH4A 1XTMA 5JHDD 2K8MA 1CGUA 5HJDA 4NO5A 1I7TB 1AANA 1YPZE 3ME0B 3QXDA 2V17H 2EDRA 4B9ZA 2VDKL 2WOYA 3HG1E 3ARVA 2XG5B 3QNFA 5EDSA 2OJEB 5IBLD 1K2DA 3BWAA 4L3CB 5A2AA 2ZXAA 3U6RB 1QHQA 3QI9A 3T08A 3I2CH 3WLBA 2WJ5A 3S2CA 1QSEB 2YUWA 3L4VA 1PZ2A 1AS7A 3F84A 3D2UB 1NDGA 5INDA 5FO9A 1CL7I 4HBCL 1ORQB 4LSTH 4RQQB 5C7ZA 1JHKL 4H4NA 1BV8A 1UWGL 4GKOA 4R7DB 3CXFA 5IVXE 2VXTH 3MV8B 8CGTA 1IU1A 1XF2A 3IFPB 2B1AL 2EIMB 1MF2H 1A8ZA 3TEYA 1YC8A 2QPEB 3LQMA 3O9WC 2CBMA 3NABH 3S96A 1PGRB 1RJYA 3FU3A 4WZ9A 3AGVA 3HAEA 1SXBA 3ELAT 2V2XB 3U83A 2YHGA 5C7XH 3HZVA 1JVLA 2XN9E 3QJFA 1N8ZA 3HN8A 4UTCA 5JIQA 4HLZG 1KJVB 2B15A 3V6OC 3OMZA 4L2YA 3OZKA 2YQ2A 1S7UA 2BFGA 3F7RA 2ZP9A 3B43A 2XY1A 4RMUA 5ID0A 2CBOA 4KK5C 1AOZA 2DH2A 4DTGH 2Q20A 1YJDH 1ACYH 3O41A 2DIBA 4PRHA 5FA4A 3MV7A 4Z7WF 2AV7A 2RFXB 4Q97A 4N8CL 3CGTA 3MV9D 5DJ6A 1EBAA 1J86A 5EFIB 1P69B 5I1EH 1Z0MA 4KZDL 4G1MA 3JYBA 5C9KA 1E4HA 1SJEB 5GISL 3FU7B 3ZDXF 1NGXB 5E9DD 1GSMA 4GXUN 3MNMA 5E8NA 5ICZB 4O4YH 2X1OA 4PRDB 2GTQA 2YPVH 5IMOB 3HE6A 1VPOL 4U0QB 2IAMC 1ZPUA 5JHLH 4Q74A 2IH1A 3DECA 4TNGA 1FNSL 2J57A 3P30L 4G5ZL 3S2AA 2IQ9H 4GXFA 3GGWA 4G7YH 5C0EA 2C9RA 3MLZL 5F7DA 1YSOA 5GGSA 2ZUTA 4ZMWA 3MA9L 2EH8L 3P3SA 1GKEA 5EO1A 1EBPA 5EZLB 4YXLH 4OLYH 3VSTA 1TTCA 2EDLA 3UX9B 4LLMA 3M8OL 3MACL 1TQSA 5A2FA 1C16A 5IB3B 2YPKB 4PJBE 3QZWA 4EDWH 5G4NA 5TK2A 1MY5A 4LSDA 2ITCB 5DHVH 2YD0A 2KMWA 3MOBL 1GH7A 3EAKA 3G6JE 4M61A 1ZIAA 2VXVL 5C3LD 2ZWLT 3Q2VA 3CJJA 5T1KD 4PJ9A 1NFDF 2HTKC 4RMWA 2CCVA 2WYZA 1YYLL 4NQXB 1NC2A 1YHPA 2N1KA 3WUZA 3MROB 4A7VA 3TA3B 2B1HL 3O9WD 2N0MA 1EO8H 2UYLB 2HKAA 4HEMA 4IRZL 4A7GF 1OVZA 2VUYA 5GS1C 2PO6D 1YEKH 2XV2A 3N85H 3E3QC 4IOSD 2WZ0A 1J8HD 1D6VH 4M7KL 2DLFL 2DWEB 5CSZB 3SIKA 5I6MA 4Y2OB 5EUKB 5CHNB 3BH9B 3BAEL 3L3DB 1AFVH 5CP3A 1LWHA 2JQZA 2OQJA 4KK5D 1GOFA 4QRPE 4M4RB 5BZWA 3KPSA 4X6DF 2HKHL 4Q9BA 2ICCA 2CG9X 2VH5L 1U8QB 1J1PL 4CKQA 1U91B 2BINA 2F8OA 1HH9A 5HPMA 4IOIA 5EBLA 5I1AB 4XCCH 1HZLA 4IKNA 1IT9L 2EYSA 3AXLA 5I82A 4IRJB 4CSSA 2A2QT 1RZ7H 4MQSB 2C1PA 2XQBH 1LVEA 5FF6B 1A21A 3X11A 3KXFE 3OKOB 1NCHA 4XNQB 3WEXB 1VADB 2BFVL 1NGYB 2IAMD 3NCFB 4OGAD 3OBAA 4JHVA 5F3BA 2PW2B 1HKLH 3GJFA 3I9PA 5AKTA 2AGJH 4OLUH 1E43A 3B7TA 4UINL 3CDGA 4PGDB 3QUYB 2CR6A 2HFGL 3FTZA 5D7IB 5B1JA 3VFMA 3PP4L 3PHSA 2VQ1B 4PREB 5ES4B 5F88B 2A1WH 1CXLA 1X7TA 2CH8A 2OX5A 1KB5L 4DGWC 4IJTA 4EE2A 4F33A 1BOYA 3K7UA 3NK4A 2AXWA 4KX8A 3ZTNL 2PXYA 2WTPA 3OKLA 3BO8A 4X5LA 3CVHH 5D4HA 4L0PB 2Q7AA 3MVSA 2WQSA 4J3WA 3U4BH 1NLDH 2F53E 1HNGA 3D4CA 4H1LH 3VXME 5IFJA 4Z7VE 2R15A 2J20A 3BD3A 5JOPE 4MQ7A 3EOAA 3K8LA 4NO2B 1D7CA 3DETC 5B39A 2KBGA 4GBXC 4K5PA 3AREA 4AGLA 3GK8L 1H0DA 3PWUA 2W0FB 2C34A 3NCJL 3B4NA 3QDGB 5A16A 3R06A 1MIEL 4G6ML 5GS3A 5K9OB 5LBGA 4Y9CA 