2YRDA

Solution structure of the zf-sec23_sec24 from human sec23a mutant v69a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
b'GSSGSSGEPVLCSRTTCRAALNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title Solution structure of the zf-Sec23_Sec24 from human Sec23A mutant V69A
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.380 Mainly Beta Roll SH3 type barrels. Zn-finger domain of Sec23/24 2yrdA00
2NUPA 5KYWA 2NUPB 2QTVA 5KYWB 3EH1A 1PD0A 1M2VA 2NUTA 1M2VB 2NUTB 3EFOA 3EFOB 3EGDA 3EGDB 3EG9A 5KYXA 3EG9B 5KYXB 3EH2A 5KYYA 5KYYB 5KYNA 3EGXA 1PD1A 3EGXB 2YRCA 2YRDA 1PCXA 5KYUA 1M2OA 5KYUB
chains in the Genus database with same CATH superfamily
4P5NA 1ARKA 2FL7A 1KQ1A 1WHJA 3CCEQ 2LJ0A 2LQWA 1XJWB 4FM4B 3I55Q 2J6FA 3JAME 3PIPA 4CC3A 5ECAA 2GCXA 2AK5A 3KBGA 2E10A 2DVJA 4M78C 5I11A 3A1PA 4A63B 3VS6A 1OPKA 4RTWA 3QDRB 4BI8B 3VRZA 4KULA 3E2UA 2KEAA 3CCSA 2X35A 4M7AC 3EAEA 4J7FA 2HSEB 1YJNQ 2CUDA 4HA8A 5CKDA 3H8ZA 1M2VB 2FO0A 4C8QF 4M75E 1RLPC 2B8AA 2HBWA 3L2RA 4FSSA 1UTIA 2OTJQ 2CP7A 2E65A 4C0FA 3MHXA 1K9MC 3S3OA 2RI3A 2GTJA 3I56Q 2DO3A 3FJPA 1VQ4Q 1VQ7T 2HKNA 1QCFA 1HYOA 1AZGB 2K5IA 1FWZA 2DBMA 3OYNA 2V8KA 3SHWA 4A54A 2QA4Q 4M7DD 1BI2A 2QYZA 2RN8A 3FEOA 3CCQT 5GAMe 3A8GB 5FROA 4FL6A 4K11A 3ZBDA 1QKWA 2BUDA 4LUEA 3E9GA 1UECA 1KC8R 1WFWA 2F5KA 2E4HA 2HD0A 2WACA 3L2QA 2O4XA 4CI0C 1XOVA 1HK9A 4RTVA 4HXJA 2YUOA 2FRWA 1VQ6A 2DRMA 1QVGA 4JJCA 1YCSB 1S1NA 3PGGA 1TG0A 4HT8A 3E1SA 4C8QB 1CKBA 1K1ZA 4J8OA 3G6EA 2V1RA 4M78D 5CIUA 2J06A 1AWXA 1YI2Q 2PVGB 5GAOq 1Q81U 4M77E 5A0LA 4M7AD 2DXBA 4RMOA 1QP2A 4FYYB 5GMKl 1U06A 2RHIA 3H41A 3M5AA 3SB2A 1WXTA 5GMKi 2PUKB 3H6ZA 5GAMd 1YITT 4MZTA 5EG2A 4AMCA 1I4K1 4AFZC 2K3BA 3CD6T 1E6HA 1S72T 3CPWP 2X9HA 2YHTA 4MZMA 2GQVA 4QKUA 5A2QE 1Q82U 2CT4A 1VYUA 2XMFA 3QJYA 1RL2A 1UGPB 1Q7YR 3NGPA 2VYTA 1JQQA 5FWBA 4BDZA 2D0NA 1YIJA 2EJGA 1SRLA 3UPUA 3ZEHA 1WJSA 4LN2A 2GBQA 2EWNA 1VQKT 2QG9B 3GPLA 4DOWA 2X3XD 1NLOC 2CDTA 2FEIA 1X6GA 1N9RA 2LCLA 2DAQA 1SHGA 4Z8AA 3FJ5A 4KBMB 1UGSB 5GAOl 1KJWA 2K2MA 4JJDA 2RK1A 1M90R 1C6VX 1VQNA 1SEMA 2JUFA 2X4XA 3OSSC 1WJQA 3V8KA 2E6ZA 2FZGB 2DTIA 2JS0A 3BDUA 2RHXA 5CKBA 4B9WA 1G83A 3QJ6A 3M56A 1ABOA 2DL3A 5KE3A 1K9MR 4ZNXA 1U3OA 2O88A 1K0SA 1I5LA 3M0SA 1N8RU 1KQSA 1VQ8A 5C6SA 1VQOT 2YLBA 1O75A 4RTZA 1IHWA 1I1JA 1UEBA 1NEGA 5KCOA 2OJ2A 3LW5E 5GAOr 1MUZA 1PNJA 4M7DA 5IAYA 2NLUA 2LT1A 2JN0A 5FU6C 4LD9K 2I2LA 3I5RA 1XNIA 1N6AA 5FU6B 2RI2A 4XK8E 4BDYA 1OU9A 4LDVA 1N27A 1B34A 5FWCA 1M1KU 2CP3A 2E3HA 4XTWA 2ZAEA 4E2FB 3C12A 2OTLT 4DBQA 4PFZA 5D7UA 4IUTA 3CCLA 2DIQA 5LJ5j 2KRMA 2KROA 2YUQA 4MDXA 3A8HB 2E41A 1RLQC 7AT1B 4RTXA 2MWOA 3JB9G 4M78A 3CPWA 1KQ2A 4FT4A 3M0UA 3MP8A 2JS2A 4C8QE 5LJ5h 1OZ3A 2K57A 5AT1B 3SEMA 4M7AA 2CP5A 1T3SA 3MEWA 1N8RC 3QXEB 3EFOB 3META 4PK4A 4PJOF 1M3AA 2D6FA 2L8DA 4GLKA 2EQJA 4Z88A 3M58A 4F7UF 3G7ZA 3TEEA 2EIFA 1UG1A 1WHKA 2VVKA 4QVDA 1D0YA 4NS5A 4DBRA 2DYIA 3QPHA 5I21A 1AT1B 1X6OA 3EG3A 1QW1A 4C92G 3OW2S 5GJVB 2HDAA 2LP5A 2XICA 3JCMh 3OS1A 1MHNA 4E47A 1RADB 2HMAA 3QUIA 3CC4T 4KGXB 2QDLA 5GANf 2RHUA 1IRXA 3JCMg 1JXMA 2F2XA 2K5FA 4PLIA 2W0ZA 2K3YA 2EYQA 3QIIA 4R56A 4E7SA 4PJJA 3M4YA 4A4HA 2QQ9A 2M16A 4A4EA 2JVVA 3P8BB 1MMAA 4BD3A 2C06A 1AWWA 4PJOC 2L3QA 3FB9A 3CCRT 1CKAA 5IHIA 1NM7A 2P84A 4XU1A 3VU3C 4PJOB 3DB4A 2HAXA 4OMMA 2M51A 1NE8A 3FLGA 1YN8A 1NLPC 3JCMX 4F7UB 3QHSA 3OYDA 4DA4A 1SHFA 5IXFA 2JT4A 1NG2A 2C0OA 1VQ7A 1Q82R 4AG2C 2H8HA 1JXOA 2CSIA 4M75F 2LMJA 4QVZA 2HZYA 1MNDA 2O31A 3D7SB 1PHTA 2JM9A 3EG1A 4B6MA 3CCQA 2HL3A 3CCMQ 4RTTA 3CCJQ 1VQLQ 2PZ1A 3OYGA 4OMFB 1AOJA 5FU7C 1V1CA 2DXCA 3RERA 2ZGWA 3VS3A 3SDZA 3N5BB 1VUBA 1X69A 1YIJT 2P0QA 1TSFA 4F04B 2MI6A 2PVDB 2RA2A 3M4GA 2EAYA 1K0XA 3OYEA 2DL4A 2RK2A 1VQPT 4QW2A 1ABQA 2GQIA 4JJBA 4JDSA 3S3NA 1N8RR 2MF2A 2LZ6B 1U1SA 4M75C 2FPEA 1KK7A 1ZSZC 4MMKA 1YITA 1VIFA 2ZPEB 2KE9A 2A37A 2LQNA 4M75B 1G5VA 1IB8A 1PM3A 1IHVA 3CMAQ 4ELZC 3CD6A 3EHRA 3M54A 1PKTA 2ROTA 2BZYA 3OMCA 2XKOC 1WXBA 3UF4A 4ZN1A 4E7LA 4OB1B 1WIEA 4LDXA 1LOJA 3H0IA 2OX7A 5IHNA 1BI1A 1ZQ1A 3URGA 3CCVT 3OBWA 2KT8A 4J6YA 