2YRFA

Crystal structure of 5-methylthioribose 1-phosphate isomerase from bacillus subtilis complexed with sulfate ion
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
340
Chain Sequence
SVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioribose-1-phosphate isomerase
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 103
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yrfA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yrfA02
3A11A 1T9KA 1W2WB 3A9CA 1VB5A 5DBOA 4ZEOA 3VM6A 3ECSA 1T5OA 2A0UA 2YRFA 2YVKA 4LDRA 4LDQA 4ZEMA
chains in the Genus database with same CATH superfamily
1E3WB 3BYZA 5LL6P 1H6GA 1SCNE 1QDUA 1SUPA 4YRSA 3PQ2A 1I1QB 4CM5A 3JT1A 3FZYA 4TVKA 2R8EA 4ITUA 4ZAFA 2VASA 3VOSA 1PWEA 3VZQA 2QE6A 2IKSA 4BV3A 1KI6A 3C74A 1FIUA 3B8EA 1J5PA 2YYZA 4OQNA 1C3XA 1ONOA 3GLHA 2C2OA 5L3RA 5J1TB 3EXEA 4OFBA 2FVYA 3CVJA 4YRRA 3C62A 1WXGA 3EEOA 5BUZA 2Y71A 1NI4A 2C8VA 4AUNA 4CR6A 5A4AA 3MMSA 5FR1A 4AQYB 2O07A 4RO0A 5CIVA 4P1ZA 1Z2OX 2QTZA 2XE6A 3KQUA 3CO5A 4GKAA 2P9BA 1Q19A 5ALFA 2DKFA 4RY0A 1D2EA 1UKBA 3IVGA 2V7QA 2EBHX 3NHUA 4C08A 4L50A 1EJ6A 1QRDA 4AM8A 3RS4A 5F77A 4C0HA 1YIOA 3BT7A 1JAYA 5L7YA 2FJUA 3N0TA 3W3AH 2JI4A 2H07A 3JVUA 4NPAA 4XIGS 4F38A 3KU4A 1SURA 2AVKA 2A7XA 4DLUA 4ZV4A 4G0NA 5BSVA 1CFJA 2VDLB 5DP1A 2HIMA 4GD3Q 2D5AA 3NH9A 1N6IA 3GVPA 3TSOA 4OXYA 3T4PA 1U0SY 1IMJA 4MI1A 3RHSA 2OFFA 3ZW7A 2IY7A 1FFCA 3P5SA 3CLKA 3W6ZA 5L40A 2R5NA 5EKXA 5BWNA 2G67A 3C4VA 4WABA 4BE9A 2EHDA 1DWOA 4X1IB 4DPMA 4ZYLA 3SBEA 4Z8YA 4UHEA 5ALYA 4YFYA 2UYGA 5FOUA 2WJJA 5DXJA 2WWWA 3EK2A 1XZKA 4HDMB 1VHWA 2ONZA 4JT4A 3OQIA 2EEZA 1FMTA 1V8ZA 2ZVQX 1E66A 1XKLA 1JLKA 1E69A 4FQ8A 4J2HA 4XPWA 5CA1B 4RFVA 1KK1A 4KXLA 3USES 1SR2A 5A3SA 1NFFA 3PFCA 4MUEA 2O0LA 1XP8A 4I1MA 2VXYA 4MB2A 1P1FA 1UFQA 5I9NA 3S84A 4FPXA 3UUWA 3HEBA 5IJ0A 5EIWA 4HBGA 2DMRA 2MYUA 2Q3CA 3NOXA 3GLGE 2C42A 2VHCA 3RC8A 1KU6A 3QHAA 1MH1A 4A8HA 4GW3A 1M76A 3ZV7A 2P27A 1EGAA 2AD1A 3AVOA 3A3YA 3OEHD 1UBHS 2X4IA 1KAGA 3N1UA 4PRZA 2VUSA 5MGNA 1SUAA 4WZBB 5CTAA 4RVFA 2WWFA 2ZREA 5CU7A 2NXJA 1Z13A 3DO8A 3U16A 1Z6YA 3P9YA 1IZ0A 3IDOA 5D1HA 1S8OA 2A9VA 3TXYA 1TA0A 3H83A 2PWPA 4GLLA 3I53A 2G7MC 5JUAA 1QORA 2ZR9A 1JR2A 2YZGA 5JMWA 5ENDA 2RGNC 1YACA 3D81A 2B1QA 4CIAA 4L72A 3AM3A 3KJXA 3BHNA 2DKNA 3DO6A 2GEJA 1S2OA 1QHNA 3GLFE 1RQPA 2I33A 4GX5A 2JGLA 3NTUA 3DEYX 3IXLA 1CVIA 3FPGA 3VDRA 3HZRA 1NVBA 1YAUO 4NPCA 3SHTA 2WHPA 1Z6TA 1BQEA 2W2LA 2NVWA 1UBJS 5EJEA 3OMLA 1EVLA 4QVIA 2F1RA 2Y77A 3PCVA 1J21A 1JRAA 1ZVZA 2Z2XA 1JF8A 1H8ED 5A06A 2B5WA 2IM8A 1UKEA 2RMKA 1TQ2A 1RVDA 1GYRA 4K9SA 1X1CA 1PZNA 1A1SA 3A6FA 4X84A 1OX6A 4YJGA 1UK6A 1BHJA 2C9CA 3Q2IA 5A6VA 2ZE6A 2JIPA 3U61B 4KXYA 2AJDA 2Q46A 2EILC 5BMVA 3X1MA 3KEOA 1RYBA 3HKCB 3T12A 4TT8A 2ZYGA 4GLOA 4RDXA 1NLYA 1HT1E 3UIEA 3K3PA 3UH1A 4JBGA 1WNTA 2ZIXB 3QUSA 5CDFA 4YBZA 1HBJA 2IIQA 3U56A 1KZ4A 3Q3HA 4CIVA 4HRXA 1N1CA 4BNKA 2P5UA 1TTTA 1O5OA 2PFDA 1D6MA 2R25B 2QN3A 2ANBA 1MVLA 2DB4A 4S1PA 1GG5A 1SIBE 2HF7A 4FEAA 4R98A 5BSRA 2UZ1A 2XUJA 1ZYRF 1GPAA 2XOKD 4IV0A 1YHYA 1C3VA 4PHFA 5AW3A 5DH9A 1PZHA 2R751 2J59A 1Q95A 4Q21A 4OSOA 1T1GA 5IAOA 3HB9A 5AOCA 3QXGA 1FDWA 3OHMA 2X5NA 3DJFA 2XL6A 5A71A 1OHHD 5E6UA 4JXXA 3T15A 2ZB8A 4DJTA 2QVCA 1A9YA 1IN6A 1LPMA 5DN9A 2XCSB 2NIPA 3BFJA 4ZVSA 1L9KA 2Q2NA 4UHDA 1WF6A 3FSGD 4QDLA 3RQIA 2R8YA 3O3CA 4E17A 3KLOA 3FD8A 3V55A 3GWNA 3OOHA 1LQ2A 5FL7D 2C97A 2YIMA 3OFVA 1KL7A 2WOOA 4P3YA 2F3UA 1RAAA 1WCXA 4H35A 3VR0A 2LCQA 3IKJA 1LDBA 4YRAA 2ZXUA 4JCHA 1MA0A 1REQB 4ENTA 4E11A 4PRKA 2UVQA 3WWDA 2NUTA 1L7BA 1JLRA 3HU3A 3W2GA 4LA4A 3S9OA 4TX1A 4D45A 2QM3A 4HGPA 5F3DA 2ZYUX 3EEIA 4MVJH 4OUDA 3WGIA 1ISJA 2EZ4A 4S1OA 3USZA 3RJZA 1LWOA 4U7JA 3VR6D 2AFRA 1V43A 3LQ2A 4DNXA 3GFFA 3HBMA 1DC5A 2C4NA 1PEYA 1G3RA 4A0FA 4OI2A 5ETJA 3KR2A 4LZPA 1JA0A 4JCCA 1QOPB 1SCDA 2X2FA 3WIBA 3DBRA 2G1JA 5CX1B 1X7YA 1QNLA 4E5PA 3N8IA 4QTZA 4A4AA 4Y0NA 3WL5A 1WETA 1VIMA 1Y9JA 3E82A 1XLTC 2HIGA 1JB1A 4WJZA 1P9NA 4H16A 4JT2A 3BSYA 1PBNA 3RWOA 3EGXB 3H4VA 4L95C 3L0SA 2LK4A 3I2JA 2WTAA 5KJEA 3SDZA 4PPGA 1BHO1 3DCYA 3WWCA 4XD7A 3LWBA 2IITA 4JJZA 3UJ3X 3W8FA 2WWRA 1WDTA 3KQKA 4UPVA 3REGA 1YFJA 3OLXA 2YWXA 2VT7A 2I67A 2VJMB 1ZUNB 5B1YA 2P9GA 1JFSA 2H85A 4J0EA 1T2VA 4LYJA 4G7OF 3HXLA 1W2WA 1CNMA 3HCFA 2VHJA 2PRJA 2R1ZA 4P4SA 4QOEA 3IXQA 4HDAA 3G50A 4REQB 1C2YA 4QE3A 1R3UA 1KMHA 2XNDD 3O39A 3GFQA 3ZC4A 2DHQA 3GARA 1GZUA 1OJ7A 2I4IA 1OZAA 1LTHR 3LDGA 1EGVB 4XM1A 3K0SA 5IKOA 4CLXA 1E20A 3M6IA 4QNMA 5T6MA 2GCPA 3GRVA 3WDKA 4I3HA 2I15A 3VYWA 2CMHA 1W5SA 4V39A 3TD9A 4PCVA 4OYRA 1QX3A 3DVAA 1ACLA 3QKRB 3L8EA 5ALSA 5CPFA 3CSDA 3AB8A 4XXHA 4Y6QA 4B6GA 1NOIA 1U8ZA 4RY2A 4CG0A 4KUGA 3CX3A 3UGOA 2GZHA 4XX1A 4CF7A 3HHEA 4MGZR 5FEUA 2AMFA 1J20A 1OPXA 1CQXA 1TQ8A 3BSSA 4NU0A 3MSCA 5K6TA 2XAAA 3EAQA 4JKVA 1RHUA 3HXPA 1MO6A 2X86A 4RE6A 4J1TA 5KYTA 2L9JA 2I6XA 3DDOA 4N8DA 3ENKA 4LDPA 4MJLA 3ROPA 3QF7A 3ZQUA 1JTEA 2ZANA 3LP6A 2ETSA 3V2IA 1P6XA 4DLYA 2O5EA 5FYDA 4ZYWA 1TFOB 4R41A 3WHKA 4TTQA 1HZZC 4GBJA 1SCAA 3HV0A 1Q12A 4YAGA 2RI0A 4GOLD 2PYDA 