2YRDA

Solution structure of the zf-sec23_sec24 from human sec23a mutant v69a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
GSSGSSGEPVLCSRTTCRAALNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the zf-Sec23_Sec24 from human Sec23A mutant V69A
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.380 Mainly Beta Roll SH3 type barrels. Zn-finger domain of Sec23/24 2yrdA00
5KYUA 5KYYA 3EG9B 2YRCA 3EGXB 3EGDB 5KYYB 3EFOB 3EG9A 1M2OA 5KYNA 2QTVA 3EH1A 1M2VB 3EFOA 1PD0A 1PCXA 2NUTB 1M2VA 5KYWA 2NUPA 2YRDA 5KYUB 5KYXB 1PD1A 3EH2A 3EGXA 2NUTA 3EGDA 5KYXA 5KYWB 2NUPB
chains in the Genus database with same CATH superfamily
1E6HA 5KYUA 2A08A 3OY9A 3G71Q 2ROTA 2P4RA 1YJNA 5J26A 3EGDB 3SFMA 3OYFA 3CD6T 2OTJQ 1EX4A 1OV3A 2KYMA 2CYZB 2FG0A 2DEQA 1YP5A 1K9MC 5FROA 4RCBA 2RNAA 2ZAEA 1Y07A 1NYFA 3M0SA 2HMAA 3OYGA 4M75C 1K8AC 2ECZA 1SPKA 1T0JA 1PHTA 1CSKA 2QTVA 1WJQA 3EH1A 3FB9A 3GOXA 4RTWA 2RQRA 3WVDB 3ZL7C 4E7JA 2M02A 2QEXA 1VQKQ 2KQWA 1M5Q1 3CC2T 4C92F 3CC4A 4Q5WA 2IPOB 2WSCE 4M7DG 1BI0A 4MZPA 3CCRA 4Z8AA 3JB9G 1YHQT 2QK0A 4PJMA 1Q7YR 2BTTA 1NJIR 2ATCB 2E41A 4C0ZA 4IUUA 1W2BP 1VQLQ 2FPDA 2NUZA 2J6FA 1UJYA 1IO6A 1AWJA 1KQ2A 3MEAA 3NTHA 2FRYA 2KK4A 4C92E 3OYBA 2MYSA 3EHRA 2BZ8A 2F1LA 3H9NA 2DF6A 4C5IA 4GLMA 3WVEB 2EPDA 2DJZA 3META 4DA4A 3O5ZA 1VQ8Q 2OAWA 1KQSS 3LX7A 2O4XB 4JJDA 4IUTA 2LJ0A 1MNDA 1IXDA 3RKXA 4HCBA 4XQ3A 1UFFA 1VIFA 1K9MU 3G71T 2DO3A 2GF7A 1OU9A 2RJDA 1WDXA 3OYCA 1T3LA 2DD5A 3M53A 3RBBB 1CKBA 2HKNA 3I56A 2E65A 3HRSA 1X69A 3KFVA 1S72Q 1KQSA 2CKKA 1UB4A 4AFQC 1X43A 2DXUA 2ROLA 1D3BA 3CCMA 4PJOE 2CP0A 4J9GA 4EIKA 5FU7B 2IG0A 2R57A 3EFSA 3QYGB 4E47A 2D1XA 2RHYA 3M58A 4QQDA 1VQOA 2LX7A 2K5LA 3F70A 1VIEA 4DBHA 2X4JA 3M5AA 3TCJA 3M0UA 1PM3A 3L2QA 4ZN3A 4HT9A 5GAMj 3QIIA 4XU0A 2JXBA 1YHQQ 2LC4A 2DAQA 2GNCA 1FMKA 3OYEA 4NL2A 2XIDA 3CCQQ 4IUPA 2EQIA 1EZZB 1KHIA 4RCCA 1JJ2P 2PQWA 4M78C 2QI2A 4B6MA 4F04B 5LJ5e 1OYXA 3PVLA 1NPRA 3PMTA 5GAOm 2FZCB 2FZKB 2CZ7B 2EIFA 4F7UG 4CI0C 1K73R 1M3BA 5L8RE 2E3IA 1WX6A 4J6XA 4HCCA 3CCST 3MO8A 4BE2A 2LT1A 4JRKA 2O2OA 1NLOC 1X01A 2QQBA 1AOJA 4C8QE 4M75D 1WI7A 4VUBA 1WA7A 3RIRA 3CMAT 3CCLT 2WSEE 4FT2A 1JJ2A 3JB9J 2NUTB 3OA6A 3VUZA 3C4SA 1Q81C 4NL3A 1YBYA 1M3CA 2DZ9A 3E19A 1UEBA 1BBZA 3E9GA 2QA4Q 1W1FA 1GBQA 2CH4W 3BDUA 1VQ6T 1XNIA 3CCJQ 2K3XA 1X27A 3QDRB 1VOMA 1VQ7Q 2HSEB 5CQXA 1QP3A 3A8OB 1G3TA 1I81A 2K3BA 3GIBA 3SWNB 2VKNA 4FM4B 1JXMA 4PKCC 1VQ4A 3MP6A 4F14A 2R58A 2E6ZA 2FL7A 1X6OA 5GAOq 4MMLA 1H3ZA 4PJOF 4J9CA 2L2PA 3CMAQ 3M0PA 3AT1B 2DNUA 2R5MA 2JS0A 5CKDA 2EFIA 3CC2Q 4LDUA 5I11A 2HKQB 4KGVB 1VQMA 1P92A 3CCRQ 4WF2A 1K9MR 5FRNA 2WACA 4LE9A 2HEQA 2D9TA 2RHUA 1JXOA 1S72A 3RMSA 3EFOB 1U3OA 3E9FA 4J9FA 2QA4T 2JOYA 1YJNQ 2QDYB 3JSCA 2X3WD 1ZSZA 4JLGA 3ZBDA 3EGXA 1JEGA 4M77A 1SSFA 1OX8A 3L2UA 2VGMA 3LW5E 1RLQC 1M90R 4Z89A 4XU3A 4J9IA 3HSBA 3QG1A 5CKFA 2FEIA 3H0FA 1Q7YU 1JU5C 4C8QA 3CPFA 3OYKA 5GAN8 5A0LA 3M57A 1TTHB 2BE7D 3FJ5A 3FEOA 4KH0B 3OYNA 2LZ6B 1Q86R 1N9SA 4FIBA 3VS1A 4PJOD 3C94A 3HHTB 2DXCA 4PJOA 1UGSB 4HCZA 2JJ9A 1QVFA 2L89A 2DX1A 1AZGB 4PFZA 5GMKi 2XMFA 1JO8A 4C92C 2QG9B 3Q1JA 4N4IA 4CC3A 1VQ8T 4LDWA 2AK5A 2YLBA 3OS2A 4HXJA 3M54A 1AD5A 5EG2A 5CQYA 3VRZA 4PFPA 3J81E 2EYWA 3L2VA 4C8QB 2EGCA 1VQ8A 2FYKA 1Z9QA 3QPHA 5GAOr 4LD6A 2ZPIB 1OZ3A 3OBYA 3VJPA 4M7AF 2MAMA 3PT9A 2OTLQ 4LN2A 3QBYA 5AYFA 2P4TA 4Y28E 3OW2P 4YTLA 2XDDA 5KYXA 2RD1A 1AHJB 1UECA 1YHQA 4Y91A 3H41A 1VQ4T 3QSUA 1PSFA 1D0YA 1I07A 1K8AU 2HQHA 4FT4A 4PL6A 2MI6A 4GBQA 2VYTA 1GL5A 3MHXA 5D7UA 2PU9B 2YUQA 1MMNA 1NBEB 2HBPA 2YDLA 3SHWA 8AT1B 2LQNA 1QCOA 2CREA 3QO3A 5LL6S 1OPKA 3CD6Q 2J7IA 3BW1A 3JCMb 2JM8A 5GAMd 1CKAA 2RJFA 4WTOB 2L3QA 4DOWA 2FO0A 4AFSC 2RB6A 3PFSA 3CXCS 2LVMA 4OMMA 1BI3A 2PVOB 3HKSA 2J06A 3CBOA 1LPLA 3GF5A 2MPXC 5GAN3 3OYJA 5C0MA 3CCJT 3UDCA 2KMTA 4M7AA 2VASA 1K0SA 1M1KR 2CP6A 1I4K1 4J8OA 3CMAA 3EG1A 2CZ6B 4XTXA 1YWPA 3JB9D 2NUTA 3MEVA 1NLPC 5L23A 5KYYA 4M77D 1YJ9Q 2CGHA 1N27A 1BIAA 2HNIA 1NZ9A 2RJEA 1M2OA 3RKYA 1QWEA 4ME7A 5A0DA 3C12A 1R0CB 5J39A 5LJ3g 4A63B 1VQPQ 2KY9A 1ZLMA 1S1NA 2HQXA 