2VKNA 2MPXC 3O5ZA 2AKKA 3EG9A 5GAN3 3MCAB 4ZN3A 4OP0A 5CVIA 4DEXA 4KUDK 2C0TA 5LJ3j 3J81E 2XHCA 3OA6A 3VS7A 4EIKA 2R58A 2CGHA 4OF1A 1ZBXA 1H92A 1T0JA 3CCSQ 1K9AA 1OYXA 1X27A 1G3WA 4RG8A 3AHUA 5LJ3h 2DMOA 2YT6A 2CH4A 4PFPA 5HK0A 3LGLA 3DLMA 3CMET 1G3SA 1LCKA 2NYSA 1WJRA 1SRMA 2XDDA 1TUDA 3UWNA 2O2OA 2XDBA 4PJOE 2XK0A 3MO8A 1WA7A 1R0CB 3WVEB 2KT1A 4F7UE 4XTZA 5LJ5e 1VQOA 1UHFA 2DERA 1VQ5A 3TSZA 1R77A 2CT3A 3S6WA 1D3BA 3HRSA 1Z9QA 4C0GA 3OY9A 2HL5C 3JCMJ 2RJFA 4KH1B 1YP5A 2ZPBB 4GBQA 1M4ZA 2EVRA 3L2ZA 1QVGP 4LDUA 2V26A 4GLMA 1JB0E 1MNEA 3EG0A 2JTEA 4OMQA 2FZKB 3RKWA 1TWBA 2F2WA 2RJCA 5C0MA 2JOYA 3G4ST 4F14A 3UDCA 2OTLA 3CC2Q 1OPLA 1VQ6Q 1QVFP 4BY6C 1X2QA 3JCMQ 2ED1A 3ER0A 2LJ1A 3VYGA 4OB0B 1WHHA 4Y92A 2FPFA 3G6EQ 3QWYA 5L8RE 4V2SA 4RTYA 4XU0A 4HKEA 3JCMe 1Y96A 1U1TA 2MYSA 2VWFA 5LJ5d 3P8HA 1OULA 2GGRA 2DJQA 2NUTA 3RUXA 3EGDA 4HVUA 4HVVA 2KMTA 1W4SA 1Y71A 4PJMA 2K3XA 4BE0A 1WHLA 2BKDN 4M7DG 2RF0A 2VUBA 2AIRB 2XG8D 3GOXA 1M90C 3HPWA 1TUCA 4E7JA 4BUGA 2CZ7B 1BU1A 3M53A 2KXCA 4M77D 1CSKA 1P92A 3EH2A 1QVPA 2RJDA 2VGMA 3M55A 3O8VA 4OMOA 2DZCA 1VQ9T 1M3CA 2BZ8A 3JCMd 3V8LA 3EFRA 4E7HA 1JJ2S 3ASKA 1G3TA 4PLLA 4PL6A 2E5KA 4M78G 4BB7A 3CC4A 3AT1B 5CCAA 1FX7A 5KE2A 2SRCA 4BE1A 1T3LA 3CCUT 3VKIA 3VS5A 2QEXT 2EKOA 5J3BA 1VQNQ 2MAMA 4M7AG 5FW9A 2EYXA 2EQMA 2DILA 1IGUA 2WSFE 2SEMA 4C0DC 2P4RA 3HP9A 4ATOA 4LD6A 1KQSP 3CCRA 1ACMB 3CBMA 2ENMA 4C0DB 1I81A 3X26B 3JB9I 4N0AA 2QQAA 2DETA 2F69A 1QQJA 3A8MB 4C8QC 4EMKA 1VQ8Q 1PRMC 2RHZA 4ZTJA 3QG1A 1KFZA 2DD4A 2DL5A 1QVFA 3EHQA 4OGCA 2IPOB 2ATCB 2O9SA 1ZLMA 4J9DA 2BE9B 1ZSZA 2RPNA 3SWNC 2R5AA 1NJIU 3PMTA 3SWNB 3JCMb 4FYXB 1AVZC 1WYXA 4FCYA 2CUBA 1B3QA 1ZUYA 4JJNK 3CCEA 4Z02A 3REBB 3CCLQ 5IHKA 2B86A 1ZUKA 4LDWA 1QP3A 4JPBW 1LVKA 2DXUA 2E5QA 2CP6A 2KRNA 4L6V5 5GAN2 4O6JA 2COYA 1UJYA 3G71T 1QWEA 3FRNA 5GMKm 2HEQA 2OAUA 1KHIA 1FMKA 1VQMQ 2DLPA 2WSEE 2XU8A 3DB3A 2EQIA 2FVUA 1N9SA 5KYWA 1QWFA 2PNIA 1A0NB 2LQKA 2D1XA 2DK3A 2JXBA 2RQWA 2EFIA 1W2BS 1VQPA 1WDXA 3MPUB 3RDVA 2HBPA 3CXCS 2NUZA 5GAMf 3NTKA 1YNZA 3JB9F 4J6WA 3QZ9B 5KYYB 2OTJA 5LJ3e 2YRCA 2V1QA 2QI2A 4FYWB 4JLIA 4NOYA 2DEUA 2CREA 1Q81C 2MIOA 2J6KA 1BI3A 1UDLA 3ME9A 1VQ4A 1JJ2P 3X28B 4M77A 2DTHA 4C8QD 1BI0A 3OS0A 3RR6A 4FT2A 4QQDA 5M9OA 2K2VA 3S3MA 2QQBA 3OYHA 2QA4A 1RAEB 2F1LA 1YHQT 1BIAA 2HQHA 3CCVA 3FIFA 4B9XA 4MDWA 3BY7A 2D9TA 3TCJA 4DBHA 1WHMA 1Q82C 1TU0B 1VQ5T 1UUEA 3VUZA 1I07A 3KFVA 1NPPA 4RTUA 1X43A 1W6XA 3R6NA 5EC7A 1WI7A 4C92F 2A3LA 1OU8A 1NYFA 1W70A 2DD5A 5LJ3d 2A7YA 3JSCA 4XTXA 3THKA 3QKJA 3KXTA 2XIDA 3QZ5B 1M27C 4ESRA 1SKUB 4QT7A 3CMEA 1Z9ZA 3EG2A 2E64A 3I35A 1YJ9T 2CYZB 2P0KA 3PFSA 3QO3A 4Y91A 4ZGEB 5GAOn 4JUVA 4UC4A 1VQ7Q 3VYHB 2L0AA 3VJPA 4EPCA 3QYHB 4AFUC 4BACA 1GBRA 3V7CA 2ZPFB 2EW3A 1X75C 1D1CA 5CKFA 2NUPB 4DBFA 1LJOA 2QGGA 3CCQQ 1I5OB 1O9SA 3L42A 1M1GA 1HJDA 1M2VA 1MGQA 3PMIA 5LJ5g 1UB4A 4XU2A 3MEVA 1Y0MA 3M0RA 1SG5A 2BZXA 3R6OA 3G4SA 1NBEB 2E70A 2RQTA 3OYYA 2HCKA 4C92B 3JCMW 1Y57A 5GAOp 4ME7A 4JZ4A 1D0ZA 5CO7A 3M57A 1YCYA 2W10A 2LDMA 1W2BP 1MMGA 2KNBB 4OGEA 2VB6A 1M1KC 3VS2A 4DEYA 5KYXB 2K5LA 2MOXA 2NWMA 1JJ2A 1GCPA 2VXEA 2D8HA 3EGXB 1YJWT 3M0QA 1QKXA 4J7IA 1HXDA 2IG0A 1UGVA 2XI9A 1YITQ 3BW1A 1ZA1B 3JB9J 5L23A 4JS4A 3CD6Q 1S72Q 1NZ9A 2M9UA 3GNGA 3LLRA 4D8DA 2A28A 1Q81R 2EBPA 2JTMA 3OMGA 1NJIR 3ULRB 2KR3A 4C8QA 5KYUB 2QQRA 3OQ5A 2VGNA 2QASA 3CPFA 4KGZB 3QWXX 1VQ9A 3JCMV 1WPYA 1K73U 1VQKQ 2MCNA 3PVQA 2PUOB 3X20B 1G3YA 2EQKA 4BE2A 5GAN4 2HQEA 2YRDA 2H3JA 4TVRA 4OMLA 3GIBA 3CCUA 2C0IA 2QEXA 4FW2A 2AHJB 2RM4A 3OBYA 3GP8A 3CC7T 3NTIA 3L1AA 2Y4YA 5KCHA 1C0MA 3CCET 4RCBA 2L89A 3H0HA 5GAMj 3I55T 5CKEA 1AHJB 5D6WA 2QQSA 1TTHB 1RAGB 5DLQE 1QCOA 2PTKA 3UA7A 3MKDA 3RKYA 2K79A 1VQOQ 4LNPA 4FIBA 2AKLA 4JLGA 4AFSC 2L3SA 2AZVA 4IUPA 4HVWA 1OI1A 2EJ9A 5D6XA 5GAN7 1W2BA 1YJNT 5LL6S 2R57A 2X4YA 4AT1B 4QVCA 4J9EA 3NFCA 4J9CA 1PD0A 2QGFB 4D6WA 4PJOD 4WF2A 2OTJT 2OTLQ 1UGQB 5CR2A 2O4XB 3LH5A 4J9HA 3OW2P 2RH2A 3LGFA 2EGEA 3OYFA 3GLXA 3I56T 3LWIA 4XQ3A 3QSUA 1VQ4T 3X24B 1K8AU 4QQGA 4IKFA 2BTTA 1EFNA 3G71A 4C92E 3PIOA 1M1KR 3INZA 