2YRFA

Crystal structure of 5-methylthioribose 1-phosphate isomerase from bacillus subtilis complexed with sulfate ion
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
340
Chain Sequence
SVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords Methylthioribose-1-phosphate isomerase
total genus 103
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yrfA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yrfA02
1T9KA 3A9CA 2YVKA 4LDRA 5DBOA 1VB5A 2YRFA 3ECSA 4ZEOA 3VM6A 4ZEMA 3A11A 1T5OA 1W2WB 4LDQA 2A0UA
chains in the Genus database with same CATH superfamily
1ZHTA 4B3TB 2YXBA 3IPYA 5DTEA 2NO5A 2QGNA 1R9NA 3CIFA 2CNWA 3EQ6A 3N9IA 4GZLA 5LP6C 1MT0A 4TXLA 1RRVA 1VXOA 2E4AA 3QXJA 4G9EA 5TMPA 1DC7A 4K9MA 4CIYA 4IJWA 5BUZA 1Q0LA 2G40A 4LXTA 2C7PA 1UEIA 1W581 2ZWPA 4NIMA 4MVSA 2FUKA 3DYIA 3F2IA 1EHIA 3OTHA 1F8YA 2F3TA 1SCBA 1X7HA 4CCAA 3AF6A 1QAOA 1ST3A 1NMZA 3VZBA 2ZUDA 5FA5A 1ZK1A 2YZ2A 3COZA 3O6VA 3DJYA 4LJRA 4KOEC 5JCOC 4PZPA 5IKXA 2GYVA 1PR2A 3OHMA 4NWIA 4JAVC 1SB9A 3O8QA 4HPJB 4D8XA 4DNXA 3FNEA 4X1YB 2D3WA 2BFBB 5IDVA 5J5AA 2J3KA 3A4YA 4DCOA 3T1HB 1ORDA 4DR6B 1R5BA 2EFJA 3L7YA 3FOWA 2IDJA 2CFIA 5JZMA 4ISCA 2ANBA 2JLUA 3HI4A 2X4IA 4LVCA 3QX9A 3NKDA 1RAEA 2Q99A 4P2BA 2PSEA 4OP2A 1GG2A 3K6BA 3CZPA 1N2OA 1Y3BE 2H1LA 2PYIA 3B3JA 1QUFA 3LY5A 3RVNA 5EJ9A 3JYYA 1BOOA 2C4WA 1UPTA 5CW2A 1CVRA 3E3LA 1ZGHA 1VLVA 5B1YA 4OHCA 4NBNA 1V9SA 3OX2A 2R7MA 4R68A 1B6SA 1FE8A 5LZ9A 3K5IA 3V2UA 4C7KA 6ABPA 3FHTA 2ILVA 3W4IA 2PKCA 4DEVA 4J1NA 4BC0A 1I4YA 5LQKA 3W2WA 2YW9A 3NCTA 3H1AA 5FBHA 2J31A 3SWWA 5EKTA 4UM5A 4ZMBA 2I4IA 5ARCA 1NMQA 4Z1OA 1J8DA 3HWX1 3MWEB 5TE9A 5EXSA 1JKJA 2QD3A 4FU0A 4S1OA 3HEMA 3K9HA 2RH4A 4LHWA 5FO1A 1MB9A 4JCOA 4DCVA 4WUVA 2WMNB 5JJ5A 2H63A 1UKBA 3E82A 1RI3A 3ESAA 3MPOA 1C3OA 2VDWB 4MW9A 4E13A 3MWDB 1Z6QA 4HNQA 4R8SA 1HM5A 4J16A 4OHMA 4RYLA 4BZWA 1JOGA 1RZRD 1B7GO 1RYDA 4JT2A 3TUIC 4MTCA 1R3UA 2EX0A 2QKYA 4WKGA 1W19A 3DR5A 3F97A 3VGJA 2ORWA 5BW8A 5JQGA 3NVMB 1XZHA 5DO9A 3RSZA 5LOVF 5D5HA 3U81A 3HKBA 2IHTA 1Z34A 5LWHA 3Q6IA 1GU1A 4KN8A 2JC3A 1WUYA 3MW8A 4WY8A 5IHXA 5K0SA 1R0YA 3CKLA 3INTA 1EI7A 1TVCA 1X0XA 4ZEWA 3URMA 3MEQA 1FFWA 4WFIA 5FWXA 3WWEA 5JD6A 3PD7A 2Q1SA 4PQEA 3QH4A 3IVRA 4ZOLA 2XM4A 2QSJA 1N8SA 4PN7A 5I7UA 1Z25A 1ZI9A 2GEFA 3FIUA 1HY3A 4PTLA 1DDGA 4QJIA 3EIEA 3UMKA 1M5UA 1QMGA 1WQ1R 3TZBA 1SB8A 1C3JA 1K3UB 3GEDA 4GYWA 1WKBA 4FZVA 4IHQA 4QFDA 4QQRA 3M4XA 2NW6A 3FJOA 5A9SB 1E9FA 2BLNA 2B34A 1ICIA 2VQ6A 4MQMA 4WA8A 1B15A 1BXGB 1EVZA 2B4QA 1LPBB 1LJ8A 1YL6A 2XSZD 3OX3A 4AIIA 4BP3A 3Q6MA 2XODA 1TQDA 2QQEA 3A3OA 1OYVA 3G2IA 3PP8A 3KD2A 3QENA 3BRQA 4D3SA 4A0QA 4EQZA 2BMFA 1AS0A 1DKNA 2UKDA 2Y39A 2POQX 3COSA 3WGZA 5BXYA 4D0SA 4ZDIA 2OM2A 4UU8A 1Z8HA 5HW0A 1N1MA 3U80A 1DRKA 2TMYA 4XDZA 1RJFA 2IYVA 5DCLA 3EIFA 4MIYA 3NXSA 2G5PA 1OOEA 2VJYA 1C0KA 1TO6A 2VYQA 1IG3A 1T1EA 3AIMA 1F4VA 4GI1A 5NLLA 5CDGA 4ZYUA 621PA 4F91B 1D4AA 5A05A 4LHVA 2HBQA 4BMYA 2OXTA 3M3DA 1SKYE 2PS9A 3B60A 2X13A 3KXKA 1PL7A 3N07A 3SEFA 1JKJB 4BO6A 5JZVA 4LY6A 1LD3A 3GCDA 3SBOA 1YE5A 5BMOA 2EAUA 4QYXA 4GOKA 1UT6A 2Y99A 2PZJA 3EAGA 9MHTA 1ZJJA 5BN4B 5TT1A 4RDAA 2QZJA 1LGYA 2VF8A 1GUFA 1N2JA 1T9ZA 3BJEA 4BFVA 3PFFA 4QELA 3P52A 1GGFA 1D1SA 1W59A 3HHPA 1OZ0A 4MUMA 3OJFA 1HKUA 4MVUA 1I0LA 4MRPA 3ZEIA 5EMMA 5L7TA 1IQ0A 4NFLA 4EHBA 1ZKDA 4UHBA 4YK7A 1Y48E 2FG7C 3LX8A 1JSRA 1RWMA 1L0BA 1T1IA 5JVEA 1YB6A 3MAJA 1U1GA 1NIJA 3W6UA 3Q41A 1E83A 2PU7A 1PTJC 3WB2A 3LEOA 2QP3A 3T0IA 1X7YB 5EHNA 5AKHA 2J3EA 3IPXA 4YAJA 2Z2KA 2YBDA 3OMXA 4DF3A 3X1OA 1QGDA 3EVTA 1RC0A 1HMOA 3M79A 1Q2UA 2VHXA 2ZIXA 3L34A 4I0WB 5F4ZA 2QMYA 5TQ2B 4BPMA 1TK2A 5ITVA 1UDXA 4DIBA 3GL9A 4EMTA 2D0OB 1CUAA 2C2HA 3S70A 5K4AA 1G59A 1NOJA 3BWVA 2AMVA 4Y2GA 2ISSD 3FZNA 4BFXA 2WB2A 2CGEA 1BWSA 3M4JA 3ANTA 2W9YA 1ZGZA 4B3CA 2GCPA 4LY3A 3F8TA 3FRJA 3CZAA 1G1AA 1VA4A 4K2HA 4U2CA 1Q3HA 1DQRA 2QUKA 3C16C 3KZ1E 4AAYA 1L1QA 1OILA 3JAWA 2NYVA 4B0PA 3QKIA 1AUQA 1LH0A 5IVHA 2WJ6A 3IIIA 4NC9A 3UGTA 4E94A 4FJ1A 5HGJA 4DWOA 4ZN6A 1OFHA 1OX4B 3GUHA 3WNZA 1ORIA 2RGXA 3IIEA 3L4BC 2BDUA 4KQ1A 1VSVA 1Y7IA 2FLKA 2PZLA 4X6UA 1CEYA 3D3WA 4RPIA 3V5XA 5AOAA 4NE9A 3SMVA 1GXSB 1SVWA 3TMKA 2XMQA 4GRDA 4DIOA 2WYHA 3FVVA 2ZUFA 1UR5A 2B5VA 2I8LA 2Z57A 3EZFA 3RVYA 4OHUA 3AXSA 3HCAA 4NNJA 3S8MA 1E3MA 2VHCA 5ILGA 3QI2A 4PYRA 4YLEA 1JHYA 3W2EA 1K5PA 1C9EA 2I71A 3AX6A 4WX2B 4ZYLA 5B1AC 4RQBA 3UHPA 2EU8A 5L4SA 1QU2A 1EK5A 1Q7RA 2FSFA 2ZRHA 3HJRA 4DANA 3M7IA 4HCJA 5DWVA 4JSYA 3LAWA 2NSFA 3K4PA 5UKDA 1UWCA 4FEAA 4TQAA 4TYQA 1FRQA 3EJ6A 3GA7A 4MVMA 1O8CA 5B6JA 3GM3A 3GRVA 1U28C 4HMPA 3IXQA 1XMIA 2REXB 4YJWA 2VDLB 4G25A 1J42A 1O95D 1OY1A 1PEAA 2W58A 3MGBA 4Y2RA 2FNAA 2GKOA 5ER9A 2FMTA 1MX1A 3W2TA 1RBMA 1LDNA 4ZK6A 2Q7DA 2JAXA 1L5WA 2BKUA 4RENA 1X92A 4LZLA 4GLJA 1IJKA 1Q0RA 3L7CA 2WY2D 1K6XA 3AF5A 4NABA 4TMTA 2XQIA 3X1JA 4EHIA 1BWQA 1OXTA 2XDYA 5BMVF 4BHTA 1C1XB 9LDTA 4EQ6B 1QV9A 3AYZB 4I6EA 3UPTA 1KH1A 5F9FA 5CH8A 1OWMA 1XL0A 3OOEA 3FOCA 1TMKA 4ZT6A 4P0PB 4HXGA 4LQCA 1M3SA 3QOFA 3QVWA 1GTMA 4AUNA 2PWPA 3RFXA 2JJ2A 2WSSA 