3CC7T 2V8KA 1YJWA 2LNVA 1O9SA 2QA4A 2LDMA 1WNLA 1H8KA 3GP8A 1U1TA 2KNBB 2A7YA 2LQKA 3OYYA 4A54A 4J7FA 2GQIA 3CCLA 4M75B 1AWXA 4OMQA 4C0FA 1N6AA 3EAEA 1QVFP 1K73U 1ZA1B 1OI1A 4ZTJA 4EMKC 1RAEB 2IIMA 4N0AC 5I22A 2BKDN 2ZPGB 1WXBA 1V29B 2P0QA 1F1BB 4QVCA 1SRMA 4F7UE 2JTMA 3SD4A 2O01E 2GFUA 1WIEA 1ZQ1A 2QQAA 3U23A 1D09B 2ZPEB 4TVRA 1WHJA 4BDYA 1VQ5Q 1QKXA 3CCMT 1K8AR 3TU4K 3M0RA 2DK3A 5LJ5f 1TU0B 2PUOB 1Y71A 1U5SA 4HCKA 3RMQA 2KRMA 2C0TA 1VQ5T 5DY9A 4OB3B 1BCMA 3RKWA 4RTYA 2RHIA 4LXCA 2QQ9A 3FIFA 5GAN2 1PRMC 2F5KA 4CC2A 1SHGA 3UWNA 1OQKA 1TUDA 5CR2A 4C5GA 4M75E 8ATCB 1X2QA 4PLLA 4BE0A 2PZ1A 2D0QB 2QGGA 2WSFE 3VV0A 1WFWA 5KYXB 2K5FA 1QVGA 3LWHA 2JW4A 4JJCA 3G71A 2VV5A 2ZPBB 2QEXQ 4XU2A 2AIRB 3VYHB 1KG1A 4E6RA 2VB6A 3PIOA 3H0HA 1ZUUA 1N8RR 4BACA 4BY6C 2DL3A 1X6BA 4EMKA 2OAUA 1KD1R 2EQUA 4N4GA 3G6EA 3EG0A 4QW2A 1W6XA 4L6V5 5FLXE 1OX9A 1SSHA 2BIVA 3S6WA 1VYVA 2FPEA 2DL8A 5FU6B 3C0CA 2V8JA 3G4SQ 3CCQA 1VQPA 5GAOl 1KC8U 1M3AA 2MOXA 1OZ2A 2OTLT 5EC7A 3VUBA 5HY6A 1E6GA 2D6FA 2EGEA 2ESWA 3LYIA 5GJWB 2RJCA 4RG8A 2XHCA 1VQ4Q 3I5SA 4J7IA 5KE3A 2E4HA 5HCKA 3OS0A 1J3TA 5LJ3j 3VYGA 5I21A 3NPFA 1BYMA 1YI2Q 4BD3A 4BI8B 1N8RC 3RNJA 1YJ9T 1HSQA 5DM7R 2XK0A 1G8XA 2MCNA 2KT8A 5LJ5h 3NTKA 2SEMA 1VQNA 1LOJA 5FWBA 3CD6A 1G3SA 2DTHA 4FSSA 1X75C 1KQSP 2K3YA 4OGCA 2EW3A 2DM1A 2BUDA 1RUWA 1W70A 4J5YA 4OVAA 1G3WA 3H8ZA 2G3RA 4JRQA 4OB2B 4R0KA 1UHFA 2XI9A 1D3BB 2J6KA 2AZSA 2P0PA 2KROA 4LDYA 3INZA 2P0KA 2CT4A 1G3YA 2GGRA 3JCMP 2A36A 1JQQA 1BIBA 4HVUA 2QXFA 4X9CA 1MMDA 3DKMA 3JCMd 2YUPA 4NS5A 5CVIA 4F7UF 1M30A 1YJWQ 2VWFA 3JRZA 2CUBA 1PWTA 2RQVA 3OW2A 5CCAA 4A53A 1WHKA 5HK0A 3VS3A 3OYDA 2O4XA 2DXBA 2LT4A 1WJRA 3RDVA 1VA7A 1BKBA 4M78F 3VS7A 1RAFB 2X3XD 3HRTA 1MMGA 3UA6A 4IIOA 3QKJA 4QKUA 5GANf 3VS5A 4DBFA 1VQOQ 1WQ7A 2Y90A 3C95A 2COZA 5GANh 3MEUA 3OMCA 4OB1B 2AKLA 3HTRA 2XDPA 1MV0B 2E5KA 2X4XA 2OTLA 1LCKA 4OMLA 1OPLA 5CKHA 1D1BA 3MP8A 3MPUB 4KULA 3MKDA 1C0MA 4ZGDB 3JCMJ 3M56A 1R0BG 4R56A 4RTZA 1DJ7B 2DRKA 3E1SA 4J6WA 4E7KA 3BFMA 1OULA 4AFZC 5LJ5g 1QVGS 1ARKA 3DLLA 3JB9F 5GMKj 2JNGA 4PK4A 2CT3A 1UE9A 3NGPA 1TUGB 2JTEA 3MCAB 1TSFA 4AG1C 3RUXA 1VQNT 2DZCA 4BI3A 3N5BB 2EKHA 1M8VA 2Y4XA 2H3JA 5GMKm 1ZSZC 4XTZA 1RAIB 1UTIA 3CCMQ 2LCCA 1N9RA 2BE9B 3EFOA 1VQLA 1E7OA 3CC7A 3GLXA 3EFRA 3JCMg 3CC4T 3RR6A 1XJWB 2E10A 3NHNA 3NTIA 3QHSA 5I2MA 2MK5A 1VQMQ 1Q81R 2H3EB 4D8KA 4HVVA 1RADB 3CC4Q 2V1QA 3QZ9B 2KRSA 3X25B 3AHUA 3UPUA 1C1AA 1PSEA 4OGEA 4KH1B 2LP5A 3M9QA 2JMAA 2JUFA 3CCVT 4PFOA 3L1AA 1WJSA 1NJIC 1GRIA 3LGFA 2V8IA 4B9WA 3RERA 1M1GA 2HQEA 5J3BA 3X20B 5KYNA 4QVDA 5GAMh 1M2VB 4M78G 3MEWA 4NOYA 1Q7YC 1D0XA 2F2WA 3JCMW 2Z0WA 2AKKA 1NG2A 1KHCA 2E3HA 1ZUKA 2NWMA 2I0NA 5GJVB 2L3RA 2DA9A 2OTJA 2GQVA 1NE8A 2VUBA 2RA2A 1K4US 2K57A 4LUDA 2DKGA 2HSPA 2BZXA 3CCRT 1K0XA 3A8HB 1QWFA 3A98A 3CBMA 4B9XA 1WQWA 4E7HA 1VYTA 3I5RA 4Z88A 1IGQA 2RK1A 2O9SA 1VQ9A 2E12A 3CMEA 4RTTA 2KDSA 3P8BB 4PJLA 2LCSA 4JJBA 2M0OA 3FLGA 2C0IA 2DBMA 2GCXA 2O88A 2FHDA 3H6ZA 2YRDA 1NYGA 2DIQA 2EVRA 1B7TA 4J9BA 5GAOp 3CQTA 1YITT 2DL7A 3X28B 2B8AA 4C8QG 3CPWS 1YI2A 1FX7A 1QVFS 3J7AF 1QQJA 2DETA 2LCLA 1HJDA 3PVQA 4XTVA 3URGA 1Q86U 4FYWB 2QQRA 2M51A 2FB7A 1ZHIA 1EFNA 2RHXA 4C8QC 5CK9A 1HXDA 4DQ2A 5M9OA 3JV3A 1UGPB 1Q82C 1LJOA 3BE3A 2L0AA 2DLPA 4M78A 2COYA 4JPBW 2EJ9A 1H3HA 1JB0E 2ZGWA 1RACB 3OYIA 1U1SA 1IB8A 4M75F 1I8FA 1XQHA 3M0TA 4JJNK 2EYZA 2EQJA 2GTJA 1U06A 2QASA 3OSSC 2M1HA 4ESRA 2AZVA 2DVJA 5CKBA 3VS0A 4M77G 2CS7A 2FZGB 4D8DA 4AT1B 4QVZA 5KE2A 3UT1A 2E6NA 3G7ZA 3HFOA 1NM7A 1FWZA 3HFNA 5LJ5j 4M7DD 1B07A 4IURA 1RI0A 1GCPA 1W4SA 5D6WA 4LD9K 3VRYA 5GAMe 1K76A 2HL5C 1VQ6A 1BI2A 4M7AD 1Z9ZA 4F16A 3CCUT 2M16A 1PRLC 5GANe 3VS2A 4MDWA 2GBQA 2GTOA 1SEMA 2C0OA 1M9SA 3PNWC 1I5LA 4RUGA 4C92G 4ATOA 3OMGA 2E1HA 4FU6A 1ZA2B 2QQSA 2JM9A 1QCFA 1Y7XA 2KRNA 4OP0A 1UHCA 1WHMA 1G2BA 3QWXX 2GFAA 2LTOA 2A28A 2SRCA 1AWOA 4C0DC 2CP5A 4M77B 1H641 1VQLT 1V1CA 5GAN7 2H8HA 4MZMA 5A2QE 3V7SA 1IREB 2OJ2A 4IIMA 3TREA 2M0YA 2CSQA 2RI5A 3S3MA 3SEMA 2DILA 1Q95G 1I5OB 2XU8A 5GMKl 4JDSA 1PCXA 5LJ3h 3ER0A 3SDZA 2LQWA 2O31A 