2QA4T 2JM8A 3C94A 3V7SA 4HCCA 3WXMB 4ORZA 4IUQA 3OS5A 4IUVA 2JMAA 1Q95G 1RACB 3L2WA 2COZA 5GAN8 2YSQA 4DOVA 1N5ZA 2GF7A 4M75G 1PCXA 3LH0A 4J5YA 4LDYA 1RAFB 2DIGA 2DYBA 2QTXA 4RCCA 3E19A 2CSQA 2HNIA 2RQVA 4PKCC 1OV3A 3HRUA 1YI2T 2XDPA 4M7DF 5HCKA 3OYAA 5LJ3g 3UA6A 1NPRA 2FPDA 1YHQA 1MMDA 1Q7YU 4A53A 2MMPA 1KD1U 4DQ2A 3CC4Q 2F5TX 2LC4A 1RABB 3EFOA 2DF6A 2ESWA 1IREB 2VASA 3CCMA 3CCJA 3DLLA 4M75D 1VIEA 3TREA 1VQLA 2Z0WA 8AT1B 4FYVB 3VUBA 1YWOA 4O5VA 1X2KA 2DXTA 5CK9A 2PQWA 3VS0A 2LRQA 1PG5B 2ABLA 3CCRQ 4M78F 2K7AA 2EGAA 2FG0A 2ZPHB 5GANj 2ROLA 3GNFB 4FW1A 2KQWA 1RAAB 1IGQA 2O01E 4C0ZA 5IXBA 5GMKj 1WQWA 2ED0A 4PNOA 4YTLA 1G8XA 4M77G 2DZ9A 3WVDB 1YJ9A 2EKHA 4M7AF 4RKUE 1K76A 3OYKA 1D0XA 1MV0B 3RIRA 4WTOB 3C95A 3HFOA 5GANh 4J9BA 3OW2A 4X1VA 1K9MU 4L59A 3TVTA 4J9GA 5GMKh 4M7DB 3CMAA 2JZ2A 3ZL7C 3BE3A 2M1HA 1K73R 1B34B 4HCKA 1I8FA 4BI3A 1AWOA 1KD1C 4PJOA 2LTOA 3CPWS 3QYGB 2QXFA 3MJXA 1LPLA 2A0FB 4J83A 4F7UA 4LE9A 1WQ7A 1BCMA 2E1HA 1G2BA 3EGUA 3REAB 1V76A 4M78B 4E7KA 1YIJQ 1Y07A 2A36A 5LJ5f 1E6GA 2LT4A 3SFMA 4Y28E 1YJWA 1VQPQ 4JRKA 2E6NA 4M7AB 2CP2A 2FB7A 3MP1A 1KSWA 2RB6A 3P8DA 3ZFJA 1ZUUA 5J26A 4PJNA 3JRZA 5CKHA 1UE9A 2GTOA 3A5ZB 3JV3A 2KRSA 4XAXB 3A98A 1M2OA 2LX7A 5HY6A 1M1FA 4C5IA 1H641 2LQ8A 1BIBA 2RMOA 1R0BG 4M4ZA 4N4GA 1SF9A 1B07A 1PSFA 4KT0E 3JCMf 1DJ7B 1OZ2A 3CCVQ 5FRNA 2RHYA 2J7IA 1M5Q1 5KYNA 5HK3A 3T9NA 1SPKA 2XD0A 2KBTA 4Z89A 5CAIA 5I2SA 2O9VA 3TSWA 1Q86U 3OSVA 4IIMA 1K8AR 2ZPGB 4X34A 1Y7XA 3QDFA 2EYWA 2RNAA 1K4US 4M75A 4E6RA 3CC2A 4L5GA 3NHNA 1VA7A 1VYVA 2IIMA 1WHGA 4N4IA 3Q1JA 1RAHB 3HKSA 4KRTA 6AT1B 3CC7A 2FZCB 3DKMA 4XTYA 4ELYC 4C5HA 2CZ6B 1YFNA 2CH4W 2CZ0B 5IH2A 3EFSA 3M59A 4II1A 5A0DA 3CMEQ 8ATCB 3BDLA 2WSCE 4FU6A 3I55A 4C8QG 1BK2A 2K9GA 2RD1A 3HHTB 3PVLA 4BI4A 3J80E 5D6YA 1U8RA 3RMQA 2DBKA 5CQXA 3HTRA 2EPDA 1M8VA 4CC2A 1YJNA 4E7IA 1KIKA 2FYKA 4HT9A 2K4YA 1AWJA 4M7DE 4KUIA 2QK0A 3IQLA 4D8KA 1KD1R 1F1BB 1Q86C 1GFDA 1HSQA 3PT9A 3G4SQ 3UT1A 1OQKA 5IN1A 1WNLA 3MEAA 2YUNA 3OYBA 4ZGDB 1SSHA 2HKQB 2K6DA 3RESA 3I56A 2G3RA 5I2MA 5I22A 1NJIC 1GXIE 2YXYA 1JBMA 2R5MA 1TUGB 1ZSGA 4JZ3A 3OYMA 4C5EA 2G6FX 4OMPA 4OB2B 1I0CA 5GAOm 5DLOA 1PD1A 3VV0A 2X51A 4IUUA 4M78E 2DTOA 2HQXA 3NTHA 3OYIA 2ZPIB 3CCMT 3CCJT 2DRKA 3MP6A 1U5SA 1VQLT 4NL3A 2JTFA 1RAIB 3A8OB 3NPFA 4M7AE 2VC8A 2KYBA 4A4KA 2EYYA 4QQ6A 4EDUA 1VYTA 3SD4A 4MMLA 1YI2A 2QTVA 1GCQC 2X3WD 1H8KA 1VQ9Q 1OEBA 1X01A 2VV5A 1ZHIA 4XU3A 1D1AA 2CZ1B 5GANe 2F2VA 1BKBA 3EG9B 2I0NA 1YWPA 5GMKe 3JCMc 3VS4A 1WZOA 4OMNA 3CBPA 1JRIA 3CCUQ 5KH6A 2QEXQ 3CMAT 2L2PA 1TH7A 2YLCA 3PTAA 1OX8A 1MV3A 5J39A 2JW4A 5LJ3f 4F16A 2IVWA 1SSFA 2L3RA 1FYNA 3HL8A 2AT1B 3M9QA 4A4FA 2D8JA 2PU9B 3LX7A 4WCIA 1BB9A 4C92C 1VQMA 2DEQA 2X4JA 4VUBA 1PWTA 1QMCA 5GAN5 4XTVA 5GANd 1XQHA 2KVQG 3CEYA 1J3TA 1EZZB 2KYMA 1D3BB 3CXCP 3L2VA 2E3IA 2ZCFB 2DFUA 3CCST 1GFCA 1EX4A 1RI9A 2V8JA 3MEUA 4KH0B 1NYGA 1W1FA 1PSEA 2X4WA 3FDRA 1UFFA 2KI7A 2RO0A 2V8IA 4X9CA 1FMVA 3RMSA 4R0KA 2KSSA 2L3PA 2CKKA 1BCOA 2LX9A 1Q86R 2COWA 4F17A 3JB9D 2FRYA 5GJWB 1ZA2B 4JRQA 2H3EB 4GY5A 2LNVA 3OYJA 1RUWA 2DM1A 3L2UA 3G71Q 2EQUA 1PC0A 1Y96B 3HRTA 3QBYA 3UATA 4HCBA 4ANJA 4OVAA 3FC3A 1WLPB 1IXDA 2NUTB 1X6BA 3EGDB 3CQTA 1ZX6A 1WX6A 1IO6A 1T0HA 2KAFA 3SWNA 1JU5C 4FSXA 3RBBB 2MWPA 2YRVA 2LJ3A 1GL5A 4C5GA 1C1AA 2LCSA 3TU4K 2DA9A 3CC2T 2Y4XA 2Y90A 3H9NA 4E7ZA 1VQ6T 4C92D 5FLXE 4AG1C 1WXUA 2YUPA 1GBQA 5CQYA 3M0PA 2RQUA 3LYIA 4KGVB 1OX9A 4PJOG 3G6ET 4JS5A 2VXFA 2J05A 2RQRA 4F7UG 3PNWC 4AFQC 4J6XA 3M0TA 3C0CA 5IT9E 3GBQA 1QCNA 1UGRB 1UHCA 1XTDA 1YHQQ 4HCZA 2A08A 4RUGA 1PRLC 2DX1A 1M8MA 3E9FA 9ATCB 3TQ7P 3HFNA 1VQ5Q 2P0PA 3BFMA 1E7OA 1JEGA 5GAMh 2EJFA 3I9QA 2KGTA 5KYYA 1RI0A 5KYUA 2CS7A 3G1JA 1R8OB 1H3ZA 1QVGS 5GAMg 1K73C 3CXCA 5FU7B 3I5SA 1EIFA 4N0AC 4EMGA 3GF5A 3J7AF 2E12A 1NEBA 3C4SA 1BBZA 2GFUA 2DKGA 1QVFS 1JO8A 2OAWA 5GAN6 4IURA 4EMKC 2KDSA 4Q5WA 1VOMA 2JNGA 2BE7D 4A4GA 1UJ0A 1YJ9Q 4EMKB 1AZEA 5DY9A 1KC8U 1B7TA 5A0GA 3A8LB 2RJEA 3JB9H 1GRIA 2FHDA 4CC7A 2YWWA 1ZSZB 2EYZA 1H3HA 1VQNT 4OB3B 3U23A 1S72A 4J9FA 1FXXA 5HKCA 1ZBJA 4J9IA 4LUDA 