4CLOA 2H7VC 1SHZA 3TOZA 1XHLA 5J5CA 5BNTA 2XRZA 5E9WA 5K6AA 1UDWA 1ULSA 3V4FA 1O87A 4NMWA 5F1KA 5CVVA 2A94A 1JP7A 5DNAA 2HMUA 2Q9CA 2GAJA 1D3AA 4PE5B 1O95C 3OCCA 3ZD6A 1XYYA 4OXQA 5HOEA 3IS3A 2D1QA 1WG8A 4URXR 5LXTA 1KXJA 3GP3A 1H5QA 5DHRA 2P6PA 2HQSA 1DBVO 1E1YA 2A86A 1Y1RA 1NRXA 2VYND 1I1OA 1O58A 4OEHA 2ZRLA 4W1SA 4B47A 3AFOA 4AMGA 4RA9B 1DQPA 4CCAA 1JWLA 2LE0A 5A62A 3OHPA 4DHWA 4G8DA 3VC7A 4DW8A 3Q7RA 2I5PO 3SGLA 5L0JA 2OBMA 5LZ2A 5HJ2A 3NWOA 5AVWA 4MUKA 1CB7A 4K9RA 1V39A 3IB3A 4LX8A 5L53A 1J8YF 3NAQA 4C4YA 3O95A 1DLJA 1KI1A 2JLCA 2RAFA 4QNRA 3BJIC 4EH1A 4FINA 2QW8A 2WI8A 5AC4A 1XJQA 4M8LA 3LUFA 3KAPA 3HYSA 3H1GA 3O73A 2OVBA 5CT6A 4PY2A 4ZREA 2X7HA 4H0FA 4Z0HO 3D4PA 3J81A 3TTVA 4O4HF 4HAYA 5GIOE 4CTKA 3DFUA 4RV4A 3EZ2A 5L0CA 2WG0A 3WYFA 3JQAB 1TR2A 2DHCA 2VDRB 5IVKA 4CDVA 1TCCA 4MDFA 1XAGA 4UUAA 1WMDA 3EVBA 2ZJOA 1NYQA 1R6TA 3CLHA 1TFUA 4C22A 5JZMA 1G8KA 1AKEA 4EAAA 2ZB4A 1MEEA 3GVCA 3MB8A 1YU6A 1HNWB 1DBWA 1R66A 2XDWA 3O0TA 5F51A 5JJ5A 3W3AA 1ZSVA 4MV5A 3X1XA 4DR6B 4ZYUA 3X1YA 2GRJA 2Q3JA 2PUWA 2P6VA 2HQBA 4OD4A 4FIDA 4G56A 1DAOA 4MUNA 1FFBA 1ZLYA 3I09A 5HE8A 1Q0ZA 3Q8XB 3HJGA 4AG3A 3V5ZA 4MVQA 4CIWA 1B6TA 4YRQA 4AN1A 3DT6A 4DDUA 4CEHA 5JLIA 4ARZA 4E4YA 3D0KA 2X4LA 1E9AA 3OZAA 1WGWA 1MZVA 4CKBA 1FTNA 2Q5LA 3SYNA 4I55F 4R69A 3I0MA 4WVFA 3EQLF 2CFCA 5IXSA 1VPLA 5LCXA 1HZZA 3WJ2A 4EHNA 4R5HA 4CLHA 4ADSG 1MAWA 3AVPA 5DM2A 2ZQZA 2Z83A 4WZAA 2X0FA 3ZGZA 3EBOA 2FDXA 2J87A 5DI3B 4H1UA 1XALA 4YUZA 1RRVA 5C18A 1T6QA 1PW7A 2P0NA 1ZDMA 3GN2A 4QASA 2CNNA 1STOA 4YT2A 1GN9A 3ZTYA 1AVTA 3DGFC 2YNMD 3UK0A 4IMIB 2QRKA 1D09A 1O95A 2ODTX 5KNCH 3AGUA 4GPZA 1YMUA 1NXPA 4YRDA 4J0IA 5C34B 4KMOA 1H42A 1AKUA 2ORED 2F8LA 4PQGA 4J30B 1IVNA 2WSSD 4IH4A 1PE0A 3JWEA 1Z7WA 3ONNA 1N9KA 3LLKA 3U62A 3OZSA 3DO5A 3WIDA 3K6BA 1Z22A 3AL3A 1W7AA 3JRNA 3WGTA 2ZI4A 4WUTA 1M0EA 2FZEA 1VG8A 3G2HA 1XEWX 2DB3A 1T5IA 5DSTA 3LXUX 3ZNQA 4B8ZA 3UWSA 3JQDA 3Q40A 2X2EA 3ZCQA 3U0CA 2OC4A 2YRXA 4QHTA 4LPSA 5LUBA 3A1UA 4YR7A 4J03A 2FQQA 2LCIA 3ZKWB 1C0KA 4NXNB 4AZ0B 3DE4X 4PBTA 1N2XA 4P53A 1D0ZA 2PA3A 3KSBC 2LNDA 3BA1A 2Y2UA 4EPYA 2WYIA 1AJEA 2AXNA 5AUOB 1AG9A 5JECA 3AERA 5HTKA 1ZUHA 3O8QB 4AW9A 3EZ7A 1YMQA 4KRFA 4TTIA 4QNNA 4UEOA 5FLYA 3N05A 3WLIA 4Y2UA 2HDWA 3F6BX 4QTYA 3SE7A 2NZVG 1SC1A 1Q74A 1W35A 2OO7A 2VK4A 1E1CB 1KY2A 2ZRIA 1BS1A 1OAOC 2BKUA 4DUGA 2GBIA 4HE8D 4YV7A 4ZT5A 4UE2A 1VP3A 2QYOA 1MB2A 2E21A 1DOHA 1FDTA 2JJQA 1QGAA 1DQYA 4Z1MA 1U0HC 1V1RB 4WNCA 1WSWA 4TTJA 1Z5OA 3NBQA 4NOLA 2BBTA 2HJ9A 3UAVA 2JJ2D 1UJ4A 2OV2A 1MFPA 2VHXA 3GZTB 4J0CA 3NKFA 2JZOA 4P0QB 2G28A 2W83A 3BVPA 1DIAA 4O4IF 1U2SA 1H6BA 1SVLA 1Y1LA 3JWJA 2VPWA 1DAIA 2CYDA 1CW2B 1VLTA 1HDEA 1G41A 3D4LA 2IZZA 3X1WA 1LBHA 2Y69C 4JB0A 2FOLA 2QL9A 3PCRB 1H9TA 4HD8A 3ZE8A 3H9CA 2V7WA 3SEZA 1Y6DA 3T7SA 1I4OA 1TM5E 1GPMA 1IBRA 2HJGA 1CU1A 3W4JA 2E82A 5ENZA 3FMGA 3AR2A 1HLFA 5JNLA 3P9IA 3ID6C 1IZ9A 3A6DA 1SZPA 3PNOA 1HT0A 5KDLA 4ASUA 1NE2A 3N7AA 2I6QA 1CF4A 1SHLA 4DJFC 1WQ3A 5L4LA 4RFSA 4B35A 3R7DA 2WSLA 4RJJA 4FVTA 2XVZA 4MIKA 3G2PA 2YN4A 3FHDA 4XB2A 5BYAA 1K40A 5ALQA 3TH5A 4I46A 3SX2A 3C8GB 4E7OA 5DDIP 4M37A 5LYJB 3QEBZ 1COWA 1X39A 3HNPA 2FUEA 3PPIA 3BMQB 3B2EA 4GE0A 1NM5C 1PS9A 2O8BB 4I8IA 4YHBA 4GRIA 3QPCA 1WX1A 2P11A 1ZN2A 4J0FA 3DOCA 2XRHA 2WT9A 5C1BA 5F78A 1FU4A 4QGGA 1N6RA 3PRYA 4BFYA 3FPLA 4TTPA 1HR0B 2Z4TA 2GSDA 1H23A 1GZ4A 2XMZA 1WW2A 4KGVA 5F5NA 5DU2A 1MPXA 4D9MA 2LKDA 5DRYA 1YUMA 5DGCA 5K8LA 4EKNB 1WUIS 3WWYA 1YA8A 2JIRA 2KB0A 3GH3A 4HFFB 4RGVA 3P9CA 4UNRA 3RYFB 4Y0AA 5HMMA 3T6GB 3EXG1 1OW6A 1TO6A 2ICAA 3B2QA 3ZCPA 1ORRA 3CUUA 4BVEA 3G2QA 5AJZA 3BM5A 4MIEA 2WJGA 3FDIA 5LP6B 4GI7A 2QAJA 4KYUA 3JQ7B 4LRSB 2B7CA 1FRVA 4PSCA 3W5IA 2DY1A 2YL2A 3QWHA 1T6NA 2QLLA 4WBXC 1MLDA 3JYNA 5KCMA 2B0HA 1IPHA 1ZXXA 5IZCC 4MVJA 2GJ9A 1D1QA 2YHIB 4AIIA 2YMMA 2J9FB 3MYIA 4KXNA 3ZGOA 1XRLA 3NKEA 5IBPA 2RHHA 4GPBA 3O1LA 3LM8A 3M6VA 2XUZA 1C0EA 2QAGC 4EDHA 1ND5A 3A1FA 1WL8A 1RFLA 3DHVA 2P3OA 3GU3A 1YZCA 4DCNA 4X20A 3WJ7A 3PD1A 2AF3C 3V4SA 2D54A 1E2EA 2H2HA 3CKLA 1NOJA 2PQMA 3WOVA 2ZUVA 3PNBA 4XUGB 1PJ2A 2HHAA 3I12A 2BUAA 3SF8B 1JRLA 6ABPA 1NZFA 4YMWA 1JYFA 2N46A 3CVVA 2VDOB 1N6KA 3NWPA 4HLNA 4BFVA 1Y7PA 2PS3A 2BFNA 3E1GA 1X42A 4J3JA 4LOKA 1YWGO 3SFZA 4TVSA 1T9ZA 2YXEA 5EE1A 1BCSA 1GCGA 3ROFA 4FB5A 1NMYA 1U1DA 5IBCA 1O5TA 2ZUFA 1MJNA 2PVCA 4LXYA 1I2AA 4BC0A 5E9AA 3EQZA 3OOWA 3NORA 3LG2A 4L27A 2OHGA 3UMIA 2OZLA 4TUYF 2OQRA 1FU7A 3NVKI 2CDQA 1KEUA 1SOMA 5FFNA 5FOXA 2HL6A 3T5CA 1IONA 2IZ5A 5C8YF 1HMYA 2WJ6A 4WZBE 3H6HA 1VA4A 1ORJA 1CPRA 2BN4A 3PICA 5DM60 4CFZA 2UUAB 1OFGA 3TJ6A 3SZRA 3LESA 5FI5A 3L7BA 3UFBA 1J6UA 3IL2A 5K09A 4QECA 3SXPA 4MV0A 2A9FA 5KKNB 1SMKA 1ZGZA 1UBCA 1SBTA 3CZCA 1QG0A 3R0ZA 1UMDB 4X8HA 4PSVA 2RGCA 1FDOA 4JP2A 1II8A 1MMGA 4QGBA 2OV1A 3DZJA 1SKUA 1X87A 2R4TA 4C7VA 4HY3A 4LTDA 3ZGXA 4C29A 4CQLA 1P9LA 1LSUA 4R5MA 5FQOA 4I19A 4MW0A 1C1DA 2O2DA 1I7NA 3KTFA 2X51A 8AT1A 3NP9A 2PX0A 3WLEA 3EWNA 1VL5A 3AF3A 2ZXOA 1NAHA 1M6WA 1O54A 2GFQA 3GA7A 3DOJA 4MRSA 5BRNA 1EHIA 3KLBA 1JQLB 1WXDA 4ETMA 1ZHYA 2BGKA 4KK4A 