2YRFA

Crystal structure of 5-methylthioribose 1-phosphate isomerase from bacillus subtilis complexed with sulfate ion
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
340
Chain Sequence
b'SVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioribose-1-phosphate isomerase
molecule tags Isomerase
source organism Bacillus subtilis
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
total genus 103
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yrfA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yrfA02
3A11A 4ZEOA 3A9CA 4ZEMA 3VM6A 2YRFA 4LDRA 1W2WB 5DBOA 2A0UA 4LDQA 2YVKA 3ECSA 1T5OA 1T9KA 1VB5A
chains in the Genus database with same CATH superfamily
3R9IA 3RUEA 3DXFA 4BRWA 2AZTA 5LYJB 1SQSA 2R44A 1JG1A 2QB5A 3Q3EA 3PXCX 4DZZA 2JJ2A 1HG1A 4KAFA 3E22A 4TZ0A 4W7SA 2VSNA 3GRKA 1M6WA 2ZIXA 3PQ3A 1E85A 4NYJQ 3I09A 2JI7A 4XZ3A 1DRJA 2ZE6A 3UW3A 1YDIA 1YQDA 1QHHB 2X0IA 5EN4A 3MIZA 4YR9A 2AS0A 4MVJP 4QGHA 1SR2A 1RQXA 4JE9A 1KAQA 4K03A 2WTMA 3F9IA 4JJFA 1DIHA 3HXKA 1QRTA 1R8QA 1NNEA 4AWXA 1W6UA 3NBYC 4CR7A 5CDUA 1TIBA 3LY8A 3OCXA 4BMZA 4L9WA 2NUPB 1MW9X 1R4MB 2QD4A 4I4TF 1T9GS 3NXSA 2G88A 3PHJA 2D3WA 4MDHA 4FUQA 2YWXA 1FMJA 3RVMA 4YJGA 4TQUS 5DOZA 4BO9A 4PQYA 1F4VA 3BJRA 4EPVA 1ZKMA 4EM6A 5DLJA 1B1AA 3B3QA 4EUKB 3N07A 5I7FA 4Y9TA 3R77A 2PT5A 5BSUA 1CR4A 1E9CA 3OT1B 3EXAA 4FCTA 1KDTA 1TCUA 2O6LA 4F4CA 4XH9B 3SOPA 3ELDA 1AF7A 1E3EA 3MTJA 3QEMB 5AVRA 1J25A 5IFKA 1CYEA 3TK1A 4N82A 3T61A 4QRHA 3WV5A 4DV2B 2WJZB 3ZWQA 3NHRA 1SZDA 4OKNA 1ZR2A 1X7WA 3SM9A 4RACA 1F06A 4XWOA 2WG0A 3QBJA 3ISVA 4N7JA 5JYEA 4Z9HA 4JLSA 5I01A 2GZAA 2RAVA 1EK2A 1XQYA 1ZH0A 4JU9A 3VKUA 5HE9A 1U3DA 2C1XA 4AY6A 4D74A 1L7MA 4ZVVA 1ZHXA 1TFOB 1G8MA 2VJLA 1P1BA 3AF3A 3U9SA 4DB2A 2PS3A 3IP6A 4MYDA 2OZEA 1GZHB 3C8MA 3TR5A 2PUGA 1HY3A 4IWNA 4RM3A 4YEDA 2JFUA 3UNXA 2EF0A 3FX2A 1DV2A 4L3WA 3IJEB 4WXYB 3DS8A 4MK4A 4E03A 3F46A 1R0SA 3DUFA 1JIUA 3GPBA 2C31A 1A82A 3GWZA 3M6IA 4L5BA 1RYFA 2XNDA 4N8DA 1YQQA 3ZH2A 4K87A 4GGMX 3LUAA 3N86A 5E3IA 521PA 1MDBA 4B7ZA 5LWQA 1GNTA 4BNMA 4CL2A 1N2CA 2FWNA 4KQ1A 2GKOA 2AKYA 4IJ5A 4X71A 4CKXA 4PVCA 3R5HA 5HDQA 1UFBA 1SVKA 1U2DC 3F6PA 2CEKA 2PL5A 1XI2A 5F5FA 1P7PA 2EYUA 4ZGGA 1JV2B 2O2HA 3O93A 3JWGA 3M9WA 1SIWA 1NU6A 3I61A 1SKQA 5BMOA 4XFDA 3N8IA 4WZAB 2VWHA 2O2IA 2HC9A 4Z3KA 2FRDA 1JDBC 1XTKA 2CLOB 2OILA 5EG5A 3R75A 2B2CA 3CURA 1H42A 4M63A 4FQ5A 5LFAA 4MCJA 4S1NA 1FFXA 3K0SA 4FLEA 3NRHA 1WCYA 3EMVA 3AVVA 1F1BA 3LKVA 2HNAA 1A95A 5J63A 4MQFB 3BMNB 2Y2UA 1AC5A 2XE6A 5M2QA 1LD3A 1KL7A 4FYMA 4RZ2A 5J2UB 4D02A 5A6SA 1WL8A 1LM3B 1JT9A 1J8DA 4QBKA 1HORA 4YP7A 4Z7NB 3GP5A 4XPZA 2CXHA 1N33B 3JAMA 4M9XA 1SPXA 2HRQA 2YZKA 2PTHA 3N9IA 1E7YA 3F5MA 4HN4B 5CEJA 3CNQS 4US2R 3ILXA 5FP0A 3R3UA 4Z4CA 1SU7A 3V8RA 2VNHA 1CWUA 4EYSA 3WR5A 5AW2A 3QXHA 4P4GA 1ISRA 5E6UB 3DF9A 2A7QA 1P75A 2NUTB 2J59A 4QYSA 3AF4A 3Q8LA 2DUUA 4QT0A 3FPGA 2XF2A 4BFXA 4D4NA 3SICE 4P0QB 1N8TA 2GEFA 1L5KA 3OBIA 3DAFA 3JSEO 2WJPA 5TGTA 1Q0SA 2JEOA 3L6BA 4Z4FA 1XEXA 3GA7A 1I94B 3E23A 4BEMJ 2IKQA 4DEVA 4RWZA 1ZH6A 3NWEA 4V2IA 3X1ZA 1N1MA 1YJ5A 4ENPA 4PNPA 2UZ1A 1W0CA 1GQFA 5KYUB 1H1LA 3AUXA 3ND6A 2NSLA 1QFJA 5LNK1 1PKEA 4MS4A 5ICCA 3DTVA 4TQGA 3QVSA 3ZBUA 3LL4A 4G1UC 2HY7A 3VDRA 4C0KA 3VNQA 2OK8A 4B71A 3BFKA 4AM8A 3BRCA 2B4QA 5FJIA 2W11A 1P31A 4GKAA 4AJKA 4GMDA 3H4VA 2PRZA 2PD4A 5EHXA 3VA7A 2V3VA 3RJ5A 3ZN2A 4XJVA 1XZFA 3OPXA 1SBQA 3ROFA 2IRWA 2H52A 4AYXA 1JAIA 2XXAB 1SCAA 3I6QA 5TQ0A 3E9VA 3WTCA 1OLXA 4KGVA 2D00A 2XV1A 1ZI8A 3F2IA 3VNRA 3K96A 3NBMA 4EI2A 5A5FA 4DLPA 2PMEA 5GJBA 4WVLA 5C7IO 4OD4A 2D1TA 2FWIA 4BVFA 3QKSA 7YASA 3L8JA 3CAXA 2BI7A 3RIMA 1ODTC 2P91A 1PF7E 1TD9A 4R68A 3UAZA 4B7XA 2JATA 2V6JA 4L02A 2XSZA 2GM4A 4BV9A 1E5DA 3ETGA 5G3ZA 2V5AA 1PP4A 2AUNA 5J40A 3WHLA 3U09A 1UMDB 5FLXA 1TUBA 1WW8A 4ND3A 2Q1TA 2OBXA 3AV3A 3CPSA 2QPAA 4RJJA 2B34A 2R7RA 1O6FA 2CHUA 3JQAB 4XUCA 2V6MA 5CW2A 4PN7A 3H2VA 4F8JA 5C18A 2OGZA 1Y6ZA 3DYVA 2QGZA 2YX1A 1RWQA 1P2VA 4JUDX 3HEAA 1OXUA 5DWQA 4EHNA 5A1TA 1P91A 3ZHOA 1XQVA 1YHZA 2DFNA 2HLHA 4DIFA 3H2BA 3PQDA 2Q6IA 4W5JA 5FTNA 3SXKA 3RYHA 3FW1A 3HYCA 3T12A 5JCOC 4PSVA 3CCBA 2XKBA 5E6SB 1BGWA 4PC2A 2PGXA 5G4KA 1K68A 2E4WA 2FUG1 2UXBB 4DT1A 3LC1O 3QUCA 4GQHA 3W5IA 3U19A 4UTRA 2SHKA 2VHJA 4O1MA 5F5HA 1NXPA 2AI3A 3DEFA 3LCUA 4BKMA 2I54A 3SCZA 3PKIA 4UAUA 1T4GA 3E2MA 1AGXA 1H2AS 1GA1A 4QOIA 4B5KA 4EHBA 4EW6A 3PJEA 5HKBA 5JRJA 2QE7D 2X19A 3I83A 4OI0A 2IXFA 2JW5A 2FSHA 2FPPB 5AM0A 2D5AA 5EJEA 2OLEA 4KXUA 3LK7A 3BXZA 2CYBA 5SZHB 4BLQA 3BC1A 5K5EA 4RLHA 3MJCA 2GPWA 5C32A 1BYUA 3UANA 5JDCA 3T1TA 1XKQA 2G1UA 3OZAA 4N5LA 2BGMA 4G4GA 4ZVQA 5CCDA 3GYBA 3G5UA 3K92A 3ZKWB 4EUHA 1WUKS 5B58C 2NQ8A 4P5PA 3L40A 4QX6A 1JHDA 2WUWE 3U4AA 4YB8A 5JG7A 5J2TB 4Z7QB 4N0MA 4COOA 3FFWA 1U65A 3ROKA 2QS9A 1WEKA 2W2TA 1XAGA 2E1PA 4L22A 2NU8B 4E13A 2AV6A 1MOPA 1Q3KA 4NBRA 5E6SA 2PFKA 2RBEA 4B4VA 1P2FA 3H9JA 3CW9A 1ETHA 2Q5JA 2YV2A 2GESA 3LDGA 3SP1A 2HN9A 1TZMA 3RIPA 5AKHA 3G0DA 2XNSA 1AUQA 3FMPB 5FNVB 4MWOA 4XJTA 4ZVNA 1FY2A 2ONCA 4F4IA 4KKVA 1XQ9A 3IQZA 4GM0A 3QEAZ 4HOYA 