4M77F 4XTUA 4JRPA 3X25B 1M9SA 4PFOA 3HSBA 2DJZA 1IZ6A 3V7RA 5FRMA 4JRIA 1MMNA 2DL8A 2J6OA 2L5QA 3NMZC 1GCQA 3OB9A 2KY9A 1VQKA 1VQ8T 1AD5A 4MZPA 3OS2A 4N4HA 1OOTA 2M0OA 1AEYA 2ZZDA 4CC4B 1TXQA 4X9DA 1D09B 2KXDA 4LXCA 2MK5A 4R55A 2NUPA 5KYWB 3V8JA 1YJWQ 4EMHA 3OYCA 3RKXA 1YBYA 3RNJA 1HD3A 1K8AC 1KC8C 2DPPB 3LWHA 2PVOB 3CCLT 2ECZA 3CBOA 1V29B 3OYLA 2GNCA 1D1BA 4C92A 2RI5A 3VS1A 4M77C 1M30A 3F70A 2LCCA 4RG2A 1KQSS 2BIVA 4M77B 2M02A 4CRIA 1BYMA 3H0FA 2HSPA 1M90U 2DE0X 3PE0A 4IIOA 2DNUA 1VQMT 5KYXA 2GFAA 2P4TA 4ZGJB 1FMWA 2DL7A 1LNXA 1PKSA 1TS9A 2YDLA 5DM7R 2KK4A 3EGXA 2EGCA 3KUFA 5AYFA 2LNHB 2JMCA 1QLYA 2DVEA 2AZSA 2M0YA 4PJLA 3JCMP 2LVMA 1M3BA 4M7DC 3EH1A 2D0QB 3VRYA 2OI3A 1WGSA 2JJ9A 1KG1A 1TOVA 5GANg 2QDYB 4ZTFA 1Q7YC 4BY6B 3CC7Q 2CP0A 4NL2A 2QAZA 1KHCA
chains in the Genus database with same CATH topology
2NUPA 5KYWA 2NUPB 2QTVA 5KYWB 3EH1A 1PD0A 1M2VA 2NUTA 1M2VB 2NUTB 3EFOA 3EFOB 3EGDA 3EGDB 3EG9A 5KYXA 3EG9B 5KYXB 3EH2A 5KYYA 5KYYB 5KYNA 3EGXA 1PD1A 3EGXB 2YRCA 2YRDA 1PCXA 5KYUA 1M2OA 5KYUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP A;  5KYW A;  2NUP B;  2QTV A;  5KYW B;  3EH1 A;  1PD0 A;  1M2V A;  2NUT A;  1M2V B;  2NUT B;  3EFO A;  3EFO B;  3EGD A;  3EGD B;  3EG9 A;  5KYX A;  3EG9 B;  5KYX B;  3EH2 A;  5KYY A;  5KYY B;  5KYN A;  3EGX A;  1PD1 A;  3EGX B;  2YRC A;  2YRD A;  1PCX A;  5KYU A;  1M2O A;  5KYU B; 
#chains in the Genus database with same CATH topology
 4P5N A;  1ARK A;  2FL7 A;  1KQ1 A;  1WHJ A;  3CCE Q;  2LJ0 A;  2LQW A;  1XJW B;  4FM4 B;  3I55 Q;  2J6F A;  3JAM E;  3PIP A;  4CC3 A;  5ECA A;  2GCX A;  2AK5 A;  3KBG A;  2E10 A;  2DVJ A;  4M78 C;  5I11 A;  3A1P A;  4A63 B;  3VS6 A;  1OPK A;  4RTW A;  3QDR B;  4BI8 B;  3VRZ A;  4KUL A;  3E2U A;  2KEA A;  3CCS A;  2X35 A;  4M7A C;  3EAE A;  4J7F A;  2HSE B;  1YJN Q;  2CUD A;  4HA8 A;  5CKD A;  3H8Z A;  1M2V B;  2FO0 A;  4C8Q F;  4M75 E;  1RLP C;  2B8A A;  2HBW A;  3L2R A;  4FSS A;  1UTI A;  2OTJ Q;  2CP7 A;  2E65 A;  4C0F A;  3MHX A;  1K9M C;  3S3O A;  2RI3 A;  2GTJ A;  3I56 Q;  2DO3 A;  3FJP A;  1VQ4 Q;  1VQ7 T;  2HKN A;  1QCF A;  1HYO A;  1AZG B;  2K5I A;  1FWZ A;  2DBM A;  3OYN A;  2V8K A;  3SHW A;  4A54 A;  2QA4 Q;  4M7D D;  1BI2 A;  2QYZ A;  2RN8 A;  3FEO A;  3CCQ T;  5GAM e;  3A8G B;  5FRO A;  4FL6 A;  4K11 A;  3ZBD A;  1QKW A;  2BUD A;  4LUE A;  3E9G A;  1UEC A;  1KC8 R;  1WFW A;  2F5K A;  2E4H A;  2HD0 A;  2WAC A;  3L2Q A;  2O4X A;  4CI0 C;  1XOV A;  1HK9 A;  4RTV A;  4HXJ A;  2YUO A;  2FRW A;  1VQ6 A;  2DRM A;  1QVG A;  4JJC A;  1YCS B;  1S1N A;  3PGG A;  1TG0 A;  4HT8 A;  3E1S A;  4C8Q B;  1CKB A;  1K1Z A;  4J8O A;  3G6E A;  2V1R A;  4M78 D;  5CIU A;  2J06 A;  1AWX A;  1YI2 Q;  2PVG B;  5GAO q;  1Q81 U;  4M77 E;  5A0L A;  4M7A D;  2DXB A;  4RMO A;  1QP2 A;  4FYY B;  5GMK l;  1U06 A;  2RHI A;  3H41 A;  3M5A A;  3SB2 A;  1WXT A;  5GMK i;  2PUK B;  3H6Z A;  5GAM d;  1YIT T;  4MZT A;  5EG2 A;  4AMC A;  1I4K 1;  4AFZ C;  2K3B A;  3CD6 T;  1E6H A;  1S72 T;  3CPW P;  2X9H A;  2YHT A;  4MZM A;  2GQV A;  4QKU A;  5A2Q E;  1Q82 U;  2CT4 A;  1VYU A;  2XMF A;  3QJY A;  1RL2 A;  1UGP B;  1Q7Y R;  3NGP A;  2VYT A;  1JQQ A;  5FWB A;  4BDZ A;  2D0N A;  1YIJ A;  2EJG A;  1SRL A;  3UPU A;  3ZEH A;  1WJS A;  4LN2 A;  2GBQ A;  2EWN A;  1VQK T;  2QG9 B;  3GPL A;  4DOW A;  2X3X D;  1NLO C;  2CDT A;  2FEI A;  1X6G A;  1N9R A;  2LCL A;  2DAQ A;  1SHG A;  4Z8A A;  3FJ5 A;  4KBM B;  1UGS B;  5GAO l;  1KJW A;  2K2M A;  4JJD A;  2RK1 A;  1M90 R;  1C6V X;  1VQN A;  1SEM A;  2JUF A;  2X4X A;  3OSS C;  1WJQ A;  3V8K A;  2E6Z A;  2FZG B;  2DTI A;  2JS0 A;  3BDU A;  2RHX A;  5CKB A;  4B9W A;  1G83 A;  3QJ6 A;  3M56 A;  1ABO A;  2DL3 A;  5KE3 A;  1K9M R;  4ZNX A;  1U3O A;  2O88 A;  1K0S A;  1I5L A;  3M0S A;  1N8R U;  1KQS A;  1VQ8 A;  5C6S A;  1VQO T;  2YLB A;  1O75 A;  4RTZ A;  1IHW A;  1I1J A;  1UEB A;  1NEG A;  5KCO A;  2OJ2 A;  3LW5 E;  5GAO r;  1MUZ A;  1PNJ A;  4M7D A;  5IAY A;  2NLU A;  2LT1 A;  2JN0 A;  5FU6 C;  4LD9 K;  2I2L A;  3I5R A;  1XNI A;  