2YRPA

Solution structure of the tig domain from human nuclear factor of activated t-cells, cytoplasmic 4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
114
structure length
114
Chain Sequence
GSSGSSGLPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear factor of activated T-cells, cytoplasmic 4
publication title Solution structure of the TIG domain from Human Nuclear factor of activated T-cells, cytoplasmic 4
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrpA00
4JANA 3VWJC 4MDIA 1UWEH 3P77A 3BEVA 4PUBH 4OAWA 1ZT1B 4ZPTA 1NAMH 2BVQB 1A3RH 4HK0A 2I60H 2P1YA 3ARFD 5EO1B 4JHWL 2ZUSA 3L3IB 5DC0A 2RFXA 1T1YB 2Y06H 3BAEH 5A2KH 4ZPVB 5HI3C 1NBVH 4KH2A 4M8QB 4D0BB 4HIJB 4PJ9A 3UTSB 2HFEA 3MLPA 2OR8A 4LKCB 1K8DB 2VLJE 1SJEB 2Y07H 2LAGB 5F8RC 1GVIA 3RY6A 3FN3A 3LMJL 2QADB 1RZJH 1JI2A 2WBWB 1QSFE 4PV8B 1MEXL 4OZIF 4U31A 3L5XL 1OP5K 2JJTA 4Y0GA 1NDGA 4YHOL 3NTCH 1S9XB 1D7FA 1A1MA 1BREA 1MRFH 2DWDA 4I77H 5ANME 5C1MB 2DI9A 3QXUA 2HT2D 5CCKH 4FTVD 1VFUA 1BVZA 2VNCA 1LGVA 1B6UA 3KVQA 3NCMA 4P46B 2AJVH 4NQXB 4ODVL 4HHAB 1AHWB 4PTUB 3I9GH 4OLXH 3HLAB 1VENA 1RU9L 3KR3H 2HFGL 1HEZA 1WJ3A 2HH0L 3SGKC 3T8XB 4A6YL 5D1ZA 5IB3B 3HZYA 4MXQD 3MLVL 1IAIH 1LP9E 3O81A 3RWDB 6CGTA 1H3XA 4FFWC 4G6FB 2FIKA 2DKMA 5C07D 1OOAA 2R0ZH 4F9PA 2Y6SC 3C6LD 4PLNC 1P2CB 3EYSL 3GSVA 5J8OA 2E7LC 3DXAA 4X7DC 4N8PA 1UEYA 4DKEL 1BGXL 1N2RB 3LS5L 5I19L 4J2XA 1HI6B 3SGJA 2I27N 2IH3A 1S5HA 3V6OC 1T04A 2R56H 2UY6A 3BH8B 4ZSOA 1OARH 5ID1A 1DEDA 2IANE 2P5WB 3ARBA 5C0JA 2ADFL 1SM3H 3W0WE 2R4SL 4I0PB 1L9MA 1WIOA 4YGVB 5C6WH 4LPUA 4F58L 5HD8D 2DL2A 4H26B 3OKOB 5KSAC 1CLOH 3RIFK 4PJHA 5J1AA 4O51A 3T4AA 2YMXL 3EDFA 4O9HH 5D4QA 3WSQL 3VGEA 4NQCB 2J8HA 5KVDH 4LLQA 5LGKA 5EOCL 4WNQA 1KB5L 5I8KH 1VCAA 4M48H 4Y4HD 3IU3B 4X98B 1J0JA 5IVXA 5GGSA 4YK4B 2P8PB 5ICZB 4JFFA 4M6OH 3MRHA 5SWZB 1J0ZA 2HKHL 3P0GB 3X3GH 3MNWA 4TTDD 2XNAB 4EBQL 4LPVA 5AAWA 1H5BB 4YPJA 1SYSB 1D9KD 2WMPA 4ODXB 3ULSA 3RA7H 3FB8A 1U92B 3BIAX 3BN9C 1QSEB 2C5DC 1QSFD 5GRXG 1BOGB 3BH9B 3ET9F 5FYKU 1KTLA 4NWTL 4ONFL 1ZA6B 5D5MA 1GIGL 3JSSA 2BVUA 3C08H 2FX7L 3TO4D 4KPHL 4LLWA 3BZDA 5F7KC 1P6FA 1EEZB 4N0RA 4JR9H 3WUWB 4EVNB 1F4HA 1VESA 4MD4A 4NO3B 1DBAL 5HHOB 3CFIC 1TPXB 5JR1H 2VXVH 4HWBH 1C5CH 5B3NA 1Q9LA 5C09A 2R15A 4P5MB 2V9RA 3IVKA 1U8JB 2A6JA 2LQRA 3IU4H 3MJGX 2VLKE 3G6DL 2DIBA 1DN0A 5MERB 3IFOA 2P7TA 1TZGH 4HIIA 3X11B 2NNAB 2ZG2A 15C8L 3KHOA 4PJHF 4K94L 4AENB 3LSOB 2IMNA 1JHLH 4OGYH 2BHUA 3CU1A 2VQUA 4MAYD 1U58B 3WFEL 1WEJL 1XH3B 2Y5TA 4JPKL 3H9SA 4RAUA 2VTFA 3NH7L 5L0QB 1ADQL 2GSGB 5IVXF 3PHOB 5C0BA 4B53A 3EO9L 5LGHH 1LD9B 2W92A 1JNJA 2PW1B 1FAIL 4HQQL 1EMTH 3W0WD 1R3HA 1Y6KR 2ICCA 2P5EE 1IC7L 5DHVB 1S8DA 1DDHA 2G60H 4NUJA 5IFAL 3O6KH 1A0QL 3VWKD 2VN4A 1RJZA 1Q9WA 1MHEB 2JJTC 2VN7A 4LHQB 3VW3L 4U2ZA 4D0CB 5GRJH 4MX7B 5D5MF 5GGRB 3GBNL 4PJCB 4XGZB 1IGYB 1TZIA 5D7LE 5JIHA 5CP7B 3G08B 1HDMA 3IDNA 5JLZB 5D1XA 1QLEL 4MQXC 1G7PB 3KLDA 1S78D 1T2JA 4S0TD 3T0DA 4OLZL 4BQ9A 4UIKH 2ZSVB 1ZA3B 2A6IB 3VRJA 4YBQD 2OXHA 3JWDH 4PRHE 2J6EH 1U3ZA 2V7HB 3FZUC 2VUOA 4N0CD 4N8VB 3UBXI 3ZKSD 4GMTL 3OJDA 3SGEI 5TDNB 4PGBB 4HULB 1XR9B 4G8IB 2Z4QA 5CWSA 5F1IA 1AE6L 2P48B 5DJ0A 4M62L 2GAZA 5KSVB 3QHZL 2ENSA 4Z7UB 4ZTPL 3UYRL 4F9PC 5T1DL 1T2XA 2HTKD 1A6TB 1F90L 3ULUF 3Q48A 4JLRA 1FRGH 3LCYA 2XA3A 5AUMB 1MREL 3GK8H 1R6VA 3GUTB 1HZHH 1MQ8A 4IEFB 4NYLA 2NY1B 3SGJC 4J3SA 4KI1A 6FABH 3BP6A 1JTPA 2XWJA 1TVBB 5IVZB 3ARBC 2E6JA 4G8GA 5JUEH 5D72L 2EDRA 3HMXA 3X14A 2D0FA 2G5BB 4KZDL 1AD0B 3MLRH 1QRNE 3NPSC 4NC1C 1MCWW 1QSVA 1KPUA 4U6TA 1MFCH 4PJIB 4X5WA 3QXVA 3CH1A 4OZFB 1NBZA 1JWSB 2EIEA 1JGLH 4LLDA 4JREC 2GTZA 3E0GA 4HT1H 5JPMB 3V6BR 5FYKE 4G9FE 2DM3A 2OZ4H 2P8MA 4Q9RL 4WO4D 3O2DL 1RUPL 5F6HI 4WFGE 3JWOC 4X83A 4RWYH 3SKNB 4E9LA 5LCVH 1F6AB 2DYPB 1D6VL 4MA8L 3T1FA 3HC4H 4GAGL 4YX2H 5KJRH 2BSSA 1WBZB 4ENED 3WNKA 3NCBB 5BQ7A 1RI8A 2P5ED 4LOUC 4APQA 4WEUD 4Y1AE 1HHHA 2LAAA 2EYRA 4K71B 2NY3B 1K6QH 4L8SB 2EDYA 1FGNL 3RVXD 1JGDA 1CD1B 1QZ1A 2AK4A 4JVWA 4OTXH 1XGYL 1WCQA 1OLZA 3P9MB 7CGTA 1Y18A 2BY2A 4AEHH 1SBBA 4RAVA 4Z0BH 3QUYD 3MRRB 3WFCL 4NZRL 5F7FA 2AI0L 3OAUL 2W60B 3B3IB 5GGQH 3LHPL 3QAZC 4NOBA 4M7KH 5D7LD 4WIQA 5FKPB 2ZCHH 4X0KB 3BIKB 3U46A 2VZ1A 1IBGH 2PW2A 4S1DD 4HPYH 5J12B 3HE7A 4FXGA 1KT2B 3U36B 3CFEB 3DETC 43CAA 4OCSL 1TQCC 4DFHA 3RWGA 4PRHD 4QRPD 1Z9SA 3GBML 1QR4A 2R2HB 2YS4A 1FVEB 3SO3C 4CDGC 1A4KB 4XP1L 4WI6A 2PO6D 2FH8A 4CN6A 4P23D 4YDJB 1CDBA 5FFLA 3BO8A 4DFIA 4MD5A 4XMLH 3HG1B 4CJ0A 4TSAH 5F3HA 4CVXB 4GKZA 2NXZD 3ULUC 1FJ1B 3NIDE 4BZ2L 4L4VD 2WWKT 2EDLA 1CFSB 2ZCKL 5L88H 1T22B 1OWWA 3HE6A 3EYUH 3BOVA 3DURB 1U93B 4NBXB 4Y4FD 3CLFL 5CP3H 3C2AH 1B2WH 3G9VA 3QXTA 1ETZA 2MCPL 3W9DA 3RDTB 5FUZL 4C83A 1DBKH 3V5KA 4KK5D 4PJBB 3VDCA 3LDBC 2J3SA 4EI5D 3V0VA 4XI5D 3GMNB 2HFFA 1QRND 4ZFFA 3LKRA 3V4VH 1C5DB 2N4IA 3O6MH 1DSFL 1K2DA 1RZIA 3IFNL 2A0LD 5E1AA 4U1SB 5BZDB 5HI5C 4R3SB 3VH8A 2DQHH 3GIVB 2LVCA 5D7JA 2X70A 2FEEL 3VXPB 3AXLA 5FYKD 3WCYA 3NIFF 4G9FD 4RX4D 5KZCB 4HMEA 4L4TA 1UADC 2PTTA 4TSBL 5TFSH 4D9RE 4K23H 4WFGD 4JFPB 1BAFH 4XNMB 