2YRDA

Solution structure of the zf-sec23_sec24 from human sec23a mutant v69a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
b'GSSGSSGEPVLCSRTTCRAALNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title Solution structure of the zf-Sec23_Sec24 from human Sec23A mutant V69A
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.380 Mainly Beta Roll SH3 type barrels. Zn-finger domain of Sec23/24 2yrdA00
3EGDA 5KYWB 3EH1A 5KYYB 2YRCA 5KYUB 3EFOA 2QTVA 3EG9B 1M2VB 5KYWA 5KYYA 2YRDA 5KYNA 1PCXA 5KYUA 1M2VA 3EG9A 3EGXB 2NUTB 5KYXB 2NUPB 5KYXA 3EGDB 3EH2A 1PD1A 1PD0A 3EGXA 2NUTA 2NUPA 1M2OA 3EFOB
chains in the Genus database with same CATH superfamily
3HTRA 4II1A 5GANd 1N5ZA 4OMOA 5L8RE 5IT9E 2EGAA 1WXTA 2QDLA 1QKWA 1XJWB 5CAIA 2GBQA 5I21A 2RB6A 2DF6A 3MP1A 3OYAA 1B3QA 3CCVQ 1TSFA 5GMKh 1WX6A 4DA4A 2E10A 1M1FA 1XOVA 3E19A 2JNGA 1LOJA 3CCVA 3VUZA 1NM7A 1V29B 3MEWA 4LNPA 4JJDA 2JM8A 1NLPC 1UDLA 2EKOA 4D8DA 3RKWA 1JRIA 4IUVA 3QDFA 3CC4A 4A4GA 4JS4A 3RKXA 2OAWA 3OSSC 2BZXA 1UJYA 4OMFB 2ZPHB 4N4GA 1QP2A 1W70A 2FB7A 2K3XA 2EQUA 5J3BA 3M0TA 3NTHA 2FG0A 1G3YA 2ZPFB 2EAYA 2LC4A 4M7AB 1KSWA 2EQJA 2XD0A 3ZEHA 3V7RA 1MMNA 1PG5B 1AEYA 2ESWA 5DLOA 2EW3A 4AFUC 3PIOA 2V26A 4M77F 2GNCA 2PQWA 1OZ3A 3OBWA 2OJ2A 3E9GA 3TU4K 1MGQA 2LX9A 1VQPT 2KVQG 4X1VA 4E7SA 4F16A 4XTXA 4LDYA 4EMHA 5KCOA 2GCXA 1MV3A 2VGNA 2EGEA 2SRCA 1VQ8T 1VIFA 4BE0A 4UC4A 1VQ6T 5GAN2 3EGDA 2DTOA 1H3ZA 2EFIA 3RDVA 3JCMh 2FO0A 2KQWA 2B86A 4C8QE 3PVLA 2DEUA 1Y96A 4BD3A 5CKHA 4M7DA 2LQNA 1RL2A 1WJQA 4RTZA 3T9NA 4F7UA 5GANj 2DAQA 1M3BA 2EYYA 1M4ZA 3A8MB 3MJXA 2FEIA 2JTEA 4JRQA 4QQDA 3CCJQ 1K8AU 1RACB 4HA8A 2JN0A 1JO8A 3CCJA 5A0DA 2RQUA 5IHNA 3BE3A 3PVQA 2CYZB 1Q82C 3OYCA 2IVWA 2CH4A 4PK4A 4JDSA 4C8QA 1AHJB 4MDXA 4O6JA 1GBQA 4JUVA 5GAN3 2E41A 4C5GA 3HRSA 2DFUA 4FYXB 2D1XA 4FU6A 4RG2A 4ZN1A 2HQHA 1VQLQ 1NYGA 2ED1A 1TWBA 3UA6A 2COZA 2K6DA 1X75C 1KQSS 2P4RA 4BY6C 1W2BS 1VQLA 2JS2A 2PTKA 2R58A 5AT1B 1BCMA 5FRNA 2XDPA 5KYWA 4E7KA 3A8OB 4QVCA 3INZA 2LMJA 3SFMA 2HSEB 1Q86C 3M0QA 2J6OA 2KRNA 2L8DA 5J26A 3SWNB 3GNGA 4HCZA 2ZCFB 1KD1U 3CCLQ 4C0ZA 5LL6S 3FEOA 3OS1A 2BE7D 1ZUKA 5I2SA 2QASA 5FU7B 3CCLA 3S6WA 2LCSA 4C92C 2KR3A 4XU1A 2HDAA 1UHCA 3L2WA 4KGXB 5GJWB 1K8AR 4FT2A 2NUPA 2YSQA 4PLIA 2E3HA 2K5FA 3I56Q 2GTOA 1EIFA 1PSFA 3CMET 2E64A 3JB9I 3I56A 3VS2A 1IGUA 1NPRA 4XTWA 2LJ1A 1NPPA 2HL5C 1Q7YU 3EH2A 4DBRA 1KG1A 3SB2A 4R55A 2HL3A 1KJWA 3EGXA 4IIOA 5IN1A 3C94A 2VC8A 4M7AE 2RH2A 3LWHA 2CUDA 2ZPGB 2QTVA 3CC7T 2ZGWA 2CS7A 4LE9A 3GBQA 1VQNQ 2XI9A 2R5MA 5D6YA 1UGPB 4OMPA 2E4HA 2FRWA 4DOWA 2BTTA 1VQNA 3M56A 1FXXA 1X6GA 4LDUA 2FPDA 2BIVA 2FZKB 4KULA 1WZOA 1JJ2S 1ZSGA 5GAMf 3OYEA 2OX7A 2DEQA 2L2PA 2RQWA 4ZN3A 5A2QE 2RF0A 3RMQA 4M7DD 2OTJQ 4M77A 2ED0A 3QBYA 4BI4A 2EBPA 1KD1R 1MMAA 3X26B 4N0AA 3RKYA 5HKCA 2X35A 2OTJA 4KBMB 1EFNA 2V8JA 1KQSP 4OB0B 1W2BP 1D3BB 1UUEA 2FZGB 2RN8A 2RHIA 3QDRB 4M7AA 1UGSB 1IHWA 4PJOC 1W6XA 3G6ET 1UJ0A 2QXFA 4LDXA 4RCBA 1BI0A 1SHGA 2DD5A 3OY9A 3CCUT 5HY6A 3BFMA 1HSQA 3X24B 4HCCA 1BB9A 1FX7A 4J83A 2PU9B 2RPNA 1YHQA 1YWPA 4C8QD 2BUDA 5HK0A 3RESA 3HFOA 3PTAA 2G3RA 3ULRB 1Q7YR 4D8KA 3CC2T 3FJ5A 2ZPEB 1JJ2A 2PZ1A 4M7DG 3N5BB 4QQ6A 2EQMA 1OX9A 3CD6T 1Y0MA 1UGVA 1Y07A 5GAMg 1MHNA 1WI7A 1YITT 4RUGA 1U3OA 1HYOA 2B8AA 2FHDA 2CP0A 4KGVB 2LQKA 1TOVA 4TVRA 1RADB 5EC7A 1XNIA 3J80E 4E47A 2JTMA 4B6MA 3JCMV 1TUDA 4ANJA 4QKUA 2ZPBB 1Q81U 3MHXA 2A37A 2DTHA 2BKDN 1VQ5Q 4FT4A 2WACA 1SRMA 5GAOr 3BDUA 4MDWA 4C8QG 4Y91A 3CCRQ 2LZ6B 3QKJA 3KXTA 1D1BA 1VQ5A 2LX7A 4EMGA 3CCRA 1QVFP 1S1NA 2L3RA 3HRUA 2IG0A 3C0CA 1NJIU 3KFVA 1NLOC 1Y57A 2WSEE 3M59A 2CGHA 1LCKA 3QJYA 3FDRA 4BB7A 1VQMQ 4VUBA 2K2MA 3E9FA 2YUQA 5GJVB 4JLGA 2JT4A 1VQMA 3S3NA 3FB9A 1U06A 4KH1B 1X2KA 3VU3C 1JXMA 1DJ7B 3MP6A 2PNIA 2YRVA 2CP6A 2V8IA 2KROA 4QVDA 1ARKA 2RO0A 1WQWA 4OVAA 2DPPB 3REBB 2L3SA 1M90C 2FRYA 3SWNA 4A4KA 2BZYA 1YNZA 3OSVA 2PUKB 5FW9A 4M7DF 4JJBA 4JZ3A 1O9SA 1MNEA 2GF7A 2X51A 3HL8A 2DETA 3JB9D 4EMKC 2DM1A 4F7UF 5CKDA 4HKEA 4A63B 2QTXA 4X34A 2HNIA 3EFOB 4LN2A 1D09B 5GAMe 1UGQB 2HKQB 2DYIA 1K4US 4DBFA 