1UDLA 3CCSQ 1VQKT 2OX7A 2RH2A 3GNFB 4C0GA 4ZGJB 5GAMg 4MDXA 4F17A 2X4YA 3CC2A 1A0NB 2CP3A 3MP1A 1SHFA 5D6XA 4A4HA 2QAZA 2EAYA 2K4YA 4KT0E 3CC7Q 3OB9A 4X34A 4LNPA 2B86A 3OYMA 3G4ST 1GCQC 2K2MA 2PVGB 1QCNA 2W0ZA 2DL4A 2HZYA 2FPFA 3V8JA 1NEBA 1LVKA 1I0CA 1WHHA 2EYXA 4JRIA 3CCEQ 4J9HA 2VVKA 4PLIA 1VQ7A 2KBTA 2K7AA 4OMNA 3SWNC 3QYHB 4AFUC 1YCSB 2OI3A 3CCJA 2EWNA 3JCMh 5IT9E 4GLKA 5IHIA 1WLPB 4PJNA 2KSSA 2IVWA 3CEYA 3LH5A 3HRUA 3CMET 2ZPFB 3ME9A 2F5TX 2QGFB 2F2XA 4ANJA 5DLOA 1ZSGA 6AT1B 4KUIA 2RK2A 1Q82R 1KC8R 4ELZC 4IUQA 2HDAA 1BU1A 3ZEHA 3FC3A 3H0IA 5KYWA 3I55A 1SF9A 1AEYA 1FYNA 2JVVA 4E2FB 2DIGA 5GAOn 2Y4YA 1O75A 3KUFA 4KUDK 1IRXA 1S72T 4D6WA 3CCQT 2OTJT 1RABB 4CRIA 1NPPA 2MWPA 3EGXB 2X4WA 1YITA 2A0FB 1BB9A 3P8DA 9ATCB 5GANg 4RTUA 1VQOT 1N8RU 4MMKA 5GAN6 1Q82U 4X1VA 3JCMX 3BY7A 3L2WA 3A1PA 2MMPA 5LJ3f 2KXCA 2NYSA 3GPLA 4DBRA 3V7CA 1VQ9T 1XOVA 1KD1C 1OOTA 2XDBA 3V7RA 3OBWA 4IKFA 2G6FX 4ZGEB 5KYYB 4M7AE 3CCSA 3THKA 3I55T 4OMFB 1KD1U 3HP9A 1ZX6A 2COWA 2PVDB 3QUIA 2KYBA 1SKUB 4A4EA 5I2SA 1KC8C 1M1KU 3S3NA 4EPCA 1YJ9A 1PD1A 4RKUE 2NUPB 3JCMV 2DRMA 4M75G 4JRPA 2D8HA 2CH4A 2EJFA 5LJ3e 2C06A 4M7DC 1RL2A 1VQ6Q 4JZ3A 1IHWA 5HKCA 2HCKA 3MJXA 2CDTA 2L3SA 1HK9A 2RF0A 1ZUYA 1PD0A 2KXDA 2BZYA 4N4HA 2RMOA 4LDXA 4FL6A 3J80E 2CP7A 3FJPA 3OYLA 2PUKB 1YI2T 4M7DF 5KYWB 2EJGA 4DOVA 3JCMf 2MF2A 4M75A 2DL5A 2ENMA 4BE1A 3X24B 5DLQE 4X9DA 4OB0B 1VYUA 4XU1A 2J6OA 4FYYB 4AMCA 1AVZC 2K6DA 1GFDA 4O6JA 3LGLA 4C0DB 2LX9A 2NLUA 3EHQA 4OMOA 4E7LA 4FYXB 3OSVA 4F7UB 1D1CA 1IHVA 2CSIA 3GNGA 3JCMe 2VXFA 3VS4A 3OYHA 2K9GA 2V1RA 4BB7A 5GANd 1JBMA 2M9UA 1VUBA 3QWYA 4DEXA 3TQ7P 2KT1A 2DTIA 5GMKe 4RTXA 1X2KA 1NJIU 1QP2A 1D1AA 4L5GA 5AT1B 4EMKB 1M1FA 3KXTA 1UGRB 4J9EA 5C6SA 1VQNQ 1WYXA 3LH0A 4M7AB 1NEGA 1YIJQ 1KK7A 1K73C 4KBMB 3L42A 1ZBXA 2DMOA 2A37A 4A4KA 4WCIA 5FW9A 1VQ5A 2X35A 1EIFA 1VQMT 4C8QF 4BDZA 5CAIA 4E7IA 3PIPA 2KE9A 5IH2A 4F7UA 3OS1A 4Y92A 4RMOA 4HT8A 3NMZC 4M4ZA 1QLYA 5FU7C 3OQ5A 2CUDA 2RHZA 2KAFA 1MNEA 2DD4A 1Q81U 4M7DB 1RLPC 3CCET 4CC4B 2KGTA 4XK8E 2HD0A 1PNJA 2ABLA 3G4SA 4QQ6A 2LJ3A 2EQMA 4LDVA 3DB4A 5IHKA 1MMAA 2DERA 3OW2S 1MGQA 4HKEA 4M7AG 1T0HA 2CP2A 1GBRA 4ELYC 2O9VA 1GFCA 1R8OB 3P8HA 3REAB 5CO7A 4M78D 3REBB 1QMCA 4ZN1A 3I55Q 2HBWA 3EH2A 2KVQG 4M7AC 1FXXA 2PNIA 3JAME 5A0GA 4ZTFA 2EKOA 1ABQA 3R6OA 3SB2A 4BUGA 1PKTA 2RN8A 3M0QA 1UG1A 1UUEA 1LNXA 2RM4A 1YIJA 2JTFA 2LMJA 2YLCA 3QJYA 4EDUA 3CCUQ 1KJWA 1BCOA 2K2VA 1HD3A 1VQ7T 1IZ6A 1WGSA 4II1A 4XTWA 2DXTA 3D7SB 4UC4A 3WXMB 1KIKA 3TSZA 1D0ZA 1RAAB 2K5IA 3CXCP 1V76A 4HVWA 3G6EQ 1KQ1A 4PJJA 1OU8A 3S3OA 1M4ZA 3UF4A 4L59A 2LNHB 4EMGA 4OF1A 3CCEA 4J83A 3JCMQ 1YITQ 1UGVA 1TWBA 5GAN4 2V26A 4JS4A 1ZSZB 2E64A 2QTXA 4KGZB 3CXCA 3CBPA 3EG9B 2FRWA 4HA8A 5FRMA 2DYBA 3X26B 4E7SA 2XD0A 2W10A 4XTUA 4J9DA 1Y96B 4RTVA 2I2LA 1WHLA 3PTAA 2ZPHB 4K11A 5GANj 3QDFA 4M77F 2X9HA 4JLIA 3V8LA 1Q86C 1SRLA 2DBKA 1YJNT 3R6NA 4C92B 2DEUA 3RESA 1BK2A 4CC7A 3HPWA 3A8MB 2LJ1A 3M59A 1WHGA 1KSWA 1U8RA 1JJ2S 4EMHA 1MHNA 4N0AA 3TVTA 1MUZA 1MV3A 2VC8A 2JZ2A 1YFNA 2XKOC 2YXYA 2DYIA 3NFCA 2EQKA 4C92A 2X51A 3A8GB 1OEBA 3G1JA 5GMKh 3IQLA 5GAN5 2DE0X 1PC0A 1H92A 1Y0MA 1VQKA 2YRCA 1B3QA 1PKSA 4PJOC 4O5VA 3CPWA 1QVPA 4C5HA 4M7DE 4PNOA 4QT7A 2DVEA 4ORZA 3CCLQ 2HAXA 1BI1A 1K1ZA 1R77A 4FSXA 4IUVA 5KYUB 4PJOG 2KI7A 4FCYA 1TOVA 1XTDA 1C6VX 3CCUA 2RI2A 5KCOA 4V2SA 4BI4A 2F2VA 1RI9A 2YRVA 3I56Q 2CZ1B 4KGXB 1QKWA 5GAMf 4M78B 4M77C 3VS6A 7AT1B 5KCHA 1ACMB 1QVGP 3A8LB 3DLMA 2ED0A 2L5QA 4J6YA 4MZTA 1K9AA 1YNZA 4JZ4A 5ECAA 4DBQA 3VU3C 1RAHB 4XAXB 1FMWA 2CZ0B 3A5ZB 4OMPA 2EYYA 3CPWP 3TEEA 2AHJB 4LUEA 1G5VA 2YUNA 3T9NA 2LQ8A 2LRQA 5HK3A 2RO0A 3QXEB 3EG2A 1I1JA 2YSQA 3JB9H 3UA7A 3CCVQ 1AWWA 3VKIA 1WXTA 3SWNA 3FRNA 2QEXT 4Z02A 5FU6C 3OYAA 2YWWA 1M1KC 2YT6A 4GY5A 5IXFA 4C8QD 2F69A 2D8JA 5LJ5d 5IXBA 1ABOA 3ASKA 2E70A 4E7ZA 1TUCA 4FW1A 3M55A 4M78E 2L8DA 4ZNXA 2QDLA 1JRIA 3I56T 5KH6A 1GCQA 1B34B 2JT4A 2P84A 4C5EA 1RAGB 3KBGA 3O8VA 2PTKA 1W2BA 1ZBJA 2XG8D 4C92D 3M4YA 1TXQA 2RQWA 2VGNA 3FDRA 4P5NA 4M7DA 1YCYA 1YJWT 4JUVA 1TH7A 1G83A 3BDLA 5IN1A 