4P5EA 4FMCB 1WZUA 1XT6A 2HB6A 4HQOA 3GLIA 3H2HA 3P26A 2XF8A 5C81A 4UHJA 5I51A 1ID8A 1WIWA 3TULA 4A8JA 5KO2A 1W2HA 4G5XA 1BGWA 2I2WA 3U49A 3VZQA 1RIIA 1X38A 1A7VA 2C1EA 3FFXA 3UWDA 1YRQA 3I9V1 3IUPA 3WZLA 4D96A 3SAJA 3A27A 4DCSA 4NMHA 3UV3A 1CRPA 4EY8A 1JFVA 2ID7A 5E6RB 2R7UA 3E35A 3L02A 3IFSA 4D6PA 2ZANA 5AVSA 5IG2A 3IQDB 4Y2PA 1VG8A 4YQZA 3ZDDA 3LQKA 3JASB 4U8HA 3VTFA 1TCBA 1YVPA 3P0JA 4QOGA 3PYMA 2PG3A 3DT9A 3IO3A 4HEQA 1H3EA 1ZMTA 4TZ0A 4JLAA 4BUCA 1UFVA 3SEQA 1FR0A 4TWRA 5HEKA 3GR6A 2OJQA 4AYXA 3R5SA 2HEIA 1E0JA 4FGWA 1KS9A 4B0OA 1FAPB 2E4VA 3F5DA 5CBPB 2B6NA 4IGFA 4IIVA 3NBYC 3JZFA 3R3VA 4KIUA 3RUAA 3IE0A 1XQXA 4O4IF 1I5RA 4G86A 4O6NA 2AOWA 2Q9AA 2UDPA 1HFWA 4MWTA 3PU6A 4R1OA 4AX8A 2ZI4A 1UODA 2PNOA 1NP7A 2E3JA 4IJVA 3RAFC 1VKOA 3H6HA 2RCYA 5BN3A 3MINB 1SAYA 4HWSA 1NN3A 3IDAA 1MRZA 3QX7A 4JYZA 2N0SA 4E5DA 1SKMA 1O58A 3BD8A 2B5OA 1UK6A 4BO0A 1JBEA 4YGYA 2Z8YM 3FOAA 1CUHA 5IKOA 1C5KA 2WIBA 2DP4E 2XY4A 5ALKA 1YS2X 4B76A 3ELDA 2P6RA 5KYUB 3S0XA 3M83A 1ONNA 2A1IA 5JIBA 2QPOA 4Y6SA 3DDCA 2QMQA 4NU6A 3S4YA 5IZCC 1XTRA 2ZDGA 3GRCA 4F1KA 1TCVA 2G70A 2WSBA 3TNFA 4BC1A 1YQTA 4GI5A 4HWPA 1EVJA 4URUR 1L5HA 1NT4A 2ODTX 3SZRA 1ZUNB 1F51E 3N3AC 1DQNA 2VT6A 3NG1A 1KARA 1AZSC 1O97D 2DCUA 3TX6A 4I8DA 5DU2A 3T5MA 2D2VA 4CKBB 2SCUA 1G5IA 3DO5A 2YJ5A 3T6KA 1HI9A 2R8ZA 2XHZA 4LJYA 5DIZA 2UUBB 4BX3A 1F3OA 3OZTA 5HXAA 3USES 3O2SB 2JAHA 3BE8A 3C5VA 4GMFA 4FGZA 1QIHA 1VHDA 5K1ZA 4BNTA 4EKGA 4JLKA 3S90A 3RF3A 4JVMA 3B20A 5BRAA 1RKVA 2XUKA 4QVGA 3OPYA 2I1VB 4URFA 2VSFA 3K96A 4HD8A 1E9EA 5HOEA 1TRHA 3ECSA 4NQFA 1OGJA 1Y3DE 2REQA 2WJJA 3KV1A 1TF5A 3K0AA 4HQLA 4KXUA 4KO8A 3N0WA 4WNAB 1MAAA 2H7XA 5EWMB 4MV4A 1SC4A 1E79D 3ESQA 4LIPD 1AZLA 1T9AA 3QPBA 3TNDA 2R79A 1XX6A 1T29A 2G4LA 2ZYTX 3EODA 2OYSA 2BELA 4DQXA 3F8SA 2V1UA 2X0DA 1K4YA 1ND6A 4EI7A 3W2HA 5FEMA 3NATA 5KC9A 3QBEA 1Q3KA 1S2IA 4PICA 4KN9S 1Y6RA 5IDWA 4JW1A 2DFDA 1G3IA 1ZL2A 3G5MA 2ECPA 2VYFA 2A86A 4H0FA 5HZHA 3RH3A 2PA0A 4F11A 3Q3VA 5H9VA 1YA4A 2HDOA 4OK6A 2RI6A 3ZDXB 3W2IA 3KYCA 1WN0A 1ML4A 3WV5A 3KTAB 2DFLA 4OOEA 3AGUA 2QW1A 2WSMA 3FUUA 3V8NA 3ST7A 4UTRA 1BFKA 1UK8A 2BM9A 3PIDA 4L6AA 4DVGA 1V3UA 1E58A 4C0KA 3QTTA 3VHRA 2BI7A 4E46A 4G56A 4KKVA 1BKYA 1H42A 4RVHA 2JAWA 5KOHA 2Y3GA 2A1TS 3SVZA 3VHQA 4QODA 4ZLDA 1A8HA 4L57A 4NRDA 3Q8WA 4TL9A 3UM9A 2IOFK 1OHHA 2YN2A 2G82A 2C04A 1GPDG 1OYWA 2QORA 3ZDLA 3BEDA 3NI2A 4UNNA 2CLDX 3EN0A 3UQYS 3OTWA 4JJEA 3QYJA 3OC0A 1T4GA 1JDBC 1QNLA 5BRNA 5DGTA 2X2FA 4XIJA 1B68A 1NF3A 2C29D 2HQRA 1GSIA 1CQJB 5B6PA 5KQGA 1P4SA 3TJ6A 2EQBA 2ZJBA 3M0EA 1OFGA 1UINA 4NMWA 1XL1A 4NOKA 4TMXA 2G71A 3AO0B 2XWPA 3F7TA 3ZZ1A 1DARA 2FPOA 2JLQA 2QHXA 3N86A 1H6DA 1XLTC 1TK9A 1ZNWA 3NDRA 3NNDA 3OJXA 4JSTA 3T5CA 1Z8DA 4EYQA 5JYCA 5ESRA 2FEAA 2Z8ZA 3T9OA 1UBJS 3AF0A 3TM5A 2HZ7A 4CM9A 3M1IA 4QG3A 4F3TA 5HQ3A 1T5SA 2Q4OA 2JI6A 2O2SA 1MAUA 4XCXA 5IKEA 2XWJI 4XUDA 3IOMA 3PUIA 1MDBA 4CV1A 2JB9A 1XMJA 4B3HA 3DO6A 1NFNA 2M32A 2VZLA 5K2MA 4H27A 1X7DA 4XOIA 1IXYA 3K32A 4GAEA 3CX4A 4NICA 2HA0A 2XEDA 4M46A 4M9UA 3S2IA 5E9QA 2XE6A 5AMXA 3ABLC 1IW7F 1MJHA 3W6OA 1MB0A 1ULAA 1RKEB 2BFDA 4RY0A 2XNKA 2LE0A 2YY7A 4LYEA 1Q7TA 2CMKA 4LKRA 5IT9A 1VHQA 3FNGA 2ZTSA 5EHXA 1JR3A 2ZRFA 3WJAA 4C4AA 3AVVA 2P68A 1GPKA 1UMCA 5HCNA 1JF8A 4LDQA 5BR8B 1FLDA 1M2FA 1ZFNA 3U3FA 1HO3A 2J0UB 1IBCA 2VFAA 2YIVX 4FPXA 4F96A 1X42A 5CNJA 4AY2A 4QIHA 4JTDB 1GNVA 2QTRA 4GEKA 4II7A 3SIWA 3V1TC 3X1XA 1RW4A 3CR7A 1U28A 2XYHA 3OM8A 1XN4A 3EA0A 3TCXB 3WOVA 3MJVA 3OX4A 2ECFA 2IEBA 1QFZA 2YFYA 4UUPA 3SYKA 4Q3DA 3DJNB 4TQGA 5L6LB 4UM8B 1KBQA 2GO1A 5ELLA 3I6IA 2ZAOA 3MUNA 3OFND 3IOCA 3DTNA 4EJ0A 2W2LD 2E18A 3L7BA 5EUBA 5HMMA 4BO1A 1QVZA 1JEEA 1A7UA 2EFDB 2JIQA 1MIOA 3ZTMA 5FF9A 5JSHA 5J2TB 5CTAA 1VL5A 4X8MA 5K0NA 1LQ2A 3CF6R 3EW7A 2HHHB 3MYYA 1RXWA 2PBEA 1R00A 1P77A 1J1IA 3JQ7B 3NDPA 3PHHA 3GFVA 5C1OA 5HJEA 4OGGA 4ZAWA 5LZ4A 1DFHA 4L5JA 3DYBA 3T3PB 3GRYA 3O1JC 2JJ2D 2WSSD 2X8BA 3FYUC 4GUDA 3UJDA 3UKDA 4JYAB 1ZN2A 5D3ZA 4IQFA 2PIAA 5JV5A 1ZVMA 2GPAA 1P6QA 3ZBUA 3O8RA 3SC2A 2VHUA 1ORJA 4Y1GA 4IWNA 3IBCA 4C0LA 4U9EA 3WMRA 3KALA 4M83A 5AUNB 5ISMA 1EE2A 1KOFA 2QN9A 3RLIA 4QT4A 1E1DA 2WVQA 1AGPA 1NI5A 4EITA 1A0OA 3WHIA 5CA1F 1EU1A 1P7YA 2H3HA 5EVCA 4AY4A 4BNUA 4B3MB 2X6QA 4I1SA 2EPMX 3GUUA 5K6TA 3UCXA 2PL9A 2R47A 1Y98A 2Q3FA 1R8SA 4RMHA 2YWJA 3GIWA 5D87A 3TLEA 2WZDA 1MMGA 3OE5A 2IZ5A 1UBHS 2OSVA 1H65A 2XJ4A 4U63A 821PA 1O8BA 2FSSA 4D3DA 2CHVA 5HTOA 2NV2B 2VNSA 3LLIA 2DJIA 1DEXA 4IXTA 5KSZA 3G68A 3F2VA 4JU8A 4PGGA 4ZVLA 1T0BA 2DHRA 3GP5A 4YH1A 2Q3BA 4DADA 3AVWA 3AG5A 2I6FA 3ZHYA 2NUTB 4BTVA 2YRWA 3KZCA 3JATA 5JSKA 3VPBA 4EZIA 3IEVA 4U7JA 2YQYA 2HSZA 1NQWA 2QQFA 3UXMA 1N0IA 4DSUA 3TO5A 3LCVB 4TXJA 1LQTA 1MRNA 3JQGB 4GSLA 5A3QA 2PAFA 1O2DA 5E2AA 1NVFA 3CLTD 4OUDB 1W8DA 3TAXA 1J2TA 3OURA 1TYAE 3WQQA 3A0RB 2VF7A 4R3WA 1BE0A 3UATA 2LSEA 1SUFA 1ULTA 2AKAB 3WOHA 3BZWA 1Z5PA 3M9WA 1YMVA 4ETWA 2CLKB 3C3DA 3LDGA 4MV0A 2HL6A 4KDFA 3EXHC 5JZ9A 1XTSA 1PNTA 3FNHA 1YGPA 4EB6B 1UL1X 4PIPA 1XOIA 2XUOA 1GYQA 4ANJA 3PPWA 4TRMA 1AHPA 5BUQA 4BVKA 