4UT9A 4YHZH 3NIGE 4HZ1A 1SPDA 2WBJA 4KKAD 2QTVA 4BXVA 3GI9L 5J0BA 3TT1H 2GJ6E 3ZTEA 4X4XB 2ENYA 4MHHG 1E6JL 1TQTA 4EUPA 3CZFA 2DQTL 1B2WL 1UGNA 1EXHA 4KJYA 3ZHKA 1DVFD 3L1GA 4X8JB 1G7PA 4JFXB 1GYCA 4P5KB 4XVJH 4G59C 5CXPA 4NAQA 3LAFA 2DY2A 2VLKD 4KKQA 1XFPA 4K8RL 1M53A 2Y4SA 4Y89A 5ECJE 3KPRB 1NEZG 4KKCD 5C0BA 4AIOA 4XBEL 3RB7A 5F2FA 5IT2L 3IGAA 3QUXD 4KO9A 4E2OA 2F5AH 3QSKB 2CJSA 3L8QA 2HG5B 1WA2X 3EH1A 4AEHL 2JJSA 3OWRA 3VMOA 2PR4H 1IBHA 1VACB 1WCBA 4ZSOA 5DD0H 3C60D 1UA3A 2Q7YA 3WFZA 2BZCA 1A6UH 3HI5L 3L16A 6CGTA 1M3IA 1PQZA 5HDOA 1CB4A 4R9HA 3FO0L 3ESPA 1ACXA 3DBSA 4OF0A 1LE5B 2OMYB 4AGMA 2WINA 2ZCKH 1L7TH 3GYRA 4LCUB 2FJHA 2WANA 3FHEA 3MNWB 1JSYA 1AGCA 5KG9B 3ZMRA 5KZCB 1QBAA 2EXYD 4PJ7B 1GSKA 4GMTL 1GTFA 5A3ID 3STZA 5BV7B 1EFXB 2BCKA 3E80A 1SJHB 3DETD 4GS7C 3Q06A 1Q0YH 2I9LA 4R4BA 1L9OA 1WD9A 3C5XA 4JMNA 2RACA 2QKIB 4H13C 3RUGB 2AZAA 3HZYA 4PJIA 4APQC 4AKOA 1JYVA 1OKEA 2WNGA 2G5UA 2GC7C 4MCYB 3SY6A 2GJPA 4YE4L 3OLDA 1QPPA 1DVQA 3BMWA 4X7SH 5JIHA 2VABB 5E6UB 1XCWA 2KLSA 4NBXB 5SWSB 3UJJL 3ZJAA 1HCVA 1Z2KA 5JW4R 4NQDA 5FV2A 3DIDA 4QRUA 3GSWB 4H1LG 3U6XA 1LDPL 5FYKD 1JZIA 4FTVE 2C3VA 4J4PD 4ERSH 1UOWA 5GRUL 1A8JH 3BPLB 3D3VB 3PAUA 5I5RA 4KI5C 3KLAA 3UBXA 1HEJC 4HIQA 5IJVA 3ARFB 4LU5H 4E9YA 2MQ0A 1NM4A 5CJ5A 1LEGA 2C9AA 2X53A 3O0RH 1WBXB 5JIIA 1AZUA 2EIJB 2PMZA 4AJYV 4LVOC 2NQCA 4BUQA 2W0PA 5IF0B 2GIYA 4HWUA 3FJTA 3FT2A 4ADJA 1XCXA 3B6SB 1FIGL 4MNGB 1JGUH 1XGRA 4GAGL 1KBPA 5BNXD 2UUDH 2YGNA 1UYWH 1P7BA 3CFBA 3QFDB 3B83A 5ALCH 4JZNB 1ZVNA 3BQUA 4N9GA 4JDEB 5IW3A 1OARH 3WJMB 3ZZQA 5CBEB 5JXEC 1Z3GH 5DK0A 3ZZSA 1BBDH 3OJDA 4OM0L 4Z7QF 4BK4A 1CDBA 5JPNC 4MA8H 4TSBH 4JY6B 1MNUH 3WFBL 2P80D 1Z5YD 1VCAA 3LXUX 1CJYA 2ALAA 3J2PA 4C57C 5HYSG 3QDME 5BJTA 4XXCC 1KFAH 3HTLX 4LXFA 4Z3EA 1O7DC 3AG4B 1YUHB 3ZYOA 3V0GA 1J0KA 2B59A 3M7OA 4UNIA 3MLWL 4KJPC 5AG8A 5L6YH 2FLMA 5CCHE 4U1MA 2HH0L 2VQTA 1KEGH 1QR4A 4XNDA 1NDMA 4Y5YB 4M48H 5DD1L 4LOFA 1MCHA 4BFIA 4BFJA 5DJAA 4XP5L 4D8OA 5ID1B 4KTDL 5ACMA 3DIVA 3CN4A 2XWDA 3MNZB 4JN1H 2NW3B 3MV11 1XGTB 1ANUA 4FFYL 4APQD 3U0PA 3SCMC 1QG3A 4Q58C 1S9WA 2WGXA 4LARL 3UIYA 1YRKA 5J7CC 4K5LA 3F3HA 3GI8H 3B5HA 3AS2A 3IAPA 1KCRL 2NLJA 3FQWB 4JY4A 4UQBA 2X1WL 1O9VA 2VN3A 4P2OA 5HYIA 5ANMB 1CE1L 1OB1B 4QR7A 5C0DB 3U7YH 1XD1A 4GKLA 4KI5D 4OSUL 2JCCA 4KJQC 4QRPA 5I8EA 1AH1A 1YN6A 3L9BA 1EWHA 1EDQA 2QHLA 2Y69B 1GJIA 4HUNB 3WS3A 1TMQA 1IEHA 2CHZA 3MTXA 3TNNB 2WOBA 5DF0A 3EDEA 3AUVA 3FQNB 3SZ6A 1YEWA 4QGTA 1NGQH 3IE4A 3I9AA 4YZWA 4HXBH 4MMYB 2DQCH 4EDXB 3AM8C 5DEZA 2G3NA 2HFEB 4YHPA 3UAFA 4PJCA 4QXTA 3PWVA 3MZTA 1MI5A 1HQRA 4KDTA 2B4CH 3PUUA 4X4KA 4KRPB 2FWOA 5JXED 3LKQB 4S1SH 4OZIB 3P2BA 3BE1H 1BAFL 2Y07H 2ESVE 3OMAB 2DDQL 1IVTA 3NZSA 3WFHB 2BRRL 1AQHA 3AQXA 3S8FB 