1FSGA 2ZTUA 1NW4A 4LI3X 1X1DA 3JQ8A 2VQFB 3ONWA 5TVGA 3UPDA 4YA6A 4EZIA 2EJCA 1D0VA 1XTBA 5LOVB 4C4TA 1HE1C 4D0SA 3WGMA 3DVSX 1VCHA 2J9GA 4XASA 1SY7A 4CHGA 2N1MA 5BOSA 2FZVA 2MINA 2UAGA 1B0UA 3HWX1 1GA1A 221PA 2EL9A 3QWIA 1R2QA 2ZZKA 2F9LA 3DDUA 3EPJA 4OHPA 5FX2A 3ZZUA 3ZI0A 3E61A 5JDCC 3NH6A 2WMDA 4PZ9A 4MAMA 3PRKE 1ZM7A 5CG2A 3BF8A 3LDHA 4LWQA 2NVOA 2X8JB 3GJ3A 3H0KA 3QHQA 3LS0A 3MD9A 4JBYA 4MQMA 3F6EX 1V7PC 3LVQE 2HLPA 3BEDA 4EHAA 2QRMA 3SHWA 4OB8A 5IS2A 1PJRA 2BPOA 521PA 3E8SA 5AW2A 1MAVA 1U9YA 3A2NA 4LZLA 4I6EA 4JUFA 1JEYA 3MS7A 1R0CA 3R7SA 5JRJA 3MOIA 4XUCA 4ACAA 1KH3A 5IBQA 2CYBA 4ZYXA 5JS5A 1PJAA 2CUTA 2OPHA 4MW5A 4NX2A 2IXDA 4L4UA 1ZWKA 3BWXA 2H6EA 5EWLA 2VQEB 3TO5A 2W11A 1JHDA 3ACDA 2ODBA 4X3CA 3IQWA 3WX0A 5KQLA 4S2UA 3DLHA 2PWAA 4L0DA 4B6OA 3PC7A 1EUZA 1YRLA 4CKZA 5CVUA 1D9ZA 2O3QA 3HABA 5JANA 4C4XA 1BDHA 2V0GA 1IRXA 2HSWA 4DR7B 1LF0A 3DZFA 3CGGA 1YDGA 4RM2A 1TIKA 1HLDA 4NSNA 4RVCA 3NRJA 5A2GA 2H2WA 3MXTA 1LS1A 2GX6A 4H7EA 4OHMA 1CHDA 3TSWA 4Y6GB 3OZTA 4BZXA 2HH9A 4AKGA 4GU5A 3DAGA 1TTPB 3RGWS 2NZWA 1NVDA 4MZDA 2FK8A 3DA8A 2VDWB 3DBLA 4EO4A 3ESZA 2ZSFA 3WHIA 4HQOA 4DXHA 3JQAD 4JTDB 4R81A 1XJWA 4NU8X 2GZ2A 4IDEA 2LPMA 4YR9A 3DLIA 2QRVB 5JNVA 4AY6A 1U0GA 1SKMA 2HJVA 2OCLA 3JSXA 4AUKA 4KOAA 3QVKA 1C3OA 1MMFB 4Z53A 3GQVA 1V5FA 2QXYA 4HYYA 1NBHA 3CEHA 3Q8KA 1OFIA 3ZCTA 2C5AA 1UM8A 5EIHA 5K3EA 3LE8A 3C5HA 1R00A 3Q85A 2O48X 3RIGA 2KX7A 1WXEA 3A6PC 5T3YA 1NPDA 4LVOA 2GPAA 4I4CA 1ULUA 4YNBA 1V8DA 4UMDA 4YRZA 2YVLA 1IJBA 3COPA 1RQXA 2JAXA 2VTBA 3AZPA 5LA6F 5AVOA 5EUCA 3PC3A 4ZTUB 3L4KA 5FUMA 2OCDA 3SXYA 2R0QC 3TW8B 3ZK7A 1Y89A 2WLTA 1LKXA 4C0LA 5H16A 3ZHYA 2CJPA 1YOVA 1EFVB 1QGUB 3SN6A 3KQSA 4RZHA 1KEWA 3Q6IA 1HY3A 3HN7A 1ZNQO 1MH9A 2PKEA 3DXYA 2CVQA 3OT1A 4FYWA 3AJEA 1EDBA 1ZINA 1JKFA 4HB4A 1ZEMA 4CG3A 2X7JA 5F28E 3I1FA 4Q1BA 1J2JA 2IDJA 2CLEB 3WGZA 1RLIA 2HKIA 4AS1A 3FTEA 1XTZA 3HB7A 4W8KA 4G9BA 3F4LA 1EGMB 1UOOA 2N47A 3T9BA 2PUDA 2I1QA 1NFOA 1RXWA 3RS2A 1POXA 2IWRA 3ZN2A 1ZU5A 1RC8A 3DWGA 1JH9A 4DVZA 4JROA 2CC2A 3DHEA 1R9GA 2VSNA 1GXSA 3DLAA 1SQ5A 4J94A 1RXUA 5TMBA 4WKGA 1JJAA 5AVVA 1SZDA 3A28A 4HEJA 2OV8A 1DKLA 1RADA 3Q7EA 4K9MA 1WUJS 3WSWA 4ZAZA 4D3SA 2QBYB 1TLLA 3USCS 3EHEA 4RC9A 3SQLA 1V7ZA 2LQGA 3GOQA 3LYHA 4D74A 3PZBA 1T10A 1JR3D 3PDWA 3LS2A 5AI8A 4OBWA 2DP4E 1SXJB 5AM1A 2XUKA 1TLFA 2L7AA 1RE0A 4XDGA 4BLSA 1WR8A 4CKEB 4Y3UA 3KDAA 3ZZTA 2WLSA 3OIFA 1Q22A 3K1AA 5AK0A 2DR0A 1PKEA 4PIPA 3S5UA 2Y0DA 2HWWA 2Z4SA 2BJWA 1HWYA 2O4UX 3I01A 4YCCA 5A5EA 3KQMA 3ZI7A 2C3MA 2D2IA 3NMJA 5IJ9B 1HL3A 1VLLA 1DPFA 1W9MA 4ENSA 4JU8A 3W8IA 4C7XA 4QAJA 1HW2A 5J2UA 1CRPA 3DZBA 1TU3A 5D3KA 1DFGA 2A3NA 3IEUA 1S5PA 1NBBA 2O6LA 4IXNA 1E79A 1OJLA 1WXWA 3C3MA 1XZQA 3SFTA 2PBFA 3GZ4A 2IXBA 3FKJA 5DBFA 4QELA 1I2DA 1XRMA 3UCFA 5CDSA 3NX4A 4H3SA 2PNJA 3KQYA 2ZJ0A 3F96A 5FTWA 1EUYA 1HQCA 3PV0A 2V9ZA 3K9HA 1IN8A 3ENQA 2EF0A 5ARDA 3AU9A 2H0QA 1JU4A 1G16A 1OTXA 2F43A 5FHRA 1DELA 4E7SA 3HMQA 3PWTA 4Q00A 2O52A 4FW9A 1I5NA 3WHLA 3IMEA 3N53A 1Z6XA 3PFFA 3D6AA 3QE0A 3BWDD 2FX2A 4C2BA 1DE0A 3KB6A 4ND6A 2G09A 4O63O 2QLMA 3LPAA 3PIRA 2ZVJA 4AJNA 5LB2A 1W6UA 3GUHA 1PGOA 3LV8A 2IP2A 1BVUA 1C0PA 3C8GD 2ZWPA 3FZEA 4XVQA 4PFKA 2BTEA 1W85B 4J91A 4KCGA 1SBQA 4TQ9A 5KKAA 4DIOA 4WK0B 2ZCJA 3K4HA 4KQ1A 3DR3A 3D3WB 4EUFA 2CNBA 2EFCB 3UT5B 7REQB 2YN0A 4E5VA 4CLDA 3RRXA 8GPBA 1EMDA 2LUOA 1QVZA 4LZNA 3Q5GA 1LVKA 3W2HA 1RABA 4BG0A 2EDCA 1FOEB 3V80A 1PCXA 4HQ6A 3ZHBA 4OL9A 2C5BA 3OUTA 3DKPA 3UMHA 5AQ1A 1USIA 3CSKA 3IOMA 3R7WB 2JZCA 2LP4A 3TBHA 2JCVA 2IEYA 2J3IA 5AT1A 3I45A 4ZAVA 4EW3A 2I4NA 3OESA 1T91A 2VPYA 1FXWA 3EXHA 1DGQA 4ZOLA 2ZIFA 3DDWA 5CT8A 3DL2A 3FTQA 2O20A 4N3NA 3EPVA 2R02A 1JSZA 1UWKA 3CB4A 1FJGB 1N0IA 5CFLA 5IEJA 1ZW6A 4RXUA 2NYUA 1GRNA 4MNDA 4JKIA 3D6JA 4MW1A 4F2GA 1V4AA 4EABA 4IARA 1ZQ9A 1H6CA 5KO2A 3DKVA 2PLRA 5FFFA 1L9XA 1BE6A 2B4RO 3P2KA 5HKBA 2JIZA 1L7QA 2OWEA 1AUQA 2D8AA 5KOIA 3DDNA 1WZUA 1TM3E 4OL0A 4WK2B 2EKDA 5DYWA 1JLHA 1OGIA 2TMKA 3HLKA 3NONA 1N7HA 4OK3A 4E2YA 2V6IA 1JZQA 5DPMA 4DZZA 4HN2A 2AN3A 5JS7A 1NKSA 2YJ5A 3MQ2A 2HSDA 3PB3A 4DJ9A 5P21A 3OQNA 3EWAA 2EL7A 5GONA 1P45A 2IIVA 4KN9S 2ZKIA 2ZXWC 2WPDA 4H60A 4MS3A 4PAQA 3SK0A 5LBUA 1T4DA 1AA6A 2BE5F 1J8DA 4OK6A 1XZBA 2YHAA 3EUFA 1KTVA 2YVQA 1KFCB 1PV2A 2BEKA 3QLEA 2D4AA 1C9YA 2WVJA 2JAPA 4CQJA 1ZD3A 2GQ0A 3ED1A 4MRRA 5FYQA 2FSIA 1RMYA 2XE4A 1EYZA 1G9SA 3UC9A 2GO7A 4HNHA 3IE0A 1ZN8A 4UU7A 4J90A 1RJWA 4D92A 3OE1A 4HGQA 5HRCA 3ADDA 4IKEA 2C57A 1Z7EA 1VKJA 3DTNA 4F56A 1Z47A 3LHFA 2IBMA 1WZCA 4P9TA 1JQKA 2D1RA 1LNSA 3DUWA 2WYVA 3FPKA 3DG9A 4OP3A 1OYOA 1SULA 2UYHA 1NI5A 3DMHA 1I4WA 3BHJA 4RJTA 4N48A 5D00A 1QVXA 5B7NA 4F6RA 2DVMA 3QVTA 3K5WA 1P7VA 1Y8CA 3CAXA 4U2BA 3ZJYA 5B58C 4J9UE 1V11A 3MOGA 1K3FA 5KNDA 2CXPA 3PZRA 4MGHA 3TS1A 1JR3E 1ZD2P 2OOSA 2V58A 3OJWA 1ZCAA 2FVXA 5BQGA 2MIIA 2YC4C 1O5HA 2I66A 3SM3A 4LNUB 3QKSB 1OCOC 4XYGA 1OB5A 4I4IA 3WKDA 1XBTA 4J0JA 5AR1A 4DBLE 4G1BA 1YTLA 4HDKB 4FR5A 4YAUA 4GMGA 3LCUA 4TXLA 4EZEA 4I50B 1E96A 4E5KA 1UMCA 5JJBA 3FUUA 2OKGA 4ARCA 3GMTA 4NV3A 3CTPA 3O8CA 