2JN0A 4RG2A 5FWCA 1M8MA 2VXEA 2ZZDA 2A3LA 1M2VA 1YN8A 2RI3A 1AT1B 3PE0A 2KEAA 3JB9I 3UATA 4R55A 2EBPA 3EGDA 1X6GA 2R5AA 2HL3A 4QQGA 2YUOA 3ZFJA 1M90C 2RPNA 2J05A 4AG2C 5CIUA 1Y96A 2DPPB 1M27C 1SG5A 3G6ET 3I35A 3DB3A 4A4FA 2JS2A 1Y57A 2D0NA 4JS5A 4M77E 2NUPA 2DJQA 3EG3A 3L2RA 2L3PA 3LWIA 2MWOA 1KFZA 2K79A 1M90U 1VQPT 1TG0A 4BY6B 3E2UA 3PGGA 2RQTA 4KRTA 3LLRA 1W2BS 2ED1A 1AZEA 1GXIE 2DFUA 1QW1A 3EGUA 1YWOA 2ZCFB 1PG5B 1IGUA 2KR3A 1N5ZA 4DEYA 1HYOA 1TS9A 3V8KA 1T3SA 5CKEA 2EYQA 2RQUA 1UJ0A 1WZOA 3GBQA 1B34A 5LJ3d 1WXUA 4FW2A 3JCMc 2QYZA 3M4GA 3CCVA 5IAYA 4FYVB 4A4GA 3L2ZA 5D6YA 2EGAA 4PJOB 3I9QA 3EG9A 3ULRB 3HL8A 1UGQB 1VQ9Q 3QJ6A 1WPYA 2FVUA 2JMCA 1FMVA 4XTYA 2YHTA 3PMIA 3OS5A 2MIOA 3TSWA 2XICA 3CMEQ 1YIJT 3QZ5B 2AT1B 2DTOA 5IHNA 2E5QA
chains in the Genus database with same CATH topology
5KYUA 5KYYA 3EG9B 2YRCA 3EGXB 3EGDB 5KYYB 3EFOB 3EG9A 1M2OA 5KYNA 2QTVA 3EH1A 1M2VB 3EFOA 1PD0A 1PCXA 2NUTB 1M2VA 5KYWA 2NUPA 2YRDA 5KYUB 5KYXB 1PD1A 3EH2A 3EGXA 2NUTA 3EGDA 5KYXA 5KYWB 2NUPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYU A;  5KYY A;  3EG9 B;  2YRC A;  3EGX B;  3EGD B;  5KYY B;  3EFO B;  3EG9 A;  1M2O A;  5KYN A;  2QTV A;  3EH1 A;  1M2V B;  3EFO A;  1PD0 A;  1PCX A;  2NUT B;  1M2V A;  5KYW A;  2NUP A;  2YRD A;  5KYU B;  5KYX B;  1PD1 A;  3EH2 A;  3EGX A;  2NUT A;  3EGD A;  5KYX A;  5KYW B;  2NUP B; 
#chains in the Genus database with same CATH topology
 1E6H A;  5KYU A;  2A08 A;  3OY9 A;  3G71 Q;  2ROT A;  2P4R A;  1YJN A;  5J26 A;  3EGD B;  3SFM A;  3OYF A;  3CD6 T;  2OTJ Q;  1EX4 A;  1OV3 A;  2KYM A;  2CYZ B;  2FG0 A;  2DEQ A;  1YP5 A;  1K9M C;  5FRO A;  4RCB A;  2RNA A;  2ZAE A;  1Y07 A;  1NYF A;  3M0S A;  2HMA A;  3OYG A;  4M75 C;  1K8A C;  2ECZ A;  1SPK A;  1T0J A;  1PHT A;  1CSK A;  2QTV A;  1WJQ A;  3EH1 A;  3FB9 A;  3GOX A;  4RTW A;  2RQR A;  3WVD B;  3ZL7 C;  4E7J A;  2M02 A;  2QEX A;  1VQK Q;  2KQW A;  1M5Q 1;  3CC2 T;  4C92 F;  3CC4 A;  4Q5W A;  2IPO B;  2WSC E;  4M7D G;  1BI0 A;  4MZP A;  3CCR A;  4Z8A A;  3JB9 G;  1YHQ T;  2QK0 A;  4PJM A;  1Q7Y R;  2BTT A;  1NJI R;  2ATC B;  2E41 A;  4C0Z A;  4IUU A;  1W2B P;  1VQL Q;  2FPD A;  2NUZ A;  2J6F A;  1UJY A;  1IO6 A;  1AWJ A;  1KQ2 A;  3MEA A;  3NTH A;  2FRY A;  2KK4 A;  4C92 E;  3OYB A;  2MYS A;  3EHR A;  2BZ8 A;  2F1L A;  3H9N A;  2DF6 A;  4C5I A;  4GLM A;  3WVE B;  2EPD A;  2DJZ A;  3MET A;  4DA4 A;  3O5Z A;  1VQ8 Q;  2OAW A;  1KQS S;  3LX7 A;  2O4X B;  4JJD A;  4IUT A;  2LJ0 A;  1MND A;  1IXD A;  3RKX A;  4HCB A;  4XQ3 A;  1UFF A;  1VIF A;  1K9M U;  3G71 T;  2DO3 A;  2GF7 A;  1OU9 A;  2RJD A;  1WDX A;  3OYC A;  1T3L A;  2DD5 A;  3M53 A;  3RBB B;  1CKB A;  2HKN A;  3I56 A;  2E65 A;  3HRS A;  1X69 A;  3KFV A;  1S72 Q;  1KQS A;  2CKK A;  1UB4 A;  4AFQ C;  1X43 A;  2DXU A;  2ROL A;  1D3B A;  3CCM A;  4PJO E;  2CP0 A;  4J9G A;  4EIK A;  5FU7 B;  2IG0 A;  2R57 A;  3EFS A;  3QYG B;  4E47 A;  2D1X A;  2RHY A;  3M58 A;  4QQD A;  1VQO A;  2LX7 A;  2K5L A;  3F70 A;  1VIE A;  4DBH A;  2X4J A;  3M5A A;  3TCJ A;  3M0U A;  1PM3 A;  3L2Q A;  4ZN3 A;  4HT9 A;  5GAM j;  3QII A;  4XU0 A;  2JXB A;  1YHQ Q;  2LC4 A;  2DAQ A;  2GNC A;  1FMK A;  3OYE A;  4NL2 A;  2XID A;  3CCQ Q;  4IUP A;  2EQI A;  1EZZ B;  1KHI A;  4RCC A;  1JJ2 P;  2PQW A;  4M78 C;  2QI2 A;  4B6M A;  4F04 B;  5LJ5 e;  1OYX A;  3PVL A;  1NPR A;  3PMT A;  5GAO m;  2FZC B;  2FZK B;  2CZ7 B;  2EIF A;  4F7U G;  4CI0 C;  1K73 R;  1M3B A;  5L8R E;  2E3I A;  1WX6 A;  4J6X A;  4HCC A;  3CCS T;  3MO8 A;  4BE2 A;  2LT1 A;  4JRK A;  2O2O A;  1NLO C;  1X01 A;  2QQB A;  1AOJ A;  4C8Q E;  4M75 D;  1WI7 A;  4VUB A;  1WA7 A;  3RIR A;  3CMA T;  3CCL T;  2WSE E;  4FT2 A;  1JJ2 A;  3JB9 J;  2NUT B;  3OA6 A;  3VUZ A;  3C4S A;  1Q81 C;  4NL3 A;  1YBY A;  1M3C A;  2DZ9 A;  3E19 A;  1UEB A;  1BBZ A;  3E9G A;  2QA4 Q;  1W1F A;  1GBQ A;  2CH4 W;  3BDU A;  1VQ6 T;  1XNI A;  3CCJ Q;  2K3X A;  1X27 A;  3QDR B;  1VOM A;  1VQ7 Q;  2HSE B;  5CQX A;  1QP3 A;  3A8O B;  1G3T A;  1I81 A;  2K3B A;  3GIB A;  3SWN B;  2VKN