2WWHA 4HWTA 2VWHA 3HKBB 4RJLA 1IQRA 5KNBA 1V16A 3K73O 2AWNA 3ZIUA 5KSWB 1XZCA 2ZJ2A 3C74A 3O90A 4AL1A 2PSFA 1P8AA 4UVGA 3TWOA 2CK3D 3C7AA 3HU5A 1U0NA 3G0HA 1SMYF 3ID6C 2J3IA 1YZLA 3QUSA 3SLKA 5IT4A 1SNYA 3V33A 2DF8A 4GBJA 4OXNA 1QLJA 1N6RA 3SI7A 3R7BA 4AJNA 3RV3A 5HQTA 4B40A 1JR3E 3U37A 1NVTA 1YCGA 3I92A 4IDCA 1DS6A 3ZW8A 2JDIA 4OFWA 4R1PA 3BREA 3N8NA 3PFCA 5E7JA 1GAEO 3MS7A 1FSFA 5JMWA 3OI7A 4OMFG 1JIUA 2XWBF 3MXOA 2TMGA 3ORRA 4H3SA 1YS4A 2XBLA 2P11A 3G9UA 5CFMA 4M1OA 1BVYF 3LBIA 2QVLA 3GGJA 4RY2A 4R9UC 3EXIA 4YK5A 3A4TA 2GEDA 4BTEA 5A6SA 2GZSA 4E6PA 5JXGA 1LRLA 2L9JA 3KDPA 2W2KB 2A30A 5THXA 1KDZA 1D2AA 5G1PA 4ARZB 1QIDA 3PQ5A 3X1WA 4A2PA 2BFMA 4KQCA 3ASVA 3LCRA 3DFKA 3CO0S 3PNBA 2AK2A 4I1RA 4XAQA 3SSMA 3VOTA 3ZQJA 4MB2A 2X7XA 1AKMA 1LLQA 2HV6A 1X39A 3BWMA 4O4LB 1CERA 3K0SA 1JA0A 3PPVA 1Y9DA 1Z7EA 3HA2A 3M4BA 4YR9A 3PV0A 2EZTA 3TLBA 5JSYA 1NYTA 3UOWA 5BW5A 3E2IA 3QBVA 3S2YA 3OEWA 3AUAA 2XMCA 3FDIA 4B2LA 1N0UA 5ALTA 5B3IA 1P4HA 3DKPA 3EZ9A 4CXMA 1UP6A 4R1LA 5ECGC 4L8YA 4TS1A 3TIGA 1G6Q1 3RYLA 1B8PA 1RQRA 2JK0A 2JHCA 3KYDA 3DAYA 4MW8A 4QTZA 2WVGA 5LYYA 1DPGA 4D4KA 2ZFUA 4KACA 1ZJ4A 4L0MA 5CR9A 2EWWA 3RS9A 1SD2A 121PA 4YAKA 3AEQB 4GNKA 3TRDA 1KFCB 3V4LA 2IC5A 3GFSA 2Q2VA 2MSEB 1GRVA 2Z09A 1NPDA 3I28A 3NB0A 4TLAA 2YJNA 1P5HA 4TLDA 4Q7JB 1TEHA 2R1TA 3G7SA 4KRFA 4P54A 2ZWVA 4WQMA 1AKEA 4JBXA 1SZCA 1AN0A 4FP9A 4DE5A 1Z07A 1PEDA 2Y66A 4C2BA 4GOLD 4OGWA 5JQGB 1QRTA 2ZZNA 1G55A 4C5CA 4YWJA 1W34A 3FZQA 2A5FA 3NT2A 1KAGA 2MIIA 2PZKA 2G7MC 1G9TA 2HBYA 3D8NA 3LG2A 4JT4A 3RBZA 3LWNA 5DLDA 3OTOB 3PA6A 4KBFA 5HK8A 3PXDA 2A9JA 1WOMA 5JSLA 4II3A 1N2SA 2QRLA 5LZ2A 3R74A 3AHCA 4GNRA 1WZEA 1RABA 2CFTA 1VP9A 2PRSA 3PG5A 4JOQA 1LPNA 3L0IA 4HH4A 4FD3A 5AP9A 5GV7A 5TMBA 1VL8A 3L5KA 3ZYZA 5AVXA 5WRFA 1JR3D 1NKTA 2GO7A 1QUEA 3T7SA 3AVQA 5HK9A 3L46A 4J0EA 3H8VA 1G5PA 1K2VN 1KSHA 4YUYA 3ZWCA 1QJ4A 2W0SA 1CP2A 1TZ2A 3DULA 2ZE8A 2RSLA 3RT7A 3D5EA 4YL0A 2AOUB 3JQ6A 4HP8A 4M1SA 5TB5A 1EB9A 2KQUA 2YY6A 4I36A 1CZOA 1K7YA 1BQ3A 4B6JA 3ZVKA 4HGRA 1GQQA 3USCS 3OIUA 3ANNA 1QHIA 3G2LA 1HOXA 3MS4A 3Q7RA 3BWBA 2F1IA 5B4VA 5F2KA 1SCAA 5K6AC 4YP7A 3FFTA 3VSCA 1NBMA 4EHHA 3U1TA 3BQ9A 2NX2A 4EA7A 2HZ8A 2RJOA 3UGOA 2JJ1A 4E17A 1OV4A 2AGVA 1ZAYA 4ZT3A 1L4UA 2XI4A 4RTJA 1CFZA 3DE9A 4JBHA 1J0BA 5E6UA 3VO2A 3T35A 2XCOA 4F4UA 5KOIA 1ZNZA 1G8GA 3F6EX 5KS2A 4YN0B 1M0WA 1RLMA 1UBMS 3QWIA 4HLCA 3TL6A 5B4UA 2QN2A 4RH1A 3PEEA 1B23P 3T54A 2Y4NA 3WLEA 4EA8A 1F2UA 5EMNA 4CCSA 4PLVA 2E48A 3SZLA 4KQGA 3M4CA 3DBHA 3FRHA 4UQPA 2GZAA 4UULA 3UC9A 4KBLA 1ZCFA 5E6SB 2V7TA 4LYFA 4CEIB 1IDOA 1P6XA 1JAYA 3A1EA 5ES3A 4EVIA 1HEIA 2OCGA 2BMDA 2Y27A 3CUTA 3GOQA 3R7NA 4DUGD 5IN5A 3FCEA 2HJSA 3HLZA 4XLPF 1H69A 1XAJA 2ATIA 2ABWA 1U7ZA 2PKQO 4HNSA 2IU6A 4RPGA 2DSTA 4Q9LA 5D3KA 4YAIA 5JI2E 1U5BB 1ZJ5A 4LS3A 5HKAA 1K7EB 2FPPA 3FPJA 1GR0A 3JZ0A 5B2ZA 1ORTA 1I3KA 3T9EA 2UYGA 2OV6A 1G5RA 2R2GA 4A0FA 2YV1A 2AEJA 4QJ4A 3SJUA 1GTG1 3RW0A 2GZ3A 2R6CA 4DPLA 3PMRA 1H6BA 1CS0A 1VG0B 4LG1A 4LDZA 4M8NE 2BZ1A 4N7BA 4OLFA 4PYMA 5F21A 3TW4A 5E1MA 4Y6OA 2WWRA 2CSXA 1P2FA 3PNVA 3BDVA 3KV3O 3FI0A 4IV8A 4G7OF 3ZVMA 2IEGA 5EJ8A 1EP9A 2RKOA 1NE7A 3L18A 4CL0A 2NXJA 1Q1ZA 3IQIX 4RETA 5AI0A 2O5RA 3OKFA 1GEEA 1L7RA 2SKDA 4YACA 1ZYUA 4POAA 2C4UA 2OWEA 2SKCA 3L82B 3CE9A 4DJTA 2LCHA 1V5EA 2A7QA 4HAIA 3ZTTA 1IEVA 4F5ZA 5KUTA 5HKBA 1VDMA 3CCBA 1A88A 1XAGA 3ZLUA 1NULA 3LCUA 5JMPA 2EFGA 2EWMA 4URHA 3BHJA 4HZGA 1ISSA 1PWYE 2OHVA 1Y1LA 2XD4A 3E8XA 3IGFA 1OASA 2DYRC 2KS6A 1C9MA 4B73A 4R40A 4ZU6X 1DJPA 3PNYA 4C43A 3GEPA 5HILA 4F2HA 1FCJA 1SR8A 2ATCA 2IDKA 4YRKA 4A4DA 2HKIA 4MKXA 4ZYVA 5JFGA 2IF2A 3PNKA 2J9RA 5CD9A 1RVV1 2QG6A 1OIVA 1KU6A 1RSZA 1ZIDA 1LK7A 2NM0A 2NUPB 2CZGA 4P3PA 3AERB 1REQB 4DA9A 1FMJA 2G09A 4KUEA 2V74B 4DCUA 1ONSA 2YWDA 3EMBA 3E3NA 3U7JA 3OZEA 2PUVA 3IVCA 3UT5B 4HZIA 2G9NA 1KI4A 1N6IA 3E58A 5LBTA 4BFCA 2E5FA 3KJFA 5FBZA 5C1BA 1YGYA 3NHYA 3TSCA 2B82A 3FR7A 1ECPA 2LDXA 5ER6A 2DTEA 2PVPA 3ND5A 4KIJA 4LY0A 4EY7A 3AVXA 4IFIA 2GPSA 4LK2A 3ER6A 1ADJA 4J0CA 2HLHA 5EPOA 1I8TA 2OD7A 3KHSA 2GBFA 2IU4A 3GB9A 3HCFA 4Y67A 1KRXA 3SXKA 2L2QA 5CNIA 1G21B 4RHXA 3IJ5A 1NYRA 5AVQA 5K99A 1SY7A 3I5XA 3T3IA 2Q0HA 1QIFA 2NADA 3TQHA 2I33A 4WNIA 1GZ3A 1MU0A 3PLAE 1HDYA 1C14A 3UVEA 1YZKA 4EP1A 5DM1A 1Y8QB 1HY5A 1USIA 2IELA 3HCDA 3ND8A 5B3JA 3ABKC 4PFPA 2PQ6A 3GAFA 1QG0A 3QW2A 2VK1A 2XCLA 3H86A 5GQSA 2P9HA 2Z5GA 4EIWA 1U2GA 2ZXFA 2O2HA 1TA9A 5DN9A 2WVAA 3OBIA 5A69A 2BW0A 2D7JA 5B1HA 4DMMA 1TT5A 3HLKA 3KK0A 4EJFA 3AEKB 4NZZA 1R6UA 1T43A 3QFFA 1W6UA 3DMNA 1T2CA 1F8FA 5BSKA 1UP7A 3E70C 1A4UA 2X8JA 3FX2A 1DVRA 1OLOA 2I76A 1NR7A 2VB6A 2NSHA 3CF2A 3DMTC 3JWPA 4MUGA 3BE4A 5COBA 4B4WA 3AUJB 3YASA 3LLUA 3DV0B 3WLPA 5B12A 1Y4AE 2ZK7A 3ONEA 2BJHA 3G2NA 1R10A 4PM4A 3U2QA 1TECE 1ESEA 1XG5A 1AXRA 5SZKB 3RU2A 1YI8A 1E2QA 1KORA 2WAOA 5EYPA 1ADFA 1HWYA 1K63A 2V7WA 3PDIB 3KYJA 4OP3A 3W8EA 3ROQA 5D01A 2WW8A 1LZLA 3PEWA 5JT1A 1JPJA 4XWOA 3BMQA 4IFEA 4MTGA 4GPD1 4KXYA 1JXAA 4LYJA 2QR2A 3JARB 3THRA 1V26A 2QYOA 3IDFA 2ID4A 1HDIA 3IYLW 4KV9A 1GPLA 3NKVA 4DSOA 