3C4SA 2CT3A 1OU9A 2M16A 4XK8E 1YJ9T 3OS0A 2RM4A 4PKCC 1M3AA 2BE9B 3GOXA 4M7AD 4ME7A 3OYMA 4PLLA 4QVZA 5LJ3h 5A0GA 2DXBA 3MP8A 2AIRB 2HD0A 5IH2A 3UATA 1Q95G 4Y92A 4C8QF 2M0YA 2YDLA 5CK9A 1VIEA 1VQ9T 3VS6A 1NJIR 4OB1B 2L5QA 1Z9ZA 4OGCA 1AOJA 1S72T 1OU8A 3A98A 3L1AA 3THKA 5GAN6 2RK1A 4J8OA 3JB9G 4OB2B 1KQ2A 4PFZA 3U23A 3FIFA 2DBKA 2XHCA 1YWOA 2X4JA 2VYTA 3CCST 4XTVA 1YI2T 4OMNA 4B9WA 2M51A 3GP8A 1PHTA 1X01A 2O31A 4IUUA 1RUWA 2J6FA 4PJLA 3RNJA 2YUOA 2I0NA 3J7AF 3AT1B 2EWNA 5CVIA 4ELYC 3RBBB 1BI1A 1YIJA 4AT1B 4PJNA 2DNUA 1NBEB 4M7AG 3MPUB 4JRKA 5FU6C 4AG1C 1D3BA 1M2OA 3HSBA 4WTOB 3LWIA 2K4YA 3CBOA 1X43A 5KYYB 2M02A 2JMCA 3MEAA 4J9CA 4FCYA 2MIOA 3I5RA 5GAMd 3JCMc 4LDWA 1RI9A 1P92A 2LRQA 3G4SQ 3CXCS 2CZ7B 3CCMT 4K11A 4NL2A 2DL3A 1WNLA 3G4SA 2VXEA 1UEBA 3EG1A 4FW2A 4C92B 2DBMA 2XG8D 3G71T 1MUZA 3CCQT 1ZLMA 3OQ5A 3JCMX 2XICA 2LNVA 1K73C 1UTIA 4M75C 2CP3A 2CH4W 2EYWA 1R77A 4HXJA 2A08A 1TU0B 1B34A 2KYMA 4OMQA 2LVMA 5KH6A 3LLRA 3JB9H 1TUGB 2QA4Q 1ZUYA 2DL4A 1WHMA 3NGPA 2QG9B 2QA4A 2CT4A 2D8HA 3R6NA 1QCNA 1FMWA 5GAN4 2ROTA 1HXDA 1RLQC 2JMAA 1RAIB 3ZBDA 3VUBA 1I5OB 2KE9A 5D7UA 3V8JA 3EG3A 1A0NB 1Q86R 3O5ZA 3DLMA 2E12A 1WPYA 5I2MA 1H8KA 2RK2A 2LT1A 9ATCB 1PC0A 3BDLA 4M7AF 1D0YA 3JAME 2DZ9A 3JCMf 2VB6A 1KK7A 3RR6A 4WCIA 1AZGB 3CPFA 2LCLA 4Y28E 4M78C 2RI2A 2KBTA 5KYUB 2E5QA 3M9QA 1IHVA 3VV0A 2XDBA 2PVGB 3URGA 3MCAB 4PJOB 2EGCA 2FPFA 1N8RC 1C6VX 1GL5A 3OYLA 1AVZC 2RHUA 4FYYB 3EGUA 5CCAA 2DXUA 3F70A 5GAMj 4F17A 5C0MA 4C0GA 3CXCP 4N4IA 3OYBA 2DE0X 1AWOA 1K9MU 1R0BG 2HAXA 2P4TA 5LJ5f 2QGGA 2GQIA 2RQVA 3L2UA 1M27C 1YJNT 5LJ5h 3EFSA 4XQ3A 4XTUA 1G3TA 1EZZB 5A0LA 1TUCA 3EFOA 3L2RA 4GBQA 1MMDA 1TS9A 3RMSA 2ZPIB 1AT1B 2A3LA 4KH0B 3OYJA 1M8VA 5GAOn 3JCMg 3CCVT 2X9HA 3H0HA 4FYWB 4CI0C 4NL3A 2E3IA 4HT8A 2HBPA 3PMTA 4E7JA 5IHIA 2EYQA 2JZ2A 2COWA 2DRKA 3KBGA 1UHFA 1WFWA 2E6ZA 1U8RA 1CKAA 1FWZA 3ER0A 3M0PA 3QPHA 1GFCA 4PJJA 3CC4T 2G6FX 1KQ1A 2DL8A 3I55Q 3TSWA 3CCUQ 3M0RA 3MEUA 2QEXQ 5GMKe 4JLIA 3I55A 4ORZA 3JCMQ 3JSCA 2J05A 4CC3A 1UECA 2NLUA 3META 2QEXA 4MMKA 3A1PA 3CCEQ 1YCSB 1H92A 1PM3A 1D1CA 2AKLA 4RTYA 4RTXA 5LJ5g 1VQ4Q 3OYFA 2KGTA 2HBWA 1U5SA 3CCEA 2IPOB 1KC8U 4HCBA 4C92E 5KE2A 3CC2Q 1U1SA 1LVKA 3M58A 3TREA 1VQ4A 5GAOm 3UPUA 3H41A 4PFPA 2EIFA 3JCMb 3RERA 2KXCA 3H6ZA 2YUNA 1X6OA 1YCYA 3DB4A 3EAEA 1K9MR 2OTLT 4FIBA 2OI3A 1QVGP 4C5IA 4R0KA 5CQXA 4M4ZA 4DEXA 1VQ7T 3A8LB 4Q5WA 5KYYA 1IGQA 4DOVA 6AT1B 1KQSA 1W2BA 4HT9A 2RQRA 2RJFA 4B9XA 1G3WA 2DIQA 5GAN5 3E2UA 4IKFA 1VQOQ 1NYFA 1TTHB 4EMKB 2YWWA 2YLCA 1T0JA 3OS5A 1WHHA 1Y7XA 3QUIA 4RTVA 5CKEA 1VQOA 2K5LA 2JS0A 2DL5A 4M77C 2X3XD 3JCMP 3QJ6A 3EG2A 3LX7A 2NUTB 2PVOB 4A4HA 5KYXB 4X9CA 1QVFS 3OYHA 2FZCB 3M55A 3REAB 1NZ9A 3CMAQ 3GPLA 4XAXB 3JCMe 2O9VA 1ZQ1A 3CMAA 3J81E 3SHWA 3HFNA 4QW2A 2DJZA 2EJGA 4KGZB 2CSQA 2X3WD 1BCOA 4EPCA 1E7OA 2DERA 1K9AA 3I9QA 1X6BA 2A0FB 5GMKl 1XTDA 4OMLA 4DEYA 1KC8R 5GANh 1M8MA 1D0ZA 2D0NA 4PJOE 1SRLA 2CZ6B 2KT8A 1HD3A 3OYGA 1IXDA 2JTFA 3QWXX 3JV3A 1VOMA 4EIKA 1M90R 1QVPA 1VQLT 3I5SA 5LJ5e 3LH0A 1YJWQ 1ZSZB 3M5AA 1B07A 3BW1A 3OMGA 4JPBW 2WSCE 4FSSA 1VYVA 1YJWA 1TH7A 5FLXE 1QVFA 2RHZA 5ECAA 2EJ9A 2K79A 2RI5A 4AFSC 4ESRA 2VGMA 1VQKQ 4J9IA 3VYHB 4NOYA 5KYUA 2F69A 5FU6B 3D7SB 2E70A 3V8LA 3ZFJA 1YJ9Q 2VUBA 1VQKA 4LD6A 2HKNA 1WXBA 3CCLT 3SDZA 3LGFA 4PJOA 1OULA 3NTKA 1QCFA 1G8XA 3PMIA 2FL7A 3DLLA 2M1HA 5FWCA 1BYMA 3L2ZA 3JCMd 4AG2C 2RJEA 5AYFA 2R5AA 1J3TA 1V76A 5C6SA 2DTIA 1RAEB 2EQKA 2GFUA 4A4EA 1WLPB 3H9NA 2JVVA 2HMAA 2I2LA 2C06A 3VS1A 5IXFA 1RI0A 2QQ9A 4JJNK 1V1CA 4PJMA 4M75B 3CCSQ 1YI2Q 3O8VA 2AZVA 2GTJA 5L23A 1OYXA 1OPKA 1AZEA 4J9EA 2XIDA 1PSEA 3EFRA 2YT6A 5GMKj 4JS5A 2E65A 2QQRA 3DKMA 3SD4A 3HKSA 2Z0WA 2SEMA 4JRIA 4XU2A 2ROLA 2LDMA 2LQ8A 1BI2A 1YBYA 3M0UA 1VQNT 2QGFB 1KFZA 2QQBA 2M9UA 1HJDA 2DRMA 4Z8AA 3EGDB 1PKSA 1HK9A 1FYNA 3CCMQ 2JOYA 4C92D 1E6HA 1RAAB 1R8OB 2X4YA 4HCKA 1WHGA 2OTJT 2L89A 1Y96B 1TG0A 1ZA2B 4BUGA 2QYZA 1QWEA 4M7DB 4J5YA 4J6YA 3G71Q 1OEBA 2KNBB 4ZGDB 2JUFA 2DJQA 3Q1JA 3A8GB 3UDCA 2YUPA 4GY5A 1JXOA 4F7UB 2QK0A 2CZ1B 1H3HA 4M78B 3X20B 2RQTA 2F5KA 