3HC0A 1T5KA 4G8GB 3CDYA 4R26L 1L4IA 1NCDH 4XP6L 2B3IA 4B97A 2Y3AA 1I1RA 4P5TA 3LKPA 2IXQB 3T8XA 3ZL4L 4BFRA 3IWVA 4UU9B 5DFAA 4D7PA 4FJZA 5DSCB 2P8LA 1MNNA 3QIUD 3QEQB 4JB9H 5JQ6L 2EAEA 1EAQA 4KJPD 4LOUC 2RB8A 4YR6A 5DJZA 3VI4E 3GHBL 2Y5TA 2G0LA 5KJRH 4HUXB 4X8GA 1HYSC 4F1SA 1KUMA 3QJVB 5LNEA 3ECBA 3KNBB 5L7XL 35C8H 3OZ9H 3SCMD 1F4AA 4MNHA 3C75A 3KYOA 1ORSA 3K2UL 2F2HA 3L3HB 1A6AA 3BDYH 3RWGA 1TO4A 3IYLW 2A7BA 4LSRL 1F6FB 1IAKA 2C3XA 1OV8A 3IEAA 3IFLH 3K6FA 3LQZB 3DVGA 4MMZA 2A73B 2W9EL 4WQOA 3UFIA 4JE0A 4L1BA 5GZND 5EC1B 3NCYS 4OJEH 4QTIH 5FB8B 5JUEL 3I6KA 2QVKA 3MLUH 1Q38A 3BPCB 3QQ4B 3BDBA 5E2TH 5H2BB 5ITFA 3H2QA 4L0ZA 5CEZD 4ZFZB 1MREL 1BAGA 4E9VA 2X4TA 5FWQA 1E65A 3GZPA 2X7LA 1WBYA 3SE8H 4MAYD 3TOPA 5IB2A 1WICA 1E40A 1WFMA 5C09D 3IKCB 3N0AA 1AMYA 4FA7B 1F3DJ 3I6SA 2XJLA 5DCCA 1S7VA 2MOVA 4OQTA 4OLWH 3MNVA 4L2LA 3FO2B 3OPZL 1KBWA 4EQ2A 3H53A 4G3YH 4B95C 4HJJH 1J11A 1FBIH 3SODB 5CUSH 5HI3D 1QSFA 2K45A 5TGBA 1DQJA 4YX2L 1JPEA 1CS6A 3M07A 1QMUA 4KXCA 1EZUA 5CWSA 1D9KA 3K4ZA 2KPNA 3DXAD 3GXIA 3NIFE 4EI0A 3JWOH 1A6TA 1B9ZA 4S2SA 3DYOA 3EJJX 1E28A 2JCCF 4HJTA 1U3NA 3FK3A 1HILB 4L23A 3A6CH 2CO1A 1PLGH 4PIBA 2JLLA 4P48A 5KS9E 1AI1L 4MRCA 1N4XH 4NQEA 4UQCA 4C55A 4ODXA 3HRZC 4TNWF 2ZOUA 3W11D 3IJ8A 4K7FA 2MCPL 3WNOA 1H3VA 1BYPA 1KELL 2YA2A 3RA7L 1CT8B 1F2QA 3AROA 3ULUL 4LOUD 5FUCC 1XB8A 2MCG1 4WNQB 3BRFA 2ADFH 1BHGA 3H55A 3LKRA 5LHDA 5CLWA 2AK4D 1XR8B 2B08A 2F7QA 2QV2A 3WY4A 4ZMYA 4TUOA 4Q4EA 3K8KA 3VFSA 1HYSD 3LEVL 1RIHH 1ZLEA 4X99A 4AQEA 5C0JA 4HIPA 1ZHBA 3FCGA 5ANHA 1JV2B 2XA8L 3K6OA 4JGMA 2J1XA 3P40A 4F8PA 4QOKB 4TSCH 5AAMC 1TTAA 1YEDA 4GFXA 1FYTA 1NCBL 1TQUA 4RMTA 2Z3FA 2OMUA 5F71A 4NM8H 4LHQB 5A2BA 4X0NA 3SQRA 2ZOKA 5JHMA 5TE7L 4Y5VC 3OGOE 1EGJH 1LJMA 1Z9SA 3RZCA 3T2QA 1KCSL 4HIEB 4G6AC 4N68A 5TDNA 4B6ZA 4PG9B 3O2VH 4O58H 3ZE2E 4OQ1A 1NSNL 2CRIA 1RH8A 1A7OL 3BMVA 5FUOL 3QXTA 4ZUSB 2ZD0A 3D48R 5FK9B 1F6AA 1UVQB 3KPOB 4U3XA 1OAXL 4LBEA 3AG1B 3OSKA 2LQRA 2VLME 4WCYH 5BZDB 3L1OH 5FGBC 4TUJA 3JZYA 1AC6A 5FHBH 3LVEA 5GSRA 1VEMA 1U92A 4KXZI 1UEYA 1KENH 1U0QA 2CGYA 4JRYB 1IC7H 4Y4KD 5GGTA 3U48A 1WHPA 3U6XS 3OG4B 4WUUD 4P3DA 5BW7A 3NIGF 5EN2A 1OSEA 3ZO0A 3EOBA 2FB4H 2MHAA 1YECL 5DJYB 2HWZH 3DJTA 1BZDA 3RWFB 4YO0A 2V2WA 2WN3A 3WUWG 3MYJB 1LP9E 4UI2A 2WXLA 3BH8B 3VSVA 2UY7B 4ZTOL 4LCCA 3ALWA 4LGSB 4JKMA 4XVTH 1F97A 2F0CA 1JXGA 5LNGA 4FYRA 2XDHA 2VJ8A 5L2KD 4CU8A 4WTZA 4F91B 1QLEL 1U8CA 1EPFA 1F00I 2WXRA 2ICEB 3KHOA 2C9XA 4JKPH 3K0YA 3UZVB 1HFUA 2WV3A 4W70A 1YY8B 2YS4A 4ZS7L 2WXGA 2AJSH 1P4IL 1TQBB 2KKQA 4XN7A 2DB8A 2NCEA 3ECWA 3Q2LA 1P1ZA 3MRMB 2J88H 4JFFA 2WC7A 4UT7H 4DFIA 2CO2A 3H0TB 1ZJAA 3O8XB 1FORL 2VDLB 3EOYG 5GRVL 3HUJA 1MVYA 3T6WA 1V7ML 3PNWA 4XPTH 3BGFC 4KQ4L 1BD2E 3T3MB 1KIUB 