1MA0A 3I4CA 2Q4RA 1ULBA 5C52B 4GQHA 2OVBA 1XRRA 5DM4A 3RYCB 2LKDA 2HHCA 3NR2A 3WGNA 4OV6B 5C4MA 3ITNA 2QE7A 2QJFA 2WPNA 2A35A 3DTYA 4O8ZA 3RRJA 4E70A 1Y9AA 2WJIA 3KQSA 4EECA 2PWBA 3PEFA 5DYYA 1DSSG 3W5UA 3LRPA 2IKQA 4OI2A 4P8RA 1A8QA 2HMWA 2PS0A 4CNBA 4ZI7B 3DD1A 1XN1A 3VO9A 2YV5A 2V7VA 2FX3A 4BWYA 3HVIA 2NVOA 2DQKA 1C4XA 2WWXA 1TCUA 1LE2A 2B4KA 5GPGB 3IXMA 1CPYA 3OUTA 2BFFA 1DWUA 1WXIA 3Q3JB 3OA1A 2CXRA 2ORVA 4FFNA 2JIZA 3B7PA 4MR8B 3F98A 1T3HA 2PTHA 1KOGA 1E2DA 4QNNA 3RYIB 4L16A 3DAHA 1NXOA 5JAZA 2XGGA 4TMWA 3VXKA 3ICEA 1FDOA 3ILVA 4FC7A 2XADA 2XT0A 3KQKA 1JQKA 5A4DA 1K05A 2BFBA 2OV1A 4RS4A 4EG8A 1KYXA 4R8MA 4JFRA 4XD7D 4ZAFA 5JCOA 4GP7A 3V8MA 4A2CA 2GHRA 1JFFB 3NHWA 1M8JA 2XXAB 2CB0A 1DZIA 2UZ4A 3K0FB 1S96A 4LNAA 1OFUX 3IUQA 4RVCA 3S40A 1I7QB 2GBPA 1RZ3A 5DNDA 2B0CA 2YX1A 3C5WP 2PJDA 4K40A 4MYHA 3SX2A 5M29A 2B8WA 4K9PA 4N0PA 1MRSA 1X3SA 4RHYA 1T5IA 1U6HA 3E7WA 5DOVA 3RYFA 3BMNB 2YH2A 2H00A 3BZUA 3IQ5A 3ZZNA 3NXKA 1PJCA 2DQZA 1FW6A 2GA8A 4BU0A 5KYWB 1EFVB 2XZOA 1V47A 4GC5A 4S3MA 4YXWD 2WQ7A 1MW8X 2XGSA 2I7CA 1E9BA 2AHOA 3VI4B 4ERNA 4GS5A 7MHTA 4BLQA 3DKVA 2AFIA 4FFBB 1A7EA 2XOXA 4QO8A 1ZGBA 4WL0A 2EP7A 2A6HF 3G13A 5D84A 3RYTC 4B84A 3N2ZB 1CUUA 4Q37A 3EPHA 3KPYA 1I2AA 1QOQB 3KTFA 3O0DA 1I4EB 3ATPA 3K4HA 1WXHA 2ZJOA 4MV7A 3KVRA 1HRKA 4PYQA 3MQ2A 1X1AA 1TCCA 3ROEA 3TFOA 4LXHA 1K8ZB 4JBIA 3OQOA 2XS1A 2RD2A 2IYEA 5G0UA 2J0XA 4K6OA 5LQUA 4F4FA 4TQUS 3EYWA 1U7UA 4WGZA 4G4IA 3UT0A 4ZHQB 3O21A 4W5TA 2B8TA 4CL8A 2MYSA 1A77A 1Q1AA 2BONA 4PBTA 3P4XA 1OBVA 3DOIA 3GA0A 1OVMA 2FQQA 5FPTA 1W5SA 5KJFA 1D2MA 1XEXA 2HV8A 4L2IB 4UXIA 1ZH8A 2JG3A 1U63A 4LMRA 3O8DA 1A9PA 1NQOA 3FHDA 4EPRA 2R1TB 2H48A 5K01A 4DV3B 2IIQA 4LZAA 4TVKA 5BWOA 1RFGE 2F1OA 3EIUA 3QWHA 5CX4A 4G5YA 4HO1X 2C61A 2JHFA 2OORA 4HX2A 2Q3MA 4C04A 4YRAA 4B35A 4S35A 3MMNA 1T3SA 1T6ZA 4YN3A 1XEAA 3OT1A 2XITA 2GVZC 4B2PA 4DHWA 3VPAA 5KTPA 5J1SB 5J2TA 4ALJA 1NFRA 1Z37A 3LHKA 3GZNB 5HX7A 5LL6P 1VJGA 1RLUA 3IR6A 4FFWA 3VYWA 3F1KA 1HFJA 3S2SA 2WP0A 3FM9A 3IIKA 2ODAA 4ND6A 5EA2A 5G41A 4HL6A 4XWJA 1GARA 2JKVA 1OV6A 3SSOA 5JFTA 1PSDA 2YS6A 1M67A 3DE0X 5JU6A 4P3YA 4A27A 4JEAA 3T6JA 1P5RA 4DIUA 2IOQA 2REQB 4XX0B 1DEAA 1TUBA 2JVIA 3FGZA 1JXOA 1LVKA 1QMPA 4NAUA 3FUCA 1S6YA 1XZJA 4DDVA 5HE8A 1K5HA 4Z4FA 3H4VA 2PGIA 1YU6A 3NQ41 5F5XA 3VJMA 1LX6A 2A1UA 3LUFA 3U3ZA 1BCRA 4Q9AA 5JD3A 4CG1A 4DLBA 1KP3A 5JT4A 5DX8A 4DC9A 3FXAA 5BWCA 1NUSA 5J2UA 4EFNA 2VT2A 3I2JA 5BSFA 4AIRA 1VBNA 2P4EA 4FCCA 4QICA 4V2UA 5IDXA 3JCUQ 5KYVA 4PV7A 4HQ6A 2IQ5A 2HR1A 1PWEA 2R7VA 2WUFA 2DBQA 3ACCA 1KWGA 4CGZA 3REQB 2IBSA 1QCDA 5EJFA 4HSGA 4TKVB 4TTRA 5KTNA 1FUUA 1XA3A 3QKRB 4MEJA 5MN4A 2VTBA 2PWAA 3DD5A 4L8LA 4M0DA 1S2OA 4YYZA 3CNHA 4KKXB 4CLEA 1K68A 3VKHA 3ANLA 1T01A 4YHBA 2B1IA 3ZXUB 1YYXA 3RIGA 5ALZA 5E3AA 3CIOA 4JJKA 5C8YF 4RX1A 2XVAA 5DTIA 4CT0A 3Q3EA 1DWQA 1U0HC 2BEWB 2I5PO 3VTAA 4RTNA 2Q2QA 1DQSA 1YVUA 5ALHA 1V1RB 1DCKA 3ONVA 4RM2A 3WBKA 5I7OA 2VH3A 4UFOA 4ZJYA 3SXZA 5CVUA 3HBMA 2P78A 3K30A 3EB9A 3JQAB 1C81A 1R0RE 4GL2A 3FMFA 3DUWA 4KZPA 2VCBA 1NXQA 3HMQA 5GM2A 1O95C 4H4EA 1EQUA 2IXDA 1OD6A 3BL8A 5IAOA 3EPLA 1X19A 1GJRA 1TFKB 1EGMB 1NBIA 2BI8A 3AKDA 3US6A 1X8KA 4BGUA 2CVPA 4F3CA 4TTIA 2M6KA 2ZG6A 2W6ID 1XQVA 1ZHXA 1JMWA 3K92A 3QXHA 4HEAJ 4K5QA 1H0KA 2XNSA 1HE8B 3C4JA 5L3SA 3VJRA 2EP8A 3BH7A 2B83A 2JIMA 5L9AA 1Z56C 2EDCA 3BK2A 4G1FA 3HBFA 3IKTA 4DR7B 1LWNA 3OO1A 4HB0A 3WXMA 1IRIA 2R6ZA 2PUTA 1K0UA 2FN7A 4F4BA 4IDNA 4CIXA 5B1DA 4XJTA 2QNIA 5GJWC 4U9DA 3BERA 4HEA6 4CSAA 4LWPA 4Z9FA 2YC2C 5JJKA 4R2IA 4LJSA 2XGJA 2ERXA 3WL7A 2QLNA 1VQ1A 3RJ9A 2QX8A 3I6QA 3K0AB 3LA8A 4CDGA 4DLTA 3LWBA 2CV0A 1SBYA 3LPAA 5L3VA 3K2BA 1M6WA 2ANCA 2BBWA 3OKAA 3PFNA 2HA4A 2H5LA 2MSCB 4LSZA 4BVEA 4BE7B 1MB2A 1RWPA 5CCEA 1NVXQ 4Q7LA 3C98A 4BNJA 5KDOA 1D5WA 1YR6A 4KODA 1JHMA 4QOEA 2PJRA 1YJ5A 4JQSA 5JI3E 5JXHA 4L9SA 3WYAA 1YKGA 4I1UA 5ITSA 2PP4A 3NAQA 2ZIVB 4AMGA 4BX2A 3IESA 5HS6A 1VJ0A 1EQ1A 1MOPA 4EM6A 1UBNA 4WVFA 4E21A 4F12A 5B4TA 1FJXA 4HEHA 4GBMA 5TPWA 4TSRA 4HX9A 2AFVA 4BRUA 1ZH4A 2FTKE 4LGVA 3JSZA 1UKVY 4AZSA 4D9BA 4RC9A 4D8WA 3U44B 1XSEA 3PE6A 4NTBA 2HDNB 2VXCA 2YR0A 4GI3A 3LFHA 1G8JA 4QBHA 4RK1A 5AW9A 2NV0A 4LJAA 5AXDA 3EZHA 2MU1A 4G0QA 5KJEA 4H1TA 3O8OA 1E1NA 2B35A 3PQ3A 1S3FA 3Q0IA 1AQUA 4ODIA 1QDLB 1BBHA 3UWSA 3GARA 1W76A 3U7GA 1SEPA 4DXDA 1JIIA 4RHEA 5ENZA 3TTTA 5CVTA 3HNJA 1JRLA 1VKHA 1PGOA 2WKSA 4NZMA 3VI3B 4FYYA 5M3BA 1AQJA 5DV9A 3AJ9A 1GAQA 3T5AA 4JJ4A 3KOOA 1IQUA 1KQPA 2YHUA 4PS1A 1KDYA 3RTBA 3PEVA 3DLCA 4CU2A 3TI9A 2HREA 2ZE6A 1CDOA 4ZVUA 3GZNA 1LBQA 3WRXA 4ALNA 4Q47A 2J6BA 4XJSA 2XMPA 1K0FA 5ALUA 2Y9PB 1GTVA 1MMDA 1NDUA 4EO4A 1E1RA 3KZKA 5HRCA 2FPSA 2IP1A 2WYOA 2FPMA 3BXOA 3BIFA 3KT0A 3WMFA 3S44A 1W46A 5CB0A 4KXNA 2M4EA 4MWGA 3MLEA 4ESHA 2J0WA 1XRLA 2O7VA 3BK7A 3K9BA 4IQGA 1L1EA 1Z8FA 5AOBA 1KY3A 3THSA 3OO0A 4AMVA 3F4KA 1FFDA 4UNIA 2K2WA 4WOBA 1M5TA 1OLUA 4IGEA 2GAFA 1NAIA 2GCGA 3LHSA 3TIXB 2QTLA 4BB6A 4B82A 4BFZA 1KGDA 2KW5A 1PR4A 1P91A 4PYLA 2DHEA 1WCYA 2PUEA 1Z2CA 4MRSA 2Z43A 1M74A 4FWBA 1NFQA 3KLMX 3H04A 