4EQ2A 1UJTA 3V7AE 5FF6A 1HIMH 3QHFH 25C8L 5DGQA 5GGVH 1OL0A 3KPSB 1U8HA 4HWEL 4PYGA 5CEZE 2EDNA 5I73B 5F9OL 2JF1A 4X8JB 3ZKND 4I9WE 4LLMA 5L2KB 2IFFH 1KIPA 1HCVA 1LO3H 5HHQB 2F5AL 2NY6B 3TYGL 5IJKA 1YY8B 1U95A 1JUFA 3EO0A 3KPPA 3LEVH 5JA8B 1Q72L 4G9DA 3HZMA 1K4CB 1EO8L 5KW9L 2A73A 3I75A 2QQQA 4ODUA 4EQ3A 1KTKE 3VFPB 4G5ZH 4S1QH 3H7BA 4NKOA 1F2XK 3S88H 1UACH 4MVBD 3LEXA 5IIEB 3RKDC 3ISWA 1IEAB 1TCMA 2C1OA 3SE8L 1OGAB 4JN2A 3CXHJ 3SOBH 1JPFB 3DJ9A 1MCRA 1W72H 1W8NA 1YC7A 2CRIA 1OAYH 2R0KH 4XXDB 4KTEH 3ZHLA 3F65A 3HCVA 2R1YB 4NZJA 1NBYB 9CGTA 5AG9A 3T2NL 4DZ8A 4GRLA 1H8SA 1BLNA 3SDXB 3FCTB 2DB8A 3O3BB 4MNHB 4IDJH 4NZTL 4Y4KB 1AFVH 4NQDE 5IB5A 3K7UA 5I74C 4AEIL 5KSAB 2XRAL 4BYHA 3MFFB 4PRIA 3LKSA 5I0DA 3QJFB 1JPGA 4LVOC 4N1CA 2Q7YB 4FN0A 3SKOA 4JM2D 4R96A 1S7SA 5J6GA 2K1MA 4A2MA 1R0AH 4EN3C 2BP3A 2FYYB 4X80H 4DK3A 1NCWH 3PHQA 3WS6A 4PRPB 2EXYC 4APQC 4P3CL 3DIFA 4MJ2A 5A3IC 3NZHH 4KHXL 4X6EA 1VGEH 4DQOL 5A43C 3IAGC 3EO1B 2AQ1A 4QTIH 3TO2B 3JV6A 3D85A 3IKCA 3QDJA 4XCYA 4MD0A 3D18B 3ESVF 1OSZB 3AS1A 3UPRB 3QT2A 2X5PA 3DBXA 3GGWA 1YEDB 3T4YA 2HKFL 4JFZH 4HCRA 1BZ9B 5IUSA 4OM0L 1RAMA 1XF3A 4D9RD 2EC8A 4OZIB 4RZCA 4MJIB 3UZEA 1VPOL 3I50H 3HE7C 2FR4B 4R90H 3MYZA 5HHME 4ONHB 1A6PA 2YD5A 4GUPA 5D8JH 5E94B 3BKCH 5FUCE 1UYWH 1T1XB 3QEUB 5CEZD 3FT3B 3GMMB 1CDHA 2YA1A 3KYMA 2E9IA 1IL1B 2Z9TA 4KRMB 2BERA 5DQDH 3EJZC 4Z7WA 3REWB 2CR3A 2OSLA 4P5TA 2BOCA 5FV2A 3UBXB 4K3DH 5IKCA 3DRQA 2FBJL 4DUWA 1D5MA 4RAHA 3WL9B 2CUHA 3ZSTA 3HE6C 1KYOK 4RRPA 4X5LA 3QNYB 4BSVA 4OGZA 4E41E 1HKFA 2A9MH 3WFHB 4M03A 1HN1A 4G8EA 4GG8A 5D71H 2C7UA 1MCFA 3UDWA 5GZND 1M71B 1YN6B 4P57A 5C6TH 4ZPTB 2PF6A 5CIPA 3D87B 3QIBD 3RWEB 4ALAH 2RFXB 1PG7W 3HRZA 1J18A 1TETL 2X9YA 5KVFH 5GS0L 1YEHH 4FQ1L 2WINB 4XRCA 1K8IB 2X4SB 1JYWA 1TJIH 5TDPB 5JHDA 3RTQA 3B2VL 3V6ZB 5D7JC 3CZFA 1AO7E 5J11B 1B0RA 1PG7L 1S7QA 2C3WA 5K9OA 3BQUB 2FL5A 1NDGB 4LHUA 1PW3A 3TIDB 3ETBF 4CMHC 1URLA 3AS2A 5BMFH 1BVLB 4J3VA 3RHWF 1IGJA 2VJXA 4LSQH 4DGIH 4M1CC 1UC6A 2MFNA 1VHPA 5D2NE 1LO2L 4K8RD 3WXWL 4XPHH 1PEZA 3ZDYF 1GAFL 1TDQA 2DF3A 1INDL 5EC2B 5IJKC 1G7HA 3T0XA 4G3YL 2YPKA 2CKBA 1I1YB 4XCNB 4JFYA 5C0CB 1ZSDA 3DX9A 4MJ6B 2EIZA 3QH3B 1CD0A 5C9JA 1G7IB 4MNQB 1QFUL 3FMGH 4O2FA 1CN4A 3ARGD 5SV4A 4X99A 5GSRA 2G75B 4PGCA 1VB9A 1MFAH 3K74B 4OV6F 4CAGA 1ND0A 4PRDB 4DN4H 5HYIA 2WM0A 1IC5H 3GSVB 1ZLWH 5BCAA 4N68A 5C7XH 3DXAB 4Q6IA 1CWVA 5C92A 5D7SH 2HAZA 1RZKH 3VGHA 3L3OB 4JO4H 5C0AA 1S5HB 1T04B 5CBEB 5F3BA 3TT1L 3C60A 2ADIB 3NFNB 3OPZH 4YHYC 5ID1B 3MPCA 1MRCH 1OAZH 3ARBB 4BK4A 4JVUA 5I1EL 1NGPL 4ELMB 5EUKA 1OAKL 5I1AB 2X40A 2AJSH 1HNGA 4H5SB 5SX5H 4E41D 4RISH 3OF6A 3SEPA 4O51B 3V0WL 5KS9B 3MBED 3QPXH 4KQ3H 1EHNA 1TCRB 4HIEB 4MQSB 3HNTH 3WS6C 4L5FH 3RX5A 2D9CA 2YXMA 5H37G 4WTZG 3NCYS 1W0WB 4DGYH 2VXUL 5EU3A 1S9YA 4O58H 5HYSG 3EYOB 2APXA 1E6JH 1PGRB 4QRSA 1FZJB 1XGRA 4WUUA 4ZNEA 5IMKA 1AO7D 4R4BB 5JW4M 2NTFB 1WC7A 1JWUA 2D31A 1NUFA 5LGJA 4KTDL 2O5ZH 4ODSH 1BQUA 4GKSA 3QQNA 2NTSP 3GMOA 2XKUA 1FCGA 3EZJB 3FO1B 4UT9L 5FCSH 4XNUH 1RIVH 4E0RA 4AT6A 3H3KA 4S1SL 4D9LL 3VXRA 4R97C 5ENWB 3MLXL 4GLRH 2OK0H 4LLWB 2WBJA 3OXRB 3RAJL 4TTGA 2NY2D 5IOPA 4MD4B 5IFJB 1VFBA 3BDYH 3ECBB 1XZ0A 4P5TC 3GB7A 5C09B 4DK6A 1TQBC 1DP0A 4WWKD 4Q9QH 4BFBD 4KKAC 1DJSA 2ZZUT 2KUTA 4YHZL 2DQJH 3V52L 2JJUA 1P4BL 2ZSWB 3KS0J 5GS2D 3SO3B 2P7TB 3PIQA 3Q5TA 3NCFB 4AG4L 3IDXL 2Y7QB 5F7EL 1VFOA 1MNUL 1XCTA 5KBNC 3UDWC 2JE8A 1AIFA 3LQAL 4XHJD 4X6BB 4HZLB 3HZKA 5MP6L 1KJ3L 5DFTA 5E70A 2VH5H 1ZKAA 3H42L 3MXWL 2L7UA 4HG4J 1FL5A 3H0TB 3X12B 1HNFA 2GT9A 4QLRA 1QO3A 2VDMH 2ITDA 2FD6H 3GJFK 3MBXH 3L3GA 3QSKB 3RTQC 4NN5C 3LDBB 3SJVA 3INUH 2BFVL 1S8DB 1DDHB 2PNDA 1DUZB 5E8NB 3BI9X 4Y5XA 1KB5B 3HZVA 3E3QC 3U0WL 2H8PA 3O6FD 1J1XH 3KYNB 2F54E 4HX1B 5ICYA 1DVFB 3FONA 4X9FA 4JRXA 4M6MH 5ICXA 5J56B 4GQPH 1M7DB 4X5XB 2EDEA 5TPWH 1NMAL 4UQ3A 4YHLL 2ENYA 2XYCA 1HDMB 2XZCH 4M9PA 3T3ME 1RIUH 4DN3H 4OJFH 3DTXB 3MUJA 3O3AB 2R4RH 4UOW0 1C5BL 1MCJA 4QHUA 3QI9A 3A0OA 1CICB 1X5AA 3RBSA 5INDB 1T1ZB 5FOBA 2IFGA 4QOKA 4CNIA 3FQUB 3ZKMD 5KTEH 2VZOA 3IJSA 4LPCA 5I1IL 2Z4QB 1GGIL 4U7MA 3RWHB 2PYEA 1RULL 5DJ0B 5E5MA 3MRKB 5EUOB 1DEEA 4PG9B 1KCRL 1WFTA 4LGPB 5EB9A 1IKFH 1FN4B 5B4MD 4F7EB 1K85A 5FDYA 3TN0A 4Q6IC 4JO3L 2E7CA 5JOEA 2Y9RT 3M17B 3WN5A 3HAEG 4FQIL 3FT2B 3WE6B 4G6AC 3BP6B 2QQNL 3NABH 4P2RE 4P9HL 2YRZA 3O8XD 4GRWF 3KYOA 2JK5A 2GJ6E 1MIML 1QUNA 1HILA 5I9QC 5CUSH 2ZKHL 3MYJB 2HA1A 3TF7C 4JY5L 3PP3K 3WEXA 3MUGB 4X5WB 5DQ9B 4F7PA 2DD8H 4J8RA 5JPNA 2EZ0D 2KKQA 4V2CB 5JW3L 3MV9E 5DVLA 2IADB 3MJ7A 3QCVH 3VXUE 4KTYA 4GO6B 4FZ8L 3R0MA 4OCRL 3VA2C 3LN5B 2AJZB 1Q94A 2YPVL 4PJAE 2BVOA 4IIQB 3T0EB 2Y5EA 4ZUSB 3CGTA 1NH6A 3DX8B 1KCVH 1KUMA 4HDIB 4EN3B 1JK8B 5JXED 2I24N 4DCQA 1KXTB 3TT3H 3MGAA 2VDNL 4JFQB 1FSKC 4M7ZB 5ACZB 4F7TB 3S34H 2X89A 3KJ4B 1JF1B 4IRJA 2E7HA 4NJ9L 3VXNB 4FQCH 5JO5A 2FSEB 3MLUL 4CVWA 3OKLB 1PZUB 4NQSA 1J8HE 1WIPA 4KXZI 2F54D 4WTXA 2VLRB 1KB9K 3OKMA 4GW1B 3CK0H 4C4KO 4X6CE 5ACLA 3VXOA 2WBJC 2MPAH 1JNNL 4HC1A 4NNXB 5IFHL 4H8WL 3K3QA 3U46B 1INEL 4OIAA 1BQHB 4L3AA 1HSBA 