1Q7EA 4ZZ0A 2P6RA 3RVOA 5C31A 4AURA 4L6RA 2YWEA 4DSNA 4M53A 3MJHA 3GCGA 3NQ41 1NSGB 4LXIA 4IIJB 3E22A 2BISA 5DJ5A 2QRHA 1XMXA 1QCCA 3TQRA 1OW7A 2CZGA 1NUQA 3KJZA 4R05A 2H8GA 2WSYB 2XCUA 3S5JA 2YV2A 1XEWY 5BN5B 1R10A 3NNNA 4L6CA 3GPBA 4N3GA 3WSTA 4YJDA 3LFUA 2NWQA 1UR5A 1QH9A 4CM3A 1FP6A 2ANCA 3EGDB 2GYWA 3ZV6A 1LPEA 2R7AA 1QP8A 1GTJ1 1NONA 4BLRA 1IJKA 3HR8A 2ASVA 3DF9A 4XCXA 1VJGA 4OHUA 2AFVA 2IK8A 1FFGA 2IYEA 1BH6A 2Q0HA 1NVAA 4FHGA 3HYTA 3S68A 4H54A 3Q3EA 3T1YB 4RTLA 4YH1A 2VKQA 4RZXA 3ZWKA 1J7JA 1N2CB 1XWFA 3KR9A 2BUBA 1T9GR 2FB9A 4PR0A 3TIVA 3AL0C 2XMPA 1AKMA 5TB5A 1E59A 3TJMA 4PX2A 3IKTA 5H9WA 1TAUA 1XV5A 4JVNA 1E2IA 4LXXA 2E1PA 4Q3DA 4NDAA 2C2KA 4QQ8A 2Z9CA 2X0JA 1S1MA 1W73A 3SVTA 2YYSA 2BFFA 3B53X 3ILHA 2PU7A 2CL7X 4JENA 1YMVA 5ALXA 2D0OB 1QGZA 2G1UA 2OBBA 5IASA 4AUEA 4KVFA 2OAP1 1Q1EA 6REQA 3I05A 4M1ZA 4PANA 4J0GA 4H1VA 3FFAA 3M79A 1NC3A 2H52A 4F2PA 3IOYA 2BP7A 3BJRA 3VRCA 3MJEA 4DIDA 2XMQA 4UBKA 5INTA 2VC2B 2HV9A 3T5AA 1Q7RA 1IZZA 1EWKA 4MVRA 1R50A 2MHCA 3IAS1 4TSRA 1WHTB 4TV9B 1F2VA 3KRTA 1O3YA 2PSFA 2Q1XA 4I9FA 2XI4A 1UMBA 3ANTA 3EIHA 3BF7A 1JLLB 3OTQA 2Z5LA 3FUVA 3AILA 4DRXA 4C2AA 1VQ1A 2FWRA 4BX3A 3FOOA 2Q4EA 5D3QA 3DJUB 2AEJA 4KPEC 1L5YA 1P7CA 2P4QA 1YZKA 4IIVA 3M1YA 1F0NA 4U3JA 1D1SA 1ZGGA 3ZZ0A 3TTSA 1TMOA 1E2JA 5CCXA 1B8OA 2PUCA 5DBIA 2MR5A 2X6RA 2Q1YA 3II6X 4JYBA 1G5FA 1V5GA 2YYAA 1KYXA 1GZ5A 5FF9A 2ENWA 4J1TC 3CXRA 1CUIA 2Z5VA 1E9EA 2BFEA 3MZ0A 1N1MA 3HB5X 3AP1A 5DQZA 3F7NA 3QLVC 3HXQA 3K5IA 4NICA 1CQWA 2W0SA 4C05A 5JASA 2XOXA 4ECEA 3FNBA 1OLSA 5E2QA 3U48A 5I7RA 3IAM1 1RM3A 3MBGA 4A73A 4U7DA 3T3OA 4XGIA 4ME6A 3NW9A 4A0QA 3OIGA 5K6AC 3U8PA 2PH5A 3IAFA 5JSZB 3NETA 3IUPA 3D6FA 4TLCA 1ADYA 3B2NA 5DM70 1Z15A 4CM9D 1VXOA 3C1TA 4DOZA 1T15A 1XU4A 4CT0A 1QF9A 1P73A 3WNQA 2GGSA 4N7BA 5A02A 3MJTA 4JI4B 2X58A 4EKWA 3AQCA 2GVDC 5HIJA 4CMHA 2AOVA 5AW8A 4F3KA 5AFSA 3SIPA 2Q1WA 4GI3A 4I9UA 5DB4A 2XUIA 1EWYA 5J2TF 1QC5A 2GPYA 4JC0A 4YP6A 3R7BA 4BGDA 5KC8A 4CRWB 2PKCA 1NFRA 4RUKA 3RPEA 1IY0A 5IDXA 4YALA 1BXKA 1LS4A 1H2WA 2DX7A 3S0XA 1XDUA 4ZALA 1JVNA 4FCCA 2JD3A 1XCGB 2OCBA 3QRWA 4J6FA 4RU1A 1SXJD 3GGCA 3U3KA 4FYYA 1QO7A 3PXCX 3WNVA 3GLIA 4I1YA 3T7RA 1O96A 4GQAA 1T36A 4JIGA 4NTFA 3TE6A 2Q49A 1XCOA 1KZ9A 1BYUA 5A69A 4F46A 2H1IA 3N5CA 4IW3B 4P31A 1CUSA 4S0XA 3DHNA 3L8HA 5E1DA 5J3JA 3IEMA 2FK7A 2WQ7A 1RYZA 5HS4A 5BSKA 4H6VA 5EYPA 1K7XB 2F62A 2NSDA 1AQJA 2VRWA 4CKWA 2WMNB 4BWYA 1V71A 2JAOA 5HEKA 2XYHA 3L8JA 3TE7A 5KQGA 5GAJA 4YPVA 1ZD9A 1FPMA 3E48A 4WGGA 2HR1A 1DSSG 1G5IA 3ZWQA 2WHQA 4HFMA 4TMFA 4DQVA 3AVXA 3CM0A 4P93A 1WMFA 4EHLA 4NZMA 2DOKA 3BDAA 2GR9A 1NQTA 1WN0A 4LQCA 2B8JA 4I4TF 1Y3BE 1QS0B 3MGCA 3A27A 5GZ3A 2ISSD 1Z35A 3CZ9A 4O2AA 4KE8A 4EGFA 4Q1EA 2E4ZA 4BV9A 2EFGA 5BSTA 3DKIA 1L6IA 1PNQA 5GV7A 3OZFA 4I1RA 4HAWA 4C0JA 4XUDA 3BK7A 4KN6A 1Z6ZA 1X7GA 3QUTA 1HZJA 2AV6A 3ERCA 2H1FA 4BNIA 4FONA 2WDZA 4MLZA 2LDXA 1MHPA 3QLVA 2OXIA 1NXWA 5JD4A 1E5QA 3T34A 2DHRA 5ALJA 4MPJA 5BPFA 4IJUA 1W1UA 1J42A 5EJGA 1MXHA 3PQ6A 1RRPA 4E31A 3TQIA 2M1XA 5JAHA 3WZ2A 3GJQA 2CDRA 2KI5A 3OX2A 4X65B 2XDQA 2OMKA 3S2YA 3K05A 1BOFA 4V2UA 1BX3A 3CRMA 2XNCA 4JDPA 3ZJTA 2W43A 1EFPB 2HA0A 5A1TA 5IJXA 4W5NA 2BFCA 4ZAWA 1AO3A 2EWVA 4CF4A 4YT4A 3S0JA 4B5KA 4R1PA 5JRAA 5CEFA 5CH8A 4RDAA 2WTMA 3KR1A 3UHAA 1LA2A 3CCFA 4YB8A 2ZSJA 2OSBA 4HGOA 2OKCA 3DE6X 1UJBA 1V9LA 3W06A 4QJ5A 4LHVA 1MF7A 5IT0A 5F52A 3B6ZA 4CX9A 4FFSA 4B1FA 1ZMOA 4RTJA 4JC4A 1JFVA 2WABA 2B34A 1NY5A 4HL6A 4N82A 3W9UA 3H4TA 1Z0DA 3AUXA 2AP3A 5TARA 3RLFA 1UZMA 3D7SA 1VJTA 3L1UA 1E18A 1RXCA 1E2KA 1JPJA 2RSLA 3BCHA 4RHYA 1YDEA 2CDCA 5GV8A 1OFVA 2M98A 1ISMA 1Q92A 1INLA 2V98A 3NVAA 2G5TA 5JMOA 3V4LA 4F4HA 4HCJA 1TZKA 1O6BA 5EHIA 3SYKA 3E3LA 5LQSA 2GBPA 1FQWA 1RM5A 1LE4A 3SJBA 4YCBA 1QRRA 4GM4A 2DHDA 4ZHQA 1FDRA 3AVYA 2ZAMA 1W0KA 3PP8A 2DERA 2ZOSA 3T1NA 2IFTA 4BWVA 4BEBA 1NF2A 2IPNA 2G8LA 4IX1A 4B9EA 3TTYA 3S7TA 2XMBA 1QPZA 2FWNA 3AETB 3LK7A 5JY6A 1SOUA 1TD1A 3ITEA 2ARKA 3C98A 3ZOZA 1H2EA 5DLEA 1RJDA 1XAHA 4PCLA 4CV3A 1JLMA 4ID3A 3WLFA 1CRLA 1MOZA 2BFWA 2YJTD 1YS1X 3O8LA 2QUBA 3HDQA 2DC1A 1G8FA 4FD2A 5FI1B 3AJRA 3GFRA 5KI6A 4OI1A 3LSYA 3F74A 3OX3A 4S24A 3M5CA 4XQ0A 2CMGA 2C7BA 2E5FA 3KALA 3AEQA 3IFSA 3ZJ5A 1B8VA 3JASA 3C8UA 4N0QA 4TWBA 1OTHA 4NCKA 5B30A 5JCOA 1X8LA 1PFWA 2L17A 1EWTA 2P9CA 2XVMA 4V1CI 3AESA 3ZI4A 1YRAA 4FB4A 1TJ5A 3TXXA 3BRJA 2YW2A 1DI0A 1M1XB 4G1UC 3PUKA 3Q87B 1K89A 3RSLA 3RVBA 3NG1A 3HC7A 3LKDA 2GCEA 1KNYA 1YFLA 4WLFA 3L43A 2LDBA 2JGDB 3MLEA 3GV0A 3TG8A 1FU8A 3CUKA 1PR2A 4DWWA 4GKKB 1J7KA 4PX3A 2VDKB 3TECE 2OGUA 3W5UA 1AMNA 3I04A 2CCJA 3LZCA 4NY1A 1X7WA 3T5PA 1NUUA 2CLCX 3RVRA 3SIRA 1GCIA 3BFKA 3TIFA 4X60A 4TT3D 1X7YB 1C8LA 2Y2VA 4AJ2A 3NGLA 5BSUA 1EX6A 5DSZA 2FFRA 1SXJE 1DCFA 4EATA 1YASA 3CX6A 4C3ZA 4CM4B 4F4DA 1RBQA 4CEJA 1RHRA 3QTLA 2HIAA 4EL5A 2AFIA 5AGFA 1E5VA 4DV4B 2FQ1A 3BAZA 2GUGA 1JU9A 4JI3B 5EZYA 5KQSA 4BGEA 2R8PA 4RLSA 3EVZA 2ZAYA 2C03A 1S7ZA 1GTL1 3QPUA 4BFCA 4MPTA 3EZIA 5AESA 4HNGA 2ZJYA 5T3UA 2I6TA 2JGKA 1EWVA 2H1HA 1DWQA 3HN2A 5JROA 3AJMA 2FPOA 5A4FS 3QOXA 