1I07A 1GFDA 1OZ2A 2EPDA 1N8RU 1RAGB 4GLKA 2X4WA 4O5VA 2DLPA 2NUZA 1PRLC 2FYKA 2KXDA 1M2VB 2L3QA 3L2VA 1YHQT 2K57A 3CQTA 5LJ3f 1OV3A 3FJPA 1Q7YC 1G5VA 1ACMB 4KUIA 4CC2A 4ZGJB 1UG1A 2MWPA 1LPLA 3PFSA 1KHIA 2H8HA 2MWOA 3VS7A 1C0MA 3QWYA 4C92G 1Q82U 1ZUUA 3TEEA 5J39A 4EMKA 4J7IA 4J6XA 3QSUA 1VQPQ 5CO7A 1U1TA 5GMKm 3GIBA 3UWNA 2RMOA 1ZX6A 1UE9A 1VQPA 1BKBA 1M3CA 4CRIA 2MOXA 1VQ8Q 2LP5A 3EH1A 3G1JA 1SKUB 1WJRA 3LH5A 1GRIA 1VQ6Q 1BU1A 2D0QB 2YRCA 2O4XB 1N9RA 1ZSZC 2X4XA 1VQ8A 2AK5A 2WSFE 3G7ZA 5GAN8 4ATOA 1NEGA 1VQ6A 3FLGA 3PT9A 1IO6A 1KHCA 2CDTA 4PJOD 1ZHIA 3WXMB 3S3OA 1OOTA 1GCQA 1UFFA 5GAOq 1Q86U 5LJ5j 2DYBA 4F14A 3CCRT 2VKNA 3SEMA 1WDXA 4CC7A 1VUBA 3QHSA 4E7LA 2EYZA 5LJ3g 1I0CA 2QI2A 3GLXA 2MMPA 1YP5A 3VS4A 2E6NA 5CIUA 2KK4A 1N8RR 2O88A 3OBYA 2EYXA 4E2FB 2Y90A 1VQMT 4L5GA 1VA7A 2RD1A 2RHYA 1YJNQ 2Y4XA 1M1KC 5GAOl 2JM9A 5FRMA 3TQ7P 1MV0B 2GGRA 4XU0A 5HCKA 3VS5A 3LW5E 4BACA 1YJNA 1E6GA 1T0HA 1YFNA 1SEMA 2A7YA 3VYGA 1WA7A 4M75E 4RTUA 4E6RA 4J9BA 1QQJA 2JXBA 3EGXB 1K0SA 1Q82R 3VRZA 1VYTA 4BI3A 3UF4A 3H0IA 4LUEA 4PJOG 2L0AA 2DL7A 4MZTA 4XTYA 2QAZA 2KDSA 4C92F 1B7TA 2XDDA 3L42A 2EKHA 1M1GA 2HSPA 5M9OA 4DBHA 3GNFB 2JW4A 4MMLA 3CC4Q 1K0XA 4J7FA 3JB9F 2RJCA 5GMKi 1Q81C 1SF9A 1IZ6A 1AWXA 2MYSA 2LCCA 2P84A 2FPEA 4M77B 3CBMA 1M30A 3CXCA 2VV5A 3S3MA 1KIKA 7AT1B 4IURA 4M75A 2XK0A 2RI3A 2ZZDA 2L3PA 3ASKA 1NJIC 3OYKA 2DMOA 3H0FA 2ABLA 2ATCB 4C0DC 4M7DE 3JCMW 3QYGB 4M7DC 2CUBA 1QLYA 2Y4YA 4F7UE 2NYSA 1N6AA 2K7AA 4M78E 2OTLQ 2W10A 3ME9A 4OB3B 1VQ7Q 1JEGA 1I8FA 2R57A 1QVGS 3AHUA 2HEQA 3V7CA 2LNHB 2OTLA 3R6OA 4ELZC 2H3JA 1VQ7A 5LJ3e 3CMEQ 4JJCA 2KMTA 3OS2A 2ECZA 5D6WA 1QCOA 1WHKA 1BI3A 2XKOC 3CMEA 3V7SA 2KAFA 1YIJT 3EG9B 1QWFA 4DBQA 2ZAEA 4C8QC 3CC7Q 3OB9A 1JU5C 5IAYA 3NPFA 4PJOF 2PUOB 2VXFA 2GFAA 3CC7A 2AT1B 1T3LA 4IUQA 4BI8B 4M78A 2AKKA 2MI6A 3NFCA 3VKIA 1WHJA 1OPLA 2LJ0A 3JCMJ 3OYYA 2J06A 1C1AA 1IB8A 3I35A 3G4ST 4J9FA 4FSXA 1M2VA 4BDYA 1ZBXA 1QVGA 2MAMA 2DILA 3IQLA 4NS5A 3P8DA 4F04B 2KRMA 2CSIA 2DD4A 3JRZA 3MKDA 2PVDB 4C5EA 3G6EQ 2C0IA 4LDVA 5HK3A 3OA6A 1GBRA 3G6EA 1XQHA 1M9SA 2V1QA 3QYHB 3CCUA 5LJ3d 1LJOA 4X9DA 1WXUA 2QA4T 2GQVA 3QG1A 1VYUA 4PFOA 1FMVA 1RLPC 2O4XA 1W1FA 3QZ5B 4QT7A 4LD9K 2DKGA 4HVWA 3CD6Q 2DVJA 3OYIA 3JB9J 3CC2A 2W0ZA 1YITQ 3CD6A 1K1ZA 1M90U 4YTLA 2DXCA 2VASA 3M0SA 2D6FA 1YITA 4C5HA 4WF2A 4Z02A 2DXTA 2K3YA 3CPWS 1BIBA 4IUTA 3L2QA 4GLMA 3TSZA 2KY9A 3M4YA 1PKTA 1D0XA 1QKXA 4JZ4A 4KRTA 4DQ2A 1ZBJA 4M75D 1BIAA 2A36A 2NWMA 3X25B 4C92A 4M77E 8AT1B 1GCPA 3EG0A 2KSSA 3DB3A 4LUDA 1SG5A 2K5IA 4N0AC 1NG2A 3UT1A 8ATCB 1WHLA 2HQEA 2YLBA 4QQGA 1I81A 2A28A 1MMGA 5KCHA 1GXIE 1EX4A 2DVEA 4HVUA 4XTZA 4A4FA 4ZNXA 2DK3A 2AHJB 4M7AC 3CCJT 2O01E 4IUPA 1ZA1B 5IHKA 3NHNA 2LTOA 4V2SA 4KUDK 5GANf 5CKFA 3CPWA 2CREA 4AFZC 1NEBA 5DLQE 1X69A 1JBMA 4FW1A 5GAMh 1SSHA 4M75G 2QQSA 2O9SA 4PNOA 3M57A 2H3EB 4BDZA 1I4K1 3VJPA 2F1LA 4M78D 4FYVB 5LJ3j 4KT0E 2KEAA 1PD1A 4J6WA 4FM4B 3E1SA 2QQAA 4L6V5 3PE0A 1LNXA 1N27A 3VS0A 3OW2S 2V1RA 5I11A 4JRPA 3BY7A 2C0TA 1PWTA 3I55T 2YRDA 5I22A 5DM7R 2LT4A 2IIMA 1TXQA 3FC3A 2EQIA 4MZMA 1YHQQ 1WGSA 2QEXT 1BBZA 3V8KA 1K76A 2EVRA 5DY9A 3CCET 1R0CB 1IRXA 3HHTB 3RUXA 1YJ9A 4N4HA 4BE2A 1AD5A 3QIIA 1M1KU 1VQ4T 1QP3A 2RNAA 3CPWP 1K8AC 1QW1A 4EDUA 1VQ9Q 1K9MC 5KYNA 4OGEA 1SSFA 5GANg 3M4GA 2LJ3A 4C0FA 3EG9A 2J7IA 1WQ7A 2CP5A 2ENMA 1OQKA 1I1JA 1S72Q 1RABB 1VQ9A 2VVKA 1B34B 1K73U 4F7UG 2RA2A 1N9SA 1YN8A 1G2BA 4M78G 3P8HA 4R56A 2LQWA 1S72A 2YXYA 2K3BA 1X27A 3I56T 2HCKA 3CEYA 1PRMC 1JB0E 3M54A 3P8BB 3WVEB 5GAN7 1RAFB 4J9HA 3QZ9B 1OX8A 2VWFA 1T3SA 3LYIA 3VRYA 4OMMA 3OW2A 3CCSA 1YI2A 1AWWA 2F2WA 1O75A 2M0OA 3WVDB 4Z88A 2D9TA 1VQOT 2AZSA 4HVVA 1NE8A 4IIMA 5LJ5d 4M75F 2COYA 5D6XA 2XU8A 2CP2A 1H641 3SWNC 3QXEB 3H8ZA 3GF5A 4E7HA 1UB4A 3RIRA 3M53A 2DA9A 2CP7A 1WJSA 2E1HA 3PGGA 3NMZC 1JJ2P 1BK2A 3HRTA 4RKUE 4MZPA 5FU7C 3MEVA 3CMAT 1KD1C 1FMKA 3PNWC 1CKBA 2KYBA 2DZCA 1WIEA 2P0QA 4OF1A 1MNDA 4C0DB 1KC8C 2OAUA 3CCMA 2CKKA 5CKBA 3CCQQ 4RTTA 1M1KR 2EJFA 2D8JA 5KE3A 2RJDA 3G71A 1RAHB 4A54A 5GAOp 3CCQA 3OW2P 2XMFA 3A8HB 4AMCA 4RG8A 