2HLAB 4IOSD 1BWWA 2C3VA 2CUIA 2XWBB 4JE4B 3TP4A 3QP3A 1QLFA 2WK2A 4Z0XB 2Q8AH 1TTFA 4OZFH 3D3VE 2ZG1A 1TNNA 2BDNL 2JIXD 4QXTA 2VAJA 4FFZH 1I1FB 4NKDB 1E4WH 4KUCD 3TBTA 2W9EL 2L0DA 1QLRB 4FQPA 1U3HA 4LPXA 3IDJB 1NC4A 2FEDC 2I9TB 4Y8DC 4FQHA 2VLJA 4U0QB 3QG6B 1OY3B 1L7IL 1JN6B 1T0NA 2M1KA 1ZOXA 4OCYL 5JXAH 3MV01 1L6ZA 4GBXA 5F6HJ 1INQA 3FTGB 5ADOL 2Z31D 2BC4A 2FNBA 1A7RL 1LE5A 3G5XB 3RVTD 5E6ZA 3HMWL 4QT5A 5EBWA 2I25N 1SVCP 2Z8RA 2V9QA 1S7TA 3IETA 3DX6A 4P2RD 4NCC2 1G9NH 5D1QB 4QWWD 4EKXA 4NO0D 1U6AL 3MCKA 2E6PA 2GJ6D 1NL0L 1OCWL 5L6YH 4HFUH 1CF8L 4DGVH 5IHUH 5BJTA 4LARH 3K80A 4XNQB 5ESAA 2HFFB 5D6CB 1ZWIB 5FYJU 4Y5XC 3RIAF 2A38A 5IBUB 3D6GA 3TIEA 2OR9H 5JW5A 3QDME 3UO1H 2Q3AA 5E7BA 1A6AA 3MV9D 4PY8I 2X70B 1Z9MA 1CFQA 4PP1D 3AXLB 3VXUD 1A47A 3DSFH 4YDIH 3RPKA 2XTJC 4JRYE 4K3JH 5FO9B 3RNQA 1X7QA 5EOQH 4ZUTB 3RWJB 4CMHB 2IBGA 3MROA 2R1WB 4CU8A 3THMH 3QI9C 3ABZA 4LIQH 1RZGA 1YJDH 1XR8A 3BESR 4WU5B 3C5ZD 3G5VA 5DD1H 3SDDA 2IALB 3ALWA 3L5WA 1CQKA 1A7PH 1BIIA 1KIPB 1G9ML 2R2CA 1XGUB 1DBJL 2IANA 1J8HD 3BPCA 3MRIB 4AIXA 4W70A 2Z92B 4G9DB 3WIHH 5CLWA 3LH2L 3ZL4H 1U9KA 3DV6A 2EDBA 3PQYA 4H0IA 3TN0C 3DO7A 2W0PA 4HKZA 5I1DB 5IW3A 2HYMA 2VMFA 4UTAH 4YHKL 1CGSL 3WN5C 1XFPA 3P3YA 3JV5A 1KCSH 5DI8A 2KQMA 2FATL 2C1OB 2UZIH 3ROLB 4LSRH 4M6AA 4JN2B 1I7ZB 5GZOD 3D3VD 5FKAA 3S37X 3JWOL 4XNYH 1WZ1H 2XXCB 4IMLB 4Z77B 3MLSH 4NFDA 3FN0H 2PCPA 3U4BH 3WNNA 5TGBB 5DURD 5LQBL 1N5YH 1OD9A 1T5XA 4PGEA 3QIWD 4X6FA 4MXQC 4YXLH 2AK1H 3IGAB 1H0DB 3GHEH 2D0GA 2DIJA 3D0LA 1QG3A 4CADB 1YNTA 5HGAA 4JQIH 3LKSB 2C4XA 1S9KC 4UQ2A 3EJYD 2BRQA 3MLZH 3D25B 5ESVA 3SKOB 3H3PL 1SQ2N 2GKIA 4LVNC 5DC4B 4YZFE 4NM4L 5DVNA 2M26A 3VMPA 4U2YA 2HJFB 5BRZB 4LSTH 4L8BB 1MVUB 4I3SL 2FJFB 1EBPA 3CVHA 3WO3B 1WLHA 1WF5A 4IRJC 2H2PD 2ICEB 4YDVB 3R06A 3S36X 1SEQL 3ROOA 1YPZA 1HWHB 5HVHC 2A74B 1JNLH 3DUHA 2VLKA 3HI5H 3VFNA 2AXHA 3DBXB 3GGWB 3TEUA 2K7QA 5C0IA 3BPOC 2D7PA 3SE4A 1FVCB 4K9EL 5HD8C 3RGVB 4JRYD 1TVDA 5HI4D 3CIQA 2NY5C 3UTOA 3T65A 2HWZL 1N5AA 4WHTB 3ULUL 3MLTA 1KFAH 1LK2A 4R97B 4WW1A 3JWNC 4TPRH 2JB6A 4WO4A 1TVHB 2J8UE 3QFJD 5EORH 4HKXA 1U3HC 1KIQA 2XG5A 1JHKL 4MLSA 1TQBB 4M6NL 4RMVA 2H32B 5E8DL 5J3HD 1F97A 5A2IH 3E6HB 4LF3A 3RWFA 3HS0A 1I8KA 4GBXC 1YMMA 5FEBA 4GQ9L 3PDOA 4BSVB 2EH8L 4RMTA 3PWLA 1RMFH 4P2QB 2DJ4A 2YPLA 3QNXA 2RAMA 1ZHBA 2X4TB 3CFDA 4FXKA 1S9VA 4GS7C 4P57B 4LSUL 5C0GA 5D7LA 3Q6GL 4DAGH 1Q8MA 5CIPB 5DUPH 2PYFA 5IJVB 3P0VH 3CLEL 3PV7A 1T7VA 3VD7A 4BKLA 3S37H 2VDQL 1YPZF 4EDWL 5JHDB 3V4PL 5I1HL 1FGVH 4NN5B 4NRXB 1QYGL 5BOPA 4W81A 1BFVH 1A6ZB 3D39E 5E00A 4JKPL 3B8YA 4EUPG 2V7NB 3BEWA 5DR5L 4Z7OE 4NKIL 4NCDA 2ARJB 4LSSH 1GHFL 4N0FA 4U1KA 3V5DB 5H35A 4W6WB 1KLUA 3HRPA 4MCYB 3B43A 5IGXH 3SDDC 1NC2D 5GGUB 5FAAA 1R3IH 3F5WA 4PJGE 1GGTA 1J9CT 5MEQA 4LLUB 1KOAA 4PJ7A 4RGMB 5TE4H 4D8PA 4D0DA 4LCWE 3S96A 5E2UH 1ZHNA 2ESVE 2AJYL 1ZSDB 3FRPG 3U6RA 3QUXD 5DFWH 4LVEA 5DMIH 3OXSA 5FA3A 4PB0L 1O5DT 4I2XB 3BSZH 3S36H 1T21B 4X99B 2UWEA 2X4OA 5HYFA 3E8UL 2H26B 3TBYA 2VLME 5I17A 3JUZA 5C08D 3TYFA 1QNZL 5E6ID 2VSCA 4H88L 4RFNB 1ND0B 3K4ZA 3AVEA 1E0OB 3IFPA 1EGJL 3GDBA 1BD2A 4OCWL 5B8CB 1JZ7A 5F6IB 2A9NH 3MR9A 3OKNA 3FB5B 2D7MA 5DUMH 5TF0A 1AGEA 4HJJL 5DMGC 1BEYH 4UT6L 2IQ9L 5FYJD 2PXYB 4Y1AA 5EUKB 1F45A 3GKWL 3TV3H 4FS0A 2ZUWA 4BH7B 4LAJH 3GMQB 2B2XL 5HJ3A 5CINL 5MENE 4ORGA 5DJZB 4IJ3C 1VA9A 3OB0H 1UKTA 4XH2A 3JXAA 4M1GH 1CT8A 1FL3A 2BRRH 2V2XA 5T3XH 3K1DA 3FOLA 4YBLC 3F7VA 5TH2A 5KAQF 4H1LB 2ZUQC 1UH2A 3B5HA 2ZUVA 3BUYB 3HI1B 2BNQA 4YXHH 4MXVE 3C9NA 5J1TC 1OP9A 4OF8A 2VISA 8FABA 1I4FA 2ZUTA 3GI8H 3SE4C 5D2LA 3HC3H 2ICWJ 3D39D 5AZEL 2UWEF 1UM6H 3GMOB 5TQ2H 5HPMA 2O5XL 2PN5A 5IV2A 3C8KA 3DROA 4DZBA 3CD4A 4HJGA 5FYLE 2WBJB 2H6PB 4RFEB 4WO4C 2NZIA 2ZUYA 1AJ7H 4KROB 1DBML 1RJYA 5F7DA 4PRBB 2MTPA 4BUGA 1I7UB 3CSGA 1A6UL 3QUZA 4F33A 1WICA 4LCWD 3VMNA 2ESVD 3TNMA 4P4KD 1IEBB 3VRIA 1BJ1J 3R0NA 1YN7A 3F58L 5GSVA 3BXNB 2H2SD 2H41A 1ERNA 2J7LA 2NY4C 4ETQA 4TUOA 3PIQB 4LRIA 5DRZB 2VLMD 1AGDA 3ILPA 4Y2DB 1N64L 4GKOA 4XCFL 3LRSA 4QHNA 4RMWA 3SHSA 1XCTB 4XVTL 4X9BA 3RL2A 4K8RL 4EXPX 4JHZA 2HJKA 2XV6B 3PABB 4YHOH 4JHAL 1REIA 4Z7UE 1G7LB 3W9EA 4L3CA 1QFOA 1KNOA 2ARJQ 1T4KB 1MFDH 1V3KA 4IRSD 2P43B 5TQ0L 4KRPC 4Z9KB 3U0PA 4YFDB 1Z0MA 3MRLA 2DTMH 4M61B 5T1MB 4Z76A 3H6JA 3F7YB 4HKBB 4EI6A 3DYOA 3DGCR 3U82B 2PO6C 5D2LF 1RU9H 2ATKA 2HFGH 5MEND 4Z18A 5I66A 3LRHA 4EIZC 3F12B 4GRMB 4N5UA 3NIDF 2NYYC 3FONB 1W0VA 1NAMA 2OMNA 2R69L 3BX7C 1DLFL 4Y4FC 5JHLL 3VFVB 4YIQB 2OXGA 3RZCD 3KPRE 3LVEA 2XZAL 3QDAA 2B5IB 4FFVC 1JZ8A 1XIWD 1LQSR 2R2BB 5KSBA 3U4EB 4QHUB 4DKEH 1W8OA 3V6FB 4LEXL 1BGXH 2FIRT 4N5EC 3LS5H 4ZYKA 1XAUA 3ARFB 2P44B 4PREA 1A7QH 1E4XL 4NQVB 4S1RL 4WI9A 3P11L 2R4SH 5DUBA 1DEEB 4BZ1L 3DUUA 4F58H 1OAXH 2ZOKB 3ZE1E 3KLHC 5I18H 1PY9A 4J1UA 4NQDA 5FYLD 2VABA 4LMQI 5HVWA 4K3EL 2DQDH 2YMXH 3I6KB 4WHCA 1DLHA 1YEIL 1B0GB 4R4NC 1F3DJ 3MRDB 3A6OA 4K2UL 1KB5H 5EZIL 5GGTL 1S7VB 5F44A 3QO1A 4FTVB 5EO9A 4E5XA 5I1LB 2RIKA 5GRYA 1K4DB 4UMGA 5TDOB 2HKHH 3Q5YA 1J86A 1FO0A 4EBQH 5HGHB 4J8RB 4OF3A 4DKFH 4HCRL 4WFED 5LG1A 1KBGH 