4TULH 3C8HA 1VGEL 3N44B 5CILH 4I9WD 4O2FA 2JKIS 1NLBL 3AXHA 5LBSH 4GQ9L 4PJ5B 4G6AD 2BOLA 4LKXB 2WUCL 2RD0A 1F8TH 1YYMH 2B4CC 1DP0A 2DIJA 5I24A 4J3BA 3MRBA 2Q1EA 3QIWC 4WV1A 1QSZA 2XSKA 2CLZA 3E8UL 1U3HA 1TR7A 3IJYB 1WEJL 1OF2A 4HXAH 2X70B 2Z35B 2OR7A 2QMKA 1QI3A 4FQIL 2CK0H 1IEAB 4WTXA 3MRKA 4ZMLA 1M42A 2AEOA 2ED7A 2XZCH 3OLGA 2CDFB 5G55A 1ZGLM 1LO5A 1AJ7L 1NMBL 4LMQI 1JZHA 3FTUA 3ERXA 4U49A 5T3XD 4OZHB 5C0NC 1J1XH 1QW8A 2LLLA 2LVCA 4KGJA 4QXUH 5IWLC 1F4YL 2A9AA 3DSNA 3MI6A 3KLKA 3VO0A 5K69A 3G6AB 3ISWA 5E6RB 4LQFL 4OFYD 4PBWD 5E4AA 2OBGA 4OCLC 2B5IB 4XZUB 2OTUA 3LH2L 1AD0A 3WAJA 4ZUTA 25C8L 4NQCE 1SOXA 3QPQC 4ANXA 1CD8A 3UPRA 1O7VA 4M5ZL 2E3VA 2R8SL 4G8IB 4ELKB 2FIKA 1OP3H 3O2WH 1MW2A 1VEOA 1JNNH 2J71A 2YFOA 3IDGB 5T3ZL 1JIBA 2Z92B 2PUQT 4JO8A 4AYSA 3DO7B 2FX9H 3G6DL 5B8CC 2AEQH 3O4LD 1Z1WA 3FFDA 5K1VA 2PPDA 3ZKNC 3L2NA 3ZHLA 1KGCE 4PCKA 4X4YB 1YY9C 1UD2A 3MO1A 3LNEA 4LCIH 4XWOC 3L5XH 3KAAA 5D70L 4AQ1B 4O51A 1SQMA 3DJ9A 3HVDA 4HH9B 3UO1L 1PZUB 2A9ML 5SWZB 5C0RL 3NZ8B 3QDAA 4H2CA 2YAOA 1WHOA 3CLWA 1I9EA 2WNXA 1UD8A 3F01A 4UQ2A 2AABH 4JO3H 5DRXA 1MG3C 5BO1H 2YFNA 4ODSH 3VXUD 1GW0A 5BRZA 1OALA 4DKFL 4N2HA 3S36H 4X5PA 5JOEA 3GMOA 3KWXA 2DM2A 4NIYE 2NY0C 3NACL 4X98B 3L3GA 3T2NL 1HHHB 2VMCA 3BUQA 3HFFA 3JWOC 1E5AA 2R0WL 3WTSA 3MX0B 5IMKB 3TBTB 4ZMAT 4J7RA 3DROA 1ZWIB 3O11A 1T3FA 1JP5A 2J8UB 5LCVL 2O72A 1ED3B 2G3ZA 3HUJF 1IM3B 3O3UN 3WFCL 3DX7B 4U6HB 4QI3A 5T1LB 4AM0A 5GGUA 5AQ0A 1IC4H 1XMEB 3GHEH 5EOTA 3BRDA 4A6YL 5C0ND 5BVJB 4WGVB 3FZUC 5E4EC 3QG7L 1JD7A 2ENSA 2MMXA 3V55A 2UUDK 3AB0B 3RPKA 4N0CC 4OUUB 3RWEA 3VRIA 4AXWB 3MRDA 1XR9A 4KZ0A 1AZNA 2OMNA 5L0QB 4AV5A 3A5VA 4CBPA 4XXDB 5ISZB 1I1AC 3QI9D 2DEYX 3HS8A 3HR5A 4F9LA 5D2NB 5I2IB 5J9PB 1I8KA 4N8VB 4UQ3B 3WN5A 2XKNB 3WN6A 5G2NA 3K91A 3P9WB 4N90D 1MFCL 2UZXB 5GHWL 1MLCB 5ADOL 5I1GH 1OSZA 3WI9A 1WFUA 1TVBB 4G6JH 1ZXKA 4Y8AA 3VCLA 1PVHA 4OUOA 2CUMA 4E68A 2G2NA 3IU4H 1I7UA 1FVCA 5IQ9A 2K7QA 3JV5A 3OZLA 1YN7A 2YAMA 3S3SA 2ID5A 3FCUB 3VH8G 3ZKND 4PM1A 2DBJA 1TJGH 1E5YA 2WQRA 1FZKB 1YY9D 4D0DB 3JUZA 4KMLB 1M7UA 1M6UA 3ARTA 3EADA 4LSQH 3CX2A 2ICWB 5I1DA 1MAMH 5J12B 3B5GA 1BM3H 3HC4H 1GYVA 1Y07A 4YHLL 3PWPB 4ONHB 1OK8A 4AEEA 3U9PL 3QO0A 1TQWA 3CLEL 2Z1PA 4PRHD 4UIKL 3Q3GB 3MV7D 3QA3B 2Y24A 5IK3A 1KIPB 1L0YA 1LTXA 4NBZB 1A7QL 4N2IA 5E8PB 4A7TA 1FNHA 2NY0D 4OD2B 5F1KC 1EH9A 3CFKA 4W93A 5FM5M 5LLIC 3VI4F 3KDMA 2NUPB 2RR3A 4RFEA 3VAEA 5HDBF 1W8NA 5IVNA 1ZY9A 3O4OB 3GKWH 2OI9C 2LVEA 3MUUA 4R3SA 2F15A 1MCRA 4WTQA 4YHIB 3MJGX 1MY7A 3NFNB 3DX8A 5DEGB 4J3OF 3JTSA 2O5YL 5FV1L 1U93B 1BM7A 3TO2B 3S6CA 3HG2A 5IFAL 3VXSB 1BGXH 4MCNA 5E4IA 3VGAB 3FZUD 4JRXD 1JI2A 3SKMA 4F15B 1INDL 2P7TA 3N1PC 5FHAH 2ZPKL 3DK0A 3H9SD 3JTTB 2IWKA 3T77B 3SZKC 1T6BX 