2C0OA 3UA7A 2CZ0B 1WYXA 1ABOA 1K73R 2P0PA 3LGLA 1QMCA 3TVTA 1ABQA 4A53A 3QO3A 3OYNA 1D1AA 4LXCA 2KI7A 3HPWA 2MF2A 3EHRA 1YJWT 2MPXC 4E7IA 5CR2A 1UGRB 4M78F 4OP0A 2DIGA 2MK5A 1G3SA 5GANe 4RMOA 4M77D 5IXBA 4C8QB 2F2XA 4PL6A 4E7ZA 2DX1A 1VQKT 2O2OA 3A5ZB 1Q81R 5FWBA 1OI1A 1PCXA 2MCNA 2J6KA 2BZ8A 3KUFA 2HQXA 2DO3A 2QDYB 4ZTJA 1JQQA 4RCCA 4D6WA 5EG2A 1X2QA 1IREB 2FVUA 1GCQC 1PD0A 2NUTA 2YHTA 4CC4B 2KRSA 4J9DA 3MO8A 4L59A 5KYXA 5KYWB 1Z9QA 3TCJA 3C95A 1CSKA 2K2VA 1AWJA 2F2VA 3FRNA 2KT1A 2JJ9A 4ZGEB 1W4SA 2F5TX 1M5Q1 3EHQA 5FROA 3OYDA 1G83A 4ZTFA 1VQ5T 1I5LA 2V8KA 2P0KA 1SHFA 3NTIA 3ZL7C 3CBPA 4M77G 4Z89A 1F1BB 3HP9A 2RHXA 4XU3A 5CQYA 4FL6A 1YIJQ 4BE1A 4RTWA 3OMCA 1Y71A 3VS3A 2HZYA 4J9GA 2E5KA 4BY6B 4P5NA 1PNJA 2NUPB 1SPKA 3X28B 3PIPA 3C12A 2K9GA 1ZSZA 4AFQC
chains in the Genus database with same CATH topology
3EGDA 5KYWB 3EH1A 5KYYB 2YRCA 5KYUB 3EFOA 2QTVA 3EG9B 1M2VB 5KYWA 5KYYA 2YRDA 5KYNA 1PCXA 5KYUA 1M2VA 3EG9A 3EGXB 2NUTB 5KYXB 2NUPB 5KYXA 3EGDB 3EH2A 1PD1A 1PD0A 3EGXA 2NUTA 2NUPA 1M2OA 3EFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGD A;  5KYW B;  3EH1 A;  5KYY B;  2YRC A;  5KYU B;  3EFO A;  2QTV A;  3EG9 B;  1M2V B;  5KYW A;  5KYY A;  2YRD A;  5KYN A;  1PCX A;  5KYU A;  1M2V A;  3EG9 A;  3EGX B;  2NUT B;  5KYX B;  2NUP B;  5KYX A;  3EGD B;  3EH2 A;  1PD1 A;  1PD0 A;  3EGX A;  2NUT A;  2NUP A;  1M2O A;  3EFO B; 
#chains in the Genus database with same CATH topology
 3HTR A;  4II1 A;  5GAN d;  1N5Z A;  4OMO A;  5L8R E;  5IT9 E;  2EGA A;  1WXT A;  2QDL A;  1QKW A;  1XJW B;  5CAI A;  2GBQ A;  5I21 A;  2RB6 A;  2DF6 A;  3MP1 A;  3OYA A;  1B3Q A;  3CCV Q;  1TSF A;  5GMK h;  1WX6 A;  4DA4 A;  2E10 A;  1M1F A;  1XOV A;  3E19 A;  2JNG A;  1LOJ A;  3CCV A;  3VUZ A;  1NM7 A;  1V29 B;  3MEW A;  4LNP A;  4JJD A;  2JM8 A;  1NLP C;  1UDL A;  2EKO A;  4D8D A;  3RKW A;  1JRI A;  4IUV A;  3QDF A;  3CC4 A;  4A4G A;  4JS4 A;  3RKX A;  2OAW A;  3OSS C;  2BZX A;  1UJY A;  4OMF B;  2ZPH B;  4N4G A;  1QP2 A;  1W70 A;  2FB7 A;  2K3X A;  2EQU A;  5J3B A;  3M0T A;  3NTH A;  2FG0 A;  1G3Y A;  2ZPF B;  2EAY A;  2LC4 A;  4M7A B;  1KSW A;  2EQJ A;  2XD0 A;  3ZEH A;  3V7R A;  1MMN A;  1PG5 B;  1AEY A;  2ESW A;  5DLO A;  2EW3 A;  4AFU C;  3PIO A;  2V26 A;  4M77 F;  2GNC A;  2PQW A;  1OZ3 A;  3OBW A;  2OJ2 A;  3E9G A;  3TU4 K;  1MGQ A;  2LX9 A;  1VQP T;  2KVQ G;  4X1V A;  4E7S A;  4F16 A;  4XTX A;  4LDY A;  4EMH A;  5KCO A;  2GCX A;  1MV3 A;  2VGN A;  2EGE A;  2SRC A;  1VQ8 T;  1VIF A;  4BE0 A;  4UC4 A;  1VQ6 T;  5GAN 2;  3EGD A;  2DTO A;  1H3Z A;  2EFI A;  3RDV A;  3JCM h;  2FO0 A;  2KQW A;  2B86 A;  4C8Q E;  3PVL A;  2DEU A;  1Y96 A;  4BD3 A;  5CKH A;  4M7D A;  2LQN A;  1RL2 A;  1WJQ A;  4RTZ A;  3T9N A;  4F7U A;  5GAN j;  2DAQ A;  1M3B A;  2EYY A;  1M4Z A;  3A8M B;  3MJX A;  2FEI A;  2JTE A;  4JRQ A;  4QQD A;  3CCJ Q;  1K8A U;  1RAC B;  4HA8 A;  2JN0 A;  1JO8 A;  3CCJ A;  5A0D A;  2RQU A;  5IHN A;  3BE3 A;  3PVQ A;  2CYZ B;  1Q82 C;  3OYC A;  2IVW A;  2CH4 A;  4PK4 A;  4JDS A;  4C8Q A;  1AHJ B;  4MDX A;  4O6J A;  1GBQ A;  4JUV A;  5GAN 3;  2E41 A;  4C5G A;  3HRS A;  2DFU A;  4FYX B;  2D1X A;  4FU6 A;  4RG2 A;  4ZN1 A;  2HQH A;  1VQL Q;  1NYG A;  2ED1 A;  1TWB A;  3UA6 A;  2COZ A;  2K6D A;  1X75 C;  1KQS S;  2P4R A;  4BY6 C;  1W2B S;  1VQL A;  2JS2 A;  2PTK A;  2R58 A;  5AT1 B;  1BCM A;  5FRN A;  2XDP A;  5KYW A;  4E7K A;  3A8O B;  4QVC A;  3INZ A;  2LMJ A;  3SFM A;  2HSE B;  1Q86 C;  3M0Q A;  2J6O A;  2KRN A;  2L8D A;  5J26 A;  3SWN B;  3GNG A;  4HCZ A;  2ZCF B;  1KD1 U;  3CCL Q;  4C0Z A;  5LL6 S;  3FEO A;  3OS1 A;  2BE7 D;  1ZUK A;  5I2S A;  2QAS A;  5FU7 B;  3CCL A;  3S6W A;  2LCS A;  4C92 C;  2KR3 A;  4XU1 A;  2HDA A;  1UHC A;  3L2W A;  4KGX B;  5GJW B;  1K8A R;  4FT2 A;  2NUP A;  2YSQ A;  4PLI A;  2E3H A;  2K5F A;  3I56 Q;  2GTO A;  1EIF A;  1PSF A;  3CME T;  2E64 A;  3JB9 I;  3I56 A;  3VS2 A;  1IGU A;  1NPR A;  4XTW A;  2LJ1 A;  1NPP A;  2HL5 C;  1Q7Y U;  3EH2 A;  4DBR A;  1KG1 A;  3SB2 A;  4R55 A;  2HL3 A;  1KJW A;  