3HV0A 2VQEB 1M76A 1ZM2A 1KEEB 4HTFA 4X92A 4MTOA 4F0JA 2F59A 2GA9A 3M6UA 2J5BA 1WZIA 4N4AA 4AN0A 1T15A 4AL4A 4BNYA 1RXSA 2ZDQA 4K7JA 1E5TA 1AB6A 1B3RA 3DFIA 3VSBA 4D5GA 3PGLA 1XE3A 3LIPA 2P7IA 4HYQA 4JQCA 4KK4A 3GWNA 2XXJA 4I4LA 4K1XA 4F8YA 2A6PA 4BAZA 4OM7A 2VK2A 4O33A 1PYDA 2F62A 3WBFA 1FXWA 3P9SA 3WAJA 3QOYA 3H0KA 4LOLA 4BY9E 3U56A 4ZK2A 1XNRB 5IAEA 3SZ3A 2PLNA 3QVLA 3TE6A 3HYNA 3RS8A 1X14A 1U2PA 1MMFB 1A5ZA 5B3SC 3JTEA 2ES4A 4DLLA 5FOSA 4NTZA 4Z1MD 2FR0A 3BB3A 4AZ0A 5J4KA 3RUHA 5LQJA 3I2HA 3MMZA 1S3GA 3A4LA 3IJEB 3P9KA 4CM8B 3RE1A 4ECAA 4YMLA 1C7ZA 1W93A 2CD9A 1VRCA 2YHAA 3KR0A 5D5QA 5FTNA 4YV2A 1VLSA 3HVRA 5JMOA 1TRKA 2QLFA 4BEBA 1VGQA 2Y4OA 1ESCA 3CNBA 5A4AA 3H4MA 4IAOA 1KMHA 2EL7A 1ZISA 2VHTA 2Q1WA 3QVOA 4YCBA 4ARIA 3G8BA 4XYGA 2FZ4A 3V5YA 3DZFA 2Z04A 3PRHA 4YP9A 4EFMA 4F7DA 4ZEOA 1JA1A 5LNK1 5FH9A 3DNMA 3RARA 1FTNA 1CE8B 4NXMB 3S1AA 2FZGA 1IUKA 3LDHA 2AOVA 4BE4A 1M34A 3GHYA 2E2WA 2C07A 2HPAA 4ZIRB 4GOOD 5D1NA 1R5JA 3STUA 1OXSC 1Z0SA 4FSDA 2A3RA 3QKSA 2QXTA 1E1YA 5LZ7A 2XLOA 1IN6A 1QONA 2PPVA 4A6DA 2CV1A 1TYEB 5C4GB 1BFUA 3S99A 1C80A 1MLDA 2GD0A 4DCMA 1S05A 1CK4A 1QYVA 1ZIXA 1C30B 1YTUA 1DIRA 1JDVA 4RAOA 2P5YA 1R5NA 3RAJA 3NHFA 3C8GD 2IIPA 1QNFA 4N3NA 4PZEA 1P3Y1 4X44A 5JALA 4FKZA 1WKCA 3I32A 1Y8ZA 2ZB3A 1DKQA 1XU9A 4D4MA 2OUKA 4NZYA 1B73A 1IN5A 1QHFA 4MW6A 1JU3A 5F5HA 3FPSA 1AK2A 2EJWA 3TEFA 1QS0B 3MLBA 3RSGA 3HKEA 5K0CA 3QXXA 3GLGE 3K8ZA 5ALRA 3OCJA 1RQ7A 3LKDA 4PC1A 1E6CA 5AHWA 2AWYA 3BRJA 2ZSEA 2QIOA 1XRPA 4U7PB 2ACKA 2OXEA 3FKJA 4KFSA 1T25A 1JHUA 2A67A 2C5GA 3G5LA 4O4HF 4MQ9F 3PC7A 4P58A 5LQDA 3VPSA 2EQ5A 2Q4DA 1QBKC 5IJWA 1JEYA 4S2UA 3L7OA 3WFIA 3ZI7A 1L7PA 4PO9A 1IAVA 5BOSB 3NYQA 5DNEA 3I61A 3LYHA 4YUZA 3MWFA 4KQJA 4MW0A 3WG7C 1WMFA 4EW6A 1NU6A 1TQGA 3A4NA 3QIAA 4JC4A 1HSOA 2H17A 5JLAA 4W8PA 5SV2A 1C1DA 3D2AA 3H5LA 3ONDA 5AQ1A 1THGA 3TQSA 5IC4A 4YJ3F 2A69F 3P32A 4PO3X 1L8XA 3KVOA 1PL0A 4X6XA 5FNZA 3UT6A 1QKRA 3IUEA 3SEZA 1D2NA 3H0CA 1SWVA 3UHFA 1X0VA 4D02A 1E4OA 2VJKA 4ARSA 5E2QA 4G24A 1YF3A 3NVAA 3UUWA 1LDEA 4E14A 2P3OA 1Y5RA 2MJLA 5CPFA 2F8TA 2CE2X 2E4ZA 4MVJM 4PSAA 5I48A 4MHSA 4ITUA 1SUCA 3ZZTA 1NNEA 2X58A 1MGOA 1F60A 2OYCA 1CIVA 1F12A 1YBHA 3OPVA 4QAQA 2OXIA 2Z6AA 3SZOA 3HR7A 1EBFA 1O9BA 3REGA 3CKKA 4UMDA 1KDPA 4Q6WA 2JATA 3V34A 2IHYA 1ZNXA 2DWOA 4MRNA 3PFBA 1A96A 3DDNA 3OEYA 4DL9A 4ARAA 3KBOA 1JB9A 1HE3A 4JSRA 4GSYA 4P6VF 3ZCRA 2VKTA 3C6MA 4FZ3A 3UK2A 2ET6A 3HY4A 1NHWA 1FQJA 1K4MA 3F49S 1JEDA 5B3AA 3AV3A 3STYA 3E9MA 4R7ZA 5FZTA 1NVMB 2AR0A 4FX5A 3SJ7A 1NATA 2H29A 4ZP1A 4DPMA 4QBGB 3O94A 3TBHA 1T8RA 3JVUA 3FWZA 4J49A 4MGHA 4LPSA 4DRJB 1AV7A 4UVDA 3GV0A 2PF4E 4ZDJA 6REQB 5LIRA 4RZUA 4KX3A 5C80A 4Q4CA 2O8EA 1U9IC 4KGZA 5EQTA 2AE1A 2OD9A 4E3WA 3WGIA 3AOGA 1P39A 4UDOA 6YASA 2E4UA 1NJ5A 4TUYB 3QRWA 4A5OA 3EXEA 3FYTA 3K0KA 2XBUA 3DOCA 5CXQA 4U6SA 2CXHA 4B87A 3EZ7A 4XPYA 3LQYA 2W6MA 1EINA 3PTLA 4OAOA 4XD2A 4WADA 3WY9A 4UBMA 3ZBTA 3KLOA 1EJBA 3JX9A 4D45A 1HEUA 3QE3A 3F3SA 3HUFA 3QEJA 3EFBA 4XYLA 1NSTA 3HCWA 5HQ3B 3F6CA 1ZZEA 2PIDA 1R5ID 3T5TA 3WNDA 4IOJA 1SIOA 1A76A 1GITA 1ZA1A 1OCZC 4XIFA 1POXA 4PHGA 5KVVA 5F7OA 1MD9A 1MXHA 1D1TA 1OCEA 5FPKA 2FSVC 1M6EX 1G5ZA 1EUQA 4A2QA 3VAZA 3PC4A 4WJ0A 1EHYA 3L7KA 3QU2A 2G1AA 4QJBA 4UBOA 4CLRB 4CMJA 1PLKA 3I64A 4G5HA 1HT3A 1SBIA 5HS4A 1D6SA 2P1ZA 3OIDA 3DZAA 2AQ8A 3CO5A 3AHIA 1DG1G 2TRSB 7ABPA 1N1EA 2FUG6 4LXYA 1SBNE 1DAMA 1QFYA 3L4BA 1V54C 1GAWA 2BGKA 4FR0A 3A10A 1QGED 3I5QA 2Q5HA 5G02A 2TSYB 1UKCA 1RI2A 3GCGA 4AMUA 3NP7A 2JLWA 4WLOA 3EVCA 3Q7TA 3VKFA 1DLIA 4BJ1A 3FYSA 3H2BA 4IWBA 3OD1A 1NVGA 3IAS1 3WLKX 1VRVA 3UKJA 3IKVA 3K1HA 1J97A 3DE4X 5CYOA 1OBCA 5ALLA 1GPYA 2BUBA 2WPDA 3N0RA 5DZSA 3JAKA 3IS3A 1KQNA 2CV2A 2HUPA 4BLRA 4ZQIA 1OFTA 2VT3A 4GR9A 3H4IA 4X9XA 2O05A 4MI6A 5AIAA 1N6LA 3G8YA 1T6QA 2FK7A 3I2GA 5E1OA 4FHCA 3RFUA 4R0VA 1EI9A 4TXNA 4CR7A 1WUIS 2F67A 1S3SA 1H2BA 2FW8A 2XLEA 3JYQA 2J4CA 3UGKA 4OFXA 5JG7A 2PBFA 4EARA 4IMRA 3ZWYA 2RHOA 3PGMA 5GPBA 3A26A 3HFSA 4HAXA 4WBNB 4YCSA 1AMUA 2Q07A 2HMSA 1RI1A 4KU4A 1HL7A 2BGMA 2B98A 2O2ZA 2ZRMA 3PSHA 4YP6A 3RKSA 2IGBA 4ZQBA 3BCSA 4ZMRA 2QE6A 4CFSA 1C9YA 1TNDA 2B7CA 1JTEA 4MKFA 3EARA 4TMFA 4P36A 3KB6A 2D1RA 1BU5A 2JGRA 4XDGA 1J06A 1YCFA 3GLQA 5ELXA 3EGCA 2XMGA 1L7OA 3KOMA 5GY7A 3VZDA 4IH9A 3ECAA 2RJ3A 2JH9A 3FUVA 1A5SB 2IM8A 4A6XA 4YXFA 3IT0A 4YJHB 5EJIA 1RQXA 4AJ1A 1XLWA 1NONA 5CM9C 1SPXA 2NNWB 3RC3A 4CMBA 2X5XA 5IT5A 2XA2A 2CDCA 5FHRA 1L5HB 3CLTC 5BY2A 3LU1A 1Q0UA 1QRDA 3BFKA 2H1FA 5LMUB 3WGQA 2H7BA 2WLSA 4H17A 1NXSA 4CEJA 2WF5A 2CBZA 2HRQA 1L4BA 1RZUA 2JFWA 2KI5A 3EA5A 5FB3A 3TXAA 3J81A 1XTKA 1PL8A 4TV8B 5H02A 1UBSB 3KJNA 3LPLA 1YUBA 1GCUA 1M1NA 3OLXA 5H5JA 4YMGA 2DH6A 1RAFA 2D0PB 2RGNC 5JWRA 2VP4A 5FWDA 5GZ6A 1UZMA 1Z0DA 4G36A 4CIPA 2DHQA 2XTZA 3A32A 3ZWNA 5CLJA 1R6XA 5DWDA 3VNBA 1E0KA 3OOSA 4NC3A 1IN8A 2OG1A 3BAZA 2FGJA 4ZC8A 2L42A 2DWPA 3ND7A 3I9JA 3R3HA 1OIXA 3EVAA 3GVXA 1Y6FA 5J3JA 1TM7E 1IATA 4Q7MB 4ZYXA 1KRHA 2PMBA 3H0EA 1ISFA 2OFWA 3AEQA 5IJ0A 1DHRA 3R5HA 3HKEB 2WAYA 1ENPA 4R0MA 1Z4OA 3MJDA 4UKDA 1R4NA 2I87A 