1E5CA 3LXCA 1UADC 2AQ1A 5K9KB 3MHZA 2ERJC 1SFHA 1I4FA 2R2EB 1I1AD 2E86A 2DICA 3VFOB 4WY7H 1QTYT 3U79A 3BP7B 3GLZA 4IRZA 3PGCB 4TLKA 3IXAB 1BOGA 4OZGE 4UOQA 2X4QB 1G7MB 4DN4H 1AHWC 4PJ9D 3T3PE 4P3WA 4YIQB 1PIFA 3N55A 4OBSA 4DK6A 1GW6A 3L45A 3QJOA 1NC2D 1C12B 5TJWK 4HKBB 2ICWJ 3OQRA 3UC0H 1KWKA 3SDXB 3VQMA 4P4KA 1U8NB 3FUNA 2NTFA 4KVNL 5MEQA 1CYXA 4IIQB 1EQWA 4U7SA 5DD6B 3TBYA 2E59A 4L3ED 3NIFF 3WE6A 4ODVH 4Y5XA 3TIEA 3K4AA 4M6MH 5IR1B 1A3LH 4ELDA 4PJDB 4IOFC 3KLLA 1SY6H 2AJUL 5MP6H 3TL5A 1NGPL 1Q9WA 1ZHKB 3ES6A 4CU7A 1IGTB 1RK0B 2X28A 1XO8A 2VDLL 1MEXL 4N1HB 3W38A 1S7QB 1R75A 1WSST 1RZ8B 2VUKA 1Q9LA 1H6FA 1LNUA 3IAQA 1Q1PA 1LDSA 3ZYZA 1E42A 3LDBC 1IKOP 3T71A 4Z18A 2EDKA 4KO7A 4P57B 4CC4A 4X7CC 2A6DA 5ITBL 1KB5A 2B16A 4L4VA 4UAOB 5GJTH 3QQDB 1CO1A 4R8WH 3R18A 2DM7A 4RGNE 4W6YB 3L7FB 4KKBC 4H20L 5JOFB 1CGSL 4LLWA 3S34L 3OVUB 1BLNA 1M2VB 4YBHA 3IFOB 5K1NA 2O26U 3OAUH 1N5YH 3CH1B 4G71B 1ZTXL 4LOEA 3DOSA 4XMXA 1K6QL 3GB7B 3MRPA 2CJUL 4LL9A 2YD7A 4Q0XL 1RU9L 2SEBA 2EDBA 3VQLA 4LKCB 2PXYD 2VKXA 2W0LA 4LLDB 5CJXC 5E2VH 2ZUWA 1PLAA 1KDIA 4H8VA 4MB5A 1FHGA 1WBZA 4WEBL 3APMA 3D39B 4C59B 2ZNXA 2VO8A 1AYRA 1EO5A 1GZHC 2BNQA 2YMXH 2PYEB 4PGBA 3VB9A 2EH7H 3FQTB 1J0HA 4GLRH 1UZ6E 1KPVA 5HVFB 4JBSA 2R4SL 2XXFA 3NJKA 2BVQB 4PGEA 1CFSB 5KVEE 1BCIA 3IJHA 3S3PA 3O6FA 2PCPB 2ORBH 2VQUA 1FZMB 2VITA 1L5GA 3Q9PA 3KPLB 4H0IA 4EI6B 3ZW3A 1EEZA 3KJ4B 3LKSA 4L5FL 3T8VA 1THCA 4KXAA 5CGBA 5EIIG 5GRJL 4OI7A 2Y25A 3LSOB 2WBJD 2PWHA 4PJFB 1CQKA 5EO0B 4ICXA 1OP5K 3ZZ1A 4K3JH 2BSBA 5AOMA 3UYPB 3RGVB 5IB5A 5KTEH 4NRZA 4IOFD 2V3EA 4WDIB 2MTPA 3POCA 1TZHA 4MDIB 1UB5B 2CMRH 3UOAB 3RX5A 1NC4A 1OTSC 4XNMB 4KZEL 4RGOH 3ARSA 1DSYA 1CFTA 2HN7B 2WZAA 3ZE0E 4JFPB 2HYMA 1I9IH 3IS1X 4PP1D 4PVMA 5DS1A 2GFBB 2VDRB 2BK8A 1MJJB 3E9TA 4OF8A 5HI4D 5TTRA 3IMUA 3GT6A 3L48A 2WZ6A 1GL4B 5H8DA 2F5BL 1I3RA 1QHOA 4AV0A 5DMIH 2QSTA 4U1HB 5EC2B 5TF1H 5C0BD 1JPGA 2NY6C 3IGFA 3CPLA 1NIFA 1RULH 4M6AA 1UURA 1DDHA 5IW6B 1BVKB 2IALA 4HIXH 2FECL 4KKBD 4OM1H 2CJTA 2AQ3A 2IG2H 1EX0A 3E6HB 4XN8A 3EJYC 3EFDL 5KSBE 1TSRA 1MG2C 4NWTH 2JE8A 3FH8A 4Q6IB 2CCWA 2D7OA 2Z0BA 5C8JB 2XG5A 2X4SB 2VDMB 5F7EH 5I1HH 4FQLL 3FTGA 2OJEA 1B4JH 1K8IB 4HUWA 4R0LC 2YIHA 32C2A 4HLJA 2V9QA 1VKXA 1UOKA 3HS0C 3KPTA 2V7NB 1JWSB 4A2GA 3HG1D 4K3EL 4UB0H 3ZXAC 4EI5B 1RHFA 1LL1A 1KV7A 4Z5RB 4DUVA 1SF3A 2BO0A 4GB9A 2K6ZA 5SX5K 4YHKL 5CMAA 3T6ZA 2VJ0A 5CFHA 5HGDB 2QEJA 3QUMB 4R7DA 3TCLB 3GMRB 2J4WL 5F9DC 1KJ2H 3IFPA 3WIIH 5J6GA 1FNFA 2ZAHA 4P59L 3FONA 2ED8A 5DUBA 4MD5A 1QSVA 3MRQA 1NMCC 3EDJA 2APSA 2X4NA 3ZK0A 1UXLA 2V2XA 4I2XA 1NMAH 3FB6B 1BFVL 4LDCA 1MFEL 1KJVA 4NN6C 1QRKA 4BQ6A 3RU8H 3SE3C 1PG7H 4NQDD 2OA9A 1N2RB 3VFVB 3TURA 2KI6A 5I1KL 1E4WH 4GAYB 1EZSA 2XN9D 1SRDA 2FQGA 4XBGA 