3EGX A;  4IIO A;  5IN1 A;  3C94 A;  2VC8 A;  4M7A E;  2RH2 A;  3LWH A;  2CUD A;  2ZPG B;  2QTV A;  3CC7 T;  2ZGW A;  2CS7 A;  4LE9 A;  3GBQ A;  1VQN Q;  2XI9 A;  2R5M A;  5D6Y A;  1UGP B;  4OMP A;  2E4H A;  2FRW A;  4DOW A;  2BTT A;  1VQN A;  3M56 A;  1FXX A;  1X6G A;  4LDU A;  2FPD A;  2BIV A;  2FZK B;  4KUL A;  1WZO A;  1JJ2 S;  1ZSG A;  5GAM f;  3OYE A;  2OX7 A;  2DEQ A;  2L2P A;  2RQW A;  4ZN3 A;  5A2Q E;  2RF0 A;  3RMQ A;  4M7D D;  2OTJ Q;  4M77 A;  2ED0 A;  3QBY A;  4BI4 A;  2EBP A;  1KD1 R;  1MMA A;  3X26 B;  4N0A A;  3RKY A;  5HKC A;  2X35 A;  2OTJ A;  4KBM B;  1EFN A;  2V8J A;  1KQS P;  4OB0 B;  1W2B P;  1D3B B;  1UUE A;  2FZG B;  2RN8 A;  2RHI A;  3QDR B;  4M7A A;  1UGS B;  1IHW A;  4PJO C;  1W6X A;  3G6E T;  1UJ0 A;  2QXF A;  4LDX A;  4RCB A;  1BI0 A;  1SHG A;  2DD5 A;  3OY9 A;  3CCU T;  5HY6 A;  3BFM A;  1HSQ A;  3X24 B;  4HCC A;  1BB9 A;  1FX7 A;  4J83 A;  2PU9 B;  2RPN A;  1YHQ A;  1YWP A;  4C8Q D;  2BUD A;  5HK0 A;  3RES A;  3HFO A;  3PTA A;  2G3R A;  3ULR B;  1Q7Y R;  4D8K A;  3CC2 T;  3FJ5 A;  2ZPE B;  1JJ2 A;  2PZ1 A;  4M7D G;  3N5B B;  4QQ6 A;  2EQM A;  1OX9 A;  3CD6 T;  1Y0M A;  1UGV A;  1Y07 A;  5GAM g;  1MHN A;  1WI7 A;  1YIT T;  4RUG A;  1U3O A;  1HYO A;  2B8A A;  2FHD A;  2CP0 A;  4KGV B;  2LQK A;  1TOV A;  4TVR A;  1RAD B;  5EC7 A;  1XNI A;  3J80 E;  4E47 A;  2JTM A;  4B6M A;  3JCM V;  1TUD A;  4ANJ A;  4QKU A;  2ZPB B;  1Q81 U;  3MHX A;  2A37 A;  2DTH A;  2BKD N;  1VQ5 Q;  4FT4 A;  2WAC A;  1SRM A;  5GAO r;  3BDU A;  4MDW A;  4C8Q G;  4Y91 A;  3CCR Q;  2LZ6 B;  3QKJ A;  3KXT A;  1D1B A;  1VQ5 A;  2LX7 A;  4EMG A;  3CCR A;  1QVF P;  1S1N A;  2L3R A;  3HRU A;  2IG0 A;  3C0C A;  1NJI U;  3KFV A;  1NLO C;  1Y57 A;  2WSE E;  3M59 A;  2CGH A;  1LCK A;  3QJY A;  3FDR A;  4BB7 A;  1VQM Q;  4VUB A;  2K2M A;  3E9F A;  2YUQ A;  5GJV B;  4JLG A;  2JT4 A;  1VQM A;  3S3N A;  3FB9 A;  1U06 A;  4KH1 B;  1X2K A;  3VU3 C;  1JXM A;  1DJ7 B;  3MP6 A;  2PNI A;  2YRV A;  2CP6 A;  2V8I A;  2KRO A;  4QVD A;  1ARK A;  2RO0 A;  1WQW A;  4OVA A;  2DPP B;  3REB B;  2L3S A;  1M90 C;  2FRY A;  3SWN A;  4A4K A;  2BZY A;  1YNZ A;  3OSV A;  2PUK B;  5FW9 A;  4M7D F;  4JJB A;  4JZ3 A;  1O9S A;  1MNE A;  2GF7 A;  2X51 A;  3HL8 A;  2DET A;  3JB9 D;  4EMK C;  2DM1 A;  4F7U F;  5CKD A;  4HKE A;  4A63 B;  2QTX A;  4X34 A;  2HNI A;  3EFO B;  4LN2 A;  1D09 B;  5GAM e;  1UGQ B;  2HKQ B;  2DYI A;  1K4U S;  4DBF A;  3C4S A;  2CT3 A;  1OU9 A;  2M16 A;  4XK8 E;  1YJ9 T;  3OS0 A;  2RM4 A;  4PKC C;  1M3A A;  2BE9 B;  3GOX A;  4M7A D;  4ME7 A;  3OYM A;  4PLL A;  4QVZ A;  5LJ3 h;  5A0G A;  2DXB A;  3MP8 A;  2AIR B;  2HD0 A;  5IH2 A;  3UAT A;  1Q95 G;  4Y92 A;  4C8Q F;  2M0Y A;  2YDL A;  5CK9 A;  1VIE A;  1VQ9 T;  3VS6 A;  1NJI R;  4OB1 B;  2L5Q A;  1Z9Z A;  4OGC A;  1AOJ A;  1S72 T;  1OU8 A;  3A98 A;  3L1A A;  3THK A;  5GAN 6;  2RK1 A;  4J8O A;  3JB9 G;  4OB2 B;  1KQ2 A;  4PFZ A;  3U23 A;  3FIF A;  2DBK A;  2XHC A;  1YWO A;  2X4J A;  2VYT A;  3CCS T;  4XTV A;  1YI2 T;  4OMN A;  4B9W A;  2M51 A;  3GP8 A;  1PHT A;  1X01 A;  2O31 A;  4IUU A;  1RUW A;  2J6F A;  4PJL A;  3RNJ A;  2YUO A;  2I0N A;  3J7A F;  3AT1 B;  2EWN A;  5CVI A;  4ELY C;  3RBB B;  1BI1 A;  1YIJ A;  4AT1 B;  4PJN A;  2DNU A;  1NBE B;  4M7A G;  3MPU B;  4JRK A;  5FU6 C;  4AG1 C;  1D3B A;  1M2O A;  3HSB A;  4WTO B;  3LWI A;  2K4Y A;  3CBO A;  1X43 A;  5KYY B;  2M02 A;  2JMC A;  3MEA A;  4J9C A;  4FCY A;  2MIO A;  3I5R A;  5GAM d;  3JCM c;  4LDW A;  1RI9 A;  1P92 A;  2LRQ A;  3G4S Q;  3CXC S;  2CZ7 B;  3CCM T;  4K11 A;  4NL2 A;  2DL3 A;  1WNL A;  3G4S A;  2VXE A;  1UEB A;  3EG1 A;  4FW2 A;  4C92 B;  2DBM A;  2XG8 D;  3G71 T;  1MUZ A;  3CCQ T;  1ZLM A;  3OQ5 A;  3JCM X;  2XIC A;  2LNV A;  1K73 C;  1UTI A;  4M75 C;  2CP3 A;  2CH4 W;  2EYW A;  1R77 A;  4HXJ A;  2A08 A;  1TU0 B;  1B34 A;  2KYM A;  4OMQ A;  2LVM A;  5KH6 A;  3LLR A;  3JB9 H;  1TUG B;  2QA4 Q;  1ZUY A;  2DL4 A;  1WHM A;  3NGP A;  2QG9 B;  2QA4 A;  2CT4 A;  2D8H A;  3R6N A;  1QCN A;  1FMW A;  5GAN 4;  