3VYTB 5DTIA 4P84A 5EUMA 1SMKA 3STYA 2V7QD 3VPSA 4ARUA 2PDAA 3DNPA 4TMYA 2PKEA 2JCBA 3EDOA 3KEMA 3TMKA 1JWLA 3LPAA 2GAJA 4XDGA 5EMMA 4KLZA 5BR1A 3S1AB 3EUWA 1PHRA 1Z7GA 2O7NA 4DADA 1YBFA 3INTA 1U7ZA 3ULKA 5CPBA 4FUTA 1ZHOA 3T1YB 1GUBA 4Y67A 1QGED 4RF3A 3LX6A 2WZBA 3RV3A 1APBA 3TJ5A 2YN0A 2Z57A 1B26A 1NXSA 4CG0A 3HKBA 1ZUNB 2RHRA 3IDOA 1PI3A 1JIVA 4GVXA 4XEFA 4MI1A 2DR3A 4Y1RB 5DI9A 3X1JA 2FKNA 2PR2A 1I2AA 2I29A 3SR3A 4DVGA 3DVLA 1Q1AA 1XTQA 2L6GA 3C6QA 1NRIA 3GQBA 1CERA 4J90A 1CR6A 4NDZA 4F5EA 5CFNA 2FSGA 3EHDA 1OKKA 2M98A 2O07A 2PSDA 2Q2WA 3NETA 4LQCA 2F62A 4F4BA 2WM3A 2R8RA 1RU3A 2RIRA 1RWBA 3OQIA 4PE5B 4B6IA 4NV1A 1XJQA 4M7WA 1W5SA 5EL0A 1I8TA 2YY5A 4KXXA 2QVBA 1K2WA 1T1SA 1T24A 3DEZA 3TZEA 1GR0A 1GQAA 3E84A 1TFRA 2A58A 3BN3A 1OYVA 3GEDA 2YS7A 4FVTA 3ZWPA 4IJ6A 2LRHA 2AU5A 1EYZA 2Q27A 2PRSA 1JMVA 1W5TA 1RABA 5FZTA 2F1JA 3PL1A 4KWEA 2NVUA 4P35A 3JARB 3RFTA 1UZAA 2PZLA 2RE8A 4UULA 2IPAB 3HGMA 4QBIA 3FGNA 5K6AA 1LRJA 4U2DA 3EY4A 2AJTA 1WS6A 3FA2A 1WBJB 1UMKA 4KVAA 4PSAA 3V4PB 1XQ6A 3EXFA 4HYEA 4YQZA 1DXHA 5CR9A 3H8WA 1IXKA 2NPUA 2AFHE 2EP5A 1CY1A 3CA8A 3E6AA 1EESA 1JR3D 4KFUA 5HZMA 1U3GA 3LF2A 2VXBA 3DWEX 4QDLA 2XXJA 3AR5A 4TYNA 1ESEA 2OOKA 5BOSA 3U4HA 4PZDA 4YN3A 3PFBA 1ZJWA 3CMMA 2PZEA 4EY7A 1LV8A 3O75A 1KVTA 1M2EA 3ROGA 5FQNA 1E86A 1HE1C 3GFOA 2A9OA 2ICAA 1SPBS 1FNSA 4OI1A 3SZOA 4DJDC 4P4SB 2EJTA 4NZNA 3ANNA 5DLEA 2PFSA 1BA2A 4CIHA 1KAGA 2I7VA 1QAQA 4I5DA 5HF9A 3SYMA 4C76A 1LX7A 1UDXA 1A9YA 1PO7A 4YK7A 5EHQA 2JFFA 1PGPA 1ZNZA 1CULC 3N7UA 4I0WB 1CB7A 1Z88A 4MWSA 4JJ8A 1YDWA 2O0KA 2Q6KA 3BWXA 3K5IA 3L02A 4MQ4A 2AN3A 3TM5A 5BN1A 4MS2A 2H54A 5LQJA 5KREA 5BMVB 1X70A 3U7EB 2E48A 4OJTA 1TK3A 2BKUA 5JATA 4H54A 3K9HA 1Z4KA 3FWKA 5FAKA 1UM8A 1ORRA 3R0JA 4ND2A 3G1WA 2ASRA 2WRZA 1N5OX 4ZLCA 1QVVA 1EA5A 3DGFC 3MW8A 3QKTA 1XTBA 1KKMA 1XEFA 1UT5A 1TYAE 2OV6A 2P77A 4MWTA 4UPDA 4UC0A 3ZCTA 4WK2B 2B9VA 4DMUB 3G49A 5EQFA 5DLQC 5I5EA 3LYUA 4NEHB 3WYEA 3MYYA 2GPNA 5HFAA 4G6ZA 4F4JA 1AD2A 4PIPA 1FUEA 3PT9A 1NBME 5FT9A 3T5MA 1KI2A 1OZ0A 2Q5FA 3S5JA 4EGQA 2WOJA 4GZ6A 3STWA 1AT1A 4ITUA 2DI3A 1M34A 2RARA 4OMDA 3LBHA 2ECOA 4G1BA 1VFPA 3GRCA 4DXAA 5EEGA 4EHAA 4ZRMA 2VA8A 2PBLA 4BEJA 4HVCA 4RWEA 5KJEA 2I4IA 3FN4A 1M5TA 3I52A 3KLBA 4GOKA 5BUSA 2VFAA 1U5BA 3VQTA 2ZLBA 1MEOA 2JD2A 5TV2A 1P80A 5E9WA 5AKGA 3THWB 4IDBA 2CFRA 3ECAA 4RE6A 4ZVOA 3ROEA 2FY8A 2ZWIA 3IDAA 1PZHA 1U6IA 2FUNB 4M36A 1IN6A 5TX7A 3VGJA 4JKYA 1KJ9A 5DM4A 3JXEA 3PFGA 1M5RA 4BQSA 1KJZA 3UMCA 2GJAA 3RUDA 3O94A 2O1XA 4A2NB 3L18A 5CK4A 1E6LA 1OCOC 2EIMC 1X7DA 3QJGA 3SQLA 2PWZA 4BO3A 2H1OA 2WICA 2BZ1A 3H8SA 1AJEA 2X86A 1JI3A 2VEOA 4JKIA 4BGEA 2R1TB 1E98A 3WNQA 3PPWA 3FOBA 1REQB 5AK6A 1V25A 2YHIB 4NU5A 4YA6A 1EQUA 2AZXA 2V5UA 3KUCA 3BMXA 4LYDA 4UHDA 3P5BA 3AP1A 3A6JA 5EYPA 4LTNA 3PD7A 2EFYA 4U5CE 2O3UA 3BF7A 3N6RA 5CX1B 4DA9A 4DHWA 2OKCA 1WNFA 1MRZA 1GUYA 1OFTA 3QQ5A 2G72A 4JS0A 4YWHA 4AJ1A 4CTNA 5C1DA 3SPXA 5KTPA 2WHXA 4HQOA 2OM6A 3GHHA 2NUAB 1K7YA 1WOYA 2WPDA 4RDXA 2OV1A 2OVFA 3HU2A 4B73A 2Q3BA 2QVGA 4L27A 4L5CA 2Z04A 4D9FA 2LD6A 1EWVA 2P9GA 3UPTA 2YS6A 3AR6A 1CEQA 1WHSB 2P6VA 5TQVA 3WLRA 2QM0A 1E1QA 1P9WA 4JP2A 2J5RA 1SVLA 3NMKA 4D3SA 2G4VA 2ZI9A 1A9XB 4K6OA 4P3NA 5LDGA 3ZXIA 3ZZUA 4DIUA 3GUUA 4EG0A 5LP6A 2J48A 4AJIA 3L7AA 4Q3EA 5E2AA 5CBPA 3DAHA 121PA 3FIJA 3MAGA 4FINA 4BFLA 5BURA 5FTMA 2E37A 2XQFA 2C9ZA 3H2IA 1OX4A 1XEWX 2FPOA 2OCKA 3A04A 4FZVA 4MYTA 1E1MA 3MG9A 3KAJA 3E05A 5KC8A 4HEAJ 1GGFA 4Z9JA 2FSSA 4FLMA 2V59A 4YP5A 1VMEA 1JKFA 5EXPA 5JVDB 5FH9A 3AH8A 3PITA 2H2FA 1RCTE 4TYQA 2N75A 1GZ6A 5CNIA 5DF1A 4H16A 1EUZA 5AESA 5C46F 2HMAA 3VAAA 2D1SA 3ZD9A 1BDJB 5KVCA 2WHPA 4DBRA 1FXUA 1XZKA 2NW6A 3OUUA 3ILHA 1FMTA 4DLNA 1W48A 4XD7A 3A4MA 4QQRA 1GL7A 3LRXA 5KDOA 4GU5A 3HJAA 4TKMA 4HWSA 4G8DA 1LDEA 2C78A 5D7NA 3TZKA 5KJ6A 3FJYA 2E5LB 4J0GA 4O4LA 3WYCA 2JD3A 3T1NA 4CKBA 1XVVA 1YA8A 2WNIA 1M10A 3AETB 1AZSC 2JAQA 4PZYA 1ZM3A 4WOKA 4LRYA 5CYPA 5SZIA 3IKJA 2DKFA 4ZODA 1CQIA 3NH9A 2R8YA 3TVDA 3NHBA 4GP6A 2LKCA 1JPNA 1MHPA 2VUTA 4Q1VA 2J3JA 2YJNA 3V1MA 5DMXA 3WMGA 5CUQA 3A4TA 1ZITA 4U5QA 1FMWA 1FRQA 2QG6A 4MWBA 5FOUA 5IW8A 2DWUA 3ZX5A 4Z7JA 1R5OA 4BGDA 1U8EA 2VAMA 4D43A 4KXMA 5JS5A 4MVYA 3ZV3A 4RY2A 3L1HA 2WIGA 5EXDA 3DJYA 2W42A 2Y3DA 3QYPA 1T01A 2J31A 2HJGA 4B6OA 3QVOA 3GZTB 2Y67A 1RD4A 4Q6WA 2IPMA 4BFTA 1KYQA 3TG2A 3HO1A 4JV5B 2FP4B 3BRSA 2WSIA 3AJDA 1B00A 2EV9A 2DUMA 3M1LA 4FE7A 2W70A 3SE7A 1RC0A 2BGWA 3B5IA 1T8TA 1P29A 1Y33E 4NYIQ 4HD8A 1Z3CA 5EOVA 1ZRSA 2G0AA 5K0GA 1AHPA 1CXZA 4MSUA 1EHIA 1U8ZA 1M7BA 1YACA 3EGCA 1GAXA 1ISMA 4P6VF 5CCXA 5F1OA 2FE4A 1PVOA 5CB4F 2ZRJA 4DLUA 3N3BC 4LYAA 4QOSA 2Y3IA 1IWOA 3HXTA 5CXQA 2KQ9A 1TCBA 4LHWA 3IQEA 4D5EA 1XXHA 2QV7A 3CPHA 5TE9A 1DTEA 3K05A 4OHCA 4UUAA 1YFKA 2GZDA 1LTQA 1F1JA 1S2DA 1XYVA 3JSAA 1DEHA 1HO3A 1BKDR 3HZRA 4TMVA 2OEPA 5LUAA 2CE7A 4RYDA 4LOKA 1R4ZA 5EMJA 3JRXA 1PAUA 4YJGB 4EY4A 1IM8A 1OFHA 3PQ8A 4YRTA 1PT5A 1OC2A 2DQYA 1YUBA 2VEDA 2E3JA 3EIWA 3NZEA 1BOFA 4OXNA 4Y2UA 5TNXA 2QGFA 2X4GA 3AUKA 2VPTA 1AX9A 2W22A 4EATA 1FYWA 2HU8A 4B46A 4EEKA 4QT4A 5DTQA 