2R2EB 4WV1A 2CK0H 2ORBH 4LIQE 5AYUL 3G6JE 1EAPB 3VFOA 2B7DT 3LKPA 1UCBH 3HG1E 5BVPL 1GIGH 4Y16D 4DVBA 5C07B 3OZ9H 1EH9A 4GOSA 4KPHH 3ZE2F 3C6LB 5IG7A 1JWMA 3WDIA 5KSBF 3GM0A 4DCQB 1U8IB 4H25B 1DBAH 2MKWA 1HXMB 2EDOA 1MCIA 4OUOA 2IBZX 3ILQC 2M2DA 1SJHA 5EU6A 4UAOC 3WUZA 1EHAA 4DKDC 3G6DH 1IM3A 4ZDHB 5HVHB 5J0BA 4ZOEA 4NSKA 2B0SL 3BRGC 3BZ4A 4ODHL 3BPOB 4TVPH 4QHMB 15C8H 1NAKH 5GQBA 2VQ1A 3EOAA 4JFEE 3LQZB 3KPRD 2BXZA 3MBEA 5IVNA 3PWUA 1T0MA 3IDGA 1AXTL 2C3VB 5IHLB 1T03L 2Z8SA 3C5JA 3QUZC 4RWHA 2OBGA 4JPKH 2F58L 5FK9A 4QXTB 3DMMD 3MUY1 2EYSA 4Y4HB 3P9LA 1J11A 4OD1L 5DJ8B 3H9HA 4EJ1C 2NX5A 5I16A 3MRBB 4HQQH 4LRIC 5IROA 1IGML 5HYJA 2X1XR 3IT8D 2UVEA 5C86A 3LKQA 2PUQT 4FZEL 2VLJB 5IFAH 1EA9C 5L2KE 1D9KB 3HI6H 4JQVA 1MY7A 2EYTB 1A1OA 1MCOH 3MRFA 5AWNL 3VW3H 5LKNA 1QSFB 1TFHA 1LEKA 3RU8L 1V5JA 3GBNH 3MUZ1 5I1GH 1ZGLP 1CDIA 5ANMB 3FN9A 4YWGL 4HWBA 4CMMA 3NAAL 1S7TB 3DGGA 3IETB 5IVOA 1QLEH 1NFIB 4HK3N 1AGBA 3ME0A 1GPOL 5D2NA 5JOPE 1UA6L 5I1CL 2L4OA 1J10A 3C09C 1YEGH 5IB2A 2CKBL 1F4YL 4TUKH 3TWCH 1H15B 3QZWA 3ARSA 3GSXA 5FGCE 3CXDL 1UH3A 1I1AD 1NLBH 2D7NA 1E28A 3EFDL 2X4UA 1IC4L 3KPQB 1LP9B 4UNTA 1CK0L 3QHZH 4ZTPH 3UYRH 1FZKA 5T1DH 3RVUC 3KPOB 3NZ8B 5K9KB 4LU5H 5F1OB 4WDIB 1CIDA 1R24B 2NXYD 2QHLA 5GZNC 1X5IA 1F4XL 4MAYB 4JZJA 1MREH 3T0WA 1RZGB 3CH8A 3VJ6A 1YYLH 3ZZ1A 4QRRE 3BRDA 3MJ8B 1WWAX 1MSPA 4XCCH 4ZD3H 2FWOB 5DRWB 1YEKL 4HAFA 1SY6L 2XQBL 3ALXA 4S10A 1KYOJ 4Y7MA 1HINL 2IANB 1JHTA 1UG9A 3W0WB 3B6SB 3BJ91 1GGCL 3O9WA 1A1NA 5DFVD 1HHKB 4KU1A 5I76A 5IW1B 1LDPL 1X4ZA 2E27L 4JFED 3CUPA 3KYKL 4LBEB 3VWKB 1AI1H 1RK0B 2YC1A 3MA9H 35C8H 3MNZB 3O6FA 5J4MA 4NKQB 3IJHA 3AREA 4FOMA 1FZMB 3O2DH 1RUPH 2R29L 3PWVA 3UTQA 2LU7A 1LO0H 3DVIA 5FKAB 1QA9A 2J6EA 3MV8A 1A4JA 3QDGA 1N6VA 4HV8B 5E4IA 1KPRB 5I1KL 1JFQL 1FPTH 1UKQA 1MI5A 2VZTA 4CW1B 3BWUC 4TOYL 4WHYH 3QIUD 3VFMB 4AY0A 3R8QA 5DYOB 1VKXA 1WFUA 3L3JA 2AV1B 2NR6D 1FLRH 4ZOCA 1A64A 1ZXQA 1I3UA 3UBXG 3WFZA 4WV1C 4LCYB 3BGMB 3N06B 2B1HH 3ARGC 4KK8D 4X6FB 4F2MB 2VSDA 1I9RH 5HGDB 4C54A 3CVIL 1F3RB 1H8NA 3WFCH 2VLLB 4LL9A 3HB3C 3OAUH 1M05A 3LHPH 4PY7B 1EEQA 3WXVH 5FUCC 1EEYB 1U8MB 1HOCB 5J9PB 1NEZA 2VIRB 5A2FA 3QCUH 5HGGS 3S98A 3CVHB 1FFOA 4OCLC 4PB9L 4HUUA 1X5YA 3GBMH 3QUKA 4KK9D 4MZ3A 1QFHA 1BJMA 3GO1H 4XBPA 5DF0A 2CR6A 4JGJA 4XP1H 2DQUL 4Y19D 5C0IB 3TA3D 3QUMB 1HYSD 1AC0A 5AEAA 1WGOA 3IDMB 2OZ4A 1IGIL 3WDHA 5JW4R 1S7WA 1TNMA 2V2TA 5EU4A 3BN3B 4BZ2H 4XP4L 3MBEC 2YSSB 1LK2B 3CFBA 3CLFH 4QRRD 4N8CH 2W9DL 5BS0A 1A9EB 4WO4B 1L0YA 2MCPH 2QR0A 1Y0LB 2Z93A 4HKXB 3IF1A 1KIQB 2X4QA 4X7TB 1UCTA 5IROC 5JXEA 3CPLB 1OTSD 2HP4A 1S9WB 3M1BA 4PGZA 1IAII 1NMCC 2Q8BL 1F3JA 3EHBC 1AXSA 2P5EB 2VE6A 3OGOE 4QGYA 1DSFH 3IFNH 4JQVC 3ZTNL 3ZDXE 5IR1B 1ULVA 5CAYB 1I8KB 5TF1L 1IAOA 3STLB 1RZFH 3REVA 1QVOA 3PDOB 3JTSA 5EIVA 4AIZB 4PJ8D 3K2UH 2CD0A 2V2WA 3QNXB 3TCLA 1ZHBB 1MIEL 4HUNB 2HLFD 5D7LB 1NMBL 5D2NC 3WHXA 2NLJA 4HWEH 2MHAA 4K7PL 4HW6A 1AKJA 2F19L 3N1MC 3SDYL 4C56E 4OM1L 1DQQA 4KRPB 3CMOL 4PRHB 1ZANH 2AXFB 1BZQK 5F1NB 3TYGH 4JFDA 4YHNA 5I15L 3SPVB 4BH8A 2V5YA 1Q72H 5IK3B 2PO6B 5D9SB 2MOVA 4P23B 3HUJE 1V7NL 5E2JA 5CP3A 4ELME 1EO8H 5A2JH 5KW9H 4KAQH 1FYTE 2J4WH 4NT6B 1XF1A 4L4VB 2HT3C 4NWUL 1NKRA 4LDEB 1GOGA 1G6VK 1ZTXL 3HPLA 4Y4FB 1A2YB 2H32H 4L29A 3GSUA 5D6DA 3S8WA 4ZO6A 4WY7L 3VFUB 3IDYC 4FA8A 3VXME 4XP6L 2VZUA 3ELAT 5DEZA 4EI5B 3U6RB 3CFCH 3O9WC 1QRNB 1B90A 3EYQD 1PG7X 2XWTA 1K3IA 2LU3A 2YUVA 5DA0B 4AZ8A 4G80A 3O6FC 4R8WL 4UBDD 2YD7A 1JGUL 1KXVC 4NZTH 3JTTB 3D69A 3LB6D 2QSCL 4AEIH 1BVKB 2XRAH 4G9FB 5CBAB 1G0YR 1SMOA 4NHCH 3JWDC 5ACMA 1Y6NR 5DEFA 1L0XA 3T3MF 1AGEB 2EH7L 4TULL 2RR3A 2ED8A 3TM6A 3QEQA 1S7XA 3FHAA 4P3CH 4ELKB 4YR6B 4X4XB 4DQOH 1AXIB 3T08A 1RD6A 4Y1AB 4R7DB 4HGWA 3DVGB 3ZYJA 3ZKMC 1A7NL 4LLYB 2BOBB 5I30L 1KIRB 5HJ3B 5DS8B 2OL3L 3I6GA 3B5TA 4I18A 5I71B 1PLGL 3ES6A 2GJZA 4OM0H 2AV7A 3RP1A 3SKMB 3FO9A 4X6DE 4HC1L 5ERWB 4AEEA 5L9DH 1RUAH 1UZ8A 4XH2B 4YUEL 4F15B 1C12A 2RJMA 4N0YL 1VEMA 3VGAC 4OD3L 3MRMB 5ITFB 4U1JA 2BNUB 5IEHB 1W72A 4HXBL 2XT1B 4C56D 3KXFE 2W0KA 32C2A 1PQZB 3PL6D 1KJ2L 1HHJA 1AR2A 1A9BA 4NQTA 5H94B 1R3LA 2VISB 2Z35B 3UXFA 2XA8H 1QP1A 4M7JL 1S7UB 2FBJH 3GNML 1QR1A 3DX7A 3SKJL 4YHPB 1UGNA 4Z6AT 1EVTC 3HPJA 3WNMA 2EZ0C 3MRJB 4AH2A 3MGTB 1BZ7A 5T1KD 1FYTD 3OR7A 1XF4B 3HNVL 3LEYH 3DROB 3VCLB 1KELH 4DZBB 4LGSB 1OQOA 2DI8A 2YD2A 3V5HB 2HRPL 3L7EB 4PJDE 1TTUA 2IAMA 1RJYB 4N9OB 4QY8B 4BSJA 1Q1JH 4JM2B 5F7UA 4OI9A 1J12A 5D96C 2DQEH 4OZ4A 5JXEC 1T66C 4QO1A 1YZZA 3VXMD 5F9DC 1PVHA 1TETH 2I9LB 2AGJL 1KCKA 5GS0H 2ERJC 4FQ1H 2NW3B 2VL4A 3O2WL 1NGYB 1YN7B 1JZ4A 2VERN 4QRTA 4YPGA 5IBLD 5HDQH 3ZT6A 1MY5A 3UJJL 3B2VH 2C3XA 2ZCLH 3BKYL 3QDMA 1PEWA 3WIIH 2P24B 5F70A 4H1LH 2Q87A 4KI5F 4X7SH 2VL5B 5DK2B 1PG7H 5EU7E 1J7VR 3MJ9L 5T33H 4RA3A 1I7TB 5EU5B 5JW4N 1NCAL 4J6RL 3TPKA 3U30B 1WCBB 4TSCL 4PJFE 1FG2B 3W9EB 1KNOB 1D6EB 2Q3ZA 3D2UD 4NC0B 5E5RB 4FQJH 5E0QA 3SDAD 1P7KB 3WXWH 3IAPA 3UZQA 2CLRA 4W4OC 1INDH 1CFNA 2WANA 3TH2T 5F96L 4NHUA 5F9WB 1KB9J 4G3YH 4EI6B 3C09B 5FM5O 4Z78B 3AMKA 3A6BL 3BWAA 4MNGA 4ZQKA 4EXKA 