2ROT A;  1HXD A;  1RLQ C;  2JMA A;  1RAI B;  3ZBD A;  3VUB A;  1I5O B;  2KE9 A;  5D7U A;  3V8J A;  3EG3 A;  1A0N B;  1Q86 R;  3O5Z A;  3DLM A;  2E12 A;  1WPY A;  5I2M A;  1H8K A;  2RK2 A;  2LT1 A;  9ATC B;  1PC0 A;  3BDL A;  4M7A F;  1D0Y A;  3JAM E;  2DZ9 A;  3JCM f;  2VB6 A;  1KK7 A;  3RR6 A;  4WCI A;  1AZG B;  3CPF A;  2LCL A;  4Y28 E;  4M78 C;  2RI2 A;  2KBT A;  5KYU B;  2E5Q A;  3M9Q A;  1IHV A;  3VV0 A;  2XDB A;  2PVG B;  3URG A;  3MCA B;  4PJO B;  2EGC A;  2FPF A;  1N8R C;  1C6V X;  1GL5 A;  3OYL A;  1AVZ C;  2RHU A;  4FYY B;  3EGU A;  5CCA A;  2DXU A;  3F70 A;  5GAM j;  4F17 A;  5C0M A;  4C0G A;  3CXC P;  4N4I A;  3OYB A;  2DE0 X;  1AWO A;  1K9M U;  1R0B G;  2HAX A;  2P4T A;  5LJ5 f;  2QGG A;  2GQI A;  2RQV A;  3L2U A;  1M27 C;  1YJN T;  5LJ5 h;  3EFS A;  4XQ3 A;  4XTU A;  1G3T A;  1EZZ B;  5A0L A;  1TUC A;  3EFO A;  3L2R A;  4GBQ A;  1MMD A;  1TS9 A;  3RMS A;  2ZPI B;  1AT1 B;  2A3L A;  4KH0 B;  3OYJ A;  1M8V A;  5GAO n;  3JCM g;  3CCV T;  2X9H A;  3H0H A;  4FYW B;  4CI0 C;  4NL3 A;  2E3I A;  4HT8 A;  2HBP A;  3PMT A;  4E7J A;  5IHI A;  2EYQ A;  2JZ2 A;  2COW A;  2DRK A;  3KBG A;  1UHF A;  1WFW A;  2E6Z A;  1U8R A;  1CKA A;  1FWZ A;  3ER0 A;  3M0P A;  3QPH A;  1GFC A;  4PJJ A;  3CC4 T;  2G6F X;  1KQ1 A;  2DL8 A;  3I55 Q;  3TSW A;  3CCU Q;  3M0R A;  3MEU A;  2QEX Q;  5GMK e;  4JLI A;  3I55 A;  4ORZ A;  3JCM Q;  3JSC A;  2J05 A;  4CC3 A;  1UEC A;  2NLU A;  3MET A;  2QEX A;  4MMK A;  3A1P A;  3CCE Q;  1YCS B;  1H92 A;  1PM3 A;  1D1C A;  2AKL A;  4RTY A;  4RTX A;  5LJ5 g;  1VQ4 Q;  3OYF A;  2KGT A;  2HBW A;  1U5S A;  3CCE A;  2IPO B;  1KC8 U;  4HCB A;  4C92 E;  5KE2 A;  3CC2 Q;  1U1S A;  1LVK A;  3M58 A;  3TRE A;  1VQ4 A;  5GAO m;  3UPU A;  3H41 A;  4PFP A;  2EIF A;  3JCM b;  3RER A;  2KXC A;  3H6Z A;  2YUN A;  1X6O A;  1YCY A;  3DB4 A;  3EAE A;  1K9M R;  2OTL T;  4FIB A;  2OI3 A;  1QVG P;  4C5I A;  4R0K A;  5CQX A;  4M4Z A;  4DEX A;  1VQ7 T;  3A8L B;  4Q5W A;  5KYY A;  1IGQ A;  4DOV A;  6AT1 B;  1KQS A;  1W2B A;  4HT9 A;  2RQR A;  2RJF A;  4B9X A;  1G3W A;  2DIQ A;  5GAN 5;  3E2U A;  4IKF A;  1VQO Q;  1NYF A;  1TTH B;  4EMK B;  2YWW A;  2YLC A;  1T0J A;  3OS5 A;  1WHH A;  1Y7X A;  3QUI A;  4RTV A;  5CKE A;  1VQO A;  2K5L A;  2JS0 A;  2DL5 A;  4M77 C;  2X3X D;  3JCM P;  3QJ6 A;  3EG2 A;  3LX7 A;  2NUT B;  2PVO B;  4A4H A;  5KYX B;  4X9C A;  1QVF S;  3OYH A;  2FZC B;  3M55 A;  3REA B;  1NZ9 A;  3CMA Q;  3GPL A;  4XAX B;  3JCM e;  2O9V A;  1ZQ1 A;  3CMA A;  3J81 E;  3SHW A;  3HFN A;  4QW2 A;  2DJZ A;  2EJG A;  4KGZ B;  2CSQ A;  2X3W D;  1BCO A;  4EPC A;  1E7O A;  2DER A;  1K9A A;  3I9Q A;  1X6B A;  2A0F B;  5GMK l;  1XTD A;  4OML A;  4DEY A;  1KC8 R;  5GAN h;  1M8M A;  1D0Z A;  2D0N A;  4PJO E;  1SRL A;  2CZ6 B;  2KT8 A;  1HD3 A;  3OYG A;  1IXD A;  2JTF A;  3QWX X;  3JV3 A;  1VOM A;  4EIK A;  1M90 R;  1QVP A;  1VQL T;  3I5S A;  5LJ5 e;  3LH0 A;  1YJW Q;  1ZSZ B;  3M5A A;  1B07 A;  3BW1 A;  3OMG A;  4JPB W;  2WSC E;  4FSS A;  1VYV A;  1YJW A;  1TH7 A;  5FLX E;  1QVF A;  2RHZ A;  5ECA A;  2EJ9 A;  2K79 A;  2RI5 A;  4AFS C;  4ESR A;  2VGM A;  1VQK Q;  4J9I A;  3VYH B;  4NOY A;  5KYU A;  2F69 A;  5FU6 B;  3D7S B;  2E70 A;  3V8L A;  3ZFJ A;  1YJ9 Q;  2VUB A;  1VQK A;  4LD6 A;  2HKN A;  1WXB A;  3CCL T;  3SDZ A;  3LGF A;  4PJO A;  1OUL A;  3NTK A;  1QCF A;  1G8X A;  3PMI A;  2FL7 A;  3DLL A;  2M1H A;  5FWC A;  1BYM A;  3L2Z A;  3JCM d;  4AG2 C;  2RJE A;  5AYF A;  2R5A A;  1J3T A;  1V76 A;  5C6S A;  2DTI A;  1RAE B;  2EQK A;  2GFU A;  4A4E A;  1WLP B;  3H9N A;  2JVV A;  2HMA A;  2I2L A;  2C06 A;  3VS1 A;  5IXF A;  1RI0 A;  2QQ9 A;  4JJN K;  1V1C A;  4PJM A;  4M75 B;  3CCS Q;  1YI2 Q;  3O8V A;  2AZV A;  2GTJ A;  5L23 A;  1OYX A;  1OPK A;  1AZE A;  4J9E A;  2XID A;  1PSE A;  3EFR A;  2YT6 A;  5GMK j;  4JS5 A;  2E65 A;  2QQR A;  3DKM A;  3SD4 A;  3HKS A;  2Z0W A;  2SEM A;  4JRI A;  4XU2 A;  2ROL A;  2LDM A;  2LQ8 A;  1BI2 A;  1YBY A;  3M0U A;  1VQN T;  2QGF B;  1KFZ A;  2QQB A;  2M9U A;  1HJD A;  2DRM A;  4Z8A