1N6A A;  5FU6 B;  2RI2 A;  4XK8 E;  4BDY A;  1OU9 A;  4LDV A;  1N27 A;  1B34 A;  5FWC A;  1M1K U;  2CP3 A;  2E3H A;  4XTW A;  2ZAE A;  4E2F B;  3C12 A;  2OTL T;  4DBQ A;  4PFZ A;  5D7U A;  4IUT A;  3CCL A;  2DIQ A;  5LJ5 j;  2KRM A;  2KRO A;  2YUQ A;  4MDX A;  3A8H B;  2E41 A;  1RLQ C;  7AT1 B;  4RTX A;  2MWO A;  3JB9 G;  4M78 A;  3CPW A;  1KQ2 A;  4FT4 A;  3M0U A;  3MP8 A;  2JS2 A;  4C8Q E;  5LJ5 h;  1OZ3 A;  2K57 A;  5AT1 B;  3SEM A;  4M7A A;  2CP5 A;  1T3S A;  3MEW A;  1N8R C;  3QXE B;  3EFO B;  3MET A;  4PK4 A;  4PJO F;  1M3A A;  2D6F A;  2L8D A;  4GLK A;  2EQJ A;  4Z88 A;  3M58 A;  4F7U F;  3G7Z A;  3TEE A;  2EIF A;  1UG1 A;  1WHK A;  2VVK A;  4QVD A;  1D0Y A;  4NS5 A;  4DBR A;  2DYI A;  3QPH A;  5I21 A;  1AT1 B;  1X6O A;  3EG3 A;  1QW1 A;  4C92 G;  3OW2 S;  5GJV B;  2HDA A;  2LP5 A;  2XIC A;  3JCM h;  3OS1 A;  1MHN A;  4E47 A;  1RAD B;  2HMA A;  3QUI A;  3CC4 T;  4KGX B;  2QDL A;  5GAN f;  2RHU A;  1IRX A;  3JCM g;  1JXM A;  2F2X A;  2K5F A;  4PLI A;  2W0Z A;  2K3Y A;  2EYQ A;  3QII A;  4R56 A;  4E7S A;  4PJJ A;  3M4Y A;  4A4H A;  2QQ9 A;  2M16 A;  4A4E A;  2JVV A;  3P8B B;  1MMA A;  4BD3 A;  2C06 A;  1AWW A;  4PJO C;  2L3Q A;  3FB9 A;  3CCR T;  1CKA A;  5IHI A;  1NM7 A;  2P84 A;  4XU1 A;  3VU3 C;  4PJO B;  3DB4 A;  2HAX A;  4OMM A;  2M51 A;  1NE8 A;  3FLG A;  1YN8 A;  1NLP C;  3JCM X;  4F7U B;  3QHS A;  3OYD A;  4DA4 A;  1SHF A;  5IXF A;  2JT4 A;  1NG2 A;  2C0O A;  1VQ7 A;  1Q82 R;  4AG2 C;  2H8H A;  1JXO A;  2CSI A;  4M75 F;  2LMJ A;  4QVZ A;  2HZY A;  1MND A;  2O31 A;  3D7S B;  1PHT A;  2JM9 A;  3EG1 A;  4B6M A;  3CCQ A;  2HL3 A;  3CCM Q;  4RTT A;  3CCJ Q;  1VQL Q;  2PZ1 A;  3OYG A;  4OMF B;  1AOJ A;  5FU7 C;  1V1C A;  2DXC A;  3RER A;  2ZGW A;  3VS3 A;  3SDZ A;  3N5B B;  1VUB A;  1X69 A;  1YIJ T;  2P0Q A;  1TSF A;  4F04 B;  2MI6 A;  2PVD B;  2RA2 A;  3M4G A;  2EAY A;  1K0X A;  3OYE A;  2DL4 A;  2RK2 A;  1VQP T;  4QW2 A;  1ABQ A;  2GQI A;  4JJB A;  4JDS A;  3S3N A;  1N8R R;  2MF2 A;  2LZ6 B;  1U1S A;  4M75 C;  2FPE A;  1KK7 A;  1ZSZ C;  4MMK A;  1YIT A;  1VIF A;  2ZPE B;  2KE9 A;  2A37 A;  2LQN A;  4M75 B;  1G5V A;  1IB8 A;  1PM3 A;  1IHV A;  3CMA Q;  4ELZ C;  3CD6 A;  3EHR A;  3M54 A;  1PKT A;  2ROT A;  2BZY A;  3OMC A;  2XKO C;  1WXB A;  3UF4 A;  4ZN1 A;  4E7L A;  4OB1 B;  1WIE A;  4LDX A;  1LOJ A;  3H0I A;  2OX7 A;  5IHN A;  1BI1 A;  1ZQ1 A;  3URG A;  3CCV T;  3OBW A;  2KT8 A;  4J6Y A;  2VKN A;  2MPX C;  3O5Z A;  2AKK A;  3EG9 A;  5GAN 3;  3MCA B;  4ZN3 A;  4OP0 A;  5CVI A;  4DEX A;  4KUD K;  2C0T A;  5LJ3 j;  3J81 E;  2XHC A;  3OA6 A;  3VS7 A;  4EIK A;  2R58 A;  2CGH A;  4OF1 A;  1ZBX A;  1H92 A;  1T0J A;  3CCS Q;  1K9A A;  1OYX A;  1X27 A;  1G3W A;  4RG8 A;  3AHU A;  5LJ3 h;  2DMO A;  2YT6 A;  2CH4 A;  4PFP A;  5HK0 A;  3LGL A;  3DLM A;  3CME T;  1G3S A;  1LCK A;  2NYS A;  1WJR A;  1SRM A;  2XDD A;  1TUD A;  3UWN A;  2O2O A;  2XDB A;  4PJO E;  2XK0 A;  3MO8 A;  1WA7 A;  1R0C B;  3WVE B;  2KT1 A;  4F7U E;  4XTZ A;  5LJ5 e;  1VQO A;  1UHF A;  2DER A;  1VQ5 A;  3TSZ A;  1R77 A;  2CT3 A;  3S6W A;  1D3B A;  3HRS A;  1Z9Q A;  4C0G A;  3OY9 A;  2HL5 C;  3JCM J;  2RJF A;  4KH1 B;  1YP5 A;  2ZPB B;  4GBQ A;  1M4Z A;  2EVR A;  3L2Z A;  1QVG P;  4LDU A;  2V26 A;  4GLM A;  1JB0 E;  1MNE A;  3EG0 A;  2JTE A;  4OMQ A;  2FZK B;  3RKW A;  1TWB A;  2F2W A;  2RJC A;  5C0M A;  2JOY A;  3G4S T;  4F14 A;  3UDC A;  2OTL A;  3CC2 Q;  1OPL A;  1VQ6 Q;  1QVF P;  4BY6 C;  1X2Q A;  3JCM Q;  2ED1 A;  3ER0 A;  2LJ1 A;  3VYG A;  4OB0 B;  1WHH A;  4Y92 A;  2FPF A;  3G6E Q;  3QWY A;  5L8R E;  4V2S A;  4RTY A;  4XU0 A;  4HKE A;  3JCM e;  1Y96 A;  1U1T A;  2MYS A;  2VWF A;  5LJ5 d;  3P8H A;  1OUL A;  2GGR A;  2DJQ A;  2NUT A;  3RUX A;  3EGD A;  4HVU A;  4HVV A;  2KMT A;  1W4S A;  1Y71 A;  4PJM A;  2K3X A;  4BE0 A;  1WHL A;  2BKD N;  4M7D G;  2RF0 A;  2VUB A;  2AIR B;  2XG8 D;  3GOX A;  1M90 C;  3HPW A;  1TUC A;  4E7J A;  4BUG A;  2CZ7 B;  1BU1 A;  3M53 A;  2KXC A;  4M77 D;  1CSK A;  1P92 A;  3EH2 A;  1QVP A;  2RJD A;  