1UKZA 2N46A 1M8PA 3LP6A 1ZSVA 2FVXA 1MEEA 4PPFA 5CYGA 4OKIA 1JLLA 2G1PA 2CXQA 4PJLA 3DAPA 4P7BA 5AKJA 1Z2NX 2A9VA 4W7SA 4PHTA 3HGMA 3PDWA 4V3CA 3TD2A 3WWOA 2QR5A 5LLDA 1BR1A 3VPDA 1E2HA 4E22A 2XA9A 2H1OA 1UZLA 3AFHA 3FDFA 4QYWA 3CMMA 4MULA 1Q1QA 5L4NA 2VRCA 1V1RA 1VP3A 2IE8A 2W2VA 1N0HA 2R7KA 3SXYA 3I4FA 1Q0QA 2X0KA 1C3VA 2BFEA 3I5AA 3OZUA 4FGKA 1G38A 3K9FC 3HDHA 2HT6A 1QP4A 3LBYA 3G2JA 1E6WA 2VOJA 5AQEA 4BV9A 1LV8A 3A28A 1E9DA 2AT1A 2AD5A 4MJ7A 3VVMA 1WTAA 4UNRA 3D1JA 3KBBA 5HIAA 1BSVA 2G17A 1EFPA 4F56A 3F6RA 1CQWA 1CEXA 2GBLA 1X1CA 2IT1A 1GUBA 3C1OA 4G0PA 4CLHA 5JZBA 1K27A 2PD6A 1GRCA 2DYKA 3GGDA 5EKUA 2AFHE 3D43A 1IHPA 2CXUA 1UZUA 4J1SA 1CUIA 1O3YA 2MINB 3WP0A 1CGOA 4TUYF 3MJTA 2YMPA 4UATA 4C4PA 1ADGA 4EKYA 4DZTA 2PUAA 2VP5A 3HL0A 5C3MA 2QRGA 2DXIA 3EJNA 4HJXA 2O0MA 4ZCPA 4KWEA 4B7CA 3SXJA 1O1YA 2X9GA 1XLVA 4LKOA 2OV4A 1QF6A 1HTBA 2HWXA 5FUXA 2YXDA 3CVXA 3AHDA 3VH2A 3WZ2A 1KMIY 3M3PA 1RWKA 3CEMA 2E37A 4I1VA 5TS2A 1VZ3A 1YFZA 3VYRB 4ENPA 5CG2A 1B8VA 2R00C 3H6KA 4D4XA 2HGSA 2R8OA 4YP0A 4EUHA 2JGJA 2GWHA 2AS0A 1PO7A 4HAYA 2C1ZA 3DJUB 3UBMA 4BQFA 3I05A 1RPNA 1F1JA 4W1SA 4A0RA 4AUEA 4O1MA 2HT1A 2W48A 4GQIA 2EARA 1Q1EA 2IXEA 1BMFD 1DG9A 1HH4A 1LLFA 2NTVA 3B8EA 4WXHA 4QZVA 4MR9A 2AU5A 1T3ZA 1XZIA 2JKYA 5AOVA 2C7OA 1U9YA 3EHEA 4V2IA 5CU7A 2C4HA 4S04A 3HXOA 2FPUA 1D2CA 4MGEA 2ONZA 4B2YA 4N7RA 1OQAA 3BXGA 4O1HA 1VCNA 2PLAA 3NHKA 3ZV5A 4YEDA 4I1YA 4RZXA 3TUZC 3TYXA 3WA7A 5DNYB 3FVYA 1HDOA 4JUCA 5HVNA 1HYBA 4TWZA 2PGAA 5KNDA 2QM0A 4X97A 4PC3A 2FG6C 2ZJYA 2GK3A 1A9YA 3LPCA 3WGTA 1AGRA 4MA5A 2GS9A 2OGTA 1Y42X 4ZVNA 4UM9B 2NU6A 3DLIA 2RBGA 1Q0FA 1KC3A 4WN9A 2L6HA 2HA5A 4QPPA 1U5BA 1A2OA 1RRFA 4GM0A 2R44A 2WQZA 4OFBA 4BYMA 1N6OA 4XB2A 3RVOA 3E9RA 3M33A 3QEMA 4JEBA 3T4UA 4WE3A 1TEXA 3GORA 1YFJA 5B36A 2RAFA 3JD3A 2DSNA 5EE9A 5EP1A 3ZY5A 2VTDA 4FX2A 2HLPA 3ZE7A 2IYYA 3GLTA 3JWEA 4A6PA 3AMVA 3KDSE 1PJ2A 2EGHA 4NONA 3F46A 3EBPA 3OJOA 4MW4A 3VOBA 3VDXA 1LI7A 2H8AA 3KKBA 3OZBA 3TJMA 3QVMA 2PXCA 5AK3A 1EB8A 1H94A 2BM8A 1EGQA 5DE3A 2H2DA 3BG5A 3JWIA 4ZIRA 4CLRA 1VMDA 4PSUA 1YVIA 4DV6B 1IJEA 1UANA 1ODKA 2OP1A 1URPA 1KZ9A 1EX7A 4MO9A 4ZOBA 1JTFA 4D4LA 2Y0CA 2WAXA 3IPCA 1M57C 2L0XA 4ZRMA 2FSPA 4OPMA 4BBPA 3EGWA 3ONWA 2EFYA 5F28E 1JSZA 2HXSA 1HLGA 1OR8A 2ID8A 5F77A 1U3VA 1EVEA 2E49A 1I9CA 2F2TA 4K0DA 4J4BA 1LZKA 1N75A 3V2HA 2RC6A 4WZ6A 1GG8A 3B1YA 3QOWA 4FWTA 3MAAC 2AIRA 5EXPA 4BLTA 5KYWA 1Q0ZA 2H2IA 3EHMA 2C2KA 3UNGC 1NVEA 4W6QA 1DWPA 3ITDA 2EBHX 1TAHA 4OF4A 1YJBA 2PQ0A 4U00A 3QEOA 4WD3A 3RYFB 4ABTA 2Q3HA 1G7SA 1SUWA 1C2YA 1TM5E 3GQBB 3LK6A 2WIAA 1S2GA 1NR1A 3AZQA 4KRGA 4Z0HO 5LLTA 4OD5A 2CDQA 1AHIA 2PD3A 1KO1A 2X22A 3D59A 4ZANA 3G5UA 3HY3A 1DJOA 3FSGA 4FHEA 4CT4B 4M9ZA 2HKVA 3JD4A 4DSNA 5JDIA 2XXBA 4QI0A 4D46A 3UJNA 4QUJA 2P5SA 2X3YA 4OH7A 2O9XA 3RBAA 1W25A 3R76A 1NC1A 1SOWA 3D9QX 4GX1A 2AF4C 3G88A 2DRIA 4FBMA 4HYTA 4RF3A 1XQ1A 1S3IA 3D3JA 3LQ4A 2FQYA 2P8SA 5K51A 3BDIA 3TPCA 2QTFA 1CGNA 4B31A 2J9BA 3IRVA 4FC6A 3B2QA 4ZVOA 4CI0B 3TRIA 2OGUA 1W87A 4I55A 3PWSA 4YCLA 4E03A 3K70B 2JPDA 1V71A 3B1XA 1WPGA 4R9RA 3W5SA 3GZ4A 3N59A 4CM3A 1C8LA 5BMVA 2PX0A 2LCIA 4COOA 2PUGA 1MT3A 4P3OA 5L6MB 2WHRA 2PRZA 4HADA 4Q16A 4Q4HA 4YO7A 1JALA 4JLVA 1J0DA 4YV1A 5A03A 3GLFB 2PNFA 1L5MA 2FWPA 2YJGA 3ECCA 4IBOA 3ETJA 5T41A 3W0LB 5ABPA 3ORHA 4FGLA 3RVPA 1XNGA 4HB2A 4ZALA 5JO9A 4P7FA 4BTLA 5L4LA 1U3UA 2DKOA 1E1QD 2ZJZA 4FNGA 1BAPA 2FFQA 5INTA 3KE8A 4CKBA 5GIOE 2VF2A 3MT9A 3IAM6 4LXUA 2IHUA 1RWWA 1HC7A 4IH1A 3LS2A 3KS9A 2VP3A 3OJLA 4BMDA 5I9LA 4RLQA 3ZXSA 1GPNA 2ODWA 2F3RA 2NXWA 3ESXA 4ZC1A 2ZBGA 4B4UA 1D1CA 1GOTA 1FLNA 3BFXA 5JBIA 2OCXA 3UR3C 2IIVA 1OCOC 3PFIA 4OA8A 3ADOA 4LBVA 4DV5B 5ARBA 1FB5A 5BV2P 4XIGS 2FETA 5EZYB 4MVRA 2WTAA 3K0HA 3DHNA 1EVKA 2JJMA 3D8RA 1E5XA 2XMDA 2VWQA 2Z58A 2CLHB 2XRMA 2FZKA 2JHGA 2PGLA 3DOOA 1W29A 4HAUA 3L1MA 5EJMA 4BO3A 2E9SA 2RAPA 4ZAZA 1D8AA 2Q6KA 9LDBA 3GXBA 5M04A 5CH3A 1IWBB 1VL2A 2WFAA 4QOFA 3DVLA 4AJIA 2SHKA 1MO2A 4J43A 4RKYA 2QRVA 3I2KA 2VDWA 2XKJE 1H0SA 2ZB8A 4EW1A 1TJ3A 4RACA 5AC5A 3DXFA 4I99A 4OXYA 3GQBA 5JE8A 1EFVA 1E1MA 4P1ZA 3NBZC 1OXBB 3OP4A 3CX3A 1OBOA 4C22A 4ENUA 2AOUA 2AUMA 4FIDA 4MDFA 1QBGA 1J90A 2Y1KA 4DIKA 3AESB 4FVTA 5I47A 3CNEA 3OLCX 4R5MA 4LYGA 1T0PA 2CNKA 1QVVA 2NG1A 1Z0AA 2VCHA 3MRSA 5AJYA 3TOXA 4CLOB 3AFNA 3N0XA 1XDUA 4YY3B 5GADl 2O8EB 1Y7PA 4YRJA 3QYAA 4MKGA 2B78A 2O2JA 1WABA 1DUIA 2R0QC 3PYLA 2BEJA 2O8NA 1HG1A 2FEKA 3LIIA 4AWAA 1N34B 3FPKA 5KDLA 1O97C 1MQ8B 4MVJD 1VRWA 2P30A 1NUHA 5CDYA 4ESEA 2H54A 5FV4A 1VJ1A 4O0LA 1THMA 4OEHA 1D3AA 4WINA 1POWA 4RD6A 2PFKA 2MSDB 2YKZA 1JL3A 1FRNA 2J6IA 3ZW9A 4EEXA 1MABB 1NIPA 5FI5A 5FJIA 1J56A 1E64A 5EJ4A 5IM4A 1PN3A 4WESA 3PJRA 1E7QA 3D02A 4WK2B 4WZAB 1W1IA 2ETSA 3ISJA 4M22A 5T6MA 2ZUSA 1RQLA 2C7BA 4L8GA 3L0DA 1T8YA 1YQEA 2GNAA 2NQ2C 3TLXA 1YULA 1THZA 4D9CA 3EQ8A 2XLVA 5JJIA 3D3NA 4KQ2A 2EW2A 1A9XA 1XTTA 1IIRA 5TXGA 3E7PA 3K1AA 1N32B 2C2YA 1O54A 1D07A 1MEOA 3KOWA 1CEQA 1NVAA 2IYTA 4X90A 3OZIA 4LOIA 1KDVA 1GGNA 2DECA 3STXA 5JASA 2OE2A 4BO7A 4KHZA 3CZ9A 3P0EA 4QTUB 4CV2A 