A;  3EGD B;  1PKS A;  1HK9 A;  1FYN A;  3CCM Q;  2JOY A;  4C92 D;  1E6H A;  1RAA B;  1R8O B;  2X4Y A;  4HCK A;  1WHG A;  2OTJ T;  2L89 A;  1Y96 B;  1TG0 A;  1ZA2 B;  4BUG A;  2QYZ A;  1QWE A;  4M7D B;  4J5Y A;  4J6Y A;  3G71 Q;  1OEB A;  2KNB B;  4ZGD B;  2JUF A;  2DJQ A;  3Q1J A;  3A8G B;  3UDC A;  2YUP A;  4GY5 A;  1JXO A;  4F7U B;  2QK0 A;  2CZ1 B;  1H3H A;  4M78 B;  3X20 B;  2RQT A;  2F5K A;  1I07 A;  1GFD A;  1OZ2 A;  2EPD A;  1N8R U;  1RAG B;  4GLK A;  2X4W A;  4O5V A;  2DLP A;  2NUZ A;  1PRL C;  2FYK A;  2KXD A;  1M2V B;  2L3Q A;  3L2V A;  1YHQ T;  2K57 A;  3CQT A;  5LJ3 f;  1OV3 A;  3FJP A;  1Q7Y C;  1G5V A;  1ACM B;  4KUI A;  4CC2 A;  4ZGJ B;  1UG1 A;  2MWP A;  1LPL A;  3PFS A;  1KHI A;  2H8H A;  2MWO A;  3VS7 A;  1C0M A;  3QWY A;  4C92 G;  1Q82 U;  1ZUU A;  3TEE A;  5J39 A;  4EMK A;  4J7I A;  4J6X A;  3QSU A;  1VQP Q;  5CO7 A;  1U1T A;  5GMK m;  3GIB A;  3UWN A;  2RMO A;  1ZX6 A;  1UE9 A;  1VQP A;  1BKB A;  1M3C A;  4CRI A;  2MOX A;  1VQ8 Q;  2LP5 A;  3EH1 A;  3G1J A;  1SKU B;  1WJR A;  3LH5 A;  1GRI A;  1VQ6 Q;  1BU1 A;  2D0Q B;  2YRC A;  2O4X B;  1N9R A;  1ZSZ C;  2X4X A;  1VQ8 A;  2AK5 A;  2WSF E;  3G7Z A;  5GAN 8;  4ATO A;  1NEG A;  1VQ6 A;  3FLG A;  3PT9 A;  1IO6 A;  1KHC A;  2CDT A;  4PJO D;  1ZHI A;  3WXM B;  3S3O A;  1OOT A;  1GCQ A;  1UFF A;  5GAO q;  1Q86 U;  5LJ5 j;  2DYB A;  4F14 A;  3CCR T;  2VKN A;  3SEM A;  1WDX A;  4CC7 A;  1VUB A;  3QHS A;  4E7L A;  2EYZ A;  5LJ3 g;  1I0C A;  2QI2 A;  3GLX A;  2MMP A;  1YP5 A;  3VS4 A;  2E6N A;  5CIU A;  2KK4 A;  1N8R R;  2O88 A;  3OBY A;  2EYX A;  4E2F B;  2Y90 A;  1VQM T;  4L5G A;  1VA7 A;  2RD1 A;  2RHY A;  1YJN Q;  2Y4X A;  1M1K C;  5GAO l;  2JM9 A;  5FRM A;  3TQ7 P;  1MV0 B;  2GGR A;  4XU0 A;  5HCK A;  3VS5 A;  3LW5 E;  4BAC A;  1YJN A;  1E6G A;  1T0H A;  1YFN A;  1SEM A;  2A7Y A;  3VYG A;  1WA7 A;  4M75 E;  4RTU A;  4E6R A;  4J9B A;  1QQJ A;  2JXB A;  3EGX B;  1K0S A;  1Q82 R;  3VRZ A;  1VYT A;  4BI3 A;  3UF4 A;  3H0I A;  4LUE A;  4PJO G;  2L0A A;  2DL7 A;  4MZT A;  4XTY A;  2QAZ A;  2KDS A;  4C92 F;  1B7T A;  2XDD A;  3L42 A;  2EKH A;  1M1G A;  2HSP A;  5M9O A;  4DBH A;  3GNF B;  2JW4 A;  4MML A;  3CC4 Q;  1K0X A;  4J7F A;  3JB9 F;  2RJC A;  5GMK i;  1Q81 C;  1SF9 A;  1IZ6 A;  1AWX A;  2MYS A;  2LCC A;  2P84 A;  2FPE A;  4M77 B;  3CBM A;  1M30 A;  3CXC A;  2VV5 A;  3S3M A;  1KIK A;  7AT1 B;  4IUR A;  4M75 A;  2XK0 A;  2RI3 A;  2ZZD A;  2L3P A;  3ASK A;  1NJI C;  3OYK A;  2DMO A;  3H0F A;  2ABL A;  2ATC B;  4C0D C;  4M7D E;  3JCM W;  3QYG B;  4M7D C;  2CUB A;  1QLY A;  2Y4Y A;  4F7U E;  2NYS A;  1N6A A;  2K7A A;  4M78 E;  2OTL Q;  2W10 A;  3ME9 A;  4OB3 B;  1VQ7 Q;  1JEG A;  1I8F A;  2R57 A;  1QVG S;  3AHU A;  2HEQ A;  3V7C A;  2LNH B;  2OTL A;  3R6O A;  4ELZ C;  2H3J A;  1VQ7 A;  5LJ3 e;  3CME Q;  4JJC A;  2KMT A;  3OS2 A;  2ECZ A;  5D6W A;  1QCO A;  1WHK A;  1BI3 A;  2XKO C;  3CME A;  3V7S A;  2KAF A;  1YIJ T;  3EG9 B;  1QWF A;  4DBQ A;  2ZAE A;  4C8Q C;  3CC7 Q;  3OB9 A;  1JU5 C;  5IAY A;  3NPF A;  4PJO F;  2PUO B;  2VXF A;  2GFA A;  3CC7 A;  2AT1 B;  1T3L A;  4IUQ A;  4BI8 B;  4M78 A;  2AKK A;  2MI6 A;  3NFC A;  3VKI A;  1WHJ A;  1OPL A;  2LJ0 A;  3JCM J;  3OYY A;  2J06 A;  1C1A A;  1IB8 A;  3I35 A;  3G4S T;  4J9F A;  4FSX A;  1M2V A;  4BDY A;  1ZBX A;  1QVG A;  2MAM A;  2DIL A;  3IQL A;  4NS5 A;  3P8D A;  4F04 B;  2KRM A;  2CSI A;  2DD4 A;  3JRZ A;  3MKD A;  2PVD B;  4C5E A;  3G6E Q;  2C0I A;  4LDV A;  5HK3 A;  3OA6 A;  1GBR A;  3G6E A;  1XQH A;  1M9S A;  2V1Q A;  3QYH B;  3CCU A;  5LJ3 d;  1LJO A;  4X9D A;  1WXU A;  2QA4 T;  2GQV A;  3QG1 A;  1VYU A;  4PFO A;  1FMV A;  1RLP C;  2O4X A;  1W1F A;  3QZ5 B;  4QT7 A;  4LD9 K;  2DKG A;  4HVW A;  3CD6 Q;  2DVJ A;  3OYI A;  3JB9 J;  3CC2 A;  2W0Z A;  1YIT Q;  3CD6 A;  1K1Z A;  1M90 U;  4YTL A;  2DXC A;  2VAS A;  3M0S A;  2D6F A;  1YIT A;  4C5H A;  4WF2 A;  4Z02 A;  2DXT A;  2K3Y A;  3CPW S;  1BIB A;  4IUT A;  3L2Q A;  4GLM A;  3TSZ A;  2KY9 A;  3M4Y A;  1PKT A;  1D0X A;  1QKX A;  4JZ4 