4OOFA 3MXTA 1E3MA 2F64A 4QI2A 1IIBA 3LQ4A 2B30A 3FDQA 2AMJA 3V3KA 4ZGBA 5AUOB 1DXYA 2YV4A 1NBWB 2JANA 2XDAA 3KB2A 4YPVA 1CRLA 4TZTA 2A88A 2HJSA 2G09A 3C15C 3MS4A 1HKHA 3PFWO 3W3AA 4ID3A 2X9VA 4J1NA 4KXWA 2I6GA 3N6VA 3TLGB 4QM7A 4KR2A 2JHAA 3HNRA 5JDCC 1HYHA 4M6WB 2G1PA 1A50B 4YT4A 1O9BA 4UU7A 1ZIYA 1VL0A 4NMXB 3SLKA 1ZVQA 2CF5A 2Z6UA 3OTIA 4GIBA 3Q11A 5C7YA 3RNLA 4FQ7A 2XNHA 4X3PA 3P0JA 3RQEA 2H8AA 3UT0A 1FS5A 4XEVA 1HFWA 2HMSA 3W05A 2B82A 1EX6A 4NYMR 2WWHA 4DCNA 4EHLA 4MV5A 4OG2A 3W3AD 2ZWMA 1Q15A 1C7RA 1KFCB 1ECFA 3KBOA 2VF4X 5J9FA 3T5BA 4F06A 1K5HA 1VHJA 3K9GA 5AI9A 2HNKA 5FTKA 1DNPA 4FWIB 1IZ8A 2Q5QA 3LQKA 1G5QA 1GG2A 1LFDB 4N9QA 1ADBA 5EXTA 1V7CA 4G56A 4EA7A 2FGYA 2OOCA 5L0DA 1EVJA 4K9RA 1QHSA 4PPQA 4YJ2B 2WP8J 1XN4A 2IBSA 4HXGA 3ORRA 2J46A 4QPPA 4DMGA 1J90A 4X00A 3JWPA 1NONA 3WRYA 1J07A 4FYPA 3OZRA 2ENWA 4N4AA 2FEWB 3WGGA 4EB6A 4OJQA 3V6MA 5GJCA 3IURA 4K05A 1LB1B 421PA 3MEQA 4I1IA 1QHGA 2Q6OA 1JFLA 3CLRC 4A0GA 5J3JA 4JSYA 4MJ7A 3P2YA 5AHWA 3T3OA 4B80A 5K0LA 4X44A 4N7BA 4BO0A 2B0JA 1PNVA 1T5HX 2BF4A 2I6FA 1LC0A 2W0MA 3ND9A 2X4DA 3NAMA 1G4UR 4BMSA 4ZHSA 2C7VA 3EZ6A 3QVGB 3QLUA 1HY5A 3AHEA 1J39A 5AW1A 4OH1A 5DKFA 1FFDA 3TRFA 3ZV7A 3THYB 2Z0MA 3A11A 4E09A 4U5GA 1MFZA 2ZOSA 2IYVA 5ALHA 4AX4A 1U5AA 2AXPA 1YA4A 3HLYA 3KQSA 4PG7A 3KOMA 4LZJA 1ZSYA 5SYAA 5H83A 3JU3A 4PXYA 4QA9A 5L3ZA 4E94A 1IXYA 4DCGA 1WN0A 3R9XA 2QR3A 1M6EX 1PVDA 3OKAA 3GEBA 3KXPA 5L4NA 1YAUO 2FXVA 2VJAA 3MOGA 4OIPF 1U02A 2XOKD 3GM3A 4LNUA 4ES6A 5BN5A 3HRHA 3LY7A 1U0BB 3D6HA 4ZI2A 4D4MA 1ISGA 5JROA 1OTYA 4LLEA 1G8KA 4D0GA 4D26A 4BL5A 1C29B 3D6JA 4UNRA 3LC2O 1QHNA 3ABIA 3CVVA 3FDJA 1ESNA 1WTAA 1DBVO 1UT6A 2UVPA 1M67A 4E15A 2BGJA 2H8GA 2HHAA 1QIEA 2UUPA 3T95A 3SF8B 5FJJA 4B3RB 4G5XA 1A8SA 1Q84A 1TWHA 1MX1A 3ILVA 3CVJA 4WKNA 4V39A 2GBLA 4ZAGA 2Y0PA 1O8BA 2GEJA 2H4FA 3EA5A 3ICCA 3TZQA 4E1BA 1E9DA 2VH2A 4FWBA 4YQFA 3L4BA 4KE8A 4IWXA 3A1DA 4XYBA 3N87A 4I55F 3H11A 5EMKA 2GT1A 5J2TF 1E4EA 2V4MA 1Q20A 2G67A 3OZ7A 3WWDA 1KI7A 4K7BA 1GG9A 1K7CA 1HE1A 1LDGA 3GH3A 4EFMA 5ABPA 3D6FA 2QL6A 3FTPA 1Y4UA 3HSKA 3U3DA 4Y8VA 1C81A 2Y76A 3AG4C 1YRQA 5E1OA 1NAIA 3ZI0A 5LNK6 2YWGA 3KIPA 1JU4A 1WXEA 2R97A 1KR2A 2HF8A 5DWDA 3KQHA 3QXGA 2LD4A 3MWJA 2YXEA 2DJ5A 3V4OA 2A9FA 5EIFA 1QMGA 4TROA 4KBYA 1HETA 2R5NA 4L2IA 3W4JA 5AI6A 1WB4A 2PT9A 3BL6A 2QYSA 2N42A 5JQGB 4MROA 3B9RA 2BFBB 2VZLA 4R1LA 1J2UA 3I2YX 2B0CA 3K9BA 2I4OA 3MTAA 2R7KA 4OHBA 5EGYA 2ZUTA 3H65A 3VDMA 1EVIA 1PR5A 2HK6A 4B84A 4I1MA 3BSYA 4S1OA 3WLNA 2R6JA 3D4IA 3AUAA 1EVLA 4ZARA 3TLZA 2B7CA 4LYFA 1BVYF 3PEYA 3IOYA 3KCQA 5JYDA 3VPCA 3NDBB 2NAFA 1H1LB 4HVAA 1JPUA 3A4VA 4CV1A 4AWBA 3CVYA 4JL8A 4CEIA 1R8SA 2R7NA 4BZWA 1MMNA 4FKBA 1E9BA 2JLQA 1X7YB 2L81A 3HVUA 2WWTA 1GVNB 2RC6A 4RPJA 1SIOA 1SUAA 2ALJA 4NONA 4WGFA 4L6CA 1NIJA 2HLPA 1C8LA 2P5TB 1D7OA 3KR2A 2JKYA 1TYCA 2IC5A 3KKOA 4QLBA 5HXAA 3FHTA 3NG1A 4H3VA 2H4HA 1EFPB 1N32B 3M82A 3FPFA 2R62A 5DI3B 1DKLA 3MELA 4LRTB 4PJLA 1C3XA 1UP4A 2A6PA 3AFIA 1TLTA 1TKAA 1XWJA 3AW8A 4GP9A 3KD2A 3IO5A 4RHTA 5D5QA 2Q7DA 1C0KA 3R3ZA 4KCGA 2PJUA 1NOKA 3KD3A 3LKDA 4QPCA 4Y7CA 2HWYA 4D99A 5CB4B 1GPMA 5HR5A 1TMOA 5HNKA 3V97A 3TNJA 3NAZA 4TZ6A 4BNXA 2RHHA 5KOIA 2J0SA 3PFNA 3CNHA 1EEXB 3L01A 4F3YA 1G5IA 2B94A 3IHLA 3FJOA 4FXPA 3VH1A 1YI8A 3EGEA 2NZVG 4DMFA 3U7RA 2VJMA 2JHCA 3HY3A 2BEUA 2DWOA 4HWGA 4W4TA 3NWPA 4QICA 5J5AA 4CV2A 3D4LA 5FOXA 3EEYA 2C8KA 4ETIA 4FB4A 2FE1A 5BPHA 2IHNA 4HWKA 4TTJA 1J23A 1JRAA 3BL8A 3CZ6A 4F2DA 4IRUB 3CRVA 3EVBA 3NFRA 4KP7A 5EGSA 1OLOA 4LRUA 3MAJA 3CIOA 3MMNA 2M1ZA 1B68A 5EYPB 3K0AA 3LQYA 4BWYA 3MLGA 3PICA 3VYRB 4W82A 3M2PA 3NRCA 4S0XA 3HKDA 4M38A 2Y6VA 3MZ0A 2AFRA 2WV7A 3UXMA 3V5NA 1WLYA 2HD4A 1ZK2A 1H2BA 3PWSA 2MYSA 2ZRDA 1A8UA 2X9GA 3TKLA 1JQ5A 3D0QA 4L4XA 2D06A 2W6OA 3ITNA 4FFLA 4ZMRA 1JAFA 1N5RA 2NSJA 4MAFA 1LVKA 1M6VA 2ZJ2A 3NVMB 4PO3X 5HCIA 3LVQE 5ENVA 3H9CA 1JZTA 2HOQA 2ZIVB 3BMCA 2VDQB 3IUSA 4OV6B 1DMRA 1IOVA 1SHJA 2BKAA 3J06A 3JYHA 1FX1A 4U5XA 1DBPA 4KRYA 3EEIA 4UUOA 3WL5A 4MW7A 1TZCA 4E7SA 5EZSA 5SZJA 1K9SA 4K9QA 2P9CA 2DAPA 4HBGA 4EIYA 3HFJA 3DV9A 1VLMA 3NAQA 4HAIA 2CT8A 1DDGA 3U8VA 3LDFA 1KJ8A 3M70A 4F6RA 1OXBB 5JEEA 2JNWA 3FCOA 3ZE2B 3RWOA 1G9TA 3ATPA 2O0MA 1KIMA 1I2CA 2HCRA 4NPCA 3A36A 3U1VA 4JL5A 5DN9A 5CXUA 1HEIA 1WHTA 3VKFA 5CI9A 1LVHA 2ODWA 4ARSA 2GXUA 3WDKA 1XNQB 3OQIB 1E2IA 4RYLA 4A8HA 1X74A 4BX3A 1JFVA 4OD0A 4PQFA 2ONZA 1M73E 4D41A 3TQQA 2UZAA 3MLAA 1R6AA 2KS6A 1VYUA 4JLWA 1NE2A 4AG3A 1B4DA 4M83A 5GV8A 1R0RE 3O0TA 2PUBA 4R31A 4AJ4A 1TWCA 3ZCUA 4QUBA 4BUZA 2VPIA 1BX0A 3IMFA 3SEAA 3PHCA 3VO2A 1UDWA 1J0EA 4XTCS 5F7ZA 2O3RA 4MUKA 4XSGA 3TUIC 4KRXA 5HSWA 4W5NA 3JQBC 3KSUA 3I6YA 1RKEB 4IVNA 3M33A 2PS1A 2XCUA 3ADKA 3QM1A 4KU4A 3UOAB 5KINB 4HF7A 4YIKA 2AWYA 2BFEA 1PX0A 3HM9A 1HR0B 4QEKA 1QDLB 3KJIA 1HDZA 1H1TA 2IYYA 2QY6A 5F21A 2DT5A 4L6AA 4ZT4A 5T4BA 4X61A 2O2SA 1ZOPA 1GFWA 2OV3A 3C2QA 3I12A 3OMWA 4I2NA 4BGIA 2XCRB 9MHTA 4WZZA 1YHNA 1R8XA 2HGZA 2ZKLA 1Y3CE 1TMKA 3IODA 3KB6A 3KKKA 1GXSB 2P9JA 3ZLUA 4KX5A 4L4UA 3E2PA 4U7JA 3OBBA 4HRVA 3T5GA 2FJPA 1IN1A 1NLXA 