2VGM A;  3M55 A;  3O8V A;  4OMO A;  2DZC A;  1VQ9 T;  1M3C A;  2BZ8 A;  3JCM d;  3V8L A;  3EFR A;  4E7H A;  1JJ2 S;  3ASK A;  1G3T A;  4PLL A;  4PL6 A;  2E5K A;  4M78 G;  4BB7 A;  3CC4 A;  3AT1 B;  5CCA A;  1FX7 A;  5KE2 A;  2SRC A;  4BE1 A;  1T3L A;  3CCU T;  3VKI A;  3VS5 A;  2QEX T;  2EKO A;  5J3B A;  1VQN Q;  2MAM A;  4M7A G;  5FW9 A;  2EYX A;  2EQM A;  2DIL A;  1IGU A;  2WSF E;  2SEM A;  4C0D C;  2P4R A;  3HP9 A;  4ATO A;  4LD6 A;  1KQS P;  3CCR A;  1ACM B;  3CBM A;  2ENM A;  4C0D B;  1I81 A;  3X26 B;  3JB9 I;  4N0A A;  2QQA A;  2DET A;  2F69 A;  1QQJ A;  3A8M B;  4C8Q C;  4EMK A;  1VQ8 Q;  1PRM C;  2RHZ A;  4ZTJ A;  3QG1 A;  1KFZ A;  2DD4 A;  2DL5 A;  1QVF A;  3EHQ A;  4OGC A;  2IPO B;  2ATC B;  2O9S A;  1ZLM A;  4J9D A;  2BE9 B;  1ZSZ A;  2RPN A;  3SWN C;  2R5A A;  1NJI U;  3PMT A;  3SWN B;  3JCM b;  4FYX B;  1AVZ C;  1WYX A;  4FCY A;  2CUB A;  1B3Q A;  1ZUY A;  4JJN K;  3CCE A;  4Z02 A;  3REB B;  3CCL Q;  5IHK A;  2B86 A;  1ZUK A;  4LDW A;  1QP3 A;  4JPB W;  1LVK A;  2DXU A;  2E5Q A;  2CP6 A;  2KRN A;  4L6V 5;  5GAN 2;  4O6J A;  2COY A;  1UJY A;  3G71 T;  1QWE A;  3FRN A;  5GMK m;  2HEQ A;  2OAU A;  1KHI A;  1FMK A;  1VQM Q;  2DLP A;  2WSE E;  2XU8 A;  3DB3 A;  2EQI A;  2FVU A;  1N9S A;  5KYW A;  1QWF A;  2PNI A;  1A0N B;  2LQK A;  2D1X A;  2DK3 A;  2JXB A;  2RQW A;  2EFI A;  1W2B S;  1VQP A;  1WDX A;  3MPU B;  3RDV A;  2HBP A;  3CXC S;  2NUZ A;  5GAM f;  3NTK A;  1YNZ A;  3JB9 F;  4J6W A;  3QZ9 B;  5KYY B;  2OTJ A;  5LJ3 e;  2YRC A;  2V1Q A;  2QI2 A;  4FYW B;  4JLI A;  4NOY A;  2DEU A;  2CRE A;  1Q81 C;  2MIO A;  2J6K A;  1BI3 A;  1UDL A;  3ME9 A;  1VQ4 A;  1JJ2 P;  3X28 B;  4M77 A;  2DTH A;  4C8Q D;  1BI0 A;  3OS0 A;  3RR6 A;  4FT2 A;  4QQD A;  5M9O A;  2K2V A;  3S3M A;  2QQB A;  3OYH A;  2QA4 A;  1RAE B;  2F1L A;  1YHQ T;  1BIA A;  2HQH A;  3CCV A;  3FIF A;  4B9X A;  4MDW A;  3BY7 A;  2D9T A;  3TCJ A;  4DBH A;  1WHM A;  1Q82 C;  1TU0 B;  1VQ5 T;  1UUE A;  3VUZ A;  1I07 A;  3KFV A;  1NPP A;  4RTU A;  1X43 A;  1W6X A;  3R6N A;  5EC7 A;  1WI7 A;  4C92 F;  2A3L A;  1OU8 A;  1NYF A;  1W70 A;  2DD5 A;  5LJ3 d;  2A7Y A;  3JSC A;  4XTX A;  3THK A;  3QKJ A;  3KXT A;  2XID A;  3QZ5 B;  1M27 C;  4ESR A;  1SKU B;  4QT7 A;  3CME A;  1Z9Z A;  3EG2 A;  2E64 A;  3I35 A;  1YJ9 T;  2CYZ B;  2P0K A;  3PFS A;  3QO3 A;  4Y91 A;  4ZGE B;  5GAO n;  4JUV A;  4UC4 A;  1VQ7 Q;  3VYH B;  2L0A A;  3VJP A;  4EPC A;  3QYH B;  4AFU C;  4BAC A;  1GBR A;  3V7C A;  2ZPF B;  2EW3 A;  1X75 C;  1D1C A;  5CKF A;  2NUP B;  4DBF A;  1LJO A;  2QGG A;  3CCQ Q;  1I5O B;  1O9S A;  3L42 A;  1M1G A;  1HJD A;  1M2V A;  1MGQ A;  3PMI A;  5LJ5 g;  1UB4 A;  4XU2 A;  3MEV A;  1Y0M A;  3M0R A;  1SG5 A;  2BZX A;  3R6O A;  3G4S A;  1NBE B;  2E70 A;  2RQT A;  3OYY A;  2HCK A;  4C92 B;  3JCM W;  1Y57 A;  5GAO p;  4ME7 A;  4JZ4 A;  1D0Z A;  5CO7 A;  3M57 A;  1YCY A;  2W10 A;  2LDM A;  1W2B P;  1MMG A;  2KNB B;  4OGE A;  2VB6 A;  1M1K C;  3VS2 A;  4DEY A;  5KYX B;  2K5L A;  2MOX A;  2NWM A;  1JJ2 A;  1GCP A;  2VXE A;  2D8H A;  3EGX B;  1YJW T;  3M0Q A;  1QKX A;  4J7I A;  1HXD A;  2IG0 A;  1UGV A;  2XI9 A;  1YIT Q;  3BW1 A;  1ZA1 B;  3JB9 J;  5L23 A;  4JS4 A;  3CD6 Q;  1S72 Q;  1NZ9 A;  2M9U A;  3GNG A;  3LLR A;  4D8D A;  2A28 A;  1Q81 R;  2EBP A;  2JTM A;  3OMG A;  1NJI R;  3ULR B;  2KR3 A;  4C8Q A;  5KYU B;  2QQR A;  3OQ5 A;  2VGN A;  2QAS A;  3CPF A;  4KGZ B;  3QWX X;  1VQ9 A;  3JCM V;  1WPY A;  1K73 U;  1VQK Q;  2MCN A;  3PVQ A;  2PUO B;  3X20 B;  1G3Y A;  2EQK A;  4BE2 A;  5GAN 4;  2HQE A;  2YRD A;  2H3J A;  4TVR A;  4OML A;  3GIB A;  3CCU A;  2C0I A;  2QEX A;  4FW2 A;  2AHJ B;  2RM4 A;  3OBY A;  3GP8 A;  3CC7 T;  3NTI A;  3L1A A;  2Y4Y A;  5KCH A;  1C0M A;  3CCE T;  4RCB A;  2L89 A;  3H0H A;  5GAM j;  3I55 T;  5CKE A;  1AHJ B;  5D6W A;  2QQS A;  1TTH B;  1RAG B;  5DLQ E;  1QCO A;  2PTK A;  3UA7 A;  3MKD A;  3RKY A;  2K79 A;  1VQO Q;  4LNP A;  4FIB A;  2AKL A;  4JLG A;  4AFS C;  2L3S A;  2AZV A;  4IUP A;  4HVW A;  1OI1 A;  2EJ9 A;  5D6X A;  5GAN 