4GUCA 4NN5B 4PBVC 1IGMH 1M2OA 4CN6A 1XF5A 3SKNB 2IDUA 2RFXA 2WLYA 1DBMH 3WSQL 4I88A 2EYTA 2DKSA 1PG7W 3F7LA 1LMKA 1LO2H 2ARJQ 4GKSB 3HJEA 3WS6C 4F7PB 4TV3A 1U8PB 5CCKH 1XBDA 1W0WB 5MI0B 1SHXA 4OZ4B 5ICZA 4PRDA 5D1ZA 5JO5B 4PRNB 1MH5B 3QEHA 2A4EA 5IROA 5TPWL 3ASOB 3ZDYE 3M7FB 3D0AA 5E6ZA 3HNVL 3ZTDC 5AAPA 3BQUD 4Z7NF 1MLBA 1LO3L 5M94B 3BQVA 4KQ3L 4WI7A 2BY1A 2OJZL 2X9ZA 3EJYD 3L95A 1FIEA 2O93L 5EZLA 3LNGA 3S35X 5CEXB 3ARQA 3ABLB 2UVEA 3MRNA 4GSDL 4XBMA 1FNEA 3MV9B 4BQCA 4Y4HC 2UZYB 1XGUA 2YN5A 4E5XG 1KSRA 1E4KA 3FYEB 4FFYA 3F12B 3MRHB 2M2DA 4HEPA 1UACL 5FYJL 2F6AA 4GT7A 4YSCA 3QGVA 4JPKH 4PJEE 5E9DB 3WO4C 3P54A 1WLHA 4JMXA 1EDYA 4LHUG 4NCC1 1T0MB 2MEJB 3SPVB 4MSWA 4NQXA 5I19L 1EVTC 5KBKA 1GHFL 1YCSA 4HQQH 4ZTPL 2UYLA 4JQIL 1CR9L 1IGCL 4DGVH 4ESKA 2KLTA 4F7TB 1M71B 1TG8A 3N1GC 4N9OB 2DWEA 2IO5A 3F7VB 4Q14A 2BLFA 1IAOB 1LGVA 3JSSA 3NQKA 4JPWH 4S0SD 4HUUA 1OP3K 1ZE3H 3QFJE 1N3NA 4P2OD 5HHXH 2XXMB 4M4RA 1Q9OB 4YPGB 2BDNL 4IDJH 5CLTA 3G5ZB 1DEEB 2GIXA 2AJZB 4KVPA 4J1UB 4H26A 4OI9A 5DJ0A 2NNFA 5D4JA 1U8QA 5KOVC 2J56A 1PX4A 4N5ED 4QRPD 1G7LB 4HWZA 5T1KB 2W81C 1QUNB 1XAUA 2BSSB 1R9FA 3L3OC 4M6NL 1FFOB 2R69L 4NXKA 1B0GB 3PJSB 1I1YB 1MVUB 1DCLA 2E9BA 1AXTL 4ONGL 4JFDE 2HZHA 3W56A 3OKOA 3JWNE 4XNQA 3O9WB 4HOWA 3S7GA 2JJUA 1NCWL 2VXUH 3OG6B 2M83A 4MX7A 4HD5A 2PO6B 3RAJL 1KCKA 1J8HB 4LEEA 2F8VA 2PW2A 2XKUA 4FLRA 3KXFD 3US1A 2AFNA 5D7IA 4TQPA 3QUYA 1JYWA 1FVEB 3P4MB 3MJ9L 3PS6A 2IANA 2VGLM 2JKJA 1A9BB 1KTDB 2QMJA 2D31B 2K1MA 3WKYA 2X1PA 2NXZD 2ZF9A 4HHAB 1JHTB 1E27B 2F61A 5KJ4A 3F7QA 4OGXL 5E6IA 2AI0H 2D7TL 2H1LM 4MCMA 4Y4HD 4NT6B 1NKRA 1OAYL 2B0SL 4CC0A 1OCCB 4YSEA 4E0RB 1CTMA 1FZJB 4P5TD 1JGEB 1VGKB 1WZKA 4K94L 1UWFA 1E9QB 3FPYA 5ESVB 4TQHA 1V5JA 3VXMD 4ATTA 2V3FA 4ZFOL 1JPTH 1MCPH 5JOPD 5IEHB 1J5CA 2IAMB 5E2JA 1TJHH 4MA7L 2W0FA 5IHLB 4OLZH 2C3WA 2QVMA 2DV6A 2ZWZA 4N2OA 3WV0A 3QDGA 2FL5B 3PIQA 2WUBL 1ZVSA 4GI9A 5K9OA 1BYOA 5DJ2B 2MCMA 1J05B 1E4XL 1RK1A 2G60H 1QFWM 2PWEA 4H44C 1N0LA 2CSPA 4ZPTB 5HHQB 1OAKH 2GBUA 4ZO9A 4DN3L 4MRBA 3NRPA 4F58L 1FFNA 2G30A 3PGDB 4JFYB 1TU2A 3N43F 1QLFB 5KVDL 1RV6X 1K5WA 3GLEA 1RZIA 3OLEA 2CHNA 3NA9H 4GRWF 4UF7C 3UIZA 5B38A 1Z7JA 4XMZA 1HAUA 3FCTB 1FRGL 3ML9A 5FGSA 5ETUA 1W80A 2QPDB 1NCUA 2NXYC 3QR1A 4PRIA 3VXPB 1DQMH 1MIMH 4HETA 4P5KA 4NZFA 3RKDC 2A74C 4MA1C 2W07A 4IKLA 2R2CA 1W15A 3D4GA 5IG7B 4NKMA 43CAA 3EGXB 3DMMA 3KPRA 1XF1A 5EOQH 4DQOL 2IOOA 5LWYH 4N3UA 3UZEA 4OCSH 1KLGB 3UYRH 1IAIM 5EO9A 3EYVB 2HG5A 4AL8H 3LEYL 5GS1B 5LGJA 4P05A 2X4PB 2ZKWA 1EJ8A 1X5HA 5IQ7H 5HYJA 1QBLL 2NYYC 2VDRL 1Z5HA 3VFPA 3NJNA 4XPAL 1QSFD 3RP1A 4QO1B 1IX2A 3SE9L 3QDJE 2EYRA 1VHPA 1L9NA 3OR7B 1JUFA 1P84K 4PJHE 4PRPE 4S1QL 2OMWB 5DQ9A 2P4AB 5DR5H 1NZRA 1YMMA 1DVFB 5E2WH 1LE5A 4ZW6A 