A;  4FM4 B;  1JXM A;  4PKC C;  1VQ4 A;  3MP6 A;  4F14 A;  2R58 A;  2E6Z A;  2FL7 A;  1X6O A;  5GAO q;  4MML A;  1H3Z A;  4PJO F;  4J9C A;  2L2P A;  3CMA Q;  3M0P A;  3AT1 B;  2DNU A;  2R5M A;  2JS0 A;  5CKD A;  2EFI A;  3CC2 Q;  4LDU A;  5I11 A;  2HKQ B;  4KGV B;  1VQM A;  1P92 A;  3CCR Q;  4WF2 A;  1K9M R;  5FRN A;  2WAC A;  4LE9 A;  2HEQ A;  2D9T A;  2RHU A;  1JXO A;  1S72 A;  3RMS A;  3EFO B;  1U3O A;  3E9F A;  4J9F A;  2QA4 T;  2JOY A;  1YJN Q;  2QDY B;  3JSC A;  2X3W D;  1ZSZ A;  4JLG A;  3ZBD A;  3EGX A;  1JEG A;  4M77 A;  1SSF A;  1OX8 A;  3L2U A;  2VGM A;  3LW5 E;  1RLQ C;  1M90 R;  4Z89 A;  4XU3 A;  4J9I A;  3HSB A;  3QG1 A;  5CKF A;  2FEI A;  3H0F A;  1Q7Y U;  1JU5 C;  4C8Q A;  3CPF A;  3OYK A;  5GAN 8;  5A0L A;  3M57 A;  1TTH B;  2BE7 D;  3FJ5 A;  3FEO A;  4KH0 B;  3OYN A;  2LZ6 B;  1Q86 R;  1N9S A;  4FIB A;  3VS1 A;  4PJO D;  3C94 A;  3HHT B;  2DXC A;  4PJO A;  1UGS B;  4HCZ A;  2JJ9 A;  1QVF A;  2L89 A;  2DX1 A;  1AZG B;  4PFZ A;  5GMK i;  2XMF A;  1JO8 A;  4C92 C;  2QG9 B;  3Q1J A;  4N4I A;  4CC3 A;  1VQ8 T;  4LDW A;  2AK5 A;  2YLB A;  3OS2 A;  4HXJ A;  3M54 A;  1AD5 A;  5EG2 A;  5CQY A;  3VRZ A;  4PFP A;  3J81 E;  2EYW A;  3L2V A;  4C8Q B;  2EGC A;  1VQ8 A;  2FYK A;  1Z9Q A;  3QPH A;  5GAO r;  4LD6 A;  2ZPI B;  1OZ3 A;  3OBY A;  3VJP A;  4M7A F;  2MAM A;  3PT9 A;  2OTL Q;  4LN2 A;  3QBY A;  5AYF A;  2P4T A;  4Y28 E;  3OW2 P;  4YTL A;  2XDD A;  5KYX A;  2RD1 A;  1AHJ B;  1UEC A;  1YHQ A;  4Y91 A;  3H41 A;  1VQ4 T;  3QSU A;  1PSF A;  1D0Y A;  1I07 A;  1K8A U;  2HQH A;  4FT4 A;  4PL6 A;  2MI6 A;  4GBQ A;  2VYT A;  1GL5 A;  3MHX A;  5D7U A;  2PU9 B;  2YUQ A;  1MMN A;  1NBE B;  2HBP A;  2YDL A;  3SHW A;  8AT1 B;  2LQN A;  1QCO A;  2CRE A;  3QO3 A;  5LL6 S;  1OPK A;  3CD6 Q;  2J7I A;  3BW1 A;  3JCM b;  2JM8 A;  5GAM d;  1CKA A;  2RJF A;  4WTO B;  2L3Q A;  4DOW A;  2FO0 A;  4AFS C;  2RB6 A;  3PFS A;  3CXC S;  2LVM A;  4OMM A;  1BI3 A;  2PVO B;  3HKS A;  2J06 A;  3CBO A;  1LPL A;  3GF5 A;  2MPX C;  5GAN 3;  3OYJ A;  5C0M A;  3CCJ T;  3UDC A;  2KMT A;  4M7A A;  2VAS A;  1K0S A;  1M1K R;  2CP6 A;  1I4K 1;  4J8O A;  3CMA A;  3EG1 A;  2CZ6 B;  4XTX A;  1YWP A;  3JB9 D;  2NUT A;  3MEV A;  1NLP C;  5L23 A;  5KYY A;  4M77 D;  1YJ9 Q;  2CGH A;  1N27 A;  1BIA A;  2HNI A;  1NZ9 A;  2RJE A;  1M2O A;  3RKY A;  1QWE A;  4ME7 A;  5A0D A;  3C12 A;  1R0C B;  5J39 A;  5LJ3 g;  4A63 B;  1VQP Q;  2KY9 A;  1ZLM A;  1S1N A;  2HQX A;  3CC7 T;  2V8K A;  1YJW A;  2LNV A;  1O9S A;  2QA4 A;  2LDM A;  1WNL A;  1H8K A;  3GP8 A;  1U1T A;  2KNB B;  2A7Y A;  2LQK A;  3OYY A;  4A54 A;  4J7F A;  2GQI A;  3CCL A;  4M75 B;  1AWX A;  4OMQ A;  4C0F A;  1N6A A;  3EAE A;  1QVF P;  1K73 U;  1ZA1 B;  1OI1 A;  4ZTJ A;  4EMK C;  1RAE B;  2IIM A;  4N0A C;  5I22 A;  2BKD N;  2ZPG B;  1WXB A;  1V29 B;  2P0Q A;  1F1B B;  4QVC A;  1SRM A;  4F7U E;  2JTM A;  3SD4 A;  2O01 E;  2GFU A;  1WIE A;  1ZQ1 A;  2QQA A;  3U23 A;  1D09 B;  2ZPE B;  4TVR A;  1WHJ A;  4BDY A;  1VQ5 Q;  1QKX A;  3CCM T;  1K8A R;  3TU4 K;  3M0R A;  2DK3 A;  5LJ5 f;  1TU0 B;  2PUO B;  1Y71 A;  1U5S A;  4HCK A;  3RMQ A;  2KRM A;  2C0T A;  1VQ5 T;  5DY9 A;  4OB3 B;  1BCM A;  3RKW A;  4RTY A;  2RHI A;  4LXC A;  2QQ9 A;  3FIF A;  5GAN 2;  1PRM C;  2F5K A;  4CC2 A;  1SHG A;  3UWN A;  1OQK A;  1TUD A;  5CR2 A;  4C5G A;  4M75 E;  8ATC B;  1X2Q A;  4PLL A;  4BE0 A;  2PZ1 A;  2D0Q B;  2QGG A;  2WSF E;  3VV0 A;  1WFW A;  5KYX B;  2K5F A;  1QVG A;  3LWH A;  2JW4 A;  4JJC A;  3G71 A;  2VV5 A;  2ZPB B;  2QEX Q;  4XU2 A;  2AIR B;  3VYH B;  1KG1 A;  4E6R A;  2VB6 A;  3PIO A;  3H0H A;  1ZUU A;  1N8R R;  4BAC A;  4BY6 C;  2DL3 A;  1X6B A;  4EMK A;  2OAU A;  1KD1 R;  2EQU A;  4N4G A;  3G6E A;  3EG0 A;  4QW2 A;  1W6X A;  4L6V 5;  5FLX E;  1OX9 A;  1SSH A;  2BIV A;  3S6W A;  1VYV A;  2FPE A;  2DL8 A;  5FU6 B;  3C0C A;  2V8J A;  3G4S Q;  3CCQ A;  1VQP A;  5GAO l;  1KC8 U;  1M3A A;  2MOX A;  1OZ2 A;  2OTL T;  5EC7 A;  3VUB A;  5HY6 A;  1E6G A;  2D6F A;  2EGE A;  2ESW A;  3LYI A;  5GJW B;  2RJC