3EJWA 3K71B 2YWJA 5EHZA 5DNVA 5C51B 2I2BA 5FOQA 2QM8A 1BMFD 3DKVA 1J2EA 3OU2A 5C9ZA 4UAGA 1L4EA 2NZXA 1N0UA 2GUGA 4A0HA 4ZMBA 3AUFA 4PVDA 1J7KA 1IQ0A 2CLIB 3F9RA 3P0RA 2VRCA 4OHPA 4L75A 3RAPR 1VHDA 1A04A 2O0JA 2IJGX 1NJFA 1EQ1A 1G8SA 1GQ2A 1O2DA 1EM6A 2C4MA 3JWJA 1C8BA 1SKUA 3KYDA 4U5EE 5HE8A 3O1HB 1HE5A 2F6RA 4HNHA 3V2GA 5B2ZA 2I9KA 1E63A 2G3KA 1OI3A 3MUNA 2Q4RA 2ZAYA 2JJYA 2VCCA 1HDCA 1HEYA 3CO0S 1PEAA 3L8DA 4KQKA 4PHCA 4DSUA 3LA6A 3W4IA 4AZTA 3R3XA 5LQNA 1VL5A 4CDGA 4FDMA 1TGYA 4MW2A 2B2NA 2PZ8A 3E1KA 4PTLA 1DARA 4ZLDA 2ZROA 2C42A 3ISTA 3ETJA 4X1KB 1N2IA 1EBUA 1TT7A 1IG3A 1YQGA 3IQFA 3HB4X 4QYMA 2JIMA 4YIHA 3DE7X 3C7DB 2ORWA 4IQFA 2C7GA 4ND1A 4MKHA 1CEXA 3ZY3A 5BN3A 5K8LA 2PR7A 1M8GA 3PMRA 2GARA 4ARZA 3ZWYA 1OX6A 4I1OA 5BSVA 5KTOA 2GXAA 1EGHA 1OFIA 1M2JA 1C0PA 4MVJD 4MV9A 1VPWA 4ZVSA 4YN0B 1KJWA 2YZGA 5AJZA 2C4KA 3KWMA 1SU4A 4O3FA 4RA6A 4RNDB 5HZHA 3G4ZA 6REQB 3UPUA 4Y2QA 1TKRA 1W87A 4U8HA 4XWYA 1KI8A 2OM2A 3M6FA 3RYCA 3QPAA 1U2SA 3O8RA 1UOQA 3L7OA 4XLLA 4U9IS 3Q8KA 2C3YA 2X6RA 4GL4A 3GODA 2ES4A 3ROPA 1JAHA 2OD9A 4AYWA 5A03A 4G1MB 1E4OA 4EGFA 1G8GA 3P0FA 1L9KA 4TM8A 2FV8A 1TM4E 1GPWB 2F1RA 2O4UX 4DR4B 3AG1C 2CLEB 4I14A 1CDOA 2ODAA 4DC1A 4GPD1 1XVTA 4PZLA 3ZZNA 1G2QA 4B79A 5KBYA 2EJVA 4URHA 5FUYA 3RABA 3QV2A 3L82B 4Q3AA 1JE0A 4FK8A 1U28A 3T9DA 2OCBA 4I9FA 4H1HA 1Z39A 3ZCXA 3KQNA 2P3SA 4BMYA 2FPMA 2QMOA 3PCTA 1JIJA 2XGJA 3BAZA 3RYTC 3N0WA 2HTEA 1QQTA 2I6SA 4RSRA 3H2SA 3LHIA 2XEDA 4ZCSA 3GGJA 5LA6F 4C29A 2RH9B 5K7SA 5F4BA 3QELB 1NLFA 1KTIA 5A2QA 5IYZF 1LSUA 3L7LA 1U4OA 1XAJA 5DBEX 1CQZA 4R6XA 4OX9B 4MS1A 3HJHA 3K1JA 3I0ZA 1DLJA 4WKCA 5LD2C 2D62A 4NMHA 3QLJA 1LBEA 2HIHA 2I8LA 1R4AA 2R6GA 3UYLA 2ZD9A 1AOXA 1I1OA 2ORYA 3SQDA 2MJLA 4BBJA 2CWWA 1ICIA 2HPZA 1OFGA 2OE2A 4UXIA 1EJ2A 5BNWA 3GFGA 4CS9A 3JVVA 4P93A 2BUCA 1MIOA 1HQDA 4FT2A 2FMKA 4F8YA 3AERA 3GP8A 1EDEA 2PSSA 1JLSA 2ZR0A 4B0OA 3LLMA 4CM1A 4B43A 1NI5A 4DBLE 3GLGA 2IYAA 2B4KA 3VI4B 3BDVA 2BCEA 3W6PA 2Z1DA 1U0NA 3PIIA 3JQGB 3C5EA 2B2XA 3WGNA 3I4UA 1IONA 1D4AA 1N1GA 1YMUA 2Q3HA 1YV9A 2AH5A 2G9RA 1ZN8A 2HJVA 3AHIA 3N2KB 3WWEA 2GCOA 4LN1A 2CCGA 1GEGA 4PJJA 1WXQA 2YV1A 3RC9A 3TDKA 4ZEMA 3KZVA 3HXLA 1MH9A 2FG5A 4L1KA 4GXQA 4YRFA 2AK2A 4ZYYA 2PVCA 2MTBA 1TRKA 4ZZ3A 4QOFA 2BYTA 4U3JA 4FONA 4EJ0A 3EGVA 5CMLA 3C4QA 1AY0A 5J58A 4LDNA 4NOMA 4BO6A 4C0SA 2HUPA 4BU1A 2OYRA 2ZRQA 2O06A 5EJ9A 1XR3A 2WVAA 3AC0A 5FA5A 3QFTA 4KWIA 2VHWA 3BMNA 4G24A 5HA5A 3OQ6A 3PTZA 3S3TA 3T7JA 2FPKA 4L0QA 4TLLB 1XZGA 4GKKB 5SYMA 1XLVA 4KJXA 1Y3FE 2WMNB 5EPOA 5JSYA 4NE7A 1FEZA 3GXBA 4M55A 3TZHA 1HYGA 1ZA2A 2YFYA 4LIPD 2PRIA 5FYQA 3A2LA 1MBZA 1ODSA 1ZMTA 1NC1A 3F97A 2Q3TA 2P79A 2OY0A 2J8WA 2YDXA 3AZOA 3C16C 3N5CA 3E3MA 1JSCA 2PX2A 1CGOA 3DBLA 1V7QA 1PGQA 1NNSA 2BTEA 4UEOA 3REOA 2IEGA 1E5VA 1X19A 5FPTA 3RG8A 3BORA 3AQCA 4O2BA 5MDHA 2XECA 3JQFC 1ADFA 1NQWA 2F8LA 3G2LA 4Q02A 4YREA 1M0TA 1Z0UA 1JHZA 2QAJA 3ASVA 4LOHA 2PLWA 3KQYA 4R7ZA 1KO7A 1EE2A 4C0QC 2NSFA 2A1DD 3OH8A 2G4CA 1VRCA 1FRVA 3HU5A 2VP6A 5CX4A 4DCUA 3EQ6A 1KSJA 2WOOA 1L2TA 3M1YA 2OEVA 3VU3A 2BEUB 2G6TA 5TS3A 2JI8A 2PJRA 3N24A 3MYFA 1D6NA 1TYBE 2CVZA 2EW2A 3B85A 1VIVA 3ER8A 2AP3A 3GDFA 1I01A 1DGQA 4WERA 1K3UB 1DQZA 2QZZA 3MJVA 2VHVA 3CZ9A 4XARA 1YGYA 1YZKA 3EZFA 4O4JA 3OZEA 4NPAA 3EEOA 2QY9A 3OLXA 5CTJA 4ISBA 4RENA 4CJGA 5ERXA 4WGZA 5TT1A 4C04A 3IVMA 3KTAA 4KGZA 5BWLA 1EH5A 4Y2VA 1PT7A 1E59A 3UFBA 3LWZA 3DVAA 3RM3A 1T2EA 2PKWA 1MOZA 1YRHA 5ISMA 1N2JA 2Q2OA 3IV9A 3H04A 5AXBA 2XNCA 4W8OA 2PWAA 5JC1A 1DZIA 2WLSA 5DHFA 3T3PB 3TI9A 1A7JA 3FRHA 3V7YA 4E08A 2GPAA 4OREX 2R25B 5EIEA 1ZO8A 2JGNA 2ZJ6A 5D7BA 4X1OA 3N8NA 2D3TA 4YRAA 1OH8A 3L4KA 2CWDA 3L8YA 2X5OA 5ICFA 5JUAA 1OLSA 2P8JA 4FGJA 1FE8A 1OE0A 3DBRA 3IEEA 3MWGA 1KI1A 2BBSA 4B2YA 2P9ZA 3JALB 1SXQA 1EB8A 5C34B 2TMKA 4EYOA 2WNSA 2FF5A 4IFBA 5GONF 1OV4A 2B4YA 4R5HA 1PU2A 2NIPA 5IRCD 4IFTA 2E4ZA 2WZQA 3KVRA 1F2TB 1QC5B 1SM4A 2Q4FA 2F3UA 2PSHA 1U8UA 1IJKA 2H6EA 3O73A 2QV0A 1VECA 3K9LA 4JI6B 1SVSA 1Z13A 2GPTA 2QNIA 2ZSHA 3CH5A 5M7EA 5DWVA 2YHIA 5SICE 3TGLA 3QENA 2Y05A 4BNHA 5COGA 2BSAA 1SMYF 3GUYA 3K2QA 1N1CA 3OWHA 2Q9UA 3OLZA 4HAVA 2WZFA 1W49A 4KYTA 3THXB 5F33A 3DKRA 4DABA 1II9A 1L4UA 2ID9A 3WG7C 1Z2EA 2A84A 3LHSA 1PJSA 4EKGA 4DTIA 4D98A 4PPYA 3LXMA 4LW8A 3UCXA 1COWD 2FAXA 3RSLA 1CS4C 2MU1A 4CKWA 4QEZA 2HTFA 2YFHA 1TYZA 2VJPA 3QG5A 1FPMA 1U90A 4MRPA 5AW5A 2J0UB 4CIXA 4DR7B 1Z08A 4EHKA 2H92A 4O7GA 1I7NA 2P0YA 3RBXA 3ZIAD 4DL9A 2Z4TA 2H7BA 4FU0A 1UJBA 2C96A 1SUEA 1PT9A 4TMFA 4EMUA 4KAXA 1EZZA 1O6BA 2WYVA 5EFZA 4C0LA 4HLUA 4F5YA 2C59A 1E94E 5FUXA 2XQIA 1RJ9A 2XGSA 2XUZA 3F5DA 4F1KA 1F12A 2WMOB 4OJNA 2QD5A 2GZHA 1BZ4A 2XEXA 3ZDBA 1QIGA 1UM9A 3DL4A 4KQEA 4XD7D 2P6UA 3MUEA 2OMKA 3S7TA 5DMHA 2GPBA 4XQ0A 3A6EA 1D9XA 1EWYA 1GL9B 1UBGA 2A9PA 4JP5A 3UGKA 1WB9A 2F3RA 1X1SA 3JAKB 2J0EA 4JUIA 4NQFA 2DYSC 5T41A 4J4TA 4W99A 4AL4A 4EFDA 1SK9A 3IP1A 1WG8A 4V0ME 1HDRA 4HL6A 1L4HA 1TRHA 3ICWA 3OIVA 4AL1A 4G0QA 4XRRA 2CNWA 3V9AA 4OJKA 1CZKA 1AK2A 2ZJZA 3NANA 3IBFA 2DERA 1H2RS 3KUDA 2I6QA 3F8SA 1EFRD 2QUIA 1JJFA 3ZXXA 2Q45A 1EBBA 