4O00A 4AYFA 1JJUA 2X1PA 5ESQA 4CUCA 3QQ3B 3RBGA 5L2JA 4NQEA 3PP4L 2CJUL 5IHZA 1WWCA 2ARWA 2QQKL 1Q9OA 4YHML 5FYJL 4NGHH 5D6DC 3T0BA 1NFDB 3KXFD 2VDRL 4XP5H 4FMFA 3S9DB 2WUCL 4Z5RA 3BP7B 1QKZL 4XWOC 1HHIA 4QWWC 4PJEE 1EXUA 1WUNT 5IMLB 2R9HD 2ICWB 3QIBB 2G2RA 3T0EE 3VD4A 3FQRA 2XN9E 4MCZA 4B41A 5ITBL 4J3UA 1HSAB 1A21A 1XGQA 4PJ5E 3QCTH 5SWSE 1NGPH 1SBSH 3KPMA 1G7QA 1OAKH 2DWEA 2KQNA 3RL1A 1MLBB 3G6AA 3I2CH 4U1IB 1ONQA 1M4KA 3FO2B 2X4PA 3TJHD 3TZVD 3L95B 4DVRL 2IPTH 4NQDB 2CMRL 2VABB 3V0WH 4LLVA 3KPNA 4NKMA 4X9GA 3VE0A 1P7QA 1YY9D 4R0LB 4HWZB 1QTYT 5HGBA 1AQKL 2YWYA 3QWQB 4ZUWA 4MQ7A 3O4OC 3QWRD 1Q0XL 4OFPA 5EO9B 5FB8A 1S3KH 1RURH 5EOTB 2X9WA 1ZT1A 1FO0B 3VFGL 1P4IH 3D9AL 2BVQA 1IARB 4ZUUB 4I18C 3BMWA 3VA6A 3L3IA 4KI5C 1T1YA 3KJ6L 5B3JE 5GHWL 3U48A 3RVWD 5J89A 4ZPVA 2NMSA 3MV7E 1AC6A 4M8QA 3ARGB 4HIJA 4JHBA 4KWUA 5IT2H 3UTSA 3W39A 2VR9A 3MRQB 1K8DA 1FDLL 4KY1L 2FDBP 1SJEA 1JGEB 3IJYA 3VXSE 3VD9A 5HHMB 3MLXH 4FQ2L 4OFIA 4IRZL 3KPLB 1JWMB 1IT9H 1CFTB 3GZKA 4PD4K 3PG2A 4PV8A 2JELH 4XC3H 1PKQE 1S9XA 5JOFA 5D7IE 4YO0B 1SJHB 3OR6B 4RGNC 3V52H 1P4BH 4GMSH 1JZ3A 3Q0HA 3RWIA 3MCLL 4P46A 1Z6JT 4HHAA 2CO7B 3VH8G 1AHWA 1UXWA 4PTUA 2IGFH 4JZNB 3EOAB 4FP8L 3HLAA 4E41B 4L9DA 2IAMC 3LQAH 1MFEL 3UTTD 3MBEB 3OSKA 2DBLH 3T8XA 2B20A 3IDGB 5IB3A 4P99A 4DEPB 2HMIC 3L6FB 4YZFF 3H42H 3RWDA 3MXWH 2FBOJ 1HK6A 1MJ7L 5B38B 2XN9D 1P2CA 3H3BC 4PJ5D 5SWSD 3ULVE 1CS6A 1RJLB 2X42A 1IAIM 3FB7B 1NMCB 1U0QA 1ZT4B 1N2RA 3NFSL 4BQ6A 1AO7B 1HI6A 5F72S 4KJWD 3BH8A 5HI4C 1OPGH 5E2TH 5E08H 4XNXH 4I0PA 4JO1L 4YGVA 2V17L 4YHLH 1FNLA 4H26A 7FABH 4W4NA 3OKOA 4M43H 1ZLSL 4A2LA 3BKML 1C5BH 2NY2B 1Z3GL 4PJGA 4PRNB 4NQCA 1L7TL 1CG9B 3U7WH 3AFLA 3VFWA 2XG4A 1JF5A 4WWKB 2D7OA 3RZWA 1I3GL 4NUGH 4P4KA 3GSXB 3IU3A 4X98A 5I1IH 5SWQB 5CKGA 1GGIH 1LHZA 2P8PA 3EYVA 2CRZA 4JGUA 1RULH 5ICZA 5SWZA 1JPTL 1MWAL 1V7ML 4MS8D 4QEGA 1KCRH 2XNAA 3Q1SL 1H5BA 2CDEA 4GT7A 1SYSA 3VXSD 4JDTH 5D70L 4ODXA 1KN2L 3MLWH 1QSEA 1CDUA 4JO3H 3VJ6B 3EKCA 4LGRB 5HVGB 3SQOL 1BOGA 1TITA 3BH9A 2ZOLB 4NN7B 1N26A 4FNLH 5I75C 1ZA6A 3RKPA 3B5GA 3TPUB 4P9HH 5AG8A 4G6JH 4TUJB 1MIMH 5JNYB 1EEZA 3IDYB 1KIUA 2ZKHH 3WUWA 4EVNA 5DK3A 4NO3A 4MAUL 5HHOA 3QEHB 2OP4L 4O2CB 1A1NB 1JPSL 1OAUL 4P5MA 2F53E 3FHQA 1FNSL 5DD3L 3TC9A 4RQQB 3O6FB 5A1AA 3Q6FA 3BISA 1I9JL 4LAQH 4OCRH 1T7YA 5MERA 4F7MB 1QEWB 3S5LB 1CDGA 1F58L 1AGCB 1KF9B 4HF5L 1BP3B 3X11A 2NNAA 3ZE0F 3LD8C 2BY1A 5I8OL 3K8LA 4MMZC 1WBYB 3LSOA 3MRGB 4PJGF 3ULVD 4UB0L 3CX5K 1YEEH 3QXAB 2QTEA 2VDNH 1XH3A 3I84A 4L3ED 4WGVB 1JMXA 4KMQA 4NJ9H 3L3JB 4F57L 1WZLA 3MLUH 2CLZB 3PHOA 5FHAL 1FIGH 1TZHB 4L4JA 5F97E 4UTBH 2GYSA 4JO2H 1RHHB 1LD9A 1MCEA 4MA7L 5C8JB 2PW1A 2YUXA 1R5IB 2W65B 4RRPG 2E9JA 3LIZL 2QADC 4H8WH 4WI4A 1INEH 4F8QA 1MHEA 5ILTH 3GMLB 3VGAB 4CVZA 1IQWL 4D0CA 4MX7A 3IXAB 3B4NA 4K3HA 4LDLB 1L0QA 4PJCA 1MHPH 2WNGA 3QUKB 2IMMA 5CP7A 3G08A 4OFYA 3WD5L 5JLZA 3O4LD 2W9EH 1G7PA 3O8XB 1VSCA 3TVMD 1P7HL 4QNPE 3DECA 1NGWB 1AHWC 1H3PH 2CQVA 2ZSVA 3RPIA 2A6IA 5CSZB 1UT9A 3GHBH 3L3HB 1T20B 4MJ5B 5F9JA 1L7IH 2XY1A 4OGXL 4N8VA 1N4XH 4E42B 3PF2A 4PGBA 3PJSB 4G8IA 5K33A 3CFBB 4LHUG 1A7RH 5FO8B 3CU7A 3HMWH 1RSFA 3MZGB 4Z7UA 3GSWB 3SCMD 3MACL 1A6TA 4P9ML 1NUDA 5D96B 1U6AH 1NL0H 43C9B 4HFWB 5AUMA 2CDGA 1JP5A 4WCYH 3GUTA 1J1OL 3VRLE 1OP3H 4LNRB 3S35L 2ERJB 5E7FA 2D03L 4M3KB 3U7YH 1IM9D 1EFXD 2CIIB 4GXVL 5IVZA 2F53D 3UX9B 4JFHE 4I4WB 1X4YA 3FRUB 3CVHH 4I0PC 1IILE 1MCPL 1UWEL 2IG2L 2G5BA 2Q7NA 2NY0D 1NUNB 4YHIA 1A3LL 2F54B 1AD0A 2CIKB 3RNKB 4PJIA 4XNZB 3U9UB 1NAML 4V1DE 1C16B 3R1GL 1A7OL 3B9DA 5F9AC 1XT5A 2DQFB 2DQTH 4OZFA 1DUYB 2Y06L 3BAEL 1L9NA 1F5WA 1CFVH 2P5WD 2XIDA 4IOFC 4WI8A 1NBVL 3QUMH 3O11B 1ZLUK 3LY6A 4XMPH 5JPMA 1PD6A 4PJCF 4JEGB 5FA4B 5DXWA 4ZNCD 4P4KC 4O4YL 1II4E 1CLCA 2Y07L 2JIXB 2IEPA 1DBJH 1BBJA 3RJQB 5CJQL 4YK4C 1F6AA 2DYPA 1RZJL 5T1LD 4WFHD 3VXTB 1WBZA 2YEZA 4YDKL 3BFOA 4JKKA 5ALCH 2DL9A 1H5BC 3TBWB 1I8IB 3LV3B 4LCIL 1MRFL 1FNEB 4L8SA 4HH8A 1CZ8H 1CD1A 1CGSH 1JZ2A 3P9MA 2VB5A 3S3SA 3TBVB 4Q6YA 3TFKD 2AJVL 2Z31B 4Z7UF 5DJ6B 3MRRA 3CCHB 4IRSC 3B3IA 3JZ7A 1GZQA 1RUML 2DOCA 5IMOB 4P2RB 5FKPA 4X0KA 2A1WH 3BIKA 1UB6B 5DJAB 3UPCA 1JNHA 4AEFA 2GJ6B 1TPXC 3I3DA 4KK6C 3QULB 2AXGB 1ZE3C 1MJUH 2PETA 1IAIL 1KT2A 3U36A 3CFEA 2WAHA 4LVHB 4GLRI 3HNSH 2KZWA 2R2HA 3MC0A 3MRCB 1FVEA 3D69B 1ZVSB 3MV9B 5DO2D 1OP5H 2FO1A 3VXUB 4PJIF 5FUOH 3SDCD 4KJPD 4R2GD 3HG1A 5GRUL 4PJAB 4CVXA 4YFLF 5DK0A 3H3PH 3LQMA 1YECH 4NM4H 1FJ1A 3D48R 4ERSL 2HT4C 2R56L 1CFSA 5J57B 2WQ8A 4U6YB 5JQHC 1LMKA 3DURA 1SM3L 4J4PD 3WIHA 4ISVA 5ISZE 3GSQB 3RDTA 3O3EA 1CLOL 4JFHD 1J8HB 2FX9L 1YMHB 2XKNB 4PJBA 3WNLA 4I18B 1KULA 3GMNA 2AV7B 1OQXA 1C5DA 5GJTL 3RGHA 3ZE1F 4XZUB 4X6CB 3AB0B 2V5MA 3LKNB 4U1SA 3U79A 1UZ8B 5I8KL 4M48L 2UYLB 4R3SA 1KG0B 1OTUC 3GIVA 3B9VA 4KVCL 1CE1H 2V5TA 1W72B 2FZ3B 2WP3O 2WIIB 3VXPA 4F7CB 1KLGB 1GGYA 3X3GL 5E9DE 1HHJB 3D3VB 4JFPA 4XNMA 5E5UB 1A9BB 4FG6D 1JHKH 4FQXD 3OBAA 5FYKH 3G5ZA 2AQ2A 3DX7B 2VITB 3X3FL 1N8ZB 5E8DH 5DURB 5L2KA 1N6UA 1T1WB 2GJJA 5FOJA 5HHXL 3C08L 1MFBH 5HHQA 3QIWB 1YY8A 3G6JF 1NSNL 4Y16C 