4CSZA 4XO3A 4QKXB 2BNRE 4MTMA 2XV3A 3JV6B 4TYUA 5D5ME 1UXWA 2F8XC 2VLKB 4NQED 4U0RB 1FSKC 1JZ7A 3LXAA 2XTSA 4X9GA 5ESAB 4OCRH 5JA9A 4M4PA 4JM4H 4TNWK 1KOAA 4GQZA 1HSAA 4JPSA 2VDML 4OIAA 4MWFB 3QUXB 5IZ7A 4ANWA 2QGDA 2X40A 5B1KA 2R0KH 3FPXA 1E2ZA 1T21B 2Z31A 4CGUB 3NJVA 1OD9A 3CXHJ 1TZIB 3RIKA 3C60B 2DS4A 3CNKA 4N5UA 3T09A 1LXMA 3QUML 2QSCL 4GSRA 5KBMA 3IMSA 5AYTA 2VZUA 4MB4A 1G5AA 3F6JA 3TCTA 1A1NA 5FYLD 4DGYL 3U1QA 3BW9B 2I24N 3D3VA 1IC5L 4JFUA 2BC4A 2WLKA 4HWBH 3ARFA 3FSWA 1EAJA 2CGZA 5T5NG 2Z8VC 3TM6A 4MVBC 2NXYD 3NTCH 1WBXA 3CUPB 3QHZH 4Y2LA 4R7VA 1H5BA 3VXNB 3RKDD 3KYNB 1UA6L 1I7ZB 2NNCA 5K9QI 1P7HL 3BSZH 1YQVH 4MGXA 4K2UL 5DRNA 5IF0A 1ES0A 4I1NB 4RDQG 2VDNB 4UMGA 4I4WA 1Q94A 1T4WA 1HZKA 5B7MA 4CMHB 1KTLB 5I1CL 3RVWD 3K71B 4JZNA 2FSEA 5KSAA 2A83A 4OLEA 3UTQB 1U8LB 2WLMA 3U36B 3WJMA 4JDTH 2E27L 4KZCA 2NYYD 5GIRB 4AMKH 4AWJC 1AGDA 2PWDA 1PZ3A 2JJWA 2WY3B 4G1EB 4M7ZC 1L7IL 1XAKA 2ARWA 1AQMA 3SDAC 1UJTA 4M93C 5E2UH 3SGKC 3N1FC 4LCVA 5J57B 1JPFB 1EJFA 4O2EA 3WNIA 4K7PH 3DNKA 3T6XA 2PTUA 3AAZA 2NY7L 3D69A 4GAJL 3QYNA 2P24B 1WTLA 3MUZ1 3ZE0F 3EG9B 1C08B 1MZYA 1QZ1A 3QEGH 4NAMA 5GGQL 3QDMD 3FN0L 2R1YB 4FJYA 3W9DA 3TBSB 4Z7OB 2YKKA 4QPEA 4ZX4A 1MQ8A 3KPQB 5D7KE 4JY5H 3BJLA 4ZK8A 1H6TA 3RL1B 4JHAL 2OMXB 1CGWA 1XGTA 5D7LE 3SGJC 3K72B 4N0FB 4OAWB 3V5HB 5T1JA 1CE6A 5CKGA 4M29A 2P8PB 1E4XI 4LGRB 4S1RL 2JI2A 4JFFD 4OT1H 3FQWA 4JM0A 5AW3B 3GO1L 2XVLA 4BDVA 4PYHA 1A6VH 1XSKA 5I8KL 5IY5B 1OB1A 4R97B 3RBSA 2EABA 5C0IA 1PFCA 3BI9X 1IE4A 2KL6A 3V4VH 1OTUD 4Y1AE 5H35B 3KEHA 4JCWA 2R2BB 2AEIT 1NPUA 3WY2A 4NPYB 2BMKA 3PLYA 1Q9KB 4H8WH 4L4TA 5DRZB 1PZ5B 3QJXA 4F8TA 1W6LA 3VXRE 1BIHA 1CZ8L 4RAUB 4UIMB 4TVPL 4CJ0A 4F3FB 3QZNA 1NAKH 3NT0A 3DDFA 4RWYL 4LSPL 5AB2A 4PUBH 1RZJH 4APQB 2PWFA 2HSIA 5FDWA 2XZAL 2IOIA 4EDXA 1UT9A 3C2AL 1R17A 4OJYA 4K23H 3FO1B 3TA4D 3L3KB 3D1MC 4B5EA 1S5IL 2R7EB 4K5MA 1D2PA 4XMVA 1ADWA 5F7FA 2V6HA 4MLIA 3A6BH 4GSQA 2ZIDA 2BOBA 1V54B 3NDYE 5DJXA 1JFQH 1F4WH 2LV4A 1V3JA 3WFHA 1XIWC 3P0YL 1K72A 2VR4A 5C9JB 3SDAD 1F0LA 4G8GA 5INCB 5A2JH 4G82A 2ESVD 2MPAH 3OB8A 3B2VL 2QHRL 1AVAA 2EZ0C 2IXQA 4K9JA 5DD5H 4XAWL 4HAKA 2VDOL 5DSCA 5GS2H 3WY1A 3B2PA 3UTTE 3QEQA 2GSIB 3FB7A 3GXFA 3WN5C 2Q6WB 1MWAL 2ADGB 3P4OB 4OFQA 4I3RL 3SGDI 4L3AA 1KGWA 4G70B 5AZEH 2DTML 3R1GH 3WNPA 2YR3A 3KE0A 4HUXA 5DHVB 4YDIH 3X3GL 4KI1A 3ZDYF 4ILDA 4KVCL 3FFCE 5IQLA 3G5XB 2H4EA 5GRXG 4ZFFB 1B2YA 4U1GB 3QRFM 1CXEA 1HAWA 3MGOA 2K4WA 4Z8FL 1HIMH 4L8SC 2H2SD 4FMVA 4XWGL 3EO1A 3V52L 5JPNB 2YD3A 3O45B 3EO9H 1B0RB 3FU5A 3LQZA 3Q7JA 3RZWA 1G4RA 5HHOE 2A73A 5EULV 3TV8A 3VVVA 1RURH 2JF1A 3G04B 3MMEB 4J3OD 1IM9A 4G6KL 2JQAA 1MFBH 3QE5A 4FYSA 4AL8C 4G43B 1NAML 1MJUL 4FKEA 3QIUB 2D03H 1DQQA 3WXWL 4DEPB 1QOKA 5EEZA 3B9DA 3GTNA 