4IJVA 1JVNA 4TXNA 1N6KA 2AFHB 1U5CA 2GTHA 3FWHA 1ZI6A 4E6PA 2O54A 1V11B 1GM5A 5BN4B 2HSQA 1QIHA 1T6UA 3GT3A 1JL3A 2DR2A 2XTNA 1UXOA 1O5IA 1YDFA 2Y27A 3O8BA 4BTVA 2P9TA 2P2YA 3HB0A 1JA0A 2RIPA 1ISSA 1E1RD 2POCA 2NSHA 3HCBA 4NNOA 3TL6A 4FGLA 5ULLA 3NBKA 1ZISA 2IA5A 2XHEA 4BJ3A 3M3PA 3AR8A 1GAQA 1NP7A 5JZ9A 5A0TA 3LLCA 5C8YB 5HIKA 3IEXA 3DJUB 2P30A 3MLBA 1FTYA 2NXCA 3IPRA 3QUSA 4LWZA 2DPGA 1KDOA 2AD1A 2PUJA 4PZ0A 5EKDA 1U99A 1ATZA 1EI7A 3VKWA 3RB8A 2ZYVX 3FYCA 1XF9A 1F8FA 3M15A 1XTIA 4ZOLB 4EEZA 3I39X 4O0LA 4AKIA 3BRWA 3JQGA 2C58A 3AIMA 4KN5A 3WWYA 4HLDA 2CLDX 2BFEB 3A2NA 1GSAA 4DSZA 2Z58A 3DOUA 3QEBZ 1Z0SA 4A92A 4KQ2A 4EGCB 4MV1A 3HR8A 4ZDJA 5L53A 3KYJB 1E92A 5FBRB 4ZU3A 3ZU2A 2C82A 1FP1D 1XQXA 3GUHA 5U1PA 5EJ7A 3L06A 1KH2A 1J5EB 5ALOA 4RVHA 2DC1A 3P9QA 4JT4A 1NOJA 3OA0A 4NYJR 3GCXA 2QLFA 2R7UA 4IL5A 4IO1A 4XWWA 5E7QA 1AO0A 3U6KA 1G8PA 2J9VA 1ZIOA 1ZXXA 3O38A 4GMXA 4RPLA 1ZC3A 1Z2NX 4DR1B 2WKPA 2IIPA 1Q22A 1QUEA 3HWSA 4HGNA 3TBHA 4NARA 4IV5A 1FOEB 1OQAA 1B0AA 4WNAB 1VM6A 1WB5A 1XXHB 2O8BB 1EJBA 3U1BA 1LPEA 4TLBA 3G6KA 3SZUA 3DD5A 5J1TB 3W77A 1YKGA 2RHJA 3OFND 3QA9A 1HT2E 4IQ4A 3ZHRA 4DPLA 3H5OA 1E3TA 3F96A 1KOLA 3L8CA 4UD6A 4JT9A 4PYLA 1JR6A 2XKJE 1LLCA 3LPDA 2JK1A 1E2KA 4MUAA 4FMBB 1YRAA 3OI7A 1YQXA 2WEKA 4FBGA 4EW3A 5KO2A 2R4QA 1CY7A 1OXSC 3CUYA 3RU2A 3C41J 3FAKA 5AUQA 2RGGA 4NK4A 3ZDZB 3W34A 4TL7A 4B82A 4CLXA 3FPHA 1SXJE 4B3IA 3ND8A 1GG5A 1XBTA 1M34B 2OQRA 4R3WA 5JAQA 4DA0A 1C7QA 3OFNA 3ZUPA 5KCZA 2V7VA 2GLXA 5AO9A 3GPIA 5ECYA 1EZ4A 5BW5A 3IHUA 1RWPA 3JWEA 1XALA 1OTXA 3PGA1 1LDBA 2D4HA 2MR5A 4OX9Y 5CCEA 3KOOA 5F1YA 3BSSA 1BE1A 1ZGGA 1BE8A 1C3OB 4H77A 5EIBC 3ZNPA 4EENA 5C7OO 1NXOA 5BSMA 1BHO1 4FXOA 3VU9A 2GEDA 3PUJA 4XQ1A 4KOAA 3EEBA 3B3JA 1P39A 1Y0BA 4HNGA 1MLDA 2NTEA 3I1JA 2PUAA 4WQMA 2ZS8A 5JPCA 2QP4A 1L5QA 1U0SY 1I6WA 2VT3A 2OGUA 1YS2X 3ZGZA 2BFAA 1CF2O 2B1GA 4JL6A 2RAUA 3F6SA 4JA0A 1ZM4A 2IWRA 5IG2A 3RADC 1JTEA 1AUXA 1DHTA 3W7BA 1CF9A 1D8TA 2WVHA 4PG5A 1R0CA 2YLIA 1MVNA 2QK4A 4P80A 2G0TA 3S68A 1D2HA 4E12A 2NUTA 4DB4A 5LC1A 2P4EA 4ZAYA 3IIMA 4HATA 1M34E 4YWJA 1B8NA 4F7WA 1FDWA 3K31A 3BPSA 2Y1GA 4L8VA 4WHMA 2FNAA 4GR4A 4EARA 1Q7RA 2ZWOA 3JQPA 5KJ1A 4KQWA 3QX9A 2A0BA 3E9EA 4LZPA 4DJJA 3IC5A 1OAAA 1N6NA 2HK7A 3L0BA 1WU7A 3TLCA 5HPYB 3LUGA 1U2EA 1VTKA 2YY7A 1AS0A 1E1RA 4KLAA 1ODIA 4QOEA 5BQFA 2JGAA 1PNOA 3GJSA 3ZWNA 3EPLA 3SXYA 4UUQA 2VDPB 4D42A 4UU0A 4V1CI 4RORA 5I7RA 2H65A 1H93A 621PA 1C1DB 1L7CA 2OKGA 3GAZA 3P9CA 4WKOA 2A5YB 2ETVA 1JA1A 2YC2C 4K6GA 1NQOA 1G60A 4IO0A 5LN1A 2E21A 4HQ6A 3ZGVA 2RGBA 4NZPA 3FBWA 4RQUA 3JCZA 3NIFB 2BELA 3DHEA 1W1WA 3FHJA 4X3CA 4I3MA 1RPAA 2W71A 3OWOA 4FHDA 4HRYA 1ZKDA 1NJ2A 2O9JA 3QOYA 4RFLA 5HIIA 1Y82A 5JRDS 2BH2A 3RROA 2VOEA 2Z5VA 1DC8A 1GDDA 2XOEA 5A4KA 5AVUA 4QXMA 3C6XA 3E5MA 1Z74A 1EGQA 2ZJ4A 3PIRA 2ZB2A 1IOZA 3GO4A 4IM7A 4NE9A 4YFYA 5DLDA 4OJYA 4JBYA 5JBQA 3C1AA 2O5RA 3FVYA 1J49A 1Y9EA 3BCHA 3E8MA 3EZGA 3QUTA 2CLFB 1UWLA 1XCOA 3BTSA 3E2IA 2F4VB 4PWYA 3VBEA 1VCOA 3ETNA 5F23A 3W4YA 3G9ZA 4TKVB 1ZJ6A 3ZDXB 1OREA 3CR8A 4ROTA 5E33A 2GMWA 2VI5A 3FSJX 4RVCA 1G4AE 5A05A 5J4KA 3IAFA 1OWPA 1OROA 2BMFA 4CLRA 3VU1A 4JRZA 2DX7A 4GLFA 3EJNA 1MH1A 2PV0A 1W0KD 5H0IA 5A4JA 1B2RA 4C6TA 1NZFA 4F45A 3VR1A 5JBNA 3LX5A 4ZQIA 5B4TA 1XZ8A 3EW7A 3KTOA 4GX2A 4JW1A 16PKA 2XTZA 3VR6D 4ZRDA 4JCOA 5HRCA 1QRRA 3DHNA 4OQFA 4AJLA 3HGTA 3C70A 4Q39A 5TARA 2A3RA 2Z5LA 4LE0A 1MJNA 2C07A 5GVRA 3S6JA 1YK1A 2AQIA 1HFKA 3WHPA 1KFEB 2R25A 1PFUA 3ITEA 4M8IA 1JG3A 3A1WA 3ZWCA 1VPLA 4V0KA 2RH8A 1DFIA 1R4NB 1WSDA 2X9QA 4OY3A 5E3JA 1QAOA 1NWHA 2MOKA 4G2TA 5DP2A 5TEVA 4EGAA 3LXUX 2PGNA 3RK0A 1F7VA 3GJQA 5H3LA 4RZ3A 4BP8A 5IS2A 2IH2A 1TIPA 4HQLA 4E07A 1YDHA 3M49A 2Z2JA 2ZU0C 6ABPA 2WABA 4NJMB 1PSWA 4IRXA 3K6BA 3A6DA 1HKUA 4MKFA 1KK1A 2EG5A 5F9HA 2PX6A 2HGSA 3E7DA 2EPMX 1ZL2A 5FORA 4DQDA 4Y1FA 1STOA 3U3FA 4CT4B 1EVKA 2WTBA 1DG1G 2NT3A 2QMHA 1L9XA 1DX6A 5C8DA 2WG2A 1Z0AA 1KDRA 1KMQA 2OD7A 3E4DA 2XB4A 3FPJA 3H3FA 3OJWA 1VG8A 3FY4A 3PUHA 1O4WA 4JC4A 3ZC4A 4MCIA 5DVWA 3A0UA 4LYJA 3K1IC 3ZQKA 3ERCA 5A6AA 3GARA 5BW4A 3NTVA 3OPQA 2W2KA 4YJHB 5FIUA 3KJNA 1NMXA 2OYSA 4J94A 2AA3A 1YTLA 4M1SA 3R2JA 2JLSA 1IFXA 4AICA 3FJ1A 1V35A 1PIWA 1T0IA 5A2GA 1OVMA 1V8DA 4WK0B 4AMGA 4MVQA 2ATCA 1BAPA 1T0JB 1R8JA 3NHZA 5LYYA 3ZDYB 4B6SA 3H5WA 3AEYA 4ALJA 1Q12A 3C1OA 3GD5A 1YA7O 1D2RA 5G0WA 5CFQA 4IUBS 3WMWA 3SBXA 1ZM7A 3C14C 3I2KA 5TC4A 2XUHA 4JIMA 5TDHA 3HYRA 2EGHA 1V16B 3CRQA 2PIAA 1NA5A 4JJKA 1I9CA 1HNWB 1UOPA 3QUQA 4H18A 3K2EA 4WFQA 5B7GA 2XDYA 1PW5A 1V37A 4I1YA 2VYND 3Q6NA 2NVOA 2VJNA 5TIIA 4PACA 5CT9A 4ND7A 1XZAA 3TQFA 5H4HA 4YXWA 2CDAA 1COZA 4F86A 3UGJA 5JYCA 1NJGA 2Q5CA 1J0BA 2R96A 2Z8XA 1UANA 2Z2XA 3GELA 2VJKA 3QVVA 4UTVA 3F4LA 5CPFA 1MC1A 3K2IA 4NABA 4RNCA 1N9ZA 4IMJB 4C3DA 5KYYA 1PR3A 3OECA 4JJAA 4X7PA 1T43A 2AQHA 3PHF2 1A5BB 4XJSA 1IZ9A 4XX0A 2GAAA 4JT8A 5FL3A 1KDZA 3WYDA 5BVGA 4V03A 1C3OA 3GRYA 4V0RA 4EBBA 3W9SA 1Z6PA 4QPJC 1WR8A 1XZDA 4NESA 1F0YA 4KSYA 4QYWA 4BB6A 5AW7A 3VYWA 3ZW8A 3VTKA 2YWDA 1CF4A 1L7NA 1JHAA 1Y6RA 5AK0A 3KTDA 4JUAA 4BYMA 1J5XA 