1K06A 3TPFA 1HQKA 3B9RA 3FWHA 1E20A 3F73A 3L9WA 5K05A 1BHSA 3KWLA 4MW3A 1PR9A 2GJAA 3SM9A 1ZD8A 2AXEA 3ASUA 3OQIA 4B7UA 2NPIA 4G41A 4K0KB 1SKQA 2JCXA 3C18A 4U5QA 4UD6A 3WQBA 2A5LA 3NYIA 4K9SA 4Q7KA 1HT1E 2UVQA 4BKQA 4E4TA 4QA9A 3ORQA 3OLWA 4AZWA 2AMYA 4RQUA 3PEUA 2ST1A 3W5HA 1RKXA 5JD4A 1UOOA 3A4VA 1ZW6A 2VUUA 1MAWA 5ENVA 4X3CA 1RQNA 3STVA 4Y1EA 3DWEX 1WULS 4GMHA 1WRBA 5F35A 4GSKA 4QT0A 2D2EA 2A1DD 1CZUA 1ZESA 4PYJA 1VIAA 2H9YA 4WDQA 1IBKB 3E5NA 4UW9A 2QBYB 1Y7HA 4CSAC 1KVSA 1X77A 1JMVA 1QX4A 13PKA 3I3OA 4ILEA 3RQIA 3HFRA 1SU8A 2O7NA 1XVLA 3OF2A 2YYAA 5ALWA 3BXXA 3NEJA 3P9ZA 5FFMA 3V1MA 4CFYA 4XJVA 3BD7A 4XQCA 1AKRA 4W9NC 2FQWA 1DT5A 1LJUA 4RIEA 3ZZUA 5BQ3A 1NJ8A 2ZM5A 4US0R 7REQB 1KSFX 1ENYA 2VOEA 1JG3A 2V96A 3G8AA 4BNFA 4M0UA 4TMYA 8LDHA 5LOVA 2W98A 1LM3B 4Q3KA 2IOFA 5K6RA 3NPMA 1S8AA 3V7UA 4CMGA 2JFVA 4V39A 4IXNA 5HV9A 2H3EA 3U7RA 2HF9A 3PC8C 3WLLA 5EE0A 3NASA 1Z6TA 4L76A 2XTAA 1U2RA 3A14A 3MCAA 3N74A 2XKAA 5BNFA 5JS8A 2YJ6A 3ZLTA 3R7LA 4RWZA 8MHTA 1YSCA 2G72A 5IANA 1FVXA 3K6SA 4EKDA 1JFFA 3GLRA 1EXWA 1MENA 3OF5A 3I6BA 1LLDA 1BW9A 1Q14A 4YRTA 1HG0A 3GJXC 1C9KA 1JDNA 1X86B 4JLMA 2CVOA 5T4BA 4G5QA 4CQLB 4R71A 2NT4A 4HWRA 4MGIR 5I5EA 2GXAA 2BJWA 3GMIA 3QA9A 4ZU3A 1E1CB 5EZSA 1Y3AA 3NHJA 5AESA 2YINC 4RVFA 3SLRA 1OJLA 2NNLD 2O6LA 2QPTA 1EFDN 1VJRA 3WGJA 3AQBA 4TLLB 3ZQYA 1J8MF 5CK4A 2QEQA 4Y0AA 1U2QA 3EXFA 4J8PA 2VTEA 3QUCA 4KDCA 3RWBA 4ASUD 5DTRA 2RH8A 4BRWA 4E08A 1NURA 2LW7A 3T6GB 3FSGD 2A2ZA 2J9GA 1GD1O 2WJPA 4QYIA 2BUAA 2OV3A 3RRBA 3U0BA 4YALA 5FUWA 5A2QA 3CKMA 1JQLB 5A6BA 3NYLA 3JQGA 4D98A 1NRJB 1OFVA 2R65A 1U2ZA 2WC1A 3SX4A 3EE6A 3REFA 2ZZMA 2Q7OE 1K66A 1NU8A 3OCCA 2CL5A 4G7HF 2I3ZA 4HLUC 4I19A 4OB6A 3FHCB 1SOUA 1AQLA 1XFAA 1GUYA 3EPVA 1ZVJA 1AZTA 4M0KA 2H1HA 2O7SA 1B2RA 2P1DA 3AH8A 4U0KA 5CLQA 1ZK0A 4N0DA 1FXUA 3FJ1A 4BZZA 2BM1A 4FN4A 4G97A 1GTJ1 2GWRA 3QUAA 3B53X 4FTWA 2O2XA 1KU2A 2JFUA 5EN4A 2W2PA 4C29A 1HW2A 4WXMA 4BV8A 4QECA 1Z6XA 4X64B 4BEWA 3DWGA 4NJMA 2VRWA 4KPGA 2JDID 3F74A 2CVZA 3I9KA 4Q4JA 2BMJA 2IZ1A 3KQNA 3NPAA 1B1CA 2VCAA 1SVUA 4RFSB 4UE2A 2OBMA 4WCFC 5TC4A 1I4ZA 1KZGB 2YVUA 2WD9A 5AGFA 5L0JA 4IIJF 2H8KA 4C7MA 2QK4A 721PA 3U6BA 2WQ6A 1EP2B 1X3LA 4UQOA 5HJ5A 2C83A 2QTCA 1HW1A 1FYXA 3HR4A 4K87A 4MYSA 5EJAA 1KMNA 5LCXA 1L8LA 3VR2D 4AXBA 1Z4NA 4JQZA 3WGMA 4EBFA 4FB4A 3OVMA 4HDNA 2G8NA 1IJFA 3A1SA 5LP6F 1EXDA 2R6AA 2X8WA 3GPIA 4DR4B 3OT4A 1J39A 2ZJ7A 5LNK6 1HA3A 2JZNA 1KJNA 1E5DA 1DAPA 2CNLA 2NU8A 3WGVA 4EF5A 1HFKA 3R1IA 1B6GA 1JI0A 1M2KA 2CVHA 1IWOA 3G6KA 4KNVA 3JSEO 1RWQA 1DWOA 4LDKA 1J8YF 5ALSA 4DA7A 3KSUA 3KUKA 1D9XA 1R4ZA 1XUOA 3NKFA 4J0QA 1N7IA 4K88A 3TBKA 1H6AA 3ASYA 1MO6A 5JSQA 4YNBA 4V0ME 2A4MA 2JFXA 3M70A 1I36A 1NFFA 2XAUA 1J1ZA 3OLVA 3KQWA 4QUAA 5DSXA 4PWYA 3LQ2A 4OOFA 2BIFA 3VR3A 4EGSA 4IGKA 1WUHS 2CHQA 1KI1A 3BH0A 4N54A 3VC7A 8OHMA 2BTEA 3K1AB 1OW7A 4GF5A 2IY7A 2L69A 4JT8A 2GN9A 1DOZA 4TMVA 2Q5OA 2IXTA 3V00A 3ZQ6A 2ZB4A 4U5GA 1H4SA 4UVIA 1PFKA 3SICE 2ZYWX 3KOYA 4XWAA 2Q4FA 3ZHRA 4TXMA 3ZJUA 3OCWA 2MCFA 3NDIA 5CVEA 4G81A 1KH3A 2X9VA 4C0AC 4P4NA 1U11A 3HXTA 3K9LA 4LC1A 3RTGA 1V7ZA 3O4IA 1UXOA 2J0QA 1ORVA 1GPJA 2NACA 2UYOA 1M0EA 3BQMB 4PJNA 3G4XA 4HK4A 2Q28A 1KI2A 5CIQA 4LX8A 1UC8A 4TKMA 2B9EA 1PWZA 2IZZA 4GWGA 5IX8A 3RC8A 2O9JA 2PCJA 3GUVA 1JIKA 4M1MA 4RV9A 1KRWA 4O2RA 1LSSA 1QVAA 3H17A 3IUBA 5BN4A 5KVAA 2I6UA 1KYQA 2P9FA 3NHPA 4PVDA 2V4UA 1WWPA 3K1ZA 4XWKA 4D9FA 5FWYA 2PR2A 5AJVB 4ZYTA 2XLWA 5GVRA 3G50A 1XRJA 3NAMA 4KAFA 3GRKA 4XGKA 3TG8A 2DUUA 3B29A 2OBXA 3N8DA 4R7GA 4I9HA 2MOKA 4MV1A 2TMDA 1UMDA 1DADA 2MR6A 3A6KA 3AR3A 1XMVA 1MH9A 1H5QA 2CL6X 2MSWA 4JLUA 1QO9A 3AM3A 4OQLA 3GI1A 1JFSA 3GRRA 3FSRA 1N4AA 1J9ZA 3K09A 4CF5A 3V2IA 2D2XA 2HHLA 5KYNA 5C35A 3MNFA 5DPMA 3N6VA 4Q15A 2C9DA 2WYUA 2A0KA 3D7NA 3F7NA 4WMLA 3D8TA 3ZS8A 4BB0A 2ZPTX 5KVQA 2HMTA 1U0LA 2J5XA 4RV5A 3MERA 4R9VA 3SYLA 1AS3A 1DV2A 3N8KA 1Z4MA 4YT2A 4R83A 1A97A 5DXFA 2F3PA 1MG5A 3K8QA 1TO1E 1WTYA 5JAPA 1U7DA 2P6NA 2H2WA 2BDTA 3B3QA 4DG8A 5KWSA 2HRBA 2BSAA 4CTKA 3HYTA 3IAUA 3S28A 4DQDA 3HFGA 5CT9A 5HR5A 1X7WB 1WSBA 5IYZF 1KVQA 2F22A 1L4HA 3D6HA 3LZ6A 4M9RA 3T3MB 4Z9YA 4RKWA 1MTOA 5BVGA 1I33A 3MTGA 1GNRA 3GJ5A 3WRWA 1YZGA 2XLCA 2RGNA 4U39A 3BUSA 4OX9Y 2QPLA 4MTFA 3L7AA 1B6RA 4HZUA 4PPQA 2B8JA 3INNA 4IHJA 4E2YA 3L6RA 3KQQA 1QDUA 5FKJA 2DQYA 3IP7A 2XECA 4D6XA 5IMSA 2V6MA 4Z53A 1CR2A 2CYBA 2XKBA 4OBWA 3NFRA 3H3XA 1IE3A 4XR4A 3T3DA 3AJEA 3AR7A 3BS4A 3NTLA 4QYSA 4CKCA 1D8TA 5EIBD 5BYAA 4IIUA 1NLUA 2HSWA 1WHSB 4W9NA 2RH5A 3O93A 2QD4A 1CVLA 3R0JA 3R2JA 4R41A 5JH7F 2P2DA 3CFYA 1U98A 5KTRA 3NOQA 2WAAA 3CSSA 1NQTA 3F7OA 3IMCA 3NHLA 4DEYA 4JDPA 2NGRA 1C4KA 3OEEA 1E18A 5JHGB 2GASA 2J3DA 2FR1A 2NYRA 3UFBA 4D57A 3LA6A 4OQQA 3DFFA 1YNOA 4TQ9A 2PKYX 1Y4DE 1HQCA 2KQ9A 1KK2A 4Z9IA 2YWEA 3DPIA 3GEBA 1ENZA 4D0NA 2QX7A 3CN7A 2W71A 3ELBA 5JCZA 1JXQA 1GRQA 2A9KA 1SVOA 2C3YA 3TK1A 4CLXA 3EG9A 3X2SA 5K0IA 1EUCA 4XGIA 4CM8A 4LMBA 4EPXA 1YVRA 3WWPA 1U9ZA 2B1JA 3PC2A 1AGYA 1XAHA 1E3JA 1RR6A 3IBSA 3P2IA 4PYOA 5A7GA 1NXTA 2GQ0A 2IEYA 1FFTC 1TW3A 3FNRA 