2YRNA

Solution structure of the ch domain from human neuron navigator 2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
GSSGSSGKRKPVIHGLEDQKRIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuron navigator 2 isoform 4
publication title Solution structure of the CH domain from Human Neuron navigator 2
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 2yrnA01
4EDMA 1WYLA 2WFNA 5BVRA 1AOAA 3F7PA 4TXKA 4EDNA 1UJOA 1P2XA 3KMUB 1H67A 2R8UA 2K2RA 1UEGA 1DXXA 2VZCA 1RT8A 3KMWB 5L0OA 1SH6A 1P5SA 2WA5A 2EYIA 3JAKM 4TXIA 2WA7A 1WYMA 1V5KA 4Q58A 2L3GA 1QAGA 1WJOA 2VZGB 1SH5A 3I6XA 2D87A 2E9KA 2R0OA 2DK9A 2WA6A 5A4BA 3JALM 3CO1A 4B7LA 5A36A 1PXYA 2EYNA 3HOCA 2RR8A 2YRNA 1WYNA 3KY9A 1VKAA 1TJTA 2EE7A 2QJZA 3HORA 1WYRA 4Q57B 3JARM 2JV9A 1BKRA 3FERA 2D85A 2D86A 1WIXA 2QJXA 4Q59A 3HOPA 2VZIB 2VZDA 1WYQA 5A37A 1BHDA 1WKUA 1AA2A 1WYPA 1PA7A 5J8EA 2K3SA 5A38A 3REPB 4EDLA 1MB8A 2D88A 1WYOA 2D89A
chains in the Genus database with same CATH superfamily
4EDMA 1WYLA 2WFNA 5BVRA 1AOAA 2VE7A 3F7PA 2WE6A 4TXKA 4EDNA 1UJOA 1P2XA 2HL9A 3KMUB 1H67A 4LVRA 2R8UA 2K2RA 3EAYA 1UEGA 1DXXA 2VZCA 1RT8A 3KMWB 2HKPA 5L0OA 1SH6A 5FMTA 1P5SA 2WA5A 2EYIA 3JAKM 4TXIA 5FMUA 2WA7A 1WYMA 1V5KA 4Q58A 2L3GA 1QAGA 1WJOA 2IGPA 2VZGB 1SH5A 3I6XA 2D87A 2E9KA 2WDTA 2R0OA 2DK9A 2WA6A 5A4BA 3JALM 3CO1A 4B7LA 5A36A 1PXYA 2EYNA 4LVPA 3HOCA 2RR8A 2YRNA 1WYNA 3KY9A 1VKAA 1EUVA 1TJTA 2EE7A 4DDPA 2QJZA 3HORA 1WYRA 4Q57B 3JARM 2JV9A 1BKRA 3FERA 2EQOA 2D85A 2D86A 1WIXA 2QJXA 4Q59A 3HOPA 2VZIB 3VP7A 2VZDA 1WYQA 2HL8A 5A37A 1BHDA 1WKUA 1AA2A 1WYPA 1PA7A 5J8EA 2K3SA 5A38A 2VE7C 3REPB 4EDLA 1MB8A 2D88A 1WYOA 2D89A
chains in the Genus database with same CATH topology
4EDMA 1WYLA 2WFNA 5BVRA 1AOAA 3F7PA 4TXKA 4EDNA 1UJOA 1P2XA 3KMUB 1H67A 2R8UA 2K2RA 1UEGA 1DXXA 2VZCA 1RT8A 3KMWB 5L0OA 1SH6A 1P5SA 2WA5A 2EYIA 3JAKM 4TXIA 2WA7A 1WYMA 1V5KA 4Q58A 2L3GA 1QAGA 1WJOA 2VZGB 1SH5A 3I6XA 2D87A 2E9KA 2R0OA 2DK9A 2WA6A 5A4BA 3JALM 3CO1A 4B7LA 5A36A 1PXYA 2EYNA 3HOCA 2RR8A 2YRNA 1WYNA 3KY9A 1VKAA 1TJTA 2EE7A 2QJZA 3HORA 1WYRA 4Q57B 3JARM 2JV9A 1BKRA 3FERA 2D85A 2D86A 1WIXA 2QJXA 4Q59A 3HOPA 2VZIB 2VZDA 1WYQA 5A37A 1BHDA 1WKUA 1AA2A 1WYPA 1PA7A 5J8EA 2K3SA 5A38A 3REPB 4EDLA 1MB8A 2D88A 1WYOA 2D89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDM A;  1WYL A;  2WFN A;  5BVR A;  1AOA A;  3F7P A;  4TXK A;  4EDN A;  1UJO A;  1P2X A;  3KMU B;  1H67 A;  2R8U A;  2K2R A;  1UEG A;  1DXX A;  2VZC A;  1RT8 A;  3KMW B;  5L0O A;  1SH6 A;  1P5S A;  2WA5 A;  2EYI A;  3JAK M;  4TXI A;  