A;  4KRT A;  4DQ2 A;  1ZBJ A;  4M75 D;  1BIA A;  2A36 A;  2NWM A;  3X25 B;  4C92 A;  4M77 E;  8AT1 B;  1GCP A;  3EG0 A;  2KSS A;  3DB3 A;  4LUD A;  1SG5 A;  2K5I A;  4N0A C;  1NG2 A;  3UT1 A;  8ATC B;  1WHL A;  2HQE A;  2YLB A;  4QQG A;  1I81 A;  2A28 A;  1MMG A;  5KCH A;  1GXI E;  1EX4 A;  2DVE A;  4HVU A;  4XTZ A;  4A4F A;  4ZNX A;  2DK3 A;  2AHJ B;  4M7A C;  3CCJ T;  2O01 E;  4IUP A;  1ZA1 B;  5IHK A;  3NHN A;  2LTO A;  4V2S A;  4KUD K;  5GAN f;  5CKF A;  3CPW A;  2CRE A;  4AFZ C;  1NEB A;  5DLQ E;  1X69 A;  1JBM A;  4FW1 A;  5GAM h;  1SSH A;  4M75 G;  2QQS A;  2O9S A;  4PNO A;  3M57 A;  2H3E B;  4BDZ A;  1I4K 1;  3VJP A;  2F1L A;  4M78 D;  4FYV B;  5LJ3 j;  4KT0 E;  2KEA A;  1PD1 A;  4J6W A;  4FM4 B;  3E1S A;  2QQA A;  4L6V 5;  3PE0 A;  1LNX A;  1N27 A;  3VS0 A;  3OW2 S;  2V1R A;  5I11 A;  4JRP A;  3BY7 A;  2C0T A;  1PWT A;  3I55 T;  2YRD A;  5I22 A;  5DM7 R;  2LT4 A;  2IIM A;  1TXQ A;  3FC3 A;  2EQI A;  4MZM A;  1YHQ Q;  1WGS A;  2QEX T;  1BBZ A;  3V8K A;  1K76 A;  2EVR A;  5DY9 A;  3CCE T;  1R0C B;  1IRX A;  3HHT B;  3RUX A;  1YJ9 A;  4N4H A;  4BE2 A;  1AD5 A;  3QII A;  1M1K U;  1VQ4 T;  1QP3 A;  2RNA A;  3CPW P;  1K8A C;  1QW1 A;  4EDU A;  1VQ9 Q;  1K9M C;  5KYN A;  4OGE A;  1SSF A;  5GAN g;  3M4G A;  2LJ3 A;  4C0F A;  3EG9 A;  2J7I A;  1WQ7 A;  2CP5 A;  2ENM A;  1OQK A;  1I1J A;  1S72 Q;  1RAB B;  1VQ9 A;  2VVK A;  1B34 B;  1K73 U;  4F7U G;  2RA2 A;  1N9S A;  1YN8 A;  1G2B A;  4M78 G;  3P8H A;  4R56 A;  2LQW A;  1S72 A;  2YXY A;  2K3B A;  1X27 A;  3I56 T;  2HCK A;  3CEY A;  1PRM C;  1JB0 E;  3M54 A;  3P8B B;  3WVE B;  5GAN 7;  1RAF B;  4J9H A;  3QZ9 B;  1OX8 A;  2VWF A;  1T3S A;  3LYI A;  3VRY A;  4OMM A;  3OW2 A;  3CCS A;  1YI2 A;  1AWW A;  2F2W A;  1O75 A;  2M0O A;  3WVD B;  4Z88 A;  2D9T A;  1VQO T;  2AZS A;  4HVV A;  1NE8 A;  4IIM A;  5LJ5 d;  4M75 F;  2COY A;  5D6X A;  2XU8 A;  2CP2 A;  1H64 1;  3SWN C;  3QXE B;  3H8Z A;  3GF5 A;  4E7H A;  1UB4 A;  3RIR A;  3M53 A;  2DA9 A;  2CP7 A;  1WJS A;  2E1H A;  3PGG A;  3NMZ C;  1JJ2 P;  1BK2 A;  3HRT A;  4RKU E;  4MZP A;  5FU7 C;  3MEV A;  3CMA T;  1KD1 C;  1FMK A;  3PNW C;  1CKB A;  2KYB A;  2DZC A;  1WIE A;  2P0Q A;  4OF1 A;  1MND A;  4C0D B;  1KC8 C;  2OAU A;  3CCM A;  2CKK A;  5CKB A;  3CCQ Q;  4RTT A;  1M1K R;  2EJF A;  2D8J A;  5KE3 A;  2RJD A;  3G71 A;  1RAH B;  4A54 A;  5GAO p;  3CCQ A;  3OW2 P;  2XMF A;  3A8H B;  4AMC A;  4RG8 A;  2C0O A;  3UA7 A;  2CZ0 B;  1WYX A;  1ABO A;  1K73 R;  2P0P A;  3LGL A;  1QMC A;  3TVT A;  1ABQ A;  4A53 A;  3QO3 A;  3OYN A;  1D1A A;  4LXC A;  2KI7 A;  3HPW A;  2MF2 A;  3EHR A;  1YJW T;  2MPX C;  4E7I A;  5CR2 A;  1UGR B;  4M78 F;  4OP0 A;  2DIG A;  2MK5 A;  1G3S A;  5GAN e;  4RMO A;  4M77 D;  5IXB A;  4C8Q B;  2F2X A;  4PL6 A;  4E7Z A;  2DX1 A;  1VQK T;  2O2O A;  3A5Z B;  1Q81 R;  5FWB A;  1OI1 A;  1PCX A;  2MCN A;  2J6K A;  2BZ8 A;  3KUF A;  2HQX A;  2DO3 A;  2QDY B;  4ZTJ A;  1JQQ A;  4RCC A;  4D6W A;  5EG2 A;  1X2Q A;  1IRE B;  2FVU A;  1GCQ C;  1PD0 A;  2NUT A;  2YHT A;  4CC4 B;  2KRS A;  4J9D A;  3MO8 A;  4L59 A;  5KYX A;  5KYW B;  1Z9Q A;  3TCJ A;  3C95 A;  1CSK A;  2K2V A;  1AWJ A;  2F2V A;  3FRN A;  2KT1 A;  2JJ9 A;  4ZGE B;  1W4S A;  2F5T X;  1M5Q 1;  3EHQ A;  5FRO A;  3OYD A;  1G83 A;  4ZTF A;  1VQ5 T;  1I5L A;  2V8K A;  2P0K A;  1SHF A;  3NTI A;  3ZL7 C;  3CBP A;  4M77 G;  4Z89 A;  1F1B B;  3HP9 A;  2RHX A;  4XU3 A;  5CQY A;  4FL6 A;  1YIJ Q;  4BE1 A;  4RTW A;  3OMC A;  1Y71 A;  3VS3 A;  2HZY A;  4J9G A;  2E5K A;  4BY6 B;  4P5N A;  1PNJ A;  2NUP B;  1SPK A;  3X28 B;  3PIP A;  3C12 A;  2K9G A;  1ZSZ A;  4AFQ C; 
#chains in the Genus database with same CATH homology
 3EGD A;  5KYW B;  3EH1 A;  5KYY B;  2YRC A;  5KYU B;  3EFO A;  2QTV A;  3EG9 B;  1M2V B;  5KYW A;  5KYY A;  2YRD A;  5KYN A;  1PCX A;  5KYU A;  1M2V A;  3EG9 A;  3EGX B;  2NUT B;  5KYX B;  2NUP B;  5KYX A;  3EGD B;  3EH2 A;  1PD1 A;  1PD0 A;  3EGX A;  2NUT A;  2NUP A;  1M2O A;  3EFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...