7;  1W2B A;  1YJN T;  5LL6 S;  2R57 A;  2X4Y A;  4AT1 B;  4QVC A;  4J9E A;  3NFC A;  4J9C A;  1PD0 A;  2QGF B;  4D6W A;  4PJO D;  4WF2 A;  2OTJ T;  2OTL Q;  1UGQ B;  5CR2 A;  2O4X B;  3LH5 A;  4J9H A;  3OW2 P;  2RH2 A;  3LGF A;  2EGE A;  3OYF A;  3GLX A;  3I56 T;  3LWI A;  4XQ3 A;  3QSU A;  1VQ4 T;  3X24 B;  1K8A U;  4QQG A;  4IKF A;  2BTT A;  1EFN A;  3G71 A;  4C92 E;  3PIO A;  1M1K R;  3INZ A;  2QA4 T;  2JM8 A;  3C94 A;  3V7S A;  4HCC A;  3WXM B;  4ORZ A;  4IUQ A;  3OS5 A;  4IUV A;  2JMA A;  1Q95 G;  1RAC B;  3L2W A;  2COZ A;  5GAN 8;  2YSQ A;  4DOV A;  1N5Z A;  2GF7 A;  4M75 G;  1PCX A;  3LH0 A;  4J5Y A;  4LDY A;  1RAF B;  2DIG A;  2DYB A;  2QTX A;  4RCC A;  3E19 A;  2CSQ A;  2HNI A;  2RQV A;  4PKC C;  1OV3 A;  3HRU A;  1YI2 T;  2XDP A;  4M7D F;  5HCK A;  3OYA A;  5LJ3 g;  3UA6 A;  1NPR A;  2FPD A;  1YHQ A;  1MMD A;  1Q7Y U;  4A53 A;  2MMP A;  1KD1 U;  4DQ2 A;  3CC4 Q;  2F5T X;  2LC4 A;  1RAB B;  3EFO A;  2DF6 A;  2ESW A;  1IRE B;  2VAS A;  3CCM A;  3CCJ A;  3DLL A;  4M75 D;  1VIE A;  3TRE A;  1VQL A;  2Z0W A;  8AT1 B;  4FYV B;  3VUB A;  1YWO A;  4O5V A;  1X2K A;  2DXT A;  5CK9 A;  2PQW A;  3VS0 A;  2LRQ A;  1PG5 B;  2ABL A;  3CCR Q;  4M78 F;  2K7A A;  2EGA A;  2FG0 A;  2ZPH B;  5GAN j;  2ROL A;  3GNF B;  4FW1 A;  2KQW A;  1RAA B;  1IGQ A;  2O01 E;  4C0Z A;  5IXB A;  5GMK j;  1WQW A;  2ED0 A;  4PNO A;  4YTL A;  1G8X A;  4M77 G;  2DZ9 A;  3WVD B;  1YJ9 A;  2EKH A;  4M7A F;  4RKU E;  1K76 A;  3OYK A;  1D0X A;  1MV0 B;  3RIR A;  4WTO B;  3C95 A;  3HFO A;  5GAN h;  4J9B A;  3OW2 A;  4X1V A;  1K9M U;  4L59 A;  3TVT A;  4J9G A;  5GMK h;  4M7D B;  3CMA A;  2JZ2 A;  3ZL7 C;  3BE3 A;  2M1H A;  1K73 R;  1B34 B;  4HCK A;  1I8F A;  4BI3 A;  1AWO A;  1KD1 C;  4PJO A;  2LTO A;  3CPW S;  3QYG B;  2QXF A;  3MJX A;  1LPL A;  2A0F B;  4J83 A;  4F7U A;  4LE9 A;  1WQ7 A;  1BCM A;  2E1H A;  1G2B A;  3EGU A;  3REA B;  1V76 A;  4M78 B;  4E7K A;  1YIJ Q;  1Y07 A;  2A36 A;  5LJ5 f;  1E6G A;  2LT4 A;  3SFM A;  4Y28 E;  1YJW A;  1VQP Q;  4JRK A;  2E6N A;  4M7A B;  2CP2 A;  2FB7 A;  3MP1 A;  1KSW A;  2RB6 A;  3P8D A;  3ZFJ A;  1ZUU A;  5J26 A;  4PJN A;  3JRZ A;  5CKH A;  1UE9 A;  2GTO A;  3A5Z B;  3JV3 A;  2KRS A;  4XAX B;  3A98 A;  1M2O A;  2LX7 A;  5HY6 A;  1M1F A;  4C5I A;  1H64 1;  2LQ8 A;  1BIB A;  2RMO A;  1R0B G;  4M4Z A;  4N4G A;  1SF9 A;  1B07 A;  1PSF A;  4KT0 E;  3JCM f;  1DJ7 B;  1OZ2 A;  3CCV Q;  5FRN A;  2RHY A;  2J7I A;  1M5Q 1;  5KYN A;  5HK3 A;  3T9N A;  1SPK A;  2XD0 A;  2KBT A;  4Z89 A;  5CAI A;  5I2S A;  2O9V A;  3TSW A;  1Q86 U;  3OSV A;  4IIM A;  1K8A R;  2ZPG B;  4X34 A;  1Y7X A;  3QDF A;  2EYW A;  2RNA A;  1K4U S;  4M75 A;  4E6R A;  3CC2 A;  4L5G A;  3NHN A;  1VA7 A;  1VYV A;  2IIM A;  1WHG A;  4N4I A;  3Q1J A;  1RAH B;  3HKS A;  4KRT A;  6AT1 B;  3CC7 A;  2FZC B;  3DKM A;  4XTY A;  4ELY C;  4C5H A;  2CZ6 B;  1YFN A;  2CH4 W;  2CZ0 B;  5IH2 A;  3EFS A;  3M59 A;  4II1 A;  5A0D A;  3CME Q;  8ATC B;  3BDL A;  2WSC E;  4FU6 A;  3I55 A;  4C8Q G;  1BK2 A;  2K9G A;  2RD1 A;  3HHT B;  3PVL A;  4BI4 A;  3J80 E;  5D6Y A;  1U8R A;  3RMQ A;  2DBK A;  5CQX A;  3HTR A;  2EPD A;  1M8V A;  4CC2 A;  1YJN A;  4E7I A;  1KIK A;  2FYK A;  4HT9 A;  2K4Y A;  1AWJ A;  4M7D E;  4KUI A;  2QK0 A;  3IQL A;  4D8K A;  1KD1 R;  1F1B B;  1Q86 C;  1GFD A;  1HSQ A;  3PT9 A;  3G4S Q;  3UT1 A;  1OQK A;  5IN1 A;  1WNL A;  3MEA A;  2YUN A;  3OYB A;  4ZGD B;  1SSH A;  2HKQ B;  2K6D A;  3RES A;  3I56 A;  2G3R A;  5I2M A;  5I22 A;  1NJI C;  1GXI E;  2YXY A;  1JBM A;  2R5M A;  1TUG B;  1ZSG A;  4JZ3 A;  3OYM A;  4C5E A;  2G6F X;  4OMP A;  4OB2 B;  1I0C A;  5GAO m;  5DLO A;  1PD1 A;  3VV0 A;  2X51 A;  4IUU A;  4M78 E;  2DTO A;  2HQX A;  3NTH A;  3OYI A;  2ZPI B;  3CCM T;  3CCJ T;  2DRK A;  3MP6 A;  1U5S A;  1VQL T;  4NL3 A;  2JTF A;  1RAI B;  3A8O B;  3NPF A;  4M7A E;  2VC8 A;  2KYB A;  4A4K A;  2EYY A;  4QQ6 A;  4EDU A;  1VYT A;  3SD4 A;  4MML A;  1YI2 A;  2QTV A;  1GCQ C;  2X3W D;  1H8K A;  1VQ9 Q;  1OEB A;  1X01 A;  2VV5 A;  1ZHI A;  4XU3 