2WA7 A;  1WYM A;  1V5K A;  4Q58 A;  2L3G A;  1QAG A;  1WJO A;  2VZG B;  1SH5 A;  3I6X A;  2D87 A;  2E9K A;  2R0O A;  2DK9 A;  2WA6 A;  5A4B A;  3JAL M;  3CO1 A;  4B7L A;  5A36 A;  1PXY A;  2EYN A;  3HOC A;  2RR8 A;  2YRN A;  1WYN A;  3KY9 A;  1VKA A;  1TJT A;  2EE7 A;  2QJZ A;  3HOR A;  1WYR A;  4Q57 B;  3JAR M;  2JV9 A;  1BKR A;  3FER A;  2D85 A;  2D86 A;  1WIX A;  2QJX A;  4Q59 A;  3HOP A;  2VZI B;  2VZD A;  1WYQ A;  5A37 A;  1BHD A;  1WKU A;  1AA2 A;  1WYP A;  1PA7 A;  5J8E A;  2K3S A;  5A38 A;  3REP B;  4EDL A;  1MB8 A;  2D88 A;  1WYO A;  2D89 A; 
#chains in the Genus database with same CATH topology
 4EDM A;  1WYL A;  2WFN A;  5BVR A;  1AOA A;  2VE7 A;  3F7P A;  2WE6 A;  4TXK A;  4EDN A;  1UJO A;  1P2X A;  2HL9 A;  3KMU B;  1H67 A;  4LVR A;  2R8U A;  2K2R A;  3EAY A;  1UEG A;  1DXX A;  2VZC A;  1RT8 A;  3KMW B;  2HKP A;  5L0O A;  1SH6 A;  5FMT A;  1P5S A;  2WA5 A;  2EYI A;  3JAK M;  4TXI A;  5FMU A;  2WA7 A;  1WYM A;  1V5K A;  4Q58 A;  2L3G A;  1QAG A;  1WJO A;  2IGP A;  2VZG B;  1SH5 A;  3I6X A;  2D87 A;  2E9K A;  2WDT A;  2R0O A;  2DK9 A;  2WA6 A;  5A4B A;  3JAL M;  3CO1 A;  4B7L A;  5A36 A;  1PXY A;  2EYN A;  4LVP A;  3HOC A;  2RR8 A;  2YRN A;  1WYN A;  3KY9 A;  1VKA A;  1EUV A;  1TJT A;  2EE7 A;  4DDP A;  2QJZ A;  3HOR A;  1WYR A;  4Q57 B;  3JAR M;  2JV9 A;  1BKR A;  3FER A;  2EQO A;  2D85 A;  2D86 A;  1WIX A;  2QJX A;  4Q59 A;  3HOP A;  2VZI B;  3VP7 A;  2VZD A;  1WYQ A;  2HL8 A;  5A37 A;  1BHD A;  1WKU A;  1AA2 A;  1WYP A;  1PA7 A;  5J8E A;  2K3S A;  5A38 A;  2VE7 C;  3REP B;  4EDL A;  1MB8 A;  2D88 A;  1WYO A;  2D89 A; 
#chains in the Genus database with same CATH homology
 4EDM A;  1WYL A;  2WFN A;  5BVR A;  1AOA A;  3F7P A;  4TXK A;  4EDN A;  1UJO A;  1P2X A;  3KMU B;  1H67 A;  2R8U A;  2K2R A;  1UEG A;  1DXX A;  2VZC A;  1RT8 A;  3KMW B;  5L0O A;  1SH6 A;  1P5S A;  2WA5 A;  2EYI A;  3JAK M;  4TXI A;  2WA7 A;  1WYM A;  1V5K A;  4Q58 A;  2L3G A;  1QAG A;  1WJO A;  2VZG B;  1SH5 A;  3I6X A;  2D87 A;  2E9K A;  2R0O A;  2DK9 A;  2WA6 A;  5A4B A;  3JAL M;  3CO1 A;  4B7L A;  5A36 A;  1PXY A;  2EYN A;  3HOC A;  2RR8 A;  2YRN A;  1WYN A;  3KY9 A;  1VKA A;  1TJT A;  2EE7 A;  2QJZ A;  3HOR A;  1WYR A;  4Q57 B;  3JAR M;  2JV9 A;  1BKR A;  3FER A;  2D85 A;  2D86 A;  1WIX A;  2QJX A;  4Q59 A;  3HOP A;  2VZI B;  2VZD A;  1WYQ A;  5A37 A;  1BHD A;  1WKU A;  1AA2 A;  1WYP A;  1PA7 A;  5J8E A;  2K3S A;  5A38 A;  3REP B;  4EDL A;  1MB8 A;  2D88 A;  1WYO A;  2D89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...