4HS3B 2VZVA 1QBLL 1MF2L 1K4CA 4HWBL 2X10A 4LSUH 3SGKA 3Q6GH 3QQ9C 1MCKA 4BFGA 5I1JL 3G9AB 4M5YL 3VFPA 2X4NB 5A16A 1XF5A 4KKCC 4PJXE 3KPTA 3UTPE 3MQIA 1P69B 1Z2KA 2NY1C 4GFTB 5IIEA 2VDQH 1IEAA 4YPGB 4M7LT 4EDWH 1OGAA 2Q6WB 1IGFL 1JPFA 3QDMB 1NGXB 1ORQB 3GJFB 4PJBF 1JHLL 4OGYL 3EJJX 5ADPL 5C70A 4XXDA 4JG1L 2R1YA 2EXWC 1NBYA 4JRYB 1QSZA 5DR5H 4NKIH 1EEUA 4HEPG 1GHFH 3SDXA 3DV4B 1BBDL 2G5RA 3C8DA 3FCTA 5C0FB 3O3BA 4KJYA 4X4ME 4X4YB 4MNHA 5LGHL 4Y4KA 5DMKA 1LEGB 5C71A 2D2OA 3MFFA 2CLRB 3BZFA 3QJFA 1U8QB 4JJHA 2Q7YA 5ISZD 2OTPA 2Z8WC 2FLRT 2ILLA 3U1SL 3O6KL 3QFJB 2FYYA 5DQJB 2AJYH 4PRPA 4W6XB 2VYRE 4KRLB 3L3KA 5GRJL 5DD6B 4K71C 2NY3C 4HKJB 3EO1A 4L8SC 4OLVL 3TO2A 1KJ2B 3E8UH 3FFCE 1KCUH 5LBSL 2IWGA 4H88H 4XC1L 2FJHB 3D18A 1OSZA 3UPRA 3NFPB 2UUDK 5MEOB 1Q9OB 1EGJH 1R3JB 1YEDA 4UIKL 4OCWH 5JZ7D 2YZ8A 1ED3B 5E9DD 4DTGH 3JWDL 4OZIA 2J6EL 3ORJA 4JY4B 2LFGA 5IP4A 1EXUB 2N7AA 4WEBL 5FCUH 4ZXBD 5J12C 2FR4A 5C07E 4HJJH 3VMOA 1V8HA 4UT6H 5E94A 3ARDD 2IQ9H 4HIXL 3QEUA 3GMMA 4NN6B 2H9GB 4Z7NE 3GKWH 1IL1A 3AUVA 4YXKL 4MSWB 1MFNA 3NIGE 4JKWA 4U33A 3REWA 4L8CB 2B2XH 4DWHA 5CINH 3JV0A 4KKLC 1YJDC 2RQ8A 5CEZH 3DPBA 3GK8L 3WKML 4MYWB 4ZFOL 1OTTC 2BJMH 1HZHL 3D5OF 2QSVA 4NKMB 3OKKB 3SDXF 4YFLI 3WL9A 3KYAA 6FABL 4KQ4H 4ZUWB 4RMSA 5JUEL 5C0DB 4YBHA 1NC2B 5DTFB 3WFHA 3UTPD 4NFCA 3V6OE 3B9KD 1MFCL 3RDTC 1M71A 1YN6A 3QRFM 3PGFH 1UWXK 3RWEA 1LWRA 3QUXB 5EO0B 4M5ZL 4HT1L 1CXEA 4XPAL 2OZ4L 3P4OA 2WINA 1BQSA 3VWJD 4XVSH 2O5XH 1K8IA 2X4SA 3W39B 5TDPA 5H2BB 4RWYL 2VDLL 1EVUA 5LCVL 5C08B 3V6ZA 3ZLQC 1BMGA 5E6IB 3IJYB 1MCLA 5FHBH 5KJRL 3A6CH 3MOQA 5DD0H 4N0UE 2Y1VA 3BP4B 2DQGL 3OL2A 5HI3D 3BQUA 2J8UB 3TIDA 1K6QL 5JOFB 1BVLA 3MJ6A 5A40E 1PX4A 4OTXL 2ZJSL 5I73C 4HH9B 1ORSB 5KZCD 3RWIB 1FNFA 4Z0BL 2F8XC 3EOBB 1YUHA 3FFCD 5EC2A 4P59H 5GGQL 2NY6C 2JCCE 3FB6A 4M7KL 5T5FH 1BJ1H 1N64H 1UXWB 2ZCHL 1RZ8B 3WFDH 4AMKL 3PNWA 4XCFH 5EULV 1I1YA 4XCNA 1IBGL 3MOAL 4XVTH 5C0CA 4K8RH 4MJ6A 3QH3A 3R4DA 1WV7T 2AJUL 1G7IA 4MNQA 1FO0H 4JHAH 1KJVB 4R26H 2YD8A 4Q9BA 1WITA 2G75A 1I9EA 4C57C 4ONOA 4OQTL 2FJGA 2DM7A 5TQ0H 4PRDA 1N59B 1IGCH 1D5ZB 4KK9C 2BNRE 4OZHE 3T04D 3PWPE 4FFWD 4S2SB 1UH4A 3L3OA 5L88L 1R5VB 5CBEA 2AP2A 3HTLX 3EYUL 2ADIA 3D39B 3NFNA 5GRWA 5E99H 2Y6SD 1KCLA 2J88L 3ZO0A 4F9LA 4ELMA 5I1AA 3C2AL 1B2WL 4H5SA 1E6OL 2R69H 4Y4KC 1DLFH 4Y2OA 1I3RB 1I1CA 4I3GA 1ACZA 1U91B 5C0RL 5EOCJ 1P9MA 5KS9A 4PJGB 1TCRA 4Z95L 3O6ML 4HIEA 3H8NA 1IJ9A 2DKSA 4XTRC 4HJ0C 1BHGA 1N6QH 1E4XH 2VR5A 3VFWB 4LCWB 5GRZA 2DQHL 3L3DA 2ESVB 4KKBD 4P4KB 3ZYOA 3SKUD 1W0WA 3P11H 5KSAD 3ZDXF 2OJEB 3EYVB 2OJZL 4OSUH 5TFSL 3TBSB 1A02N 4BZ1H 3EYOA 5C2UB 1FZJA 2CDEB 1VADB 2QLVB 4PJ8C 3QHFL 4R4BA 2NTFA 5GGVL 4NP4H 1J0KA 1SYVB 1RV6X 3FO1A 4BQBA 4HEME 3I6LE 2V5RA 2XZQL 5EZIH 2BSRB 1RUQL 1LO3L 1AR1D 3LPFA 3OQ3B 5ENWA 4IRSB 5ETUA 4WW2B 4HUXB 1F3DH 1LEIB 3OXRA 2Y36L 3BN9D 4A6YA 1AH1A 2IBBA 1DQLH 5IFJA 4MJID 3ECBA 3VU2A 4QRUB 5CSGA 4S1QL 5MENB 5DWUL 1UACL 1ZMYA 4ELMF 1X3DA 3Q6FB 2ZSWA 3LN4B 3U9PL 1UB5B 4HS8L 5BVPH 4XAWL 4U3XA 4NZUH 2Y7QA 2WV3A 4WTWA 3RZCB 1RY7B 4OGAC 5KS9F 4ZSOE 4QXGH 3N1FC 4KTEL 4TNWF 1XIWB 4NNPL 5GS2H 3EYFB 4X6BA 2EICA 2BNRD 4HZLA 4LP5A 2W1NA 3PWPD 4XPFH 1EHXA 4I3RL 3VFSB 3H0TA 3X12A 3EYQC 4HUMB 4PJHE 2IQAB 1LNUB 1PJ9A 1DQDH 1X6LA 4RSVA 1MCHA 2OTUB 2B0SH 2PKDA 4FQLL 4QXUL 2EE6A 4UBDC 1CTOA 4ODHH 4JFXB 2YKLH 2VDOH 3F6IA 1DUZA 2MKLC 4N9GB 5J11C 5E8NA 2GI7A 1QD0A 2QJDA 1KB5A 1D5IH 2ADJB 2P42B 1BFOB 2VZSA 3BQUC 5IVXE 2XACC 3MXVL 4PJDA 4BQCA 1VGEL 3BW9B 3KYNA 1AXTH 3G5YB 4HBCL 3QJHA 4CVZB 4PJ9D 3P30H 3Q3GB 4QTIL 4HX1A 1DVFA 1MWAB 1MELA 4X5XA 1M7DA 5CEXB 5FECB 1MCDA 4OD1H 1ZLVK 5BV7C 3DTXA 5FM8A 4JFZL 4ODWA 3OHXB 5DHYB 3O3AA 3RUGE 1N7ML 1QHPA 3RPIB 1YNLL 5LWYH 5GJSL 1CICA 3K81A 4FZEH 5INDA 1JTOA 5D5ME 3C6SB 1T1ZA 2CPCA 3P4NA 5F9JB 4QRPE 5T3ZD 1FV1B 4R90L 3UAJC 5AWNH 5DSCB 2DQIH 5D8JL 3FQUA 3BKCL 4ODBD 4OUUA 3RU8H 3O2VL 3RWHA 1T89C 3MRKA 5EUOA 3BT2H 3CC5B 4PG9A 3I6LD 4Y16B 4YWGH 5CGTA 3NAAH 4NBZB 3KDMB 1K3ZA 2FX8H 3DWTA 1FN4A 3FZUD 4L4VE 1A22B 1ZEAH 4F7EA 4K3DL 5KAQG 1T2QL 5I1CH 4YDLB 2CDGB 5D1ZD 5E24E 1M1SA 3M17A 4OI8A 5DVKA 1KPVB 1F4YH 4J3XA 1UWGH 3FT2A 1O0VA 1ZV5A 3WE6A 4PLJC 5F88B 1IQDB 4RA0C 2A9ML 2A6KB 4F9LC 3ULUE 3QWOB 1LE9B 1UQSB 5D71L 1M6OA 1YDPB 1IC4H 2MCG1 4YHIB 5GRVL 3MYJA 3DXAD 3K4AA 3QB7C 3MUGA 3ZTJH 3H9SE 5JIIA 4NBYB 5DQ9A 1FFRA 1P9MC 5C0BE 4PJDF 3KPRB 2DS4A 5KVFL 3ARBD 1YEHL 4LHJB 2IADA 4AL8L 1NDMB 1YEKH 3LN5A 2AJZA 2JB5L 1SY6H 4OLWL 1MHCB 5E8OB 4IIQA 3DMMB 3T0EA 1BBJB 4ZUSA 1HINH 4YH6A 3DX8A 4EEEA 4HDIA 4EN3A 1JK8A 3HC0B 2YEZB 4UT7L 3O0RL 1GGCH 3PDDA 4JFQA 5L8LB 1GRWA 3HKFA 1P84K 5ACZA 4F7TA 3GSNB 1LDPH 4LSQL 1JF1A 4P2OA 3VXNA 2E27H 4TNVF 1OWRM 2FSEA 3U2SB 3OKLA 4XBGB 3ULVL 5EPMB 5EUOF 4JFFD 2VLRA 1EUTA 1VEPA 2Y25A 4GW1A 1OGTB 3SDAC 4LOUD 1GZQB 4NNXA 1P1ZB 1BJ8A 2DMKA 1ZHKB 1JFQH 2X41A 1JNHB 2DICA 4TOYH 3LOWA 1BQHA 2HLAA 4UINH 3MODH 4MWFB 1SVZA 2AEIT 2XWBA 4Z0XA 3KNBB 3GKZA 4BFIB 2W0LA 5EN2A 3BUTA 2AEWA 2BVTA 2YN3A 3JV4B 1GGBL 3GI9L 1I1FA 4ZS6C 5EIIB 4NKDA 3KWWB 1X5XA 1NJ9B 4ZO9A 1I1AB 