3QQ4A 1T1WB 5LCVA 2ZUVA 5BRZD 3ZIYA 4NKDB 4ZFZA 4C56A 1AGEB 2P5WA 1X5ZA 5T5FH 4HUVB 1V3MA 3EJZC 5KVGL 2OCJA 1WK0A 1RL1A 3IKCA 3UCQA 4A6YA 2CO4A 1R5VB 4QY8B 4OKVA 3SBRA 3FO2A 3KM1A 4XOCA 5I18H 1AC0A 2FH6A 3ABZA 5TH2B 5IBUG 3UDWA 2I69A 4HFWA 2LTQC 3B7RL 5HDRA 3LMJH 2BP8B 2VN7A 4QHLB 1K9TA 3QC6X 1U21A 3EYFB 1XB6A 4H8HA 3NFPB 3FXIC 3UERA 4NO3B 3KWWB 4X0KA 3ZO9A 3K5SA 1GGCH 5IFHL 1HILA 2XY2A 1H8OA 3CG8A 4UZSA 2WWKO 1I8AA 4U4BA 5EU3A 1JZ5A 1BZ7A 4JPVL 4QRSB 4A2DA 3CN0A 1DQDH 4I13B 4WWKC 2EZ0D 2Q3ZA 4WUKH 3EUUA 5H37H 3VFTA 4MAYB 1W72L 1I3UA 1CT8A 4OZFB 5CJ8A 5C09B 5GZOC 2KZKA 1KNOB 4FFTA 1D2OA 4Z7UB 5T1MB 1HTYA 4UCFA 2WVVB 4PLKC 3S88H 3VW3L 4HGWA 4FABH 2XCMC 3QNXA 2IPTL 2N3JA 3KG5A 4KY2A 3DXAB 2WSPA 1DHKA 1G4MA 2V4LA 4OCNC 4RVBA 2EILB 4NZ8A 4ZXBC 3K46A 4QOKA 2R2HB 3SPHA 2Z8RA 3ZTCC 2XT1B 1MRCH 4XODA 5C97A 1E8XA 4G9FE 3F7YB 3ZR6A 4EKJA 1E5UI 7PAZA 1HT6A 2DIEA 1IVLA 4H8UA 4XNBA 3PV7A 4NKOA 1UZGA 1BZ9B 1PDKB 2YD9A 3VG0L 3NCXA 5ILTH 4GPVA 5AVRB 1QFWI 4B7IA 1GC1L 5K5YA 5DC4B 2XQYA 2DEXX 5MEPA 2BOCB 2DQUL 4YZFE 4N87A 1Y6KR 4W9EC 3QVAA 5FK9A 2R1XA 1UVQA 2AK4B 5BZDA 2H45A 1TTGA 3Q13A 4HA1A 3EJZD 1U8OB 3I50H 4X4ZA 5CZVH 4IJ3C 4MAZA 4J6IA 4YUEH 5D72H 5E1AA 1JYXA 1HXKA 1A4JB 4CC4C 4IGBC 3HPJB 2EE6A 1BLIA 2XWZA 1UKTA 4HALA 5HHPB 3QCVH 3AUWB 5L2JB 4Q9QL 1OOWA 2DQMA 2UZIL 2BVEA 5EV7A 3B9AA 3FRUA 2K4AA 4ZYKA 3V79C 3E2HB 3GBML 4WFHE 2F58H 2AXFB 4FG6C 4P2YA 4IBUA 3D25A 5I1IH 1U8IB 1PKQE 3O6LH 5HGHB 4FAAB 1XGYH 5E51A 5HVGB 3H6AA 1BFSA 1IAII 3OX8A 2P5EE 3FMGH 3MYJA 4UNTA 4UTBL 5L8LB 4DP2X 4XNYH 1WCQA 1KFGA 2XBDA 1FNGB 2HX9A 4H8QA 3BKJL 2X38A 3RVVC 3VXTB 5FYKL 3R4RA 1E2VA 2HRLA 3PFUA 3QCUH 4F9PA 3QORA 4X4MA 2ICEA 1RZFH 1BZEA 1YY8A 2XVKA 4Y4KB 4AENA 1JZDC 1W0YT 2B9AA 2QELA 1TF4A 5GGVL 4LB8A 4GJTB 4XC1H 2O61A 4PLKD 3NSCA 1G1CA 4ZD3H 4WUUB 3VM5A 3MRMA 4H8WC 2V17L 4N8PA 3RURA 4RMBA 3QYCA 3U2SB 2FO1A 3H0TA 1UM4H 2IGFH 4P4KD 4ADGA 4BA8A 3L9RB 2B8OT 4JANA 1LM8V 3SQOH 1T1YB 1CFVL 2I5YH 4PJHF 5A40E 1PZAA 1WPCA 3UBGA 3W57A 4GO8A 5H37G 3HRZB 2EDQA 5L2KB 1CLVA 5C0CE 4PJ5A 5I76A 4YBQD 5D5MF 4LSTL 4TNEA 1EIBA 4ZTEA 4J8QA 5E5RB 4JG0H 4DP7X 3BFWA 1Q0XH 1OQOA 2VXTL 3N2JA 5KVEH 1ZTMA 4FHJA 4X8CA 2V9RA 5G4MA 2NX5E 5J3HC 4FN0A 4Z0BL 2RALA 4GG6E 3IJYA 7CGTA 4HKJA 3QHFH 2AVGA 3JYCA 2Z35A 1K5NA 4I48A 3QEUB 3OC5A 1KWGA 1RJCA 4G11A 4KITB 4OI8A 2WB1A 3L08A 4B5ZA 1W6WA 1LK3H 3MREA 2PP9A 4Z23A 4ISVB 3WLWD 2QZQA 4UILH 1HHJB 3O6MH 2R1WB 1O9WA 3NCMA 4DTGL 1G94A 2X44D 3D9AH 1QI5A 1Y6MR 1ONQB 2DI8A 2HTLD 1MW0A 3ATFA 3OV6A 3Q5OA 4JCLA 4Y5VB 5ERWB 3HBZA 3I9GH 3PU7A 3SGEH 3WHXB 1ZGLP 3IJSA 4HV8B 2WYTA 4LRIA 2YAPA 3LHAA 5I1EL 5C08E 5AB1A 4K9EL 5BUGA 4LLQB 3VJ6B 3CFJA 4LPWA 3N1QC 1RQ5A 3RVVD 2QGBA 1NANI 4ZOBA 4F1ZA 1FG9C 3NIDE 1YDPB 2A6I