1SYQA 5CITA 1FEZA 4EJFA 4RTMA 1UPCA 3Q72A 3V6LA 5ISMA 2KK1A 3QW1A 3OJLA 1OLOA 3TK1A 9GPBA 2FFAA 3O4GA 4FHDA 9LDTA 4ZO9A 2AMLA 3DVQX 4L7VA 3HMKA 2POCA 5KJ1A 3QEJA 1UBFA 3N39C 2HJSA 2XDYA 3I9KA 1VB5A 2J30A 1ZGCA 1E86A 4JR1A 4L2IA 4J8PA 1V3QE 3RB8A 3WGNA 2ZE5A 3DV0B 3TLEA 1L7MA 1QLEC 2JVJA 2JLQA 1ZAKA 1PS8A 2R7MA 4MVWA 3FAKA 3NLLA 4R9VA 2WZFA 1ZH6A 1N25A 2E5WA 2NAFA 1OH8A 4CT5A 4ZEWA 3AV3A 4TYQA 2Z1NA 3A6JA 5J4LA 3EYWA 5GOTA 3NNSA 4XR4A 4BJ5A 3TWOA 2AHRA 4RCZA 3SE0A 1JG7A 4IS3A 3MQ4A 1Y3IA 3UYKA 3NO4A 2VJLA 2PK3A 4BNWA 2PL9A 2NM0A 1VE3A 2H9AA 1DKOA 4H7IA 1HM5A 4M1SA 2ACEA 5AVKA 4AQDA 2AQKA 2FPWA 2YLDA 2A9PA 1P75A 4M7RA 1DKMA 3TUIC 4B0PA 2F1JA 3G68A 1Q44A 3RVJA 2PCJA 4EOGA 5LVAA 4JLOA 3UJCA 5EP1A 5F76A 3OH8A 3LNMB 2IUTA 3S7ZA 2F4VB 4RYDA 2I1LA 3ZDAA 4UARA 1YB5A 2F48A 3PFNA 4XDYA 1P1KA 1U8XX 1ULTA 2ZE7A 2FR8A 4WNAA 3RK0A 1QP4A 4MR8A 3DMTA 5F23A 1YCGA 2CKMA 2RB5A 4HFNA 2ZCVA 3AUUA 4QUDA 2IXEA 2NO0A 4KJZA 1X8XA 4X1KB 3RLIA 3WDSA 2AK2A 7GPBA 4UEJA 5CAEB 2IW1A 2P0YA 4FFPA 1I36A 1JR4A 1ESMA 1N57A 4BUZA 5D5PA 5IANA 1K7CA 1I7QB 1VHDA 3QU7A 1I5OA 1PR6A 4QFBA 3WLAA 4NBVA 4FWTA 1GZHB 2DR2A 1U2GA 3OBBA 3P2MA 2GNOA 3B9BA 4LYGA 2X3UA 3HUEA 1M34A 3TX2A 1K6JA 2IE8A 4KPGA 1U7OA 1ZM9A 2FW8A 1SXIA 1S1CA 2GM5A 5BUSA 3H3JA 3GNTA 2NNWB 4NCXA 1Z5ZA 4Y2RA 2W7TA 4KO1S 3MJFA 1XFAA 2BFAA 4NZYA 4CMKA 2H5LA 2NU9B 1ZX1A 4BBAA 1EHYA 1KY4A 2H7XA 1WUYA 4XPYA 4GRAA 1MG0A 3OCWA 3KOUA 1JE0A 2VN8A 1IJEA 3MILA 4Y2YA 1V5IA 3UA4A 3QMWA 8ADHA 3IR5A 3QVMA 4FBLA 1TFRA 2QTCA 1EUDA 3GT7A 4GKBA 3AQIA 4EG1A 4YEDA 1U3GA 3JALB 2Q7OE 1SUFA 4N4AA 5A9SA 2WUDA 4U7GA 1EI9A 2RHBA 3ZCXA 4GBMA 4N7MA 1AUPA 1GNPA 3CQ9A 3U4GA 4AROA 1WV0A 2WK1A 4YXWD 4RENA 1V5EA 4MGKR 4WTOA 1ES9A 2WV7A 2RG1A 3UAWA 2CK3D 3L1JA 2W45A 4DRHB 2CXTA 1QKKA 3IUQA 3I3OA 3RC2A 5IJWA 5CB4A 5M7EA 3M6XA 4RNCA 1PTJA 3LRPA 5NULA 2BCJQ 4M0PA 2W4QA 4RTNA 3HH8A 3H2GA 1V8PA 4UTVA 2W37A 3AIIA 2O3RA 2XUQA 4BLQA 5FTLA 2VATA 3F97A 5B3KA 2I3AA 4Q9IA 5JZSA 3HGQA 3D54D 2ZU0C 1OLXB 3ND9A 3DL7A 2VJNA 3OFJA 4URWR 5A4MS 1O1YA 4EPXA 1KORA 1MV8A 1SBNE 3KM0A 2VDJA 1YFZA 2P4HX 1GO2A 4A2CA 2HB6A 4GF5A 1WRBA 5IXYA 3C5CA 3EULA 1NSYA 1C0LA 2J0SA 1YI1A 3ANXA 3IT0A 1N36B 3BKWA 2CHVA 3GZNA 3LXMA 2FPMA 1E6CA 2QV7A 1N1EA 2OB1A 1VG1A 5AK6A 1QCYA 1ODIA 1U0TA 3KH2A 5IKPA 1S2MA 1K8QA 2CDNA 3T3PB 2B6HA 4LYFA 2D2FA 3WNBA 2J0UB 1LVGA 3ZNPA 1ND6A 3W79A 2NU8A 2O8EA 3W4YA 5GWXA 3NYQA 4BQEA 2XTZA 3BMOB 5ALMA 3KT3A 2Q5EA 1HGXA 1Q6YA 4EGCB 4OIRF 2GFIA 4M83A 3TFQA 1R0RE 3MUEA 3GJRA 1VRVA 5B7QA 1ZZEA 3VO1A 4F9FA 4Z4IA 3O38A 4Q47A 1N8SA 3WHNA 2IZ7A 2EFHB 2QXTA 4BNDB 4CTNA 5CXQA 4RIHA 4BO3A 3EPKA 3GDWA 5HIAA 4ZPJA 5FBRB 3EPHA 4IMPA 3L0IB 4YLEA 1MVOA 1ESCA 2DJ5A 3GEPA 1H0KA 4Q4JA 4FNAA 1I6WA 5K01A 1FYXA 1PZEA 2QTNA 2J9XB 3URKA 3TSAA 4GMDA 3RT1A 4ZD6A 4YCSA 4MQLA 4TLMB 1I24A 1JEOA 4EG3A 1L7NA 1I01A 4DCTA 2ZBFA 2XQIA 3RYHB 4LZAA 1CY2A 3TI9A 2OCIA 4BP3A 2BFDA 1WKVA 4QVGA 4RHTA 5DLJA 3NYMA 3Q98A 1ORWA 3OUZA 1CIPA 4PPNA 4QA9A 3DTVB 4K05A 4YJKA 5JPIA 3G0BA 1N2CE 4FI3F 3AF4A 3NJRA 4HADA 1UWLA 5HR5A 1X19A 4R01A 2R1VA 2P9TA 4KAXA 1B23P 2BM9A 1ENZA 1CULC 1HLGA 4HTFB 4D5EA 2QNBA 2XJ9A 4MH0R 4LJRA 2PSDA 4JIOA 5DGDA 3JTEA 4DRYA 1QP7A 3G0CA 1YUNA 3PI6A 3H5OA 4EG0A 3E3AA 2QL6A 5I7SA 3EDYA 3SVZA 1B7GO 4GEGA 4LJAA 4Q3NA 1W0JA 3H2SA 4GKVA 1PI3A 3AL2A 2G6TA 3IQGX 4OKSA 3VNBA 3DP9A 5DTJA 1P2DA 2QJFA 3X1JA 1AZWA 1IDN1 1HC7A 5CVDA 2PZ8A 4UM9B 3ZH2A 3IGFA 3KKNA 5BORA 1ZC4A 1Z7GA 1YJBA 3VI4B 5REQB 1X74A 2HRRA 3R5JA 3AFMA 3CUVA 3BQNB 1I3OA 1Q0QA 4CT4B 4EFMA 4ZMSA 4JBWA 3GUYA 3A1VA 2OK8A 2QQ0A 4P5PA 3EQ9A 1T2AA 2R2GA 4OUKX 3NKDA 1ZJ6A 1JGTA 3W1EA 3UY4A 3VTFA 3E3NA 3H2JA 1GG9A 3WIOA 4HTAA 2LD4A 4LDKA 4ZEMA 4PGMA 2Z2IA 2QRQA 2AXEA 2HUPA 1XX6A 4IFTA 4BVFA 1KARA 1M2NA 5ILGA 1QOZA 3B1KA 4S12A 2OILA 4OSPA 4KWEA 4TMKA 1YCHA 3UHJA 2VT2A 4N9QA 4X7PA 2PWZA 3NWJA 5IN4A 4C6TA 4JSYA 2NV6A 3O5AA 5I4BA 1GYQA 1KZYC 1EG2A 1ZK2A 1ISSA 4BJ3A 4NNOA 4YJ3F 1SG0A 3ZWVA 1RZUA 2ZIWB 4N49A 3D8RA 4DVGA 1HX7A 2P4UA 3KLNA 1IHYA 3MEQA 4AL4A 4HNVA 1P1BA 3KFLA 2AKYA 5CVJA 4BPRA 4YK7A 4EG5A 1DXYA 1NNLA 3T6BA 4TXHA 4FCWA 2Q9UA 1Y98A 2ZYVX 1IL0A 1G2PA 5DBHX 3UVEA 2G08A 3WMEA 4MW8A 3V8QA 5A7FA 2H16A 3D2AA 1AUOA 1DEOA 2QUAA 3VX3A 4YL1A 1F0PA 1JE1A 2HO4A 5K7SA 2OQVA 4UJ3A 2HMSA 4NBSA 4OLAA 2VCEA 1M7GA 2F6RA 4PICA 3FCAA 4MUYA 4OOFA 1C3JA 2BBOA 3EOZA 2G4VA 1WXXA 3IQIX 3F6YA 3WV4A 1PDOA 4MV4A 5ICGA 2ZBVA 1M2OA 3ANLA 3CE6A 3WG9A 3H3XA 2CW0F 4I8DA 5TJ9A 2X3YA 1UP7A 4Y6RA 2Y68A 3GJTA 3DBHB 3L4JA 1RWXA 1EVJA 4RABA 1PFQA 1JEEA 1MOQA 1BU8A 2ZS8A 1RI5A 1XJ5A 3RTDA 2IQIA 5KNCA 4JEUA 4BAGA 4HDRA 4G8BA 4PZYA 4HFJA 2EF1A 4HVAA 1RWBA 1X1TA 5L3SB 1QWSA 2IVFA 5F9MA 3ZDLA 3R5KA 3SSNA 4IH9A 3U7GA 3WV5A 1TT5A 4P83A 4K9LA 2NUPA 4B84A 3AI7A 2O8FA 3ATPA 5A4KA 2NT3A 3O90A 2YXDA 3LWDA 3GN1A 4HNAA 2DFTA 1G0NA 2BM0A 1KS9A 4BKQA 1T2CA 4O4LF 3VKWA 5DNEA 5T8KA 1OF1A 2J4DA 3UXEA 2VJDA 2VDPB 4LGCA 3JQGA 2VOEA 1T6YA 1CQJA 1BWSA 4M9RA 2NSFA 2PHZA 3C6QA 4NBNA 3IXMA 4B4WA 3W0LB 3FCSB 2JIDA 2J08A 3HTKC 4M76B 4TL7A 4EHPA 3EXHC 4NONA 3PMRA 2AZ4A 5AHWA 