1L5LA 2C7QA 2FX2A 3DE8A 2ZYRA 2OB2A 4KI0A 1T2NA 2EARA 2JF0A 2TRSB 4Q05A 1N5MA 3QWBA 4ZDIA 3KEQA 2BC9A 3GI1A 4A8JA 2Y39A 2QZSA 4EB0A 3R7SA 4GZMA 2FMXA 2VATA 4PLGA 2R66A 5JHGB 1KOJA 4DJTA 4PLYA 1BNCA 3EG5A 3ZHUA 4B4KA 1ZYRF 1R2QA 5EIAA 1N2CE 1ORHA 4Y6GB 2VDLB 1AUVA 1E2UA 4B2LA 2VAPA 4Q4HA 4ZHQA 2OESA 4A8JC 3BJMA 2I1VB 4NATA 2H1WA 4LGMA 4C06A 3DZFA 4DZRA 1OXBA 3RUPA 5CA1F 2FP3A 5M29A 2VF7A 1RXQA 2XCQA 2JD0A 3FCXA 4XQGA 2JAHA 1RDFA 4LDPA 3QW0A 1I5RA 3TDNA 3OM8A 5A7FA 1MXFA 3KH2A 1VP9A 3Q8MA 4TS4A 3FUTA 1TQ6A 1PEYA 1MPTA 3LIPA 3OFJA 3OZIA 1T0PA 3KL2A 4REMA 4IIVA 1S2LA 2NU6A 2WJIA 3EBLA 1NYRA 5ER9A 2VDNB 3SK0A 1V11A 1E8DA 1OU0A 2YW9A 1NYTA 1V1RB 2NUPA 1SD5A 3VC1A 4X7MA 3FD8A 1OH5A 1CZOA 821PA 3OZFA 4PZ9A 4D0NA 3LE8A 4HKTA 3VKGA 3ROQA 5JS1A 2YLDA 2CKDA 1QU3A 5KWVA 3F74A 1YB7A 3GAAA 1E5LA 1E8NA 3U3ZA 1UKAA 3O8LA 1CQJB 3PPVA 1PDVA 4L4YA 2Z2IA 1T8RA 1ZEMA 2HSGA 5DBOA 3GMSA 1TPYA 4RVOA 2H9AA 2QL7A 1YZFA 4M7RA 4PONA 2NYUA 4PF1A 1XP8A 2VRCD 1JDPA 2DY0A 3HBNA 3NYIA 4I4TA 3FCYA 5BWOA 3GEMA 2HFJA 3MRXA 1M75A 1PNRA 2AFVA 2GA8A 2P67A 2ZIUB 4Q9DA 4ALLA 1QK3A 3L9XA 1DKRA 5HVNA 3KV3O 2ZS9A 4WK4B 4Z3DA 1V8FA 1C50A 3Q2OA 5ICGA 3QE9Y 2HO4A 3ZE9A 3L7BA 4EQ6A 4UM8B 1D4OA 3M5WA 1A8IA 1DPFA 3LVFO 5F98A 3CUUA 3RPEA 3TJ6A 2Q29A 4TMTA 2NPIA 5CLIA 1TXGA 4L9SA 1LPNA 4LXTA 1ZIXA 1NRWA 1EVYA 4US0R 1OHHA 4EUSA 5A9SA 4G23A 5ADVA 3ZW7A 5HKKD 1THZA 4RESA 1XB2A 2R7SA 2CY0A 1E5XA 1I32A 3QE4A 5H3HA 1N36B 1JLHA 2OAEA 4NFHA 5KPJA 4PBSA 3W4KA 2XRFA 4G25A 1A7DA 2JH9A 2YJ3A 1CT9A 1WBDA 1U3TA 3IVGA 1N7IA 3RW9A 2NSGA 2G1AA 5C0OE 1MVLA 2P2CA 2BKVA 1DKNA 3CSUA 4JQSA 4RTPA 3ZTWA 3GVXA 3ESYA 3Q5DA 1RJWA 4D3FA 3K2BA 5CNKA 3IB3A 4S1PA 4KSCA 1BMQA 4JX9A 2VK8A 2L6HA 2IEZA 2OHIA 4QODA 5GM1A 3UB2A 2KC3A 3NOXA 4LMRA 5KWJA 3EPJA 2BFDA 2BJWA 5GPGB 2VOJA 3B6EA 4FJ0A 4P2GA 2B1RA 2W4BA 1IVYA 2FPWA 5DW3A 2QR5A 1DJLA 2QYHA 4Q24A 4Z99A 1QNLA 1AKUA 1VBNA 4LJYA 4TLEA 4FMCF 5HMLA 5AW4A 2ADFA 5EE5B 4Z1MA 2E89A 3PNVA 5COBA 3NVAA 5K0EA 5D3MA 2KBEA 3K7DA 3Q6MA 4LJ9A 4PFOA 4BQEA 1J24A 5CFMA 5B3IA 4FESA 3KEOA 1FQJA 3B13B 3RIYA 4JI0B 1XJ5A 4EKEA 5GTDA 4U6QA 5DBIA 1TZBA 1SHLA 4MWEA 1ORSC 5B58T 1NMSA 3HKDB 1KHTA 2HXGA 2ZYAA 2M1XA 3JYPA 2WM2A 3QTTA 3T7EA 2VTBB 4L28A 3T7DA 4BXOA 4KTVE 4JXXA 5A3RA 2XMBA 1ZGBA 3K09C 2PUFA 3EIFA 4FZ3A 1N6HA 1M2FA 1IY1A 1M7GA 4Q66C 2NTVA 1H22A 1Q5PA 2BP7B 3DZAA 2YYZA 1RHJA 1D1AA 3WJ1A 3M4NA 5IJAA 1U4SA 2X0DA 3RH0A 4IEFB 3OPYA 1OGIA 1S3IA 2VJMB 4TZKA 1ZEJA 3L6DA 3R20A 2ZIAA 3KFXA 3RQSA 1X7WB 2WB4A 3DWGA 1SO8A 3V6LA 4B3GA 2OBLA 2I34A 3RARA 1OF1A 3VDQA 2YHSA 5AKXA 1ZVJA 1DEOA 4OBEA 3C43A 4PO8A 5T57A 2BZSA 2GK3A 4IDAA 4UMFA 4DV5B 1UODA 1QP4A 5BVHA 2KJGA 3ZWOA 1W2WB 4L8WB 1BXRB 3NHAA 2A7XA 3RKRA 2JIPA 2WUDA 4X6XA 4E7PA 5I48A 5J47A 4XEUA 3EQ8A 3LP6A 1JHVA 4TPKA 3KNZA 1ODJA 5TT0A 1T3TA 3LUDA 3ZJ5A 2IUEA 3EXIA 4JY7A 2HMZA 4MEAA 4IVRA 1Y4ZA 4GT1A 3VRCA 1WM1A 1BBHA 4AVYA 1W73A 2ID8A 4CN9A 4EUNA 4LRSB 4U7TB 5I7SA 3ZD7A 2M6LA 3FCCA 4OFBA 2J4DA 3R3SA 2OK7A 5AHRA 4TRNA 4L0DA 1E3QA 4DY6A 1DQPA 2PZMA 1FFWA 1JFRA 2ZJFA 4DSTA 1JG4A 2IZ0A 5EKSA 1RKUA 3ZH9B 3WJ7A 4AO8A 5AJTA 3EPVA 2JI6A 1ELOA 3GWNA 2RHTA 3AEUB 3RDPA 2O8VA 5ESDA 1N3LA 5I45A 4I5FA 1US8A 5JNUA 2P27A 4HTFA 3D3EA 2FQXA 3MBGA 1G6OA 3AI2A 4HGQA 1ILWA 2WKRA 2O8CB 3ICEA 1YL5A 1ADGA 1NF8A 2C20A 3QBTA 3VX4A 3UOWA 1VSBA 3L0IA 5GV7A 3FAPB 4PN3A 3I3SR 4LRQA 1XVIA 4AYTA 3C3AA 1MT0A 1RM0A 4F21A 5GIPE 3QU5A 1JJAA 3L93A 2UZIR 2WFLA 2Y0BA 3A1UA 3HGQA 3CXRA 3OTHA 2JKVA 4LYGA 1UUFA 3AFHA 3UJ7A 2ISSD 1TJNA 2HMQA 2QN3A 4R2MA 3OZVA 4RL4A 1KI3A 3JQ7A 1OPRA 1TM5E 1GQQA 1WATA 4EMBA 1XZPA 3AB3A 3K5WA 1RM4A 1W1UA 1XCMA 2Q0QA 1Y3IA 4DG8A 1MMGA 4MMXB 4CKCA 4UEQA 1H6BA 1UPFA 3PFKA 1BCRB 2HK8A 4HK4A 1XOIA 5SV2A 1M8JA 3FYTA 3M6LA 3ZOKA 2PZAA 1Z9BA 4KC9A 2V3CC 3FOOA 2IWHA 3V7UA 5I6DA 3EIEA 1KNQA 1DOVA 1U1CA 4L16A 5DDIP 2K7FA 3SR4A 1EG2A 3IKMB 4YAJA 1W0KA 1QXSA 1ULHA 2BGRA 2MDTA 5E2IA 2B3TA 1T2UA 1FIUA 3P2IA 1H9AA 4U3JB 1L3CA 1O54A 2DPYA 4US1R 5HYVA 3ZU3A 2O5CA 3VJKA 1CLUA 5AJHA 1B76A 4J0DA 5J4YA 1NBMD 2NP7A 3TTTA 1XZIA 1CU1A 1II0A 3EXFB 3M3HA 5ALLA 5AVSA 3DVSX 3M2TA 2ZDQA 1U2QA 4MW8A 4BPRA 4KHZA 4ZEWA 1RM3A 2B25A 1Y4SA 3CTMA 1E6CA 4JITA 2AC7A 4LMPA 4CW7A 2I3ZA 3AP3A 4WZAA 3GX1A 4DA4A 3AVWA 1VDMA 3WGTA 3SHOA 2G70A 2KW5A 1JSZA 5K0IA 2RHOA 3RI3A 5J59A 1PCXA 2B92A 1W29A 3DV2A 4G67A 3UJBA 3X0DA 4QDOA 3RTDA 4DOZA 4YCJA 1VE6A 1QB8A 1FP7A 4YAWA 3RVYA 5JFGA 3J7TA 4RF2A 5TXGA 1YI0A 4R8RA 1V2HE 3KTAB 5C8YF 4LDJA 4EY5A 2WZGA 2AZMA 3TQIA 3EQLF 3F0TA 3R3VA 3F5SA 5B1AC 4G37A 1XE3A 5EXEA 4BV2A 5CIQA 5I4CA 4DLBA 4EF6A 3KZXA 3OG9A 1CUUA 3ZY2A 3FBGA 4XXHA 4DNXA 3DT6A 4MX8A 1FFCA 1YZTA 3E1SA 5BR8B 3P2OA 2OO5A 4P58A 4A8JB 3ORHA 2W6NA 4ER3A 4I3GA 4WACA 1AHNA 2R4UA 4DLRA 4JURI 2YKGA 3JD3A 3O4VA 1U7HA 2JZOA 3CLSC 1GPDG 3Q3JB 5ITVA 5K3CA 5BNFA 3UAWA 3SBEA 2JC3A 3OEEA 4IDEA 5ES3A 1IVSA 1CJKC 3ZGLA 3U4GA 4MTGA 1EXNA 2FPIB 3CIFA 4LQDA 4E5YA 2ZBPA 2XE4A 3O3OB 4BCBA 1ENOA 3AUJB 1F4PA 3STVA 4HPWA 1SCBA 4BAUA 4FS3A 1WF6A 2A4KA 4QRIA 5JY1A 1Z4QA 4L5YA 3GAMA 4PSKA 4C14A 1C4OA 3M6XA 2I3BA 