1QLRA 5CMAB 3MV7A 3IDJA 1IC5L 3PGDB 3G6JB 4FFYH 5C7XL 3NA4A 2I9TA 1UKSA 3NACL 4X7CC 1A6WH 1RZKL 5C09D 5DK0B 1T5WA 3DETD 3QG6A 4UIMB 4OIBA 3VXSA 2BVPA 1JN6A 4G8GE 3V4UL 2NXYB 3T09A 3GIZH 1AGFB 1MRCL 2I5YH 4PB9H 4I48A 2Q86B 3FTGA 4QXWA 5IB1A 2R9HC 4XP9L 3G5XA 4JJ5B 1KTDB 4ISVB 4GW4B 1F4WH 2XPGA 1I9IH 3O3EB 4G7YL 2EC9T 3A67H 5D1QA 3AC0A 2DQUH 2ZPKH 4GKNA 3ULUD 3ZKXB 4XNQA 3TNNB 4FABL 2BMKB 2DM4A 3HNTL 2Z91B 5D6CA 1IGIH 4NNYA 1ZWIA 3H9SD 2F8OA 1CLZH 4OFKA 3O2DA 1X5HA 5C0BD 4JFEB 3DHMA 4DGYL 5JQ6L 1DVFC 1KENL 4O58L 1CD9B 1CYGA 2GFBB 1E6JL 4YQXH 1G6RL 5FO9A 2CRMA 1WT5A 3LAFA 1HXYA 4ZUTA 3RWJA 2O5ZL 3RHWK 2R1WA 5HI5D 3G5ZB 2Q8BH 5DMJB 5I2IA 1CICC 4WU5A 3QIUB 4IMKA 3VXQA 3ZTNH 1C7TA 1CIUA 3NIFE 4XNUL 2V6HA 2IALA 1RIVL 2DDQH 5TF1H 4I0KA 4IOIB 5EU7C 1CGXA 2A2QT 5D1XD 1XGUA 1QFWH 2WLZA 4MLIA 3MRIA 3VI3F 2Z92A 4FHBD 2X44D 2BSTB 3BDYL 3FFDB 5TE7H 2APVA 2NZ9C 4Q9QL 4P5KB 3D0VB 4MA3B 5I1DA 3LPGA 3P2TA 1UM5H 2DQJL 2A83B 4POZD 5A16B 3DYPA 1XF5B 2F19H 3SDYH 2AEQL 4Z7VB 4OM1H 5EBLB 1NFDE 3O45B 3F7PC 3ROLA 3CMOH 3MREB 1I7ZA 1IRAY 5FGCB 2GY5A 4Z77A 4IMLA 4Y19B 3QNZB 3TA3B 2AKRB 4F37F 1NGZB 5GISH 2YOCA 4PD4J 2VH5L 4YC2B 2CRYA 5TGBA 4RIRB 4F80A 2OYPA 3I85A 1FFPB 4G8GD 2WBKA 3MBXL 4KJYB 3RQ3A 3CDGB 1ZTXH 3GSOB 3IGAA 4QRRB 1H0DA 4JAMB 5DMKB 1RZ7H 5EC1B 3V79C 4OCMC 4CADA 4IIQC 3BZFB 4BUHA 3WS3B 3T0EC 2OS7A 2P47B 3D25A 3QPQD 5C2BL 4HGMA 5E1HB 2HJFA 4XP6H 5BRZA 4L8BA 1HWGB 1J1XL 1MVUA 4M7ZC 5IQ9A 2OTWB 2FJFA 3E6FB 4O02H 3L3KB 5H8DA 4L4TE 4UILL 3KJ4C 4P2OC 4CBPA 2ICEA 4KJWC 1GC1L 2CGRH 4YDVA 3NCYP 5DJYA 4PLKC 5TPWL 1JI1A 3B2UC 5GGSY 4PBVC 1MQKL 2A74A 4WI2A 1RIUL 4DN3L 4ZTOL 1TIUA 4PJ8B 2R4RL 2EXYD 4DW2L 2EO1A 1FVCA 4APQD 3RGVA 1O7SA 2VXTH 3GJFH 5L7XL 4WHTA 1OM3H 2EH7H 2UV3A 2AK4D 5KTEL 3MRNA 5DJCB 5I8CB 1DQJB 3FQXB 4XWGH 2R8SL 5BO1L 1TVHA 3QXWA 1A7NH 3SY0B 5I30H 2AEPH 3BD5A 1OD7A 3HE7D 4MS8C 3FQTA 2H32A 3BD3A 4YUEH 3E6HA 2X4RB 5I6XB 1C1EL 4Q2ZA 1VFAB 3EJZD 1FQ9C 2GK0B 4GXUN 4HXBH 5CUSL 4P2QA 1KJ2H 5IF0A 2X4TA 1F00I 2EDJA 2DD8L 4HPOL 3L5HA 5D1QC 4G43B 1EUUA 1HQRB 2EEBA 3C87A 2C9AA 5IJVA 3HE6D 3OWEA 4LCUB 3GNMH 4U6VL 5JORB 3LS4H 3P4OB 4PRIE 4WWID 4KHTL 1WZKA 1G7MB 5B39A 4DOHE 5C0NC 3HNVH 3L9RB 4GW5B 4NRXA 4HK3J 3ZDZE 1KCVL 2FH6A 1A6ZA 4IDLA 2GTWB 4LEOB 2ICES 1TJHL 1WT5C 2V7NA 3OMZA 5E8PB 1OT2A 4QHKJ 1SHMA 2ARJA 3ZYZA 2H3NB 4FQCL 3V5DA 4MCYA 5D7JD 4IMKC 1F13A 2WWKO 3O2WH 3PP3H 5GGUA 3GRWL 4M93B 4L4TD 2P8LB 5BV7B 1YUHB 3UJJH 3QZWG 4LLUA 5F93C 3FB6B 2MPAL 3BKYH 4G6KH 3PNWB 1ZGLB 1A8JH 1YNKL 3MJ9H 3QA3B 4M1CD 1NCAH 3CX5J 4I2XA 1T21A 4V1DA 5JTWA 1J5OH 3B9EA 4WGWB 4HXAL 5HYSB 2H26A 5F7MC 4Z7WE 3STZB 1E4WL 4WU7B 2AABH 2FJGB 3VFRB 4ZFOB 1LILA 4C56B 4KZEH 5B8CA 3PL6B 1ES0B 4GSDH 5F96H 2FCBA 4HGKC 2HVJB 3FB5A 1C08B 4QNPF 2WQRA 1MAJA 4QF1B 3A6BH 4D2NA 2ADGB 4KDVA 4XPGH 2GITB 1FORL 3HUJB 2QBWA 3BHBB 2PXYA 2MNUA 4U6HB 4RFOH 4G6ML 5T1KB 1FYTB 3PP4H 3K2MC 4BH7A 5CZXD 3GMQA 1G9NL 3CFKB 1R3KA 4NCC1 4PFEA 2QQKH 5L6YL 5FYJH 4DGVL 4LARL 2VDRH 2PR4L 1QKZH 5DJZA 3BZEA 4GRLD 3E2HC 3CSYB 3W2DH 3VXMB 4Z8FL 3L3DB 1SEBB 5ITBH 4H1LA 2DBJA 1W0YT 3B9AA 5EFIB 1DFBL 3BUYA 3HI1A 4PRID 4YDIL 3RWCB 1D5BB 4K3JL 5HHVL 3RVVD 4CKVX 2OI9C 1F6LL 1MCBA 1OAQH 1Q9KB 1PFCA 1X44A 3THML 2CMRH 3RX8A 3RGVC 1XCQA 4PR5B 4RBPK 2BHZA 5BZWB 4HIHB 4GAYB 1WAAE 4Z7QE 2AXJA 3D85D 4XT1C 1HH9B 2LABA 1A7PL 1NEZG 3QDJD 3D2UB 4NDMB 1JRHH 1Q0XH 4KKNA 3SDAB 5J6HB 5DRXB 5ETUB 2NCMA 5EBMB 4RFEA 2H6PA 3CDCA 4OF0A 2YA0A 4A6YB 4KV5E 1U8PA 3M8OH 4PRBA 1I7UA 2PTVA 3VGGA 12E8H 2VOTA 3HR5B 5GHWH 3F7QA 3UCRA 1IEBA 4B7IA 2I07A 5GXBB 5IQ7L 2J8OA 1FNGB 3BXNA 1MJJB 4X6DB 4LSRL 5FDWB 3P4LA 5DRZA 1FDLH 4Y2DA 2CDFB 1DBBH 4FQ2H 5C0AE 3TFKC 2QQLL 4P5TD 4IRZH 4MXWH 1FFNB 3FN0L 3KXFB 3U4BL 3PABA 1OB1B 3OX8B 5KVGL 1G7LA 1PDKA 4HAGA 3K1KC 1N5YL 2FEEI 1T4KA 1HHGA 4XBEH 3KLAB 1EPFA 2AK1L 4YEFA 1X4XA 5KSUB 3GHEL 3SGDH 3MCLH 4JQIL 4M61A 5T1MA 4R4FL 3PWNB 3HAEB 3F7YA 4HKBA 3EFFB 4U1NB 1UM4H 3RIAK 3TZVB 2VC2H 3SDCC 5DVOA 4LSTL 3I3BA 4KJPC 1MFEH 2BK8A 4PJDB 4U1LB 2CKNA 4NRYB 3F12A 3QJHB 3QRGL 5KVEH 4GRMA 3ARYA 5JHDD 3RTQD 2E6QA 2J5LB 4ZNEE 1MJ7H 3VFVA 4YIQA 4PJXA 2D0HA 3SO5A 2HTLC 1ACYH 2P49B 4XPBL 2R2BA 4ODWB 4AJ0A 3U4EA 4RGMC 4Y8AA 1QPPA 5E6YA 4LHUD 3V6FA 3M45A 3ARFA 3P4NB 1MHHB 1RK1A 3VXRE 2VO5A 1KFAL 1AQDB 4NQVA 5HDBF 4OUUB 3T2OA 4TPRL 4W68A 3T3PE 3SE9H 1NCCH 4JO1H 4OLYH 5MEPB 1FP5A 4PJFB 3D1MC 4M7LH 2HG5A 4RFNC 3X13B 3DARA 4X4MA 2ZOKA 4TN9A 2QHRL 1ZLSH 3GJEB 4QGTA 5B8CC 1Z3GH 3I6KA 5GIRB 1CVRA 5F6IC 3VG0L 5CGYC 1B0GA 1DQML 3MRDA 1L7TH 4NOFA 4XXCC 1I3GH 1S7VA 4XVJH 5FYLH 4FTVA 1Z5LA 5I1LA 1RMFL 3O3DB 2PXYC 1K4DA 2WSKA 1M6OB 1J88A 5TDOA 1K5NB 1RVFL 1MWAH 1TJGL 1CGWA 2HRLA 5HGHA 2DLFL 4DAGL 3W11D 2APTA 5DUPL 2EDFA 5C0AD 3UTZA 3IFLL 3P0VL 5GS0C 1KN2H 4G6AD 3C60D 1OVZA 4JPWH 3BJLA 1YEFH 2R2EA 3AROA 3SQOH 4GRWE 4FQQB 3S37L 1EAPA 4PJEB 1T7XA 4UV7L 3S35X 1FGVL 4PJXF 4K7FB 1OSPH 4WHDA 5C07A 5DT1L 2XN9B 3C6LA 1BFVL 3OF6D 4PJ5B 5SWSB 1U8IA 2FGWL 4H25A 1HXMA 1CXKA 2OP4H 1ODAA 5TE6H 1JPSH 1OAUH 1U8OB 4JRXE 4KJQC 2XTJE 4P2OB 2A6DB 1FNSH 4MB4A 4OD2B 