1V4VA 2ZPTX 4O2BF 1YK1A 3CBGA 1NBMD 3FNHA 1FFXA 1S96A 1J8FA 1OA1A 4QDOA 4OFXA 4JSRA 4JKYA 4WBNB 4MTLA 1ZZPA 4TSKA 1K63A 3M6WA 2BLNA 3U19A 1KYZA 3AJ9A 3F5DA 3UUFA 3Q9UA 2QI9F 5AHXA 4AYXA 4PN3A 2QPLA 1Z63A 1DOVA 4ZEOA 1MQ8B 1T0JB 3FHTA 3C6YA 1TDJA 4NU5A 2HJ3A 2RGYA 2IPAB 4IF4A 1GYPA 1HDCA 1ZIOA 1G4US 1PJZA 1K9VF 2ZRGA 1G20A 2GK7A 3F5QA 2J3HA 4MMZB 2G0AA 3N2KA 3KQNA 4QOHA 1WPXA 4UQPA 3OQBA 4X90A 3H05A 4ZOEA 2WB4A 3M6FA 3MVEA 3M1LA 3QA9A 2NSYA 1EFTA 4IWNA 2VS1A 3I6BA 2AZMA 5I6DA 4FILA 1KAEA 1P7WA 4XKJA 2ZP1A 5E7MA 1W76A 3A9UA 3B9QA 3EVTA 4RMNA 4OQ4A 1TWAA 3ND7A 2C0CA 2XT6A 1GL7A 1QR2A 1Y6GA 2JFPA 2QE9A 4NYIQ 3NIFB 4WN3A 4WXHA 5DMHA 1IBLB 5JBIA 4U0KA 2HD4A 3ZE9A 1A5AB 5KAMA 1E9RA 4UUMA 1CWUA 4S0ZA 3IBFA 4Z9XA 2AXQA 4GYYA 5H59A 3FCEA 3QU2A 1AM4D 4F71A 2JLBA 3OLZA 5G0UA 2AZXA 1O6CA 4AN0A 1HE4A 4ZOAA 3CPEA 3ZHCA 2NO9A 1EVZA 2QJRA 5JS6A 4UUQA 1QTIA 1G63A 1SUWA 4EIYA 4LVCA 2QAGB 5H0IA 2Q0XA 5TQ2B 1UJNA 5KZMB 2R6AA 4JNKA 3ODPA 4IXWA 4BV2A 4LHZA 1H2XA 3A37A 2J9ZB 1EB9A 1UPXA 4GOMD 5CDFE 4C7BA 4UHJA 1T9AA 1VL0A 2FPRA 2DH6A 1K6EA 1CJCA 1R0ZA 3PF9A 3RS8A 1L4UA 4URZR 3EHNA 1Q14A 5EC8A 2PL3A 4AE4A 4P3OA 2YICA 1W5FA 3JSAA 1Z74A 3AUKA 2TMGA 4JOSA 4BIIA 2X1LA 1VBNA 2WP8J 1AC5A 2GAAA 3THOA 4QI2A 1F14A 2ZIGA 4ZCTA 1ZJJA 2QLBA 1C7ZA 1JEDA 3W1VA 5I5GA 4I8XA 5FNVA 1MX9A 2IS4A 4G6ZA 3HKEA 4ABYA 1W5AA 1WBDA 3HACA 3I28A 4AG6A 3PVSA 2YHBA 4KQKA 1S7CA 1KOJA 5LP1A 1CDDA 3HUDA 5C0OE 2HLHA 4QGSA 3VO2A 3DD7A 4TKZA 3HGMA 4M60A 4UMVA 2YBDA 2AR7A 2X9GA 3K0KA 2VYVD 4HDNB 1FUKA 4CLRA 1TCBA 5L4SA 1FE8A 3E27A 2KLHA 4ZP1A 3MG9A 4RM3A 4GXTA 4DMMA 2O9JA 4M8NE 3OPYI 1T3LA 1Z68A 2VCBA 3WLOA 5G1OA 2PT5A 1CUXA 1RWOA 2RHLA 3QBVA 2RCYA 2EKZA 1DQRA 3BMNA 3K31A 3SMQA 3WICA 1TQGA 3G9QA 3EODA 1DIRA 4REOA 2H1SA 2ODAA 4XEKA 5IULC 1UJMA 2GZSA 4MWSA 4Z54A 4M1EA 1ZK0A 3VR4H 1XZHA 4MKFA 2CMKA 2G62A 3FR7A 3NPAA 4NNPA 2YLGA 3PXBA 1E4VA 2FRDA 3L0YA 4EF4A 4PCAA 1OX4A 4HH0A 2V4MA 3P0IA 2PSHA 1Z0FA 5LQCA 5IDVA 1WVMA 1F4VA 5IJAA 4JVSB 1JDSA 4Y9TA 1S2LA 3RRYA 4IGEA 1SQSA 2IHYA 5KX5A 4RD6A 1NT4A 1LWNA 2HM7A 2IOYA 3CEPB 1FX0A 1ECFA 3M7IA 3OZ7A 4JYZA 3EXFA 4NCJA 1Q57A 2IYTA 4YJ2F 1XZDA 3OLCX 1M8GA 3RADC 5HE9A 1J39A 2J9BA 4ZJUA 4DREA 3L46A 1EM8A 1APBA 2BBWA 4FCTA 2JLZA 4N06A 2JAWA 1A2KC 4CXMA 4YGXB 1XLUA 3QMKA 4Q3LA 2FTKE 4U5DE 3AHGA 1IJFA 2HXSA 3R3HA 3DAYA 3IV9A 4YCMA 3FDZB 2CNWD 4V03A 3CG4A 4DLLA 4FC7A 2GWWA 3OPQA 4F1JA 4LKOA 1YL6A 1I4TD 5SZKB 1Z8HA 1NP7A 2OFXA 1DAKA 4BXOA 2P8SA 5E4JA 4FHEA 1EKXA 3KYJB 1FNDA 3N0XA 4JP8A 3T3HA 1WAMA 4RKYA 2C1XA 1NVWQ 3AHEA 3IVMA 1BBHA 4Q93A 1NBME 3K72B 1FFAA 2XZOA 4DJAA 4Y6LA 3C8DA 3K9CA 3LGXA 2YZSA 4MS4A 2CLLB 5A5VA 5FO1A 4HDCA 3BFPA 3PXXA 2HHLA 1A77A 1F4LA 4DIEA 2Q5IA 3BGIA 3AGPA 4Q9DA 3TNJA 4JOBA 4K8RB 3R3YA 4HX5A 5IWCA 2C7GA 2ZSUA 2GHRA 1OASA 3IEKA 4HVTA 1CGOA 1TQ6A 5JH7A 2XS8A 1GGKA 3GR6A 4LDAA 4CMGA 4AJ9A 4C43A 2B78A 3N28A 1AKRA 2D1SA 1M8JA 4PYIA 6NULA 3DTVD 5K0ZA 1E3IA 4MYCA 3R8FA 2ECPA 2IYWA 2OM2A 5CI9A 2HMQA 1V8BA 2Q21A 4WLVA 4WLOA 5JXGA 4M9XA 3FBGA 4MUIA 1QYDA 3HCOA 4G5SA 5F4BA 3N8GA 3LL4A 3WK4A 3QE3A 4ZO6A 4IHJA 1T3ZA 4WHMA 2UUCB 1OXKB 3PJEA 1PZXA 3BG5A 4BYGA 1XD2A 2REQB 4E4TA 2XIQA 2HS5A 3IQZA 3TJRA 1K97A 1WDKA 1SKBA 3O47A 3TOSA 3LYUA 1EK5A 1PQ4A 4DA4A 2ZITA 3ETJA 4U9EA 4MYTA 3VR1A 1TGYA 2IHUA 4KDCA 3BD9A 2Y93A 3FYUA 5JWRA 3MJ4A 3VPDA 5AK3A 1C4WA 5I47A 4M8IA 4BNTA 3KSUA 3Q6NA 1PG5A 1Q17A 3BXEA 4E1BA 1YVUA 3HCEA 4O4JF 3RARA 1MNAA 3UXHA 3T9OA 1IEQA 4UM9D 4MB6A 3CFYA 1CY4A 4MRVA 1EB8A 1EK2A 4CQMB 4UMFA 4FWIB 2OAGA 4WESA 3A1DA 1Z0UA 3AC0A 5CB0A 4P4GA 3I2YX 3VSAA 3QI7A 5G3YA 5IYZB 1J2UA 4BLVA 1M7BA 2BMAA 1F9EA 3W8EA 5H4GA 3TX6A 3JWHA 3PGVA 1S2IA 4BVJA 3K6SB 5CB8A 2WHRA 3OAAD 3B70A 1XTRA 1Q0RA 3DD1A 2A9OA 4MCHA 4DR4B 3LP5A 4MW6A 5FOVA 3BWVA 4PQRA 1KGDA 4GVLA 5IF9A 1IEXA 3K0AA 3H16A 2R7XA 4BQOA 2R6JA 1CR6A 3T5GA 3B6MA 3T7TA 4HGRA 2KPOA 1Y5IA 1C9EA 2P4SA 1MU0A 2C94A 1SCQA 3NCHA 4RF5A 5BSEA 4FKMA 5IABA 4DIFA 2Z9BA 5F33A 2RAVA 2PT6A 2Y76A 5HF5A 3G8DA 4M87A 1P4SA 2Y39A 1FMVA 3VJKA 4PYLA 3OA1A 3VHRA 2GDZA 1G8GA 3B7GA 4G3XA 2QR2A 2RD9A 4EB3A 3R9XB 4ALLA 2VBCA 4KACA 4IGAA 1N32B 1E3LA 3CSSA 1Z06A 1T6UA 2A68F 3OQ6A 2JHCA 1ZD4A 3HYRA 4L5IA 1EP3B 2O2GA 1XRPA 4WCFA 1N1GA 2DCMA 4MNTA 1F3OA 4F8EA 2Z15A 5TF0A 4XUEA 5K99A 3P26A 5AVRA 4M9UA 1IBKB 2IPOA 1PUJA 2DRIA 2XA2A 3TXAA 1ABBA 1D0SA 1KQ3A 4EB6A 1E0KA 1M54A 2NP6A 2ZJ2A 5A3VA 1NC1A 4TV8A 1SU8A 4E6EA 2SKDA 4BMYA 1ZBDA 4LC9A 4KPUA 3QUAA 4IRUA 3CJRA 3RVZA 2PS9A 3UMVA 1KI6B 4HYEA 3B20A 1ZG3A 1L1EA 3GLHB 1ST6A 3WIUA 1KAQA 3EXEB 3ICPA 5ALVA 1E6LA 1NI4B 3VDNB 3U7EB 5IKEA 3FCXA 3P9XA 1WTAA 1TVEA 5G0WA 2V7PA 2DTXA 2Q62A 2WNHA 2ZUEA 4BFXA 3HY6A 1T3HA 3DP7A 5EJFA 3P52A 5GY7A 4NV0A 1OBOA 1QUEA 1J2TA 3V1YA 1ZM2A 1FP1D 1RXEA 4ALMA 1L4BA 3FZQA 1L7OA 3WLJA 2JHAA 3LT4A 3U5TA 5F1PA 1GAQA 4IOLA 2IS6A 4D0GA 2B4YA 1ID8A 3HS3A 4R8RA 3IEPA 1BC5A 2NZUG 1JYSA 1VJ5A 2L6HA 4YV0A 4KQFA 4CMEA 3D31A 2X9NA 4DDTA 2QW1A 3LUTB 1DWUA 3LDUA 3BJEA 3QW2A 2FEPA 1YZHA 1NQWA 4IUCS 2PIDA 1YR7A 2O2CA 1ZKMA 6CHYA 2E3JA 1TIPA 4ZWNA 3ELWA 2A59A 3E7DA 