A;  4RG8 A;  2XHC A;  1VQ4 Q;  3I5S A;  4J7I A;  5KE3 A;  2E4H A;  5HCK A;  3OS0 A;  1J3T A;  5LJ3 j;  3VYG A;  5I21 A;  3NPF A;  1BYM A;  1YI2 Q;  4BD3 A;  4BI8 B;  1N8R C;  3RNJ A;  1YJ9 T;  1HSQ A;  5DM7 R;  2XK0 A;  1G8X A;  2MCN A;  2KT8 A;  5LJ5 h;  3NTK A;  2SEM A;  1VQN A;  1LOJ A;  5FWB A;  3CD6 A;  1G3S A;  2DTH A;  4FSS A;  1X75 C;  1KQS P;  2K3Y A;  4OGC A;  2EW3 A;  2DM1 A;  2BUD A;  1RUW A;  1W70 A;  4J5Y A;  4OVA A;  1G3W A;  3H8Z A;  2G3R A;  4JRQ A;  4OB2 B;  4R0K A;  1UHF A;  2XI9 A;  1D3B B;  2J6K A;  2AZS A;  2P0P A;  2KRO A;  4LDY A;  3INZ A;  2P0K A;  2CT4 A;  1G3Y A;  2GGR A;  3JCM P;  2A36 A;  1JQQ A;  1BIB A;  4HVU A;  2QXF A;  4X9C A;  1MMD A;  3DKM A;  3JCM d;  2YUP A;  4NS5 A;  5CVI A;  4F7U F;  1M30 A;  1YJW Q;  2VWF A;  3JRZ A;  2CUB A;  1PWT A;  2RQV A;  3OW2 A;  5CCA A;  4A53 A;  1WHK A;  5HK0 A;  3VS3 A;  3OYD A;  2O4X A;  2DXB A;  2LT4 A;  1WJR A;  3RDV A;  1VA7 A;  1BKB A;  4M78 F;  3VS7 A;  1RAF B;  2X3X D;  3HRT A;  1MMG A;  3UA6 A;  4IIO A;  3QKJ A;  4QKU A;  5GAN f;  3VS5 A;  4DBF A;  1VQO Q;  1WQ7 A;  2Y90 A;  3C95 A;  2COZ A;  5GAN h;  3MEU A;  3OMC A;  4OB1 B;  2AKL A;  3HTR A;  2XDP A;  1MV0 B;  2E5K A;  2X4X A;  2OTL A;  1LCK A;  4OML A;  1OPL A;  5CKH A;  1D1B A;  3MP8 A;  3MPU B;  4KUL A;  3MKD A;  1C0M A;  4ZGD B;  3JCM J;  3M56 A;  1R0B G;  4R56 A;  4RTZ A;  1DJ7 B;  2DRK A;  3E1S A;  4J6W A;  4E7K A;  3BFM A;  1OUL A;  4AFZ C;  5LJ5 g;  1QVG S;  1ARK A;  3DLL A;  3JB9 F;  5GMK j;  2JNG A;  4PK4 A;  2CT3 A;  1UE9 A;  3NGP A;  1TUG B;  2JTE A;  3MCA B;  1TSF A;  4AG1 C;  3RUX A;  1VQN T;  2DZC A;  4BI3 A;  3N5B B;  2EKH A;  1M8V A;  2Y4X A;  2H3J A;  5GMK m;  1ZSZ C;  4XTZ A;  1RAI B;  1UTI A;  3CCM Q;  2LCC A;  1N9R A;  2BE9 B;  3EFO A;  1VQL A;  1E7O A;  3CC7 A;  3GLX A;  3EFR A;  3JCM g;  3CC4 T;  3RR6 A;  1XJW B;  2E10 A;  3NHN A;  3NTI A;  3QHS A;  5I2M A;  2MK5 A;  1VQM Q;  1Q81 R;  2H3E B;  4D8K A;  4HVV A;  1RAD B;  3CC4 Q;  2V1Q A;  3QZ9 B;  2KRS A;  3X25 B;  3AHU A;  3UPU A;  1C1A A;  1PSE A;  4OGE A;  4KH1 B;  2LP5 A;  3M9Q A;  2JMA A;  2JUF A;  3CCV T;  4PFO A;  3L1A A;  1WJS A;  1NJI C;  1GRI A;  3LGF A;  2V8I A;  4B9W A;  3RER A;  1M1G A;  2HQE A;  5J3B A;  3X20 B;  5KYN A;  4QVD A;  5GAM h;  1M2V B;  4M78 G;  3MEW A;  4NOY A;  1Q7Y C;  1D0X A;  2F2W A;  3JCM W;  2Z0W A;  2AKK A;  1NG2 A;  1KHC A;  2E3H A;  1ZUK A;  2NWM A;  2I0N A;  5GJV B;  2L3R A;  2DA9 A;  2OTJ A;  2GQV A;  1NE8 A;  2VUB A;  2RA2 A;  1K4U S;  2K57 A;  4LUD A;  2DKG A;  2HSP A;  2BZX A;  3CCR T;  1K0X A;  3A8H B;  1QWF A;  3A98 A;  3CBM A;  4B9X A;  1WQW A;  4E7H A;  1VYT A;  3I5R A;  4Z88 A;  1IGQ A;  2RK1 A;  2O9S A;  1VQ9 A;  2E12 A;  3CME A;  4RTT A;  2KDS A;  3P8B B;  4PJL A;  2LCS A;  4JJB A;  2M0O A;  3FLG A;  2C0I A;  2DBM A;  2GCX A;  2O88 A;  2FHD A;  3H6Z A;  2YRD A;  1NYG A;  2DIQ A;  2EVR A;  1B7T A;  4J9B A;  5GAO p;  3CQT A;  1YIT T;  2DL7 A;  3X28 B;  2B8A A;  4C8Q G;  3CPW S;  1YI2 A;  1FX7 A;  1QVF S;  3J7A F;  1QQJ A;  2DET A;  2LCL A;  1HJD A;  3PVQ A;  4XTV A;  3URG A;  1Q86 U;  4FYW B;  2QQR A;  2M51 A;  2FB7 A;  1ZHI A;  1EFN A;  2RHX A;  4C8Q C;  5CK9 A;  1HXD A;  4DQ2 A;  5M9O A;  3JV3 A;  1UGP B;  1Q82 C;  1LJO A;  3BE3 A;  2L0A A;  2DLP A;  4M78 A;  2COY A;  4JPB W;  2EJ9 A;  1H3H A;  1JB0 E;  2ZGW A;  1RAC B;  3OYI A;  1U1S A;  1IB8 A;  4M75 F;  1I8F A;  1XQH A;  3M0T A;  4JJN K;  2EYZ A;  2EQJ A;  2GTJ A;  1U06 A;  2QAS A;  3OSS C;  2M1H A;  4ESR A;  2AZV A;  2DVJ A;  5CKB A;  3VS0 A;  4M77 G;  2CS7 A;  2FZG B;  4D8D A;  4AT1 B;  4QVZ A;  5KE2 A;  3UT1 A;  2E6N A;  3G7Z A;  3HFO A;  1NM7 A;  1FWZ A;  3HFN A;  5LJ5 j;  4M7D D;  1B07 A;  4IUR A;  1RI0 A;  1GCP A;  1W4S A;  5D6W A;  4LD9 K;  3VRY A;  5GAM e;  1K76 A;  2HL5 C;  1VQ6 A;  1BI2 A;  4M7A D;  1Z9Z A;  4F16 A;  3CCU T;  2M16 A;  1PRL C;  5GAN e;  3VS2 A;  4MDW A;  2GBQ A;  2GTO A;  1SEM A;  2C0O A;  1M9S A;  3PNW C;  1I5L A;  4RUG A;  4C92 G;  4ATO A;  3OMG A;  2E1H A;  4FU6 A;  