3EXIB 4J6EA 1AN0A 1NVFA 4TWZA 4UNSA 3GVIA 3ZKWA 4LF9B 1EMDA 3EZ2A 4NZMA 3WGVA 4F3CA 4OXIA 3LOPA 2IUUA 1UBOS 2Z9CA 2J9ZB 4M1KA 5AW0A 3PBKA 5C5EA 3VPDA 3EG9A 2G71A 1RRMA 3C62A 2G8NA 1B14A 5EKUA 4C30A 2ZDGA 1SYQA 4PRLA 4L78A 1X7YA 2PRJA 4PCAA 3EWSA 1PZMA 3MWYW 1WE2A 4NJOA 4OL0A 4TL6A 5KTMA 5MN4A 1E79D 4MQMA 4KE7A 4AY4A 5BV7A 4DYDA 1GS9A 1O95C 2GH1A 2VPPA 2CXSA 1FSGA 2FPRA 1HC7A 5K0JA 4LF6B 1N3BA 2IYEA 2Q1YA 2PYIA 4XIGS 1XKTA 4LJKA 4JYZA 4IH9A 3KQPA 2R60A 2P9YA 3W2HA 4BASA 2JCSA 4G5GA 3OIUA 5IF9A 4XYMA 2FR0A 3HZZA 2QRUA 1E79A 4HYYA 1VLQA 5ALWA 2B21A 3HP4A 2OXCA 2QTVA 2C4TA 2ECPA 3A6KA 4TL9A 5DTRA 3C3BA 3VH2A 1IBRA 2X1LA 1UJ6A 3ABSB 3D6NB 3E9MA 4XM2A 5F64A 3EHMA 2L19A 2A92A 3C7TA 4GOXA 4GXRA 1TYDE 5GGXA 4KB5A 2FHPA 1E5QA 2OCPA 2B7LA 4HH4A 1U7WA 4P7BA 1XK6A 3ME5A 3SBOA 4CQJA 2D1QA 4QAJA 4X3OA 5LR6A 4LRXA 4KO4S 2BLLA 2AI1A 1Z28A 3EGWA 2Q4DA 3FNEA 5AQ1A 1EFPA 5BYAA 1HYBA 2CK3A 3B89A 4CFYA 1I51A 2SBTA 3EFEA 4LNHA 1KY5A 4RJIA 3DLBA 2BPOA 3PFIA 1UBJS 4L7QA 1ZSVA 1WPGA 2C3UA 1Q91A 2PO7A 3I04A 1YR2A 4BMOB 4EHIA 4GL2A 1X1BA 3KOYA 3GOHA 3K53A 5WRFA 1SJ9A 4XAQA 1RAEA 1QQAA 2ZSIA 1Z63A 1D3AA 2XVZA 3R3WA 1IDOA 4EMSA 4JTCB 5AVYA 4YRQA 4C3VA 1SZIA 1NVXQ 1WD7A 4J7XA 2PSJA 4QHTA 5T8KA 3ZDFA 5JRAA 4X93A 2Q7OE 3KQKA 4TLDA 1GSIA 1QG2A 1MU0A 4LKOA 1V43A 1JH9A 1IDN1 1L4GA 3HABA 5DH9A 5DSTA 4V3CA 2VPXA 5KYTA 1ZNQO 4MW4A 2Q3CA 2R5WA 3VR5D 3CUEF 4D44A 5LCXA 3L0YA 2XRZA 3AVOA 3CISA 1DBSA 4JR0A 1UBRS 3H13A 4YJ3A 3ACCA 2OSBA 3FOZA 2W2LA 3UMYA 3CX7A 3E5RA 2QJFA 1O95D 1S7ZA 3IAUA 3LYLA 1QV7A 1CZNA 4KH1A 3I05A 1P60A 3D3KA 2QLJA 1Z7YA 5IDQA 2VB6A 2A1TR 1YI1A 2FPGA 5DS6A 2FAPB 1W96A 3G9XA 1A7AA 3DKAA 4NQZA 3GLHA 3OUTA 5JO9A 5A9RA 3U4MA 2OZLB 3O1JC 3OKCA 2X77A 1KZYC 1BQ3A 1C80A 3OU6A 1DAHA 3A9WA 3O7WA 1FRNA 1BW9A 2FXIA 2N1BA 2YBDA 4C7OB 1NKVA 1W4ZA 1WSAA 4JC0A 4CMIA 1U0FA 3GT7A 5HUJA 4D9KA 4K1OA 4GICA 1Z4LA 4D4JA 2WA2A 2CW5A 4FM9A 1XMQB 4XWJA 3IHWA 2QQGA 1MXHA 1M2NA 1SR8A 1M57C 4NKRA 3AM1A 3NMUF 2I65A 1VKRA 1XMIA 1J4AA 4EDHA 2EZTA 5HIAA 4JB0A 3DTNA 3Q3VA 4XR4A 3KQWA 5K1ZA 4LXGA 3SWWA 5HQ3B 3Q1KA 4U2BA 5BOSB 4IDHA 3H5IA 1GLVA 4JCHA 2PRYA 3CSKA 1TZ2A 3JD2A 2BKLA 1X42A 4H6XA 4MQUA 4UHKA 3OWXA 1OB2A 1FLDA 1PFWA 3T6KA 3A1SA 2EZ4A 3IP7A 5ERGB 1LF5A 5D3ZA 2BD0A 2VYVA 1TD1A 3RAJA 3S8MA 5JANA 4JQYA 1W85B 4WXPA 3TD7A 4ZTBA 1E3LA 1EZ1A 1EB9A 2PY6A 1Y8RB 3U9TA 4D9IA 4HAXA 1CDEA 4NTZA 2XB6A 3NORA 5FOSA 3ZTTA 3RU3A 2GXQA 3F6CA 1UXHA 2C9YA 2D5BA 2P9HA 1SRRA 5BSGA 1IY0A 4CGZA 4PYMA 3H9EO 1TVEA 3WB1A 1OBCA 3NYQA 1XDSA 2HA0A 1NI4B 3N8GA 3K73O 3I9OA 1ZXLA 3TOXA 1GT6A 1E1DA 1Z25A 3EOBI 4J0QA 3QY9A 3SC2B 3UMSA 1KZ4A 4FX2A 5F77A 5HJ7A 3I9JA 3CX3A 3L46A 3EMKA 2VHZA 3HTXA 2LW7A 5JP7A 1H2XA 2X4IA 3ACBA 2DF8A 4I99A 1M0WA 3V1NA 3B3AA 1AMNA 3VNVA 3AY6A 3BWVA 1VKJA 4XIJA 3AEUA 1BHSA 2P6RA 4BLTA 4ZK6A 4BOYA 1U3VA 5C1PA 4PJNA 1OMOA 1ECCA 3DTTA 3JX9A 4QXQA 4TWAA 2QTAA 2OWEA 3AI1A 2J0WA 3CVOA 4QDUA 1UQTA 5IHPA 1ECPA 3B5JA 3HDTA 2OHFA 4R1SA 2F3TA 2R8BA 4ASUD 1WA5A 1FX0B 3HB5X 3G9UA 4RDAA 1ODCA 3COWA 3OLCX 4GI3A 1D2GA 4LGYA 2D4AA 1L7BA 3NGLA 1SB8A 4HDAA 4MHOA 5ENZA 1CE8A 3S81A 3V48A 3RYCB 4REQA 4XX0B 2GAFA 3KKNA 4QASA 3UKDA 2EFGA 2K87A 3N0XA 4XSHA 1LE2A 2EX1A 4PC1A 1UPTA 1V3TA 3LT2A 2SCUA 4QULA 2FRVA 4TSKA 1V6CA 2A1TS 2JFGA 3FNIA 3R24A 1WW2A 2F9LA 3TRKA 5GIOE 2YOFA 3WIOA 2VYNA 3JT1A 4LWQA 4C0AC 5L8VA 2EQBA 3BD9A 3CZ5A 3CRW1 1RIIA 4PW0A 1Q2UA 3LA8A 3BK7A 2Y68A 3NS7A 2ZBUA 2I7TA 2XLHA 3T3DA 4BFSA 4CQMD 4BZPA 2XVAA 1HDGO 5DNDA 1EWKA 1P2TA 1UJ5A 1OKKD 3SG0A 3U2LA 3S2ZA 4P6IC 5TLSA 3R4CA 4ND5A 3MMPA 1E2HA 4MVCA 3BGIA 4DRXB 4YRSA 3DDSA 3A3NA 1H85A 2NVBA 4IZHA 4XGRA 3DJFA 1N3IA 2DB3A 3OOWA 2QVYX 1Q0LA 2X8WA 1BN7A 1EK5A 4QAQA 4TSFA 3QMMA 2OCCC 5LYJF 5IZCC 2QYTA 3ZI4A 1QJCA 3OOJA 1JXAA 2AIRA 3N2YA 4Q7KA 1LBIA 1U7XA 2XDQB 2Y71A 1I9GA 3LLUA 4JLUA 1TX4B 4WJKB 3WGZA 3BHIA 5ADWA 5KNDA 3OLVA 3TS1A 1EWTA 1V3QE 3W8HA 3VUFA 4OAQA 1QTRA 3TTSA 2XS8A 2AZDA 3P9RA 4S1VA 3NVKI 1ZVMA 1PQWA 1IXRC 4NBWA 1XHLA 2P9EA 2EATA 4DWVA 4RADA 1D5WA 4NG4A 1OTHA 1UC9A 2NLOA 3H4TA 1R15A 4ITRC 2XA1A 1NSYA 4LFAB 3F3SA 5KYNA 1F6WA 2V9ZA 4RL6A 1KEKA 1GUAA 1GZ5A 1YRBA 3ZTMA 3MQFA 1P2UA 3O9VA 3N2ZB 2NGRA 1FYFA 4D9MA 4LZOA 2P68A 3AETA 3R6WA 4MB0A 4MGEA 4FMCB 4GW3A 4Q3CA 3FMVA 1P77A 1Z73A 2AHOA 1N5JA 3KBBA 2XMSA 4RKWA 2RJOA 2AB0A 2JRCA 3G7NA 3S44A 2VTBA 4O2BB 4C0WA 1CP2A 5B1DA 1QQ5A 2QRMA 3WYNA 4BP1A 3S90A 1SOUA 4I8XA 4ER0A 3L92A 1GARA 1GCIA 1ESCA 2GVZC 4FFDA 4HVLA 1QE5A 4DDUA 5IKXA 1XV5A 4EW2A 1DPGA 1QP8A 4MYRA 1RXYA 5DQZA 1PV1A 3B7PA 5LBUA 4YECA 1NLUA 2HZ8A 1WCWA 2I22A 2HT1A 2OCYC 2PMCA 1S2NA 1B7GO 2OR3A 3NEAA 3LP8A 3UV6A 5IMSA 2RHGB 3NM6B 1XSEA 3T1HB 2QG4A 2WMDA 1FFXB 1L3PA 1U0HC 1UMDA 4J2OA 4OHOA 2C2XA 4ZO4A 3ZVLA 2N3ZA 2PGAA 1T5DX 4CBVA 5BMVF 5BSWA 5C1OA 2QX7A 3R2PA 1FFEA 4JODA 4PAMA 4UNQA 1FLVA 5KYWA 4Y2YA 3ZWVA 1CJCA 4KGDA 2UYHA 2FUG6 4D9BA 2CNBA 2CXRA 1MAHA 3LS0A 4ID9A 4N6GA 3K6SB 4YQEA 4ZO9A 4AO6A 1LCIA 1DOZA 2B78A 3K7EA 2HYDA 1LPSA 3CY6A 3KVVA 3I9FA 2CW0F 4F60A 4CU2A 1ZGCA 1XMOB 2WJ6A 4R3NA 1CY4A 1X94A 2FFAA 4II2A 4IKOA 1NU8A 2SNIE 