3WNBA 1T36B 1NLFA 2VUSA 4R8KA 1EPUA 4OM8A 3F9IA 4N8SA 4B3GA 1RU3A 2VQSA 4HVAA 1NAHA 4NV3A 4EVQA 4E33A 4ER9A 4FIZA 3U5ZB 3ZPXA 3O1LA 1JP7A 4EJ2A 4XPWA 1U0RA 3A9SA 3FKSA 1KZYC 2ZQ5A 3E18A 2ZAMA 3RYHB 2OV2A 1ZOPA 1C4WA 3KP1A 4U4AA 3GFBA 3B1JA 4OL9A 2WJWA 4BV2A 3DEJA 4N82A 3KKKA 1U9JA 4DUYB 4MS3A 3ENZA 4J7CA 3RIPA 4D82A 2J0UA 4M98A 2ETXA 4JFAA 4UUOA 1N3YA 2IXMA 1HT0A 3QVVA 4G8JA 1M7BA 4J07A 4MDHA 5DNWA 3UTDA 2ZWIA 1J8QA 3LC7O 4HI0E 4NZOA 3N3BC 3C7KA 5SYAA 3FWKA 3D3WB 3I34X 3KG2A 3H5VA 3CAXA 1ADBA 4Y7DA 2XVZA 3FHJA 2Y3DA 2B9VA 2IYPA 2JA2A 2ZM6B 3H9UA 1XZGA 3DOJA 5JS2A 4M9XA 2QVZX 5B58T 4WBNF 3MWLA 1EYZA 1TA4A 4L3WA 2WG0A 2GM5A 4IXWA 3A2NA 4YC7A 4NK4A 4CMHA 5B64A 3UA3A 1XWIA 3GU3A 4CKEA 3IT2A 3V8EA 1Q5PA 1D2GA 2V8OA 3AP1A 5F1OA 3WHPA 3JQEA 3SEOA 2OGWA 3ZK9A 4A1FA 1PR3A 3FTPA 3HB0A 5C3UA 2RIPA 5AIBA 1D6MA 4HDSA 2EBFX 2RGRA 2ENUA 3VAAA 5HZGA 4OHZA 5BR7A 3EC2A 4MVXA 4PAMA 4AFNA 3VR5H 5JLIA 5KC8A 2OU6A 1DAIA 1O94D 1UH5A 3I9OA 2GPBA 2LIVA 1BE8A 1ZN7A 2X19A 2ZYGA 3C0KA 3DQPA 3R23A 4H2DA 4KO2S 4B9EA 2FEOA 4DMFA 4QKQA 3STWA 2O8FA 2HIMA 3CH6A 3H9QA 4V0KA 1ZU4A 4WCFB 2JLCA 4EMSA 1T10A 5KX5F 3W8HA 2KWIA 3WS7A 3E22B 5BORA 2A59A 5KWVA 4ZAXA 1N4DA 2ZSUA 3ORFA 4I5DA 4HQRA 2VBCA 2DFPA 2FRDC 2HI0A 3D6TB 2PL5A 3QOXA 1D2RA 1ZM4A 1G41A 3ON5A 4U0JA 5EE5B 3D7RA 3DA8A 1R27A 4G1BA 1LVHA 1N2XA 1QCYA 2ODPA 3QVJA 4R31A 4RO0A 5BQGA 4DVYP 3B6ZA 5FO0A 1WUJS 3E5MA 3FWYA 5K0GA 1CJCA 4OCZA 3N5CA 4NPAA 1UT8A 1S2LA 3EZNA 3NKLA 3N7UA 2OHXA 2F8MA 3QTBA 4QQNA 3STTA 4JY7A 1XKXA 2GYUA 1UPFA 1N5MA 2O1XA 3G0OA 3TBFA 1IVSA 1MNDA 3OQNA 4Q03A 4XJXA 2I4RA 1LEHA 3CNQS 4UFPA 3VU0A 5FI0B 4NH0A 3C6YA 2QU7A 3NWBA 4OAPA 1SXJA 5IN4A 3H1FA 1ZJWA 2Y9MB 2B0HA 1ODLA 4Z0PA 5K3FA 4YJ3B 2HMVA 3DG9A 1QIKA 2H92A 3WWCA 4L0DA 5IM5A 5I8PA 4O59O 2EKBA 5EXTA 1SBQA 1Z0ZA 2HU2A 1ZZPA 3C5CA 5FJJA 1GKYA 4D42A 3WNVA 2AUTA 4W8GA 4Y3UA 3KR1A 4DB2A 1NRXA 3HFJA 1KPGA 3V1LA 1TLFA 1YWGO 1ANKA 1NJSA 4FFMA 1W1UA 4OMUA 2H2HA 3H87A 4IHJB 1Q91A 4KYUA 4A82A 1PFQA 1E85A 5JP7A 5MFPA 3E84A 1AQNA 1QKKA 4ETNA 1VHLA 3AOEA 3BQNB 5H68A 1E2XA 4D0RA 4RDHA 3QPVA 3I30X 1QZTA 2QTMA 3EPJA 4O3MA 1JVNA 1K6IA 2ZOSA 3RF6A 3VX4A 3ZH9B 1ORHA 3MWGA 1CIPA 4ZT5A 2AG8A 2IGTA 4DM3A 4ES6A 3EEBA 1EXMA 3K09C 4HF7A 3WLHA 3CVVA 1N2BA 3TZQA 3UIEA 2WNSA 3DCIA 3FUTA 1IRXA 1I6LA 2EQAA 3UCFA 3C1UA 1HYGA 2VJOA 3C43A 3DZ8A 5AYVA 3S5UA 3T38A 3WQRA 4BBZA 1XVTA 2JFBA 3ZDZB 5LR6A 2FWRA 3C3PA 1WR8A 3UF0A 2WJAA 4HVCA 3RSQA 4UPEA 5DQTA 4RTSA 1A4RA 1UBTS 2JEYA 3TQRA 3OPYI 3U0VA 3GPLA 3DE8A 3FPEA 3O4HA 5CG1A 4YRQA 1YJGA 1F8UA 1FL9A 1PEYA 3LKBA 1U7PA 3FLEA 4E2XA 3H2ZA 1Q0GA 3TMYA 1FDTA 3UAOA 3B52X 3CZMA 2CWWA 3LLMA 1U4NA 4PFSA 4QU8A 4IDEA 1WCWA 4NEHB 1MFZA 1TKRA 2PMWB 3GFFA 2WTUA 3DEIA 3WYGA 1MXFA 3AF2A 3FHOA 4HQFA 1OBFO 1XHFA 3LF1A 2WJZB 1ZMBA 1BJTA 2FX2A 2ACWA 3O9VA 4RY9A 1HXHA 1YZFA 5LMNB 1W6RA 1Z3IX 3BIWA 3KKQA 4IKPA 4MVOA 1J8VA 4M89A 4WCDA 5AI5A 5YASA 3BCHA 4TN5A 2JFPA 1ESNA 1RE0A 3AUXA 1QV6A 3B6EA 5DW3A 2XQFA 4QTXA 3U3MA 3N76A 5IM4F 2GBLC 3NAZA 1YQUA 2BEUB 2QAIA 3EUEA 4HS9A 4MKRA 4MYUA 4C1NA 1A9TA 4YRNA 1N7JA 2ZXEA 2I4MA 1GPWB 2HF8A 4Y1RA 3G7UA 2BGGA 2QG4A 2G4VA 2WV9A 4WUTA 5AVUA 4ZPJA 3I01M 2VDVE 4URXR 5EJ5A 5JC1A 3OZXA 2EFEB 4LJ6A 3SFVA 2XV1A 3ZU6A 3I9NA 4DLAA 1XCBA 3NTVA 5A5VA 2PXAA 1MOQA 1Y9JA 4FGUA 1QG2A 4QWMA 5CA1A 1IBLB 4NBKA 3ENKA 3LKVA 1XHLA 3F7MA 3T06B 4JJ8A 3ZGYA 1XCGB 2GM4A 1YZHA 1G18A 3SE0A 1MBZA 1J07A 3A6HA 4R8VA 1S8OA 1XTBA 2AYZA 2R6HA 4FYWA 4HXEB 1VIYA 4NYMQ 5I45A 1VIVA 2WTMA 1SZDA 4IZ6A 5PGMA 3REOA 1OE0A 3ZV7A 4IGAA 4EG0A 5COGA 5BSEA 1KPIA 1MOSA 3A7EA 3MSCA 4QNRA 3OQHA 2O06A 4EKWA 3SK0A 2XUZA 2I2DA 3CBQA 1T9CA 4CETA 4C3EA 4AROA 2C1XA 3ACBA 3GJ7A 2B37A 1Q83A 4AKTA 1ZD1A 2W6CX 3PQCA 3SKVA 5K8LA 3ZD9A 4DZZA 1UWLA 2IUEA 3TZCA 3VBEA 2P9CA 4D9KA 1E3WA 1GKKA 1W9MA 1E0DA 2GNPA 2J1LA 3FVQA 2JLRA 3K4QA 1X7ZB 3NW9A 2AMJA 2O0KA 2P6VA 4L5BA 2PVSA 4KQMA 4IIXA 1G8YA 4ZJZA 4GP6A 1E6UA 4BLVA 1QGUA 1OW6A 4GC9A 1TI7A 3OU7A 5JRZA 1LS1A 4J3FA 1TW2A 4H7PA 5ALPA 1FK8A 2NPUA 2PV0A 5GGYA 4HH3C 3RC2A 3ESZA 1B41A 1TF7A 4DDWA 5KNCH 4Y7CA 3S1SA 3AHGA 1GQ2A 1AKQA 3SNHA 4DRXB 4FDAA 1E7YA 1KR5A 2W4QA 1NW8A 5BYJA 4JOSA 4KN6A 1F48A 1LDBA 1V7PC 2BEWA 2JAQA 4PGHA 4YT5A 2ZJ0A 4QEKA 4DW8A 4YRPA 4PLHA 3MTBA 2N42A 2CJWA 4A92A 2AEFA 2R8YA 3ZU4A 5JS1A 2WIJA 4KXLA 1FUEA 1L5LA 4O08A 2R8PA 3D7MA 4JCZA 3HRHA 1H8EA 1SVNA 4NECA 3VNUA 1S8FA 1KEZA 1P0PA 2B36A 1IIBA 1PT9A 2PR7A 3ZVNA 2CMFA 1FFGA 3HA3A 3AG1C 1IOVA 1EQ2A 1F3LA 2B2XA 1VJ5A 4P0QB 1OT3A 2GFQA 3WWZA 3AGQA 3WODF 1FFBA 2VBFA 2H7VC 3O83A 4N6GA 3TGPA 1G8SA 1P1IA 1S89A 2ZWMA 2OGZA 3DBLB 3FMIA 3HKCB 4GX2A 1FZTA 2PLWA 3QY9A 4QPZA 4ZEMA 3ZJTA 5EZ6B 4UMFA 2EPKX 3HZOA 4KYVA 3PNPA 2C94A 3PNOA 4TGLA 5IF3A 4H3KB 1UXJA 4MQFB 5AH0A 1CUBA 3IUYA 4KPYA 4JLOA 2ZSHA 5CEJA 1BCRB 5D5PA 2NP7A 1WDTA 2D00A 2X9LA 1BX3A 2NZUG 5CBKA 4B1FA 2QTWB 2BFPA 3FZGA 3JSXA 1L5ZA 1ZOLA 3SF8A 1MIOB 2IZ7A 1QVXA 2ZVPX 1TL7C 3PHIA 1IC6A 2WFLA 5ALEA 5LYJB 2X5NA 4KR3A 3LNMB 2R87A 1ZK4A 3GLHB 4D9NA 5AUPB 3SHFA 1OCRC 1P7WA 4WBNA 4QUHA 2X0CA 3RG8A 1K6JA 4LACB