1ZA2 B;  2QQS A;  2JM9 A;  1QCF A;  1Y7X A;  2KRN A;  4OP0 A;  1UHC A;  1WHM A;  1G2B A;  3QWX X;  2GFA A;  2LTO A;  2A28 A;  2SRC A;  1AWO A;  4C0D C;  2CP5 A;  4M77 B;  1H64 1;  1VQL T;  1V1C A;  5GAN 7;  2H8H A;  4MZM A;  5A2Q E;  3V7S A;  1IRE B;  2OJ2 A;  4IIM A;  3TRE A;  2M0Y A;  2CSQ A;  2RI5 A;  3S3M A;  3SEM A;  2DIL A;  1Q95 G;  1I5O B;  2XU8 A;  5GMK l;  4JDS A;  1PCX A;  5LJ3 h;  3ER0 A;  3SDZ A;  2LQW A;  2O31 A;  1UDL A;  3CCS Q;  1VQK T;  2OX7 A;  2RH2 A;  3GNF B;  4C0G A;  4ZGJ B;  5GAM g;  4MDX A;  4F17 A;  2X4Y A;  3CC2 A;  1A0N B;  2CP3 A;  3MP1 A;  1SHF A;  5D6X A;  4A4H A;  2QAZ A;  2EAY A;  2K4Y A;  4KT0 E;  3CC7 Q;  3OB9 A;  4X34 A;  4LNP A;  2B86 A;  3OYM A;  3G4S T;  1GCQ C;  2K2M A;  2PVG B;  1QCN A;  2W0Z A;  2DL4 A;  2HZY A;  2FPF A;  3V8J A;  1NEB A;  1LVK A;  1I0C A;  1WHH A;  2EYX A;  4JRI A;  3CCE Q;  4J9H A;  2VVK A;  4PLI A;  1VQ7 A;  2KBT A;  2K7A A;  4OMN A;  3SWN C;  3QYH B;  4AFU C;  1YCS B;  2OI3 A;  3CCJ A;  2EWN A;  3JCM h;  5IT9 E;  4GLK A;  5IHI A;  1WLP B;  4PJN A;  2KSS A;  2IVW A;  3CEY A;  3LH5 A;  3HRU A;  3CME T;  2ZPF B;  3ME9 A;  2F5T X;  2QGF B;  2F2X A;  4ANJ A;  5DLO A;  1ZSG A;  6AT1 B;  4KUI A;  2RK2 A;  1Q82 R;  1KC8 R;  4ELZ C;  4IUQ A;  2HDA A;  1BU1 A;  3ZEH A;  3FC3 A;  3H0I A;  5KYW A;  3I55 A;  1SF9 A;  1AEY A;  1FYN A;  2JVV A;  4E2F B;  2DIG A;  5GAO n;  2Y4Y A;  1O75 A;  3KUF A;  4KUD K;  1IRX A;  1S72 T;  4D6W A;  3CCQ T;  2OTJ T;  1RAB B;  4CRI A;  1NPP A;  2MWP A;  3EGX B;  2X4W A;  1YIT A;  2A0F B;  1BB9 A;  3P8D A;  9ATC B;  5GAN g;  4RTU A;  1VQO T;  1N8R U;  4MMK A;  5GAN 6;  1Q82 U;  4X1V A;  3JCM X;  3BY7 A;  3L2W A;  3A1P A;  2MMP A;  5LJ3 f;  2KXC A;  2NYS A;  3GPL A;  4DBR A;  3V7C A;  1VQ9 T;  1XOV A;  1KD1 C;  1OOT A;  2XDB A;  3V7R A;  3OBW A;  4IKF A;  2G6F X;  4ZGE B;  5KYY B;  4M7A E;  3CCS A;  3THK A;  3I55 T;  4OMF B;  1KD1 U;  3HP9 A;  1ZX6 A;  2COW A;  2PVD B;  3QUI A;  2KYB A;  1SKU B;  4A4E A;  5I2S A;  1KC8 C;  1M1K U;  3S3N A;  4EPC A;  1YJ9 A;  1PD1 A;  4RKU E;  2NUP B;  3JCM V;  2DRM A;  4M75 G;  4JRP A;  2D8H A;  2CH4 A;  2EJF A;  5LJ3 e;  2C06 A;  4M7D C;  1RL2 A;  1VQ6 Q;  4JZ3 A;  1IHW A;  5HKC A;  2HCK A;  3MJX A;  2CDT A;  2L3S A;  1HK9 A;  2RF0 A;  1ZUY A;  1PD0 A;  2KXD A;  2BZY A;  4N4H A;  2RMO A;  4LDX A;  4FL6 A;  3J80 E;  2CP7 A;  3FJP A;  3OYL A;  2PUK B;  1YI2 T;  4M7D F;  5KYW B;  2EJG A;  4DOV A;  3JCM f;  2MF2 A;  4M75 A;  2DL5 A;  2ENM A;  4BE1 A;  3X24 B;  5DLQ E;  4X9D A;  4OB0 B;  1VYU A;  4XU1 A;  2J6O A;  4FYY B;  4AMC A;  1AVZ C;  2K6D A;  1GFD A;  4O6J A;  3LGL A;  4C0D B;  2LX9 A;  2NLU A;  3EHQ A;  4OMO A;  4E7L A;  4FYX B;  3OSV A;  4F7U B;  1D1C A;  1IHV A;  2CSI A;  3GNG A;  3JCM e;  2VXF A;  3VS4 A;  3OYH A;  2K9G A;  2V1R A;  4BB7 A;  5GAN d;  1JBM A;  2M9U A;  1VUB A;  3QWY A;  4DEX A;  3TQ7 P;  2KT1 A;  2DTI A;  5GMK e;  4RTX A;  1X2K A;  1NJI U;  1QP2 A;  1D1A A;  4L5G A;  5AT1 B;  4EMK B;  1M1F A;  3KXT A;  1UGR B;  4J9E A;  5C6S A;  1VQN Q;  1WYX A;  3LH0 A;  4M7A B;  1NEG A;  1YIJ Q;  1KK7 A;  1K73 C;  4KBM B;  3L42 A;  1ZBX A;  2DMO A;  2A37 A;  4A4K A;  4WCI A;  5FW9 A;  1VQ5 A;  2X35 A;  1EIF A;  1VQM T;  4C8Q F;  4BDZ A;  5CAI A;  4E7I A;  3PIP A;  2KE9 A;  5IH2 A;  4F7U A;  3OS1 A;  4Y92 A;  4RMO A;  4HT8 A;  3NMZ C;  4M4Z A;  1QLY A;  5FU7 C;  3OQ5 A;  2CUD A;  2RHZ A;  2KAF A;  1MNE A;  2DD4 A;  1Q81 U;  4M7D B;  1RLP C;  3CCE T;  4CC4 B;  2KGT A;  4XK8 E;  2HD0 A;  1PNJ A;  2ABL A;  3G4S A;  4QQ6 A;  2LJ3 A;  2EQM A;  4LDV A;  3DB4 A;  5IHK A;  1MMA A;  2DER A;  3OW2 S;  1MGQ A;  4HKE A;  4M7A G;  1T0H A;  2CP2 A;  1GBR A;  4ELY C;  2O9V A;  1GFC A;  1R8O B;  3P8H A;  3REA B;  5CO7 A;  4M78 D;  3REB B;  1QMC A;  4ZN1 A;  3I55 Q;  2HBW A;  3EH2 A;  2KVQ G;  4M7A C;  1FXX A;  2PNI A;  3JAM E;  5A0G A;  4ZTF A;  2EKO A;  1ABQ A;  3R6O A;  3SB2 A;  4BUG A;  1PKT A;  2RN8 A;  3M0Q A;  1UG1 A;  1UUE A;  1LNX A;  2RM4 A;  1YIJ A;  2JTF A;  2LMJ A;  2YLC A;  3QJY A;  