3I72A 5SY4A 3H4IA 3SKXA 4U2KA 3IBGA 1GCAA 4MW0A 2AN5A 3QMWA 3S70A 1A1VA 2RGAA 1R4TA 2PMKA 5GJVC 1YQWA 1D0VA 4ZT2A 3CLKA 1N2XA 2CKMA 1Y81A 2X14A 5TPZD 4ZJZA 2UZ4A 1EP2B 1LX6A 3VVLA 3CE6A 3OE5A 4UTZA 3K3PA 3LT5A 1VE9A 4IVPA 4QKQA 2A30A 5D2CA 3NP9A 1C7ZA 1XZEA 3H1FA 4UVGA 3ZY4A 2OGTA 4JN6B 3SYKA 4RTQA 3ZQ4A 2F8SA 1DC5A 5JPDA 2JARA 4RIFA 2B37A 5GAJA 2OJQA 3PFFA 4FFOA 2Q00A 3L4BC 1U81A 1JMWA 5D91A 1KY4A 1XVUA 3IPYA 2AJDA 3DMGA 3GZNB 3OJCA 2I3AA 2C2ZA 1R7RA 3QPCA 1WULS 4IXDA 5EMLA 5FI0B 3EXEA 3HJUA 3HKCA 2IVFA 3LD9A 3RVOA 1E64A 2CVFA 3DMTC 4YDQA 1BOOA 2P4QA 2PO5A 1H23A 1Y7TA 4M9RA 4AY2A 2O8BA 2ZI4A 1AF4A 2FFRA 1ZJYA 2VAXA 4ZZ2A 1OHHD 2WU1A 3OIWA 3P45A 1ZUHA 1TR2A 3DEHA 4I6JA 5C8XA 1ECGA 2PJDA 1UKCA 1G0NA 2XUIA 3SHTA 1NP3A 4J0IA 1BXZA 1X1TA 2CLCX 2QUJA 2QTCA 4ZCPA 5FF9A 1WQ3A 4V02A 1YIDA 3THWA 4DLXA 2N1MA 2RONA 3RUFA 2G7ZA 1G17A 2EU8A 2JGDA 4R2HA 1HBJA 5ALEA 4WRRA 4ZXFA 3AOGA 5PGMA 1PD1A 3HYTA 3RHFA 3UGTA 4CVNA 1NJSA 2FW8A 5FNVF 1DINA 2H7VC 5AVJA 1I3OA 2AEEA 3SS9X 3WYAA 1OILA 4C5BA 2HWWA 2BRUC 3AERB 2GD2A 2KLHA 1BD3A 3B53X 4YV1A 1P6XA 4FW9A 1EHCA 1AB6A 2REXB 2WZCA 4GLBA 4YUWA 4I5EA 1QIFA 2ZRMA 3H87A 4IDDA 4HVTA 5D85A 4QE3A 3TULA 1MABA 4KLRA 1HDXA 3GMDA 4J3NA 2Y9PB 2JS7A 3R5SA 3R0VA 4R8LA 1LPPA 1QMPA 3UAVA 4Q4AA 2Q3MA 3EDRA 4MTFA 4JH0A 1NURA 4X6UA 1QH8B 3ZXYA 1P72A 1VGVA 3MUFA 3GLFE 2O7RA 4RD6A 4DDHA 1SY7A 3I5XA 4NLLA 4OYHA 4WLVA 1NHWA 5A4DA 4B3CA 2JAPA 4PR3A 5DGXA 2JBHA 3RSSA 4D9JA 1Y9AA 2HJ9A 1CSEE 4J16C 4L51A 4PICA 1PQUA 1GZSA 5T6MA 3VU8A 1YVRA 4RXUA 1XVLA 4YXWD 4JC8A 4I5GA 4DLYA 2QL5A 3DFKA 4RA9A 1H2EA 1ZUWA 4TUYF 3AEXA 5J4VA 1ZBQA 1IZ0A 5KNLA 3VVCA 1HL3A 4BATA 1O94C 4HDKA 4KPFC 5C81A 1P8JA 3NBZC 4YUVA 3CNEA 1YUNA 2C5LA 2HA7A 2JIQA 3MTBA 4QXAA 3ESXA 2XKKA 1K66A 1VSVA 5JVDA 1T5SA 1ZNXA 2H16A 4AWAA 1PR0A 1XA3A 1ZQ9A 1C1YA 2JGEA 2DFTA 4YJKA 2TS1A 5DM2A 3MHTA 3EGDB 1M2OA 1T35A 1U2ZA 1S4MA 1ZIPA 5L0IA 1QORA 3B9QA 1AXEA 5FPHA 1OYWA 5HF5A 3D8RA 4W9MC 4R0VA 3GLFB 1WSBA 2QUKA 5JZMA 3LW8A 4W7IA 3F3KA 3IAHA 2A1UA 4PBRA 2XW6A 3D4PA 4I4TB 5T3TA 4CEIB 4G0VA 4HDCA 1AVOB 1U6KA 1EX1A 1SK8A 3OP1A 3OUZA 1OYOA 1IOWA 1FVHA 1U2GA 4PU0A 3B51X 4R2IA 5AM1A 4YAUA 1F0NA 1T9GR 3BL5A 4MUHA 4F6CA 3RKOF 3ZWDA 3E9QA 4AXXA 2WU3A 3DVRX 2WINI 4RV4A 3BWBA 1NVDA 1BD4A 1O8CA 3BCRA 3QG1A 5DYIA 3TEFA 1A77A 5F1PA 4QNRA 2PKRA 1IPHA 3VX3A 1I4ZA 2CGEA 4HQKA 2QLLA 2ZBDA 3E9DA 1VJRA 1J1IA 3I6ZA 4UVIA 3SOZA 2IYOA 2HQSA 2ZAGA 3FI9A 4C0JA 1G38A 4RD2A 3UQZA 3VDXA 3FWZA 2FK7A 1AKNA 4R98A 3SXMA 1A2KC 3DFMA 1DS6A 3NTUA 4H1VA 4QYTA 4OUDA 4ZOEA 3WZLA 4CMBA 1F8XA 3AVTA 3W8IA 1EUCB 1HRKA 3R5FA 1T8PA 5I8ZA 3B2QA 2ILVA 5MGBA 2F00A 1XJWA 3GGDA 2P75A 3NTRA 4O08A 3V1TC 3WNDA 4YJ2A 3MCWA 5LBTA 3UGQA 3OEYA 3OIDA 1VIDA 3EQ9A 3BM5A 5FBLB 1PBTA 5KX5B 2VVTA 4WJLA 3ED1A 1YJXA 5JJBA 2HSWA 3ID6C 1QH9A 4PJMA 2PKYX 3SQWA 2MCFA 4DYHA 5CHEA 1E2DA 1ZWKA 3FM9A 3IQTA 1G8YA 1C30B 4LMBA 2PMFA 3LC0A 4YASA 3AKDA 4A2CA 3U7GA 3WMRA 5JSUA 4I4IA 3KR9A 3G2KA 1AK1A 3NC4A 1XTVA 1L8QA 2ZIEA 4JAVC 4LXYA 4O8CA 4P0TA 5EAIA 2BM0A 1HE9A 3DD7A 1LWOA 3IVRA 1T6IA 3D0OA 4K26A 3UOGA 3G2OA 3V4FA 3BE5A 1IQUA 3K5PA 2BFFA 5JNWA 1O3YA 4MQ6A 1HZZC 1ZN9A 4MR9B 1GZ3A 2H51A 2I5PO 3AF1A 3I6IA 3IUBA 4FYWA 4JBWA 4E6EA 4EQZA 3WAKA 4B35A 1KIFA 5IC4A 4HJRA 1K6EA 3A58B 3OX4A 3P52A 4J07A 4DKJA 2G5GX 2WJYA 2SKDA 4Q3DA 1RZVA 3Q3HA 1Y1LA 1TEHA 5AJYA 1GG8A 4ZKDA 3AEQB 1E1YA 2LGJA 4K2HA 3T5TA 4DQXA 4ETNA 1FFYA 1P44A 3UMGA 1OA1A 1K05A 2DBQA 4R16A 4BNLA 4WNYA 5HSGA 5C4GB 3X44A 2A69F 2KJQA 5KTRA 2GN9A 3WLIA 3UNGC 2JAOA 1T36B 4YRRA 5KI6A 2ZE8A 4Y2GA 1TLLA 1MQ9A 2GS9A 1NFFA 4ZN6A 5J4HA 4DNFA 4WKGA 5K6RA 5J2UF 5K0CA 4G01B 4LOIA 3COYA 3RGWS 1V45E 3DO6A 5ED0A 4DIBA 3H9GA 1IK6A 4IEIA 4YALA 2VRWA 2A9JA 3ZWWA 1YFLA 2X1HA 4DZTA 5AVXA 4M89A 2OOSA 4RQAA 2CNKA 4EY3A 2MMGA 1E99A 3PCXA 2HJHA 3AOUA 2EZUA 3AU8A 4KO3S 2GHIA 2W6QA 4UMVA 4XGQA 4AP9A 1PGNA 2NZJA 5KVVA 4LV5B 4ARZB 2JA1A 2R3SA 5A5VA 2DBZA 1RYBA 2VYFA 4QI0A 1LGYA 4H7IA 5ALUA 3E4CA 1SBYA 4BQNA 1Z5OA 2XLWA 3EHEA 3L05A 4JYCA 1GJRA 4BVEA 3DWFA 4NXMB 2ZRCA 3I23A 1BZYA 4UDVA 2C4NA 1C1XA 3FNBA 4Y2PA 3VR4D 1XZMA 1AS2A 1OCCC 4OQNA 2FEMA 1OB5A 4RKEA 1G5PA 1SEVA 4PYJA 1UMCB 4WNIA 3JRNA 3H8JA 3R5KA 5DEOA 2A57A 4FAPB 4RM2A 2ATXA 5IJWA 3DM5A 4D46A 1KRHA 2QPTA 5K3OA 4IS2A 2OHGA 3UT6A 1RAAA 2PPVA 2AF3C 4OLFA 4W7HA 4JBXA 1DJQA 3EN0A 3YASA 4B47A 3ORFA 3PXEA 4PY2A 4JI8B 4UCFA 2CD9A 1W35A 3DCYA 2GJKA 1ZC4A 3KSZO 3VAZA 1LSOA 4W63A 5AC5A 2HEIA 3EVAA 4L57A 3JSXA 1ZOOA 2GD6A 3LU1A 3OM1A 1NU7D 3WK4A 3W2VA 1KP2A 1P5RA 4IIXA 3WQHA 2WAAA 5FWDA 3G17A 1FK8A 2C9OA 2W0SA 2WYHA 3NDJA 4IDOA 4EEXA 1P81A 2CUTA 2ODTX 1ENYA 1KMHA 4TVOA 4Y6SA 2ZYSA 2Q8PA 4HH1A 1R9NA 2WWIA 4FNGA 5KB3A 4HAOA 4G07A 1XTRA 1WJGA 1YRLA 4TXLA 4EO7A 4FYIA 2WHRA 1Z6XA 2JASA 4TKLA 1YFZA 3ZCRA 1KS2A 4HR7A 5CDFA 3JQ9A 2IVZA 2Z2ZA 3THRA 5TQ0B 4AFNA 5JQGF 2UXCB 3Q40A 3SJ7A 4KXYA 5K8CA 5K6AC 2XUJA 3I30X 3OCUA 4KV7A 1DBWA 4YMWA 3KT8A 1JHUA 1PNQA 3NHJA 3PA6A 1FJHA 4KWHA 4PSUA 4BKRA 2WU4A 1L5FA 3GJ7A 4BTEA 1T8WA 3U7QA 4R7GA 2AWOA 4U63A 5TVGA 2XD9A 4M1YA 1XDUA 4C78A 2Q6VA 4LI0A