A;  1D1A A;  2CZ1 B;  5GAN e;  2F2V A;  1BKB A;  3EG9 B;  2I0N A;  1YWP A;  5GMK e;  3JCM c;  3VS4 A;  1WZO A;  4OMN A;  3CBP A;  1JRI A;  3CCU Q;  5KH6 A;  2QEX Q;  3CMA T;  2L2P A;  1TH7 A;  2YLC A;  3PTA A;  1OX8 A;  1MV3 A;  5J39 A;  2JW4 A;  5LJ3 f;  4F16 A;  2IVW A;  1SSF A;  2L3R A;  1FYN A;  3HL8 A;  2AT1 B;  3M9Q A;  4A4F A;  2D8J A;  2PU9 B;  3LX7 A;  4WCI A;  1BB9 A;  4C92 C;  1VQM A;  2DEQ A;  2X4J A;  4VUB A;  1PWT A;  1QMC A;  5GAN 5;  4XTV A;  5GAN d;  1XQH A;  2KVQ G;  3CEY A;  1J3T A;  1EZZ B;  2KYM A;  1D3B B;  3CXC P;  3L2V A;  2E3I A;  2ZCF B;  2DFU A;  3CCS T;  1GFC A;  1EX4 A;  1RI9 A;  2V8J A;  3MEU A;  4KH0 B;  1NYG A;  1W1F A;  1PSE A;  2X4W A;  3FDR A;  1UFF A;  2KI7 A;  2RO0 A;  2V8I A;  4X9C A;  1FMV A;  3RMS A;  4R0K A;  2KSS A;  2L3P A;  2CKK A;  1BCO A;  2LX9 A;  1Q86 R;  2COW A;  4F17 A;  3JB9 D;  2FRY A;  5GJW B;  1ZA2 B;  4JRQ A;  2H3E B;  4GY5 A;  2LNV A;  3OYJ A;  1RUW A;  2DM1 A;  3L2U A;  3G71 Q;  2EQU A;  1PC0 A;  1Y96 B;  3HRT A;  3QBY A;  3UAT A;  4HCB A;  4ANJ A;  4OVA A;  3FC3 A;  1WLP B;  1IXD A;  2NUT B;  1X6B A;  3EGD B;  3CQT A;  1ZX6 A;  1WX6 A;  1IO6 A;  1T0H A;  2KAF A;  3SWN A;  1JU5 C;  4FSX A;  3RBB B;  2MWP A;  2YRV A;  2LJ3 A;  1GL5 A;  4C5G A;  1C1A A;  2LCS A;  3TU4 K;  2DA9 A;  3CC2 T;  2Y4X A;  2Y90 A;  3H9N A;  4E7Z A;  1VQ6 T;  4C92 D;  5FLX E;  4AG1 C;  1WXU A;  2YUP A;  1GBQ A;  5CQY A;  3M0P A;  2RQU A;  3LYI A;  4KGV B;  1OX9 A;  4PJO G;  3G6E T;  4JS5 A;  2VXF A;  2J05 A;  2RQR A;  4F7U G;  3PNW C;  4AFQ C;  4J6X A;  3M0T A;  3C0C A;  5IT9 E;  3GBQ A;  1QCN A;  1UGR B;  1UHC A;  1XTD A;  1YHQ Q;  4HCZ A;  2A08 A;  4RUG A;  1PRL C;  2DX1 A;  1M8M A;  3E9F A;  9ATC B;  3TQ7 P;  3HFN A;  1VQ5 Q;  2P0P A;  3BFM A;  1E7O A;  1JEG A;  5GAM h;  2EJF A;  3I9Q A;  2KGT A;  5KYY A;  1RI0 A;  5KYU A;  2CS7 A;  3G1J A;  1R8O B;  1H3Z A;  1QVG S;  5GAM g;  1K73 C;  3CXC A;  5FU7 B;  3I5S A;  1EIF A;  4N0A C;  4EMG A;  3GF5 A;  3J7A F;  2E12 A;  1NEB A;  3C4S A;  1BBZ A;  2GFU A;  2DKG A;  1QVF S;  1JO8 A;  2OAW A;  5GAN 6;  4IUR A;  4EMK C;  2KDS A;  4Q5W A;  1VOM A;  2JNG A;  2BE7 D;  4A4G A;  1UJ0 A;  1YJ9 Q;  4EMK B;  1AZE A;  5DY9 A;  1KC8 U;  1B7T A;  5A0G A;  3A8L B;  2RJE A;  3JB9 H;  1GRI A;  2FHD A;  4CC7 A;  2YWW A;  1ZSZ B;  2EYZ A;  1H3H A;  1VQN T;  4OB3 B;  3U23 A;  1S72 A;  4J9F A;  1FXX A;  5HKC A;  1ZBJ A;  4J9I A;  4LUD A;  4M77 F;  4XTU A;  4JRP A;  3X25 B;  1M9S A;  4PFO A;  3HSB A;  2DJZ A;  1IZ6 A;  3V7R A;  5FRM A;  4JRI A;  1MMN A;  2DL8 A;  2J6O A;  2L5Q A;  3NMZ C;  1GCQ A;  3OB9 A;  2KY9 A;  1VQK A;  1VQ8 T;  1AD5 A;  4MZP A;  3OS2 A;  4N4H A;  1OOT A;  2M0O A;  1AEY A;  2ZZD A;  4CC4 B;  1TXQ A;  4X9D A;  1D09 B;  2KXD A;  4LXC A;  2MK5 A;  4R55 A;  2NUP A;  5KYW B;  3V8J A;  1YJW Q;  4EMH A;  3OYC A;  3RKX A;  1YBY A;  3RNJ A;  1HD3 A;  1K8A C;  1KC8 C;  2DPP B;  3LWH A;  2PVO B;  3CCL T;  2ECZ A;  3CBO A;  1V29 B;  3OYL A;  2GNC A;  1D1B A;  4C92 A;  2RI5 A;  3VS1 A;  4M77 C;  1M30 A;  3F70 A;  2LCC A;  4RG2 A;  1KQS S;  2BIV A;  4M77 B;  2M02 A;  4CRI A;  1BYM A;  3H0F A;  2HSP A;  1M90 U;  2DE0 X;  3PE0 A;  4IIO A;  2DNU A;  1VQM T;  5KYX A;  2GFA A;  2P4T A;  4ZGJ B;  1FMW A;  2DL7 A;  1LNX A;  1PKS A;  1TS9 A;  2YDL A;  5DM7 R;  2KK4 A;  3EGX A;  2EGC A;  3KUF A;  5AYF A;  2LNH B;  2JMC A;  1QLY A;  2DVE A;  2AZS A;  2M0Y A;  4PJL A;  3JCM P;  2LVM A;  1M3B A;  4M7D C;  3EH1 A;  2D0Q B;  3VRY A;  2OI3 A;  1WGS A;  2JJ9 A;  1KG1 A;  1TOV A;  5GAN g;  2QDY B;  4ZTF A;  1Q7Y C;  4BY6 B;  3CC7 Q;  2CP0 A;  4NL2 A;  2QAZ A;  1KHC A; 
#chains in the Genus database with same CATH homology
 2NUP A;  5KYW A;  2NUP B;  2QTV A;  5KYW B;  3EH1 A;  1PD0 A;  1M2V A;  2NUT A;  1M2V B;  2NUT B;  3EFO A;  3EFO B;  3EGD A;  3EGD B;  3EG9 A;  5KYX A;  3EG9 B;  5KYX B;  3EH2 A;  5KYY A;  5KYY B;  5KYN A;  3EGX A;  1PD1 A;  3EGX B;  2YRC A;  2YRD A;  1PCX A;  5KYU A;  1M2O A;  5KYU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...