4R9SA 5JSUA 1N5OX 1T6IA 3RFCA 1R9MA 6ADHA 5M2QA 2R8XA 2VCHA 3U39A 1V6AA 4B3IA 3GJ6A 1FLDA 4QDXA 4I5FA 4M54A 2C1EA 3N2EA 2FWJA 2D5CA 3OQIB 4OU5A 3GJSA 3LC1O 4F4FA 2R5FA 3C87A 1X38A 2VJKA 2WJAA 2IZ6A 1FYEA 3DZIA 3K73O 1EP2B 1UQUA 1X7HA 3PVZA 1LLCA 4DL9A 1K7YA 2G9ZA 3ILXA 3D9QX 2IGTA 5E7JA 2WUVA 5EWJA 3TDMA 3EA5A 3C3CA 5CK5A 2C5FA 4J3NA 1LNZA 3R9WA 4U9IS 3FKQA 4BECA 1O9GA 1OPRA 5IJ0B 3K15A 1CEYA 3NP7A 1G4AE 1H2FA 3TFOA 4YMHA 2WYWA 1CIVA 4M9CA 4MVZA 3HXKA 3O9ZA 1JHXA 2YJ6A 1MEJA 1YQXA 2O2SA 1O6GA 3SBDA 2QTLA 3MINA 1H93A 3AO0B 4LJLA 1JFLA 3I9LA 1D4ZA 2GEDA 2KM1A 1KJIA 2WU4A 4DT1A 2CYAA 2GAFA 3F1LA 4R9RA 4U9UA 3GDFA 5KTSA 4XLPF 3N6VA 4P2GA 4HVLA 2HRQA 1MP0A 1QPUA 4PC2A 2D7DA 5HFNA 1ODSA 1WULS 2JGRA 3NT5A 4PRYA 5JCOC 3A2LA 3N9IA 1OH6A 3RVYA 4A6PA 5JVDA 5EERA 4BX8A 3EN0A 2DPGA 4DMKA 3UJPA 4K40A 4Z3KA 2AG5A 1G55A 2FPXA 4XSGA 1I51A 2AC7A 3QKIA 4EWCA 3W77A 2VQDA 4RVHA 1LPPA 3QTTA 3EZYA 5EHHA 4DTIA 4GR9A 1QRAA 3VYVA 3QXHA 4HQFA 2WHPB 4I99A 5EFZA 3U3ZA 3DEJA 3QMVA 3LL7A 2PX3A 2J07A 4C0KA 5ED4A 2HU2A 2ZZMA 1LC0A 4M8KA 2R7WA 2BGLA 2VWGA 1RM4A 1C4KA 2AMYA 4Q9HA 3TTUA 1MJGM 4LDRA 2A4KA 4JXJA 1WUHS 4D3FA 1KJYA 2W2VA 1NVKA 4ZVNA 4DNOA 2ERYA 2NXCA 4MUFA 4EKGA 4YJGB 2YOGA 4I81A 1P77A 1XXHA 3MTEA 5BMVB 5KREA 2X42A 2VK2A 5DKFA 3SZGA 4QC2A 4BLUA 4MP6A 2XF8A 5B4VA 5AKXA 2I8AA 4JQZA 5JNRA 3EFOA 1WLSA 4Q6WA 3ORFA 3IUYA 9MHTA 1DBSA 4N12A 5A04A 4B44A 5KJFA 1WKBA 2QU8A 4D42A 3HJAA 1JMYA 3FTDA 3DBIA 1X1EA 2PWBA 3KWMA 5TY0A 3GC6A 3A04A 2OLKA 3PLAE 2RK4A 1E7RA 1YKFA 3F1KA 1YV9A 1D2HA 4BJ1A 1OV6A 1IZMA 2UZ1B 3WE7A 4WXPA 4AKHA 5EPEA 4LCJA 1V5WA 2BHSA 4DNPA 1ZM3A 4ZLDA 3WISA 1ONSA 3PGMA 4FMDB 4ZMBA 5KMGA 3RRBA 3QF4A 1SC9A 1H9GA 1MDFA 1RKXA 5CD1A 3INYA 3UWOA 3WNDA 3TDNA 1WXQA 4ZAGA 1NOKA 1SNYA 4RGYA 3HYNA 2FG5A 4B40A 3GLTA 5E0KB 3ZXIA 3SZLA 2HCRA 5L45A 3L18A 4RJ2A 1JSLA 2FPGA 1C7JA 2A5FA 4JU9A 5B3IA 5HSGA 5E6UB 1PNOA 5L6MB 3KQVA 2IXNA 4GZMA 4Z6KA 1NBIA 1H8HA 4BU1A 2VUIB 4INAA 4BJ5C 1Y42X 3PHF2 4IGGA 3VR4A 1Y1QA 1VCOA 2VYCA 5FNZA 1M33A 2P5TB 5ELLA 1BHQ1 3G6KA 2R7KA 2GD1O 3GCXA 4C6HA 3K5PA 4U3JB 4L9SA 3M89A 5BQ5A 3VNQA 1EFRA 2C88A 2ADOA 4QJIA 4DWOA 1WIWA 1IQUA 4IIUA 3VYUB 3OIYA 2NUTB 1MB0A 5F21A 4EW1A 4X6UA 3P5BA 5AW9A 5ICSA 1E3JA 1QFSA 1E1RA 2CD7A 2PKWA 3B1XA 3KWFA 1U2PA 3O91A 3VNRA 3EUAA 4UUBA 4J7TA 2FR8C 4DABA 1KMCA 4Y9UA 5T57A 1QCDA 3DMTC 3GT0A 2GM4A 2W6QA 4OUDB 1PWXA 4FOTA 3CR3C 2XWPA 3ESXA 4JLDA 4GC9A 4K87A 3DWWA 5E1MA 1X77A 1DKUA 2Y4OA 2CZCA 4M1OA 4WKCA 5FTKA 4IRXA 5BW8A 3NAMA 3E35A 1RVV1 3R24A 4LBVA 1SCUA 1JHYA 1EQ2A 3BGDA 3DBRB 4WEOA 1XF1A 2ZDHA 4HQKA 2XKBA 2YZMA 1U2GC 5BN3A 1P31A 3IP1A 2O0JA 4PZCA 1FW8A 1A9OA 4D0RA 2FW9A 3NWEA 4CKYA 3BRCA 5EVJA 1PP4A 4IBOA 3RBZA 5LSAA 4XPIA 2HJRA 4BKUA 1L8XA 3EGIA 4UNQA 1UOPA 2WM3A 3G1WA 2ZYSA 4B46A 3R74A 4N7JA 4QSMA 4C0SA 4OVKA 1H85A 2QMQA 2YLIA 4JRZA 1FS5A 2OCAA 1JHVA 3G2KA 1YKGA 3MUOA 1XD8A 1R8QA 2PQ0A 4BNUA 5DEIA 2WL8A 1OZGA 2F3RA 4LJKA 2VWHA 2VC9A 1AKYA 3WNZA 1KWKA 2ZT7A 1FLNA 1ZUD1 3BCSA 4LRUA 1W2WB 2C95A 2OBLA 1VSTA 5HFAA 3QLJA 2P6UA 4P4SB 1XC7A 4XWOA 5DTEA 4IOKA 2IYVA 2IEZA 2XECA 3U0VA 2G7ZA 1VIAA 4Y7CA 4MWOA 1JSRA 1KMHB 4GEHA 4QWMA 2EQBA 5AC5A 4JYPA 2WVAA 1PJTA 4UAUA 3AF6A 4CQNA 3OTHA 4RH1A 3NS7A 1AK1A 1SR8A 2YINC 1O2DA 1V3VA 1MPTA 2IYZA 5FH9A 4B33A 3KCQA 1AN0A 3AFGA 3TM5A 1AHPA 4UBMA 4CLEA 1V0JA 4TM8A 3T38A 3U80A 1C1YA 3IAHA 3CVOA 5JQGA 4OYHA 3DVAB 3S2EA 4N65A 1PTJC 3ELYA 3ILSA 4BFSA 1P2FA 4TYNA 2B9VA 4QUAA 1V8OA 3CH5A 8MHTA 1VP9A 3VF0A 2B20A 4LS3A 5ANRB 1CB0A 1P44A 1T0PA 5DN6D 3BFXA 1E9SA 4RDHA 4H3HB 2DTDA 2CLIB 2QLJA 4JUCA 1UZAA 3VA7A 2ATEA 3C6ZA 4DDVA 3R20A 3KVYA 5CCBA 3UC5A 5DGXA 2GKOA 3F3YA 4X7BA 4ZCLA 4HLQB 1Y3CE 4FGSA 4MWBA 3NKLA 1L7CA 1XQYA 3H2VA 4D02A 3NBMA 2BCGY 1L4EA 3AR3A 2BAGA 2VHUA 2GPNA 3VZBA 2LRHA 1YR8A 1CBUA 2Q4DA 3ZZMA 1HNNA 3UUGA 4RIEA 3VUFA 5A6BA 2QIPA 3KAKA 1D2NA 1OE0A 3OI7A 2W2PA 4HF7A 4CCWA 1HE9A 2FU5C 4RMGA 3TLBA 2PKQO 4CLOB 3TN7A 3OZRA 2XDQB 3P9QA 1TC1A 4U2FA 4FT4A 3UJNA 4O25A 3IQDB 3DFKA 2HSGA 4RD1A 5C46F 3DCJA 1XNRB 3ZIBA 2SHKA 5DX1A 1AE1A 4XZ3A 4QM6A 2WA1A 4NQZA 2XLEA 3DNPA 4BIMA 1KZGB 5LXTB 4U2EA 3RU2A 2HQOA 3N2ZB 4CDGA 2VJPA 2QVYX 1KVRA 3OIUA 4YRBA 1E5DA 3L84A 4BMSA 3AH8A 1WLYA 2XTNA 4N40A 3V00A 4LMPA 5E3CA 1U63A 3RAFC 1M2VA 2NUBA 2HBZA 3NBFA 4YT5A 1SJ9A 4Z2AA 4GGMX 1RPZA 3J06A 2ZJ3A 3L8GA 2HFIA 1DJLA 1GZ7A 1RQGA 3EPRA 4RK1A 4P6IC 5EXXA 2P6OA 1TQDA 3L1MA 5BURA 1LDEA 4NHEA 4A2NB 4LWPA 1LK0A 4V0ME 4EJMA 3IQ6A 4KYVA 1QAQA 1JJ7A 3T35A 3NC4A 1IEWA 3EJNA 1P0FA 3I42A 1JLSA 5T6BA 3H11A 4DCOA 4PXSA 3PITA 2JHPA 1OXVA 2DFKB 4DV6B 2J9YB 1W30A 1KO1A 1Y3HA 2Y0CA 3ZHSA 2D3TA 2CSUA 1YRYE 3U31A 2EPLX 4JI8B 4GMKA 2R1TA 2IHTA 3WLQA 1GVHA 2J8ZA 4NE7A 4JUDX 3LQYA 1YQWA 3O6XA 1WBBA 1XQVA 2H7OA 2V7QD 3ZV3A 4B3BA 3IESA 3ICEA 3SC2A 3ANYB 2QN9A 4ZAXA 2XGSA 4Z4HA 2XMRA 1C7IA 3QVXA 1I33A 4PG8A 2NPOA 2EZTA 2WIAA 1MN6A 4EYGA 4AF8A 1QHGA 4IYJA 1BXRA 4N6NA 4KP7A 4B3RB 3SC3A 3MBKA 2QZSA 1HY5A 7MDHA 4QHSA 4DGQA 3BWCA 2Z6QA 1GU0A 1Z9BA 4D9GA 2AYZA 4NTBA 5KIAA 5SYMA 3ZGLA 3V6MA 1C8VB 5GTDA 4CEHB 4ARZB 4NS1A 