2YRPA

Solution structure of the tig domain from human nuclear factor of activated t-cells, cytoplasmic 4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGLPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear factor of activated T-cells, cytoplasmic 4
publication title Solution structure of the TIG domain from Human Nuclear factor of activated T-cells, cytoplasmic 4
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yrpA00
4X4ME 4GKZB 3VFNB 2UVEA 4Z78B 2WBWB 5IFJA 1C8PA 1XGPA 2WUCL 3NCYS 2DTML 2EC8A 3BN9C 4PJ7A 3FAWA 3KPMA 1RJLA 1S78C 5D1ZB 1XR8B 4NBXB 2FX8L 3U9UB 1DN0A 1KB9J 5L0QB 1LDPH 4RGNB 3VFPB 3ZE1E 4N8VA 2PW2B 5CZXD 1J0ZA 1FE8H 4X98A 3H7LA 3VH8G 1IKNC 4OF7A 4GH7B 5ITBH 5IM7A 1U6AH 4QOKE 1BFOB 4FFYH 2Y5TB 5IVXA 4P99A 1AXTH 1YYMH 3WFEL 5C0BD 1RJCA 4LP5A 3HE6D 2YSSB 4PJAA 2FGWH 4KDWA 4OFIA 2Z93A 2EXYC 3G6AA 2AQ2A 1DLHA 4XCCL 1RK0B 3VDBA 3GEWB 3GMLB 5TE7L 3O6KH 1NC2B 4MJ5A 3IXAA 5EA0H 1ODAA 3QWOA 4NBZB 2NYYD 5T5FL 4HIXL 1KCUH 1U8JA 4UB0H 1KIUA 3H9SA 1LGVA 5DK0B 4Q9QL 3U2SA 1BZ7B 4X5WB 4Y5XA 4DKDC 3PGFH 5CLTA 4M7KL 4Y19E 5DRWA 5IK3B 5ID0A 1FN4A 3GJFB 4OD1H 1Q1JL 1DQTA 1T20A 3MNWB 3IDUA 1HHHA 5F8QC 3T0AA 5KW9H 3OG4B 1R24A 2ICWB 1O5DT 5TJWK 5CGMA 3BP6B 2B4CH 4APQD 2Q8BH 2XQBH 4GQPH 2W0LA 3N1GC 3GK8L 3OKYA 1MNUL 1KPUB 1YC7A 2X5PA 3LQMA 3BGFB 3IDXL 4MHHI 1MJJA 4PP2B 4KFZC 3PHSA 1LP9F 1IAMA 3BIKA 4EXPX 4QTHB 2VZTA 4XGZB 4OFPA 3VD3A 4M4PA 4FTVE 5CZXC 4P3CH 4M3JA 2X4SB 1I7RB 5IVZB 3V5DA 2NMSA 3EYUL 4E0RA 3SE9H 1IGFH 3GI8H 1F90L 1S7XB 2X9WA 3UBXI 1KV3A 2BNRD 1MVUB 3QXWA 5FK9B 5DLMH 4D9QD 2OZ4H 3HE6C 4MGXA 4JFZL 4PV8B 3O2WL 1AHWC 3OAYH 5KSBE 3D0VA 4D0CB 1QSFD 2GUOB 3BHBB 4G8GB 4K3JH 3BKML 4ZTOH 4HXAL 5C6WH 3LQZB 2ZSWA 3FB7B 4P46A 4P57A 4M62H 5F70A 4WW1A 5TH2B 3ARTA 1D5IL 3FFDA 4NRYA 2CIIB 3BPNC 3CFBB 1F13A 1ZT1A 1E4JA 1HIMH 1OSPH 4H0IA 5GPRA 4DKEH 7FABH 4JGUA 3GFUA 2VN4A 4YXHL 3VXPA 3UYOD 2DQGL 3V7AG 4OCSH 4QKXB 4LAQL 5DVKA 3DMMA 3X13A 2R9HC 3IU4H 5D2LF 4HWBL 4MXWH 3NCJL 3DBXA 3EW3B 5K9KA 4PGEB 1MFEL 2DQFA 3ET9F 5IFJB 1XGPB 5JR1H 3UJIL 5HHOE 4APQC 4GT7A 3KPMB 1RJLB 3QWRD 1GHFH 1ZWIA 1J0IA 1DN0B 3ETBF 4FFVD 3TCLA 5IB4A 1NL0H 4UT6L 3DHMA 1ZANL 4LLVA 4N8VB 5GGSY 1G1CA 2YUZA 3GIZL 1J0HA 5GSRA 4HGWB 5IM7B 3VRIA 4G80A 4UTBH 5IVXB 3TFKD 4RMUA 4ENEC 