4EDU A;  3CCU Q;  1KJW A;  1BCO A;  2K2V A;  1HD3 A;  1VQ7 T;  1IZ6 A;  1WGS A;  4II1 A;  4XTW A;  2DXT A;  3D7S B;  4UC4 A;  3WXM B;  1KIK A;  3TSZ A;  1D0Z A;  1RAA B;  2K5I A;  3CXC P;  1V76 A;  4HVW A;  3G6E Q;  1KQ1 A;  4PJJ A;  1OU8 A;  3S3O A;  1M4Z A;  3UF4 A;  4L59 A;  2LNH B;  4EMG A;  4OF1 A;  3CCE A;  4J83 A;  3JCM Q;  1YIT Q;  1UGV A;  1TWB A;  5GAN 4;  2V26 A;  4JS4 A;  1ZSZ B;  2E64 A;  2QTX A;  4KGZ B;  3CXC A;  3CBP A;  3EG9 B;  2FRW A;  4HA8 A;  5FRM A;  2DYB A;  3X26 B;  4E7S A;  2XD0 A;  2W10 A;  4XTU A;  4J9D A;  1Y96 B;  4RTV A;  2I2L A;  1WHL A;  3PTA A;  2ZPH B;  4K11 A;  5GAN j;  3QDF A;  4M77 F;  2X9H A;  4JLI A;  3V8L A;  1Q86 C;  1SRL A;  2DBK A;  1YJN T;  3R6N A;  4C92 B;  2DEU A;  3RES A;  1BK2 A;  4CC7 A;  3HPW A;  3A8M B;  2LJ1 A;  3M59 A;  1WHG A;  1KSW A;  1U8R A;  1JJ2 S;  4EMH A;  1MHN A;  4N0A A;  3TVT A;  1MUZ A;  1MV3 A;  2VC8 A;  2JZ2 A;  1YFN A;  2XKO C;  2YXY A;  2DYI A;  3NFC A;  2EQK A;  4C92 A;  2X51 A;  3A8G B;  1OEB A;  3G1J A;  5GMK h;  3IQL A;  5GAN 5;  2DE0 X;  1PC0 A;  1H92 A;  1Y0M A;  1VQK A;  2YRC A;  1B3Q A;  1PKS A;  4PJO C;  4O5V A;  3CPW A;  1QVP A;  4C5H A;  4M7D E;  4PNO A;  4QT7 A;  2DVE A;  4ORZ A;  3CCL Q;  2HAX A;  1BI1 A;  1K1Z A;  1R77 A;  4FSX A;  4IUV A;  5KYU B;  4PJO G;  2KI7 A;  4FCY A;  1TOV A;  1XTD A;  1C6V X;  3CCU A;  2RI2 A;  5KCO A;  4V2S A;  4BI4 A;  2F2V A;  1RI9 A;  2YRV A;  3I56 Q;  2CZ1 B;  4KGX B;  1QKW A;  5GAM f;  4M78 B;  4M77 C;  3VS6 A;  7AT1 B;  5KCH A;  1ACM B;  1QVG P;  3A8L B;  3DLM A;  2ED0 A;  2L5Q A;  4J6Y A;  4MZT A;  1K9A A;  1YNZ A;  4JZ4 A;  5ECA A;  4DBQ A;  3VU3 C;  1RAH B;  4XAX B;  1FMW A;  2CZ0 B;  3A5Z B;  4OMP A;  2EYY A;  3CPW P;  3TEE A;  2AHJ B;  4LUE A;  1G5V A;  2YUN A;  3T9N A;  2LQ8 A;  2LRQ A;  5HK3 A;  2RO0 A;  3QXE B;  3EG2 A;  1I1J A;  2YSQ A;  3JB9 H;  3UA7 A;  3CCV Q;  1AWW A;  3VKI A;  1WXT A;  3SWN A;  3FRN A;  2QEX T;  4Z02 A;  5FU6 C;  3OYA A;  2YWW A;  1M1K C;  2YT6 A;  4GY5 A;  5IXF A;  4C8Q D;  2F69 A;  2D8J A;  5LJ5 d;  5IXB A;  1ABO A;  3ASK A;  2E70 A;  4E7Z A;  1TUC A;  4FW1 A;  3M55 A;  4M78 E;  2L8D A;  4ZNX A;  2QDL A;  1JRI A;  3I56 T;  5KH6 A;  1GCQ A;  1B34 B;  2JT4 A;  2P84 A;  4C5E A;  1RAG B;  3KBG A;  3O8V A;  2PTK A;  1W2B A;  1ZBJ A;  2XG8 D;  4C92 D;  3M4Y A;  1TXQ A;  2RQW A;  2VGN A;  3FDR A;  4P5N A;  4M7D A;  1YCY A;  1YJW T;  4JUV A;  1TH7 A;  1G83 A;  3BDL A;  5IN1 A;  2JN0 A;  4RG2 A;  5FWC A;  1M8M A;  2VXE A;  2ZZD A;  2A3L A;  1M2V A;  1YN8 A;  2RI3 A;  1AT1 B;  3PE0 A;  2KEA A;  3JB9 I;  3UAT A;  4R55 A;  2EBP A;  3EGD A;  1X6G A;  2R5A A;  2HL3 A;  4QQG A;  2YUO A;  3ZFJ A;  1M90 C;  2RPN A;  2J05 A;  4AG2 C;  5CIU A;  1Y96 A;  2DPP B;  1M27 C;  1SG5 A;  3G6E T;  3I35 A;  3DB3 A;  4A4F A;  2JS2 A;  1Y57 A;  2D0N A;  4JS5 A;  4M77 E;  2NUP A;  2DJQ A;  3EG3 A;  3L2R A;  2L3P A;  3LWI A;  2MWO A;  1KFZ A;  2K79 A;  1M90 U;  1VQP T;  1TG0 A;  4BY6 B;  3E2U A;  3PGG A;  2RQT A;  4KRT A;  3LLR A;  1W2B S;  2ED1 A;  1AZE A;  1GXI E;  2DFU A;  1QW1 A;  3EGU A;  1YWO A;  2ZCF B;  1PG5 B;  1IGU A;  2KR3 A;  1N5Z A;  4DEY A;  1HYO A;  1TS9 A;  3V8K A;  1T3S A;  5CKE A;  2EYQ A;  2RQU A;  1UJ0 A;  1WZO A;  3GBQ A;  1B34 A;  5LJ3 d;  1WXU A;  4FW2 A;  3JCM c;  2QYZ A;  3M4G A;  3CCV A;  5IAY A;  4FYV B;  4A4G A;  3L2Z A;  5D6Y A;  2EGA A;  4PJO B;  3I9Q A;  3EG9 A;  3ULR B;  3HL8 A;  1UGQ B;  1VQ9 Q;  3QJ6 A;  1WPY A;  2FVU A;  2JMC A;  1FMV A;  4XTY A;  2YHT A;  3PMI A;  3OS5 A;  2MIO A;  3TSW A;  2XIC A;  3CME Q;  1YIJ T;  3QZ5 B;  2AT1 B;  2DTO A;  5IHN A;  2E5Q A; 
#chains in the Genus database with same CATH homology
 5KYU A;  5KYY A;  3EG9 B;  2YRC A;  3EGX B;  3EGD B;  5KYY B;  3EFO B;  3EG9 A;  1M2O A;  5KYN A;  2QTV A;  3EH1 A;  1M2V B;  3EFO A;  1PD0 A;  1PCX A;  2NUT B;  1M2V A;  5KYW A;  2NUP A;  2YRD A;  5KYU B;  5KYX B;  1PD1 A;  3EH2 A;  3EGX A;  2NUT A;  3EGD A;  5KYX A;  5KYW B;  2NUP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...