4QU5A 5B1HA 3GJYA 3JRMO 3H5LA 3AESB 2GZMA 5AJYA 5THXA 1KBZA 4CKBB 1Y6RA 2XE8A 4FZJA 1JIQA 1EA8A 1YS9A 2NZYA 3CLSD 3MAGA 3AEKA 2BR4A 1GPDG 2KW3C 2P1DA 1YC2A 4RKFA 3M6AA 1JZTA 5HXAA 3ILYA 4M0KA 4M88A 2AN4A 3KOMA 4CPDA 3PDJA 2JD0A 2GXSA 4V0LA 3S40A 4Q02A 1NVMB 4WZAB 2MSKA 2BEVA 1LPNA 2ZRPA 1VPDA 2VR1A 4NDZA 2L18A 1LC3A 3GA0A 7ADHA 1QO9A 3GGPA 2LKCA 2P7IA 2HLDA 4IPTA 1WXHA 1X7WB 4R8MA 4PC1A 3A2KA 1H2ZA 4BL5A 1DX9A 4HH4A 5AOBA 1HA3A 1KQNA 3H5TA 3QYJA 5DNVA 3UB2A 1W4RA 1B15A 3TFWA 3TAHA 2I4OA 2BKEA 1JBEA 4RXMA 5DFAA 3HDGA 2PZBA 1KEEA 1NQ5A 1SC6A 5CVTA 4KR9A 3VYRB 2IZ1A 3LUGA 1Y4SA 1YC5A 3L0DA 3FLAA 4LBYA 1WEHA 5AXBA 3PUYA 1EK6A 1I13A 3QSYA 1K5DA 5B7PA 1UBNA 3WL7A 1IZ8A 3HRKA 4QBKA 2L6GA 4JUBA 4B8YA 5AVQA 5AI4A 2D5BA 3D8HA 4PF1A 1PHRA 2FCRA 2BD0A 4IX9A 3KK0A 2JJYA 1U7WA 3BRSA 5F7ZA 1R6AA 4DCMA 2MCFA 2ZBUA 3UUEA 3RIPA 3IKMB 3EZXA 3I83A 3KSMA 1TJYA 5A6SA 5KTOA 5FPKA 1Q1ZA 1VMEA 3DB1A 1LDYA 1APCA 2DBVO 3THWA 3AERB 4ISCA 3UTCA 2EJWA 4UJ5A 3HVKA 1CVLA 4ZPXA 3LX5A 3VZDA 1AXEA 4HPWA 3JZDA 3PQ8A 2X8LA 1ODCA 2ZAOA 3CEXA 4CF6A 1VHTA 4B31A 4EHBA 5JYCA 3AHHA 4A92A 2CVOA 3AKDA 1Y8QA 1SHKA 5JD3A 4B85A 1P39A 4NP6A 5CT5A 3ITKA 3G3EA 1EA5A 5FBWB 4UE3S 2EG9A 4R40A 2W2LD 2YMQA 1QG6A 5TMPA 3FKSA 4COKA 4CDAA 5L51A 4RCYA 4Z4CA 1GCUA 1YB6A 4F5EA 4D9KA 2O5CA 1MTZA 4NABA 1D2RA 1VL6A 3S2SA 5KC9A 5IVIA 4UNPA 1JU3A 2IH5A 2FQYA 5GIPE 3MW8A 4HWTA 1USGA 1FZTA 2BI4A 1GRQA 3W5DA 5EJMA 3O26A 5IMBA 2RCNA 4QGAA 4KDRA 1ARZA 2AI2A 3WMWA 1NG1A 4Q39A 3WDMA 3O4JA 2R4QA 1P9WA 4L8FA 1SUIA 4E5NA 4O3FA 2IOFK 2BEWA 3KQOA 1PEKE 3KKMA 3OU2A 5B2EA 4MKGA 4RD0A 3MK31 3FJ1A 4YWQA 1BR4A 1YR1A 3RFTA 3DXXA 5T8KC 4GP7A 1Q91A 2JA2A 4HN4B 4CR7A 1URPA 5CGZA 1XMQB 4H1TA 3ZY2A 4D0NA 4EKEA 1KIAA 4XPZA 1Z45A 3C3WA 1JQAA 4N5NA 2YQ4A 3GFPA 3WS7A 4OQEA 1Y3DE 4RFSB 5ALPA 3AP3A 4QFDA 4RAQA 1NIPA 3C7CB 1GUDA 1Y63A 5I3ZA 3L2OB 1FS6A 3DYVA 4DCVA 3GGGA 2I6UA 1E2LA 4RF4A 1T0HB 3HBJA 1PL7A 5EIBC 2VSFA 3QW0A 4NJOA 3FUCA 4NWIA 4Y2HA 1OWLA 5JFGA 5I4KA 1KDPA 5SYAA 1T35A 2H5EA 1RTTA 3EZHA 2PJUA 3IAAA 1ZM4A 1LK5A 3X2EA 3V5XA 1U04A 1OQCA 3RF7A 3BAFA 4P92A 2F3TA 2IYUA 4QQFA 5F2NA 4FU0A 1VKZA 3CH7A 4MS2A 2E4XA 1ZMBA 2ZJZA 3D6MA 3FOPA 4YRIA 5J4VA 1BFKA 1XGKA 3QOYA 1ZH4A 3GEMA 1MR3F 3GLHE 1U3DA 1E3DA 5ERYA 5T4EA 4L8YA 2L19A 3VOAA 2SBTA 4GG1A 2YVKA 2Q99A 1GHTA 4Z7QB 3O9MA 2E2WA 1Z16A 3C8MA 4R1UA 3V1UA 3UG6A 4GP6A 3A7DA 1HDRA 1R6DA 1V1MA 5J63A 4BEWA 4F4BA 4UM8B 2MSEB 1P3JA 4MLCA 5ECYA 5DE3A 2CWWA 4LYEA 3NBKA 5BQXA 1MQAA 3ABLC 1T2UA 2GO1A 1E5LA 1M10A 4XGNA 1CT9A 3CX4A 1ECBA 4L22A 4IO1A 3RAGA 2YCBA 4DMGA 3PS9A 5JWOA 4E4RA 1LD3A 1DJOA 1SWWA 2FE4A 2QRLA 3G7UA 5ITWA 2IUFA 5BOVA 3LT2A 2NT4A 3IBYA 4ATNA 1G6HA 2C3YA 4H7HA 2BW0A 2IU4A 5TSDA 3PC6A 2R8RA 1RCPA 4RF3A 3F6RA 2X7XA 2ZI6A 5AI6A 4MLPA 4LDQA 1XU9A 3ABQB 3IERA 2ATIA 4RPLA 3REFA 3NYJA 3L1HA 4X20B 4YGYA 5AJVB 4Y9DA 1QGDA 3BDVA 2ZRDA 5FA6A 4ZMRA 4YO7A 1MIOA 3OQ1A 4W9MC 3N8KA 4N5IX 3IBGA 3MRSA 3TRDA 3QQPA 2HMYB 4DLRA 1YZQA 2O0MA 5DCYA 2WU0A 3TNLA 1V9CA 1CZRA 3A3OA 3JU3A 5IVPA 4XD7D 2PXCA 1G8PA 4HFRA 2AUMA 2UUBB 3BICA 1KH2A 2BC5A 1AGPA 2VP5A 2VA8A 3WB1A 3IPXA 1RU3A 1KJ9A 1BCSB 2QTRA 2KHZA 2BFBA 1EQUA 3U3OA 1UFVA 1NUSA 1N9ZA 2KMLA 4H1WA 5HZGA 4PFPA 5COGA 1GGHA 5DIZA 2QRUA 3AR4A 4TM7A 4NKRA 4E94A 2OZLB 3B71A 5ESDA 4JH0A 2GF9A 1A8PA 5IVDA 2O8NA 4KKXB 5ALKA 1SFRA 3E3OA 3ASOC 1KKUA 1KC3A 5JW6A 3FOWA 4B4VA 2AKEA 5F5XA 2INGX 3TOMA 3ND6A 5M3BA 2NU8B 1KMMA 3UF0A 2NPFA 2RGRA 2QX9A 1CFZA 4KQ2A 1R0WA 3OFNA 1IN7A 3KHSA 2BDTA 4C9BA 5CB6A 2GOYA 1O5IA 1GGFA 3O8NA 3C4JA 4S3MA 4HWSA 2BHNA 3EEQA 4YDHB 3SJCA 3FF1A 1Q84A 1M1NA 1J8MF 2QD3A 2Z2KA 4WN9A 4BO7A 3LT5A 1II8B 4EVQA 4XGRA 4YCAA 2NW6A 5DYTA 1UDCA 2FW7A 3UHPA 4WY5A 4RTOA 4CQLB 1OA0A 4DQKA 3TL6A 4RSMA 4BN4A 2MSLA 1C1DB 1TGVA 3ES9A 3DKKA 1AIPA 4GICA 1R9JA 4DUPA 3EYAA 5JMPA 2YKZA 2H0AA 3KV3O 3LAYA 2Q3BA 2FRDC 2DZDA 1FDSA 4Y30A 1SBYA 4M1MA 4Q7QA 3LTNC 2EDAA 1I4EB 3KPUA 4RH0A 3ZHVA 5HJEA 2VJBA 4BB5A 1E2UA 3JQ8B 3I34X 2NO5A 4P3PA 2AK3A 4GOOD 4JJ4A 5CD9A 3SEAA 1DHRA 4LAFA 2DUJA 5D3MA 4RLQA 1UF9A 2Z6VA 2Z6AA 3AUYA 5BOSB 4UNNA 2QJOA 2MINB 3SYTA 4LYDA 2AG0A 1DXOA 4MUBA 4MRNA 3IHUA 2XWSA 4OHCA 4AZWA 3IKVA 4OJTA 1G2OA 3NIBA 3WLNA 4RBNA 3C7DB 3HBLA 1LW7A 2W6IA 3GM1A 3RUCA 4MUMA 1SHUX 3BB4A 1LFDB 4LHEA 1E64A 5C32A 1Z5NA 1SMYF 4FMCB 3GODA 3DGEC 4ZQHA 3MT8A 1AK9A 1F3LA 3WYEA 3HA5A 2C00A 2WHXA 1ZY2A 2IBSA 3L0ZA 3MJSA 4DG9A 5JT1A 4XI9A 1QE3A 3WGUA 2DQKA 5EXEA 2ZJ4A 3W6UA 4EEKA 3RVLA 4UNSA 3NYWA 2DBZA 3Q3GE 3L6EA 1JEYB 5IJZA 1V45E 3WVNA 2HY7A 2JPUA 4JEAA 3HEAA 1A8HA 4GO1A 2F3PA 1IWBB 3OMWA 1VLJA 4PLZA 4ZHSA 4JHXA 4LRYA 2GRUA 4UZSA 5FULA 3T3GA 3CVWA 2F9FA 5EWLB 4Q03A 4P4NA 2GJAA 3LHDA 2V5AA 4WDRA 4BPBA 4Y8VA 3RR2A 4LYHA 2W4MA 1PT5A 3QMPA 1UKCA 3UPUA 1LY1A 3ZQJA 3DXJF 2PFSA 3H97A 3Q7LA 1VGRA 2O54A 2GK6A 3KS9A 2A0KA 1ICIA 3IT2A 2YIJA 3ICCA 3QIVA 3FB1A 7YASA 2BZ1A 2ERXA 3KLPX 5L9AA 1BR2A 5DBOA 3W1WA 3A1EA 3IOCA 4HXFB 1E2NA 1NDUA 4FFLA 4ULWA 1W8IA 2O7NA 5KSYA 1C1HA 1IXZA 1Y3FE 2GN1A 2FQWA 4F5ZA 4BJTA 4CSAA 4DJJA 5D01A 5EUBA 4BOYA 5KYXA 1IOWA 4JL6A