1DR9A 4ZDHA 2EEDA 3WFBH 3AS0A 1F58H 4HF5H 1LO5B 4Y5VB 4WUUD 5I8OH 4QHMA 1IC1A 3LQZA 4KROC 2DJUA 5EG6C 2VWEE 1H3WM 4IHOB 1OF2B 3R8BB 1A14H 1MH5A 4G42B 2W9LA 1NCBL 2PYEE 3BSZL 5MI0C 5F89A 3N85H 5HHPB 4UDTB 3WHE0 3T77B 1KEMH 4F57H 5EN2B 5HVFB 3VXRD 3TCXA 5FHAH 2YK1H 4Y4HA 3W81A 5DJ8A 2IPKB 3MV7B 3MRBA 4MA7H 4R6UA 4OV5B 4Y2DC 1CBVH 4PGDB 3L7FB 5DUML 1T5WB 3VXSB 1D9KA 2BVPB 1MRDH 2EYTA 3QO0B 1BEYL 1QSFA 1IQWH 4WI5A 4I48B 1PKQB 5IB1B 2VRAA 3TV3L 3GSNH 1E4KA 3BP5A 4LCCB 1R5WB 2Q76A 2FEDD 5T3ZL 5D7IB 5ANMA 2XPGB 3F7RA 3OAYK 4KGLA 1XGTB 1NFIA 3TO4A 1J0IA 4Z7NF 3WLWC 4GKNB 2APWA 1RUKL 2G9HA 3NVQA 4NNYB 4OGXH 2VXSL 1A6VL 3KLSA 1QBAA 5T3XL 5GS1B 1H15A 4OFVA 4ONGH 3QEGL 3QISA 4YXHL 3KPQA 1LP9A 2HN7B 5IEKA 4MZ2A 4OKVB 3SJVD 1BM3H 3KPOA 3NZ8A 3MACH 2B5IC 5K9KA 1HXYB 4WDIA 1R24A 3N1GC 4KDWA 4BA8A 4MAYA 5K9JL 4XMKH 4HUVB 5I2IB 4WJ5B 1J1OH 3MJ8A 4TYUA 4U6XB 4WUKH 5TQ2L 3K8MA 2FWOA 3ARFC 4YE4L 3S35H 1CXLA 3VXQB 4LASL 4PBXA 5DRWA 1S5IL 1JV5B 4L3EB 4JRXD 4JM4L 1I8MB 4GXVH 2E7MA 2XTJD 3FOMB 3QFJE 3S7GA 1EK3A 1AJ7L 1MCPH 2IG2H 1A3LH 1DANU 3QI9D 3W0WA 3CAFA 3B6SA 3R1GH 1A7OH 1HHKA 4QOKD 5IW1A 3UJIH 1X5GA 4JCLA 4LBEA 1HE7A 3VWKA 1RK0A 3QQ4B 3MNZA 4YEEA 1MUJB 5D93B 3RFZC 2PYED 4NZDA 3S4SA 1FZMA 2HT2C 4O4YH 1EAJA 3PXHA 4XCEB 5CJQH 2OCFD 3O4LB 4HV8A 3LQAC 1KPRA 3TVMB 3TN0D 4CW1A 4YDKH 2XQYG 5BVJB 2JCCF 3VFMA 2ITCB 2QSTA 5DYOA 4LCIH 2EE2A 1MCWM 4IS6B 1NQBA 3MA7B 4GAFB 4Y5YB 4HMCA 2AV1A 1MFDL 2E9BA 2GSIB 4HS6B 4LCYA 1G0DA 3BGMA 3EGSB 4F2MA 1LP9F 5HGDA 1RIHL 1CU4L 2DTML 2BCKB 3O41B 1ZHLB 2VLLA 5T5NF 2D7TH 5HHNB 2K7PA 2XFXB 3C6LC 1RUMH 4PY7A 3SCMB 4LSDA 1EEYA 1U8MA 1HOCA 3E2HB 5J9PA 4OZHF 2VIRA 4M00A 5IQ9B 1FVDB 1CD8A 5A2LH 1IM9B 1EFXB 1G6RB 4JY6B 1KEGL 5DJYB 5IW6B 1BECA 2F53B 4M4PA 2OI9B 3W5NA 4P3WA 2NW2B 5K59E 2MSPA 2NY0B 3QUMA 1JIBA 2FO4B 3IDMA 4JDZB 5GRUH 3FQNA 2X89D 4IRJD 1FH5L 2RGSA 1A7QL 2XTLA 3K8KA 2OQJB 4ERSH 3WJJA 5C08E 3OKEB 2YSSA 5E2WH 3MRNB 3JVGA 5DD5L 1EHLL 4HUWB 1Y6MR 1CL7H 3KHQA 1A9EA 4KKBC 4EUPB 1PYWB 4B7LA 4Y4HC 1OAXL 3PQYE 1I7RB 5C0EB 1JGVH 1Y0LA 5I18L 4R9HA 2FX9H 4X7TA 2DQDL 5T1LB 3CPLA 1S9WA 3FQTB 4H0HB 4TTDC 5FYJE 5GJTH 3RI5F 2P5EA 1D9KC 5C9KA 3VDAA 4P9HC 2ZP0T 5IBTH 5IR1A 5DDHB 4J3OC 1XGPA 1TLKA 4Q2ZB 1CE6B 4KVCH 3STLA 1ZAGA 5JMRA 1U3HD 3DSNA 3GBLA 5CJOH 1E4KC 1NC4D 4AIZA 3QUYA 1U8KB 1AR1C 1ZT7B 5IF0B 4FRWA 2VLJD 3TO4C 2W07A 2VQTA 2WWMD 1XF2B 2EEAA 1CGVA 3OKYA 4P4RB 3DVNB 4DKFL 5CS7A 3OTTA 4GBXD 1KBGL 1PSKH 4V2BA 4ZS7H 3RUGA 3X3FH 2CK0L 1NCTA 2ORBL 4UV4L 3U0TB 1NCNA 1UCBL 2AJ3B 1HQ4B 1W2KT 3G04B 4KVNL 4KUZH 4PRHA 1YQVL 4QRPA 5HTSA 5HHXH 5B39B 2AXFA 3FO0H 3OZ9L 5F1NA 3SPVA 4EOWL 5HYQB 3UJTL 3WLBB 1NSNH 5IK3A 1NUGA 2PO6A 5D9SA 1X6NA 3SDCB 4G7VH 4P23A 1QBLH 1MF2H 2X7LB 3QHTC 4R2GB 3QG7L 3BVNB 3T2QA 2VDKH 5I1JH 1YPZE 4MAYC 4NT6A 4M5YH 4L4VA 4PRAB 4F3FB 4JZOB 4ZODA 1IZJA 4Y4FA 1A2YA 1IGFH 4YJZL 1LO4H 4GAJH 2W59A 4TVPL 4H8WC 4G8FB 1NAKL 1M7IB 3VFUA 2C3GA 4JG0L 1WWWX 3HMXL 4K7PY 4D94A 5ADPH 5IB4B 5E8EB 2R1XB 1RHFA 4JG1H 4EI5A 4PP2B 3SDDD 1QRNA 4V1DB 1L4IA 3VWKC 1T7ZA 4WI7A 1BBDH 4DJMA 2F5BH 1ROWA 5JDSB 4AM0B 4PJ9C 2IAND 1B9ZA 3JTTA 3FT4B 3MCG1 1BVKA 5CBAA 4G9FA 4RX4A 1S7RB 4PV9B 1P4LB 3HN3A 3RY6C 3U1SH 3HI6L 3PQYD 2Y4SA 1S78C 1YMME 3PV6B 3TESA 1WTLA 1MCOL 2GK2A 4FQXB 5EZLB 3RUGF 3WUWG 1RJCA 3OAZK 1J87A 4ELKA 4YBQC 2E5EA 4X4XA 4YR6A 4CDHA 2YPLE 4N0CC 5J13B 2KPNA 4LMQE 4OLVH 4R7DA 5I1GL 3Q2CA 3DVGA 2VAAB 5LBSH 3FAWA 5CILL 4K55A 3F8UB 4LLYA 4XC1H 2BOBA 1KIRA 1PX3A 1R3KB 1I1RA 1CLYH 5DS8A 1NANH 1FNHA 5BV7H 1YEGL 2DTSA 2HTKC 5DMGD 3SKMA 3BZEB 3F6LA 4TUKL 3UP1A 1GJIA 5ERWA 2XI9A 1ZS8A 4JDVB 4WEBH 3TWCL 5EZOL 2B4CH 4ZFZB 3WNOA 4I5BB 5D1ZC 2EKJA 5F7HA 3DUSB 3MRMA 5ITFA 5ID0B 2O61B 5H37H 2BNUA 3O6LH 5IEHA 1NLBL 4HIXH 1T3FB 4LPYA 4GG6B 4XPTH 1GXEA 2J1KA 1U8NA 4YXKH 4U49A 1PQZA 3BMVA 2Q1EA 1NEUA 4LU5L 5H94A 2Z35A 1KSRA 3WKMH 1S7UA 1YYLL 1XCQB 5EWIL 2BVEA 4XCCL 4ZD3L 1UEMA 4YHPA 3MOBH 3AAZB 3MRJA 4XAKE 3WJJC 5IM7B 5E56A 1G9MC 3MGTA 4PJ7E 3ARTA 1XF4A 1EERB 3JVGC 3VCLA 2P45B 2VLKD 2DLTA 3IS0X 3V5HA 3L7EA 4QY8A 5MHSE 2UWEE 1U8PB 5ISZB 4JM2A 3WIFB 3RIFF 1BPVA 1UXSB 5MI0B 4JHWH 4ENEC 1AI1L 1NKOA 2I9LA 3MA9L 35C8L 1G9EA 4M5ZH 2I26N 2I07B 1BOYA 3QFDB 4XPAH 2NW3A 1NGYA 1BD2E 3OGCB 1EGJA 4RCAA 4N8VG 3L1OL 2VDLH 3RVXC 1LO0L 4JPVL 1YYML 5HDLA 2DM2A 1LDSA 1PKOA 2P24A 1FPTL 3LMJH 3QUYC 2VL5A 4WFEE 5DK2A 1MEXH 2DQGH 3GSRB 3L5XH 4YAQB 1I7TA 5EU5A 2Z0BA 3FQWB 5E9DB 3IXTB 1WCBA 2X05A 2NY4D 1FLRL 1P84J 1FG2A 1YMMD 3CZJA 4J23A 4S1DC 4ZXBB 1D6EA 2PTUA 2ZJSH 2B1HL 1HHGB 4LRNL 4UU9B 1P7KA 1I9RL 3MMEB 3ARDB 4K07A 4C55A 1G7JB 2YPLD 4ODVH 5F7NC 3WXVL 1F11B 4AMKH 4Z78A 1IKNA 2F74B 3MOAH 3HFML 3NBNA 4P23C 3UMTA 3CSBA 3QCUL 2HH0H 2AJUH 2FHCA 4A6YH 2O93L 3IRPX 1KV3A 2BNQE 2DLGA 3MLVH 2NXZC 4OZFG 4KRPD 3QQ3A 2OMBA 1CGYA 2J12B 3EDJA 2CLVB 5E95B 3GO1L 2AS5M 4OQTH 5D2LE 1A7BA 4PJXB 2JJSA 3EYSH 4K9EC 2WUBL 1NFDA 4HD9A 3B9KB 4JM2F 4QTHB 3BP7A 4L9LB 5KN5B 1VGKB 1MAKA 5I19H 2NYYD 4KK5C 1RK1B 5HYEA 5IMLA 3QIBA 2ICWA 5AZ2L 4EI5C 4XI5C 3H2WA 4Q74A 2CXGA 4CJ1A 1HSAA 1JVKA 4N8CL 2J88H 2ADFH