1S5IL 2IPUK 4AM0A 5I75B 1W8OA 4PJFE 2RHEA 4PG2C 3ARDD 5E95B 4BFGA 2Z93B 3G6AB 4YJZL 5TQ2L 3ZTJG 3QDMA 3TBWA 3ARPA 4YFDB 43CAA 4RISH 4HEPG 3IXAB 4MJ5B 3NABL 5F7LB 2MKWA 4RMVA 1YECH 3QQ4A 4HV8A 4DTGH 5C08E 4NUGH 1CR9L 1U8JB 3CDGA 3QG6A 3FO2B 4TTGA 5I9QC 5I1GH 2CPCA 5D93B 1CTNA 3U2SB 3AUVA 1MRDH 4Y5XB 3FFCE 4R0LA 3UCRA 5DRWB 2KH2B 3U46A 5ID0B 1FN4B 1HINH 4OCRH 1T20B 4Y4FC 4MB3A 4PPTA 3CVHA 5D7LA 4FQLL 1HHHB 2PXYC 2OYPA 4U0QB 5D6DA 4CUCA 1R24B 3AMLA 1F3JA 1MRFH 3U30B 2NXYB 4MJ6A 1OPGH 4PLJD 5MI0C 1RI8A 5C9JA 5IBUB 1SYVA 5HDBE 4S1QH 1N7MH 2CUHA 5E6IC 4PFEA 2QADB 4TVPL 2P8PA 5I1LA 3SQOH 4R6UA 2BDNH 1MJJB 1AR1C 2H1PL 3GO1H 1DQDH 2H2PD 2OTPA 3F7RA 5F93C 5ILTL 1KEGL 2VERN 1ACZA 1JYXA 2B20A 2V5SA 1Q38A 3SDDC 3TH2T 3V5DB 3RGVA 4E0RB 3PL6C 4MVBC 4HF5L 2BVUA 3V4PH 1T03H 4X0KA 4IMKC 3HC4H 3N85L 3ARDC 2X1QA 2VLJA 1EJOH 3D0VB 4YH6A 4JRYD 3IVKA 1OTTC 3EZJB 3RHWK 3SCMC 1EGJA 3QBTB 1OP5H 4KK6C 3SE8H 2OR8A 1A6WH 2ZSWB 4P46B 4P57B 1JZ6A 2FWOA 4WW1B 1QSVA 2EDWA 4MQSB 3TN0A 3HZYA 3HRZA 1KBGH 4ZD3H 5F9OL 3FFDB 4NRYB 4XP5L 4PJGE 4MJIB 3V6BR 3IDGA 4LPUA 5B39A 1ZT1B 4AL8H 3QXUA 3X11B 3ABZA 4A2MA 1KJ2A 1T1WA 3AY4A 4FFWD 4LLYA 3VXPB 5CHNA 2APVA 3X3FL 4AG4H 3W0WA 1AI1L 5ANMA 2FIRT 3DMMB 1H9VA 4P5MA 5I1DA 1Q72H 3X13B 5C0AD 3DBXB 5I1AA 4OZ4A 5K9KB 1NBYA 4PGCB 1EEQA 4KUCF 5ADPL 4Q9RL 3B6SA 3W39B 1BM3H 2VDOL 1SMAA 2VMFA 1ZWIB 2VDNH 5IBTH 1MCIA 3MSPA 1G7MA 2AEIT 4PJEA 4Q6IC 5IB4B 3HPJA 1UQSA 5E7BA 1UH2A 2XZQH 3T2OA 4LLVB 4XWOD 5DGQA 1CD1B 4UOW0 3T1FA 4NJAH 5IB3A 3SE4A 5DTFA 5I0DA 3OKDA 5C7XH 4DUVA 3RDTD 2NXZB 4U1SA 3VRIB 4G80B 2DKUA 4AY0A 3VXRD 3LD8C 4ZOBA 1FNHA 2O5XL 1TCMA 2Q76A 6FABL 1VACA 4Z7QF 2E7LC 1TCRA 2QHRH 3QDMB 1E28A 43CAB 1FAIH 5MENA 2CRYA 5IEHA 3QQ4B 4HV8B 2OLDA 3CDGB 3QG6B 1JZ3A 1R0AL 3MUHL 5BOPA 2Y36H 4KAQL 5IESL 2C7UB 4E41E 4R0LB 5GGRY 3D3VA 4L4VD 3U46B 1MH5A 1U2HA 4FG6D 1FH5H 4LNRA 5FV1L 2MHAA 5D7LB 5JXAL 2YA2A 5EO1B 1WBZA 1F3JB 2DL2A 4FFWC 3DX9A 2VUYA 5L9DL 4MJ6B 3OHXA 3MXWH 2EDEA 2CKBH 1UA6H 2CO7B 5C9JB 5HD8C 1SYVB 3TPUA 3WEXA 2AJZA 3AB0B 4S1RL 2P8PB 4I48A 5I1LB 2MPAH 4LSQL 2P5EA 1JN6A 3MRBA 1U8HA 3T2NL 2CUMA 1YZZA 4QLRA 6CGTA 5GHWH 5GIRB 1A7OL 4P23A 3RDTC 1KTDA 3RGVB 1J12A 1OGTB 1N6VA 4ZS6D 1BQHG 2AJ3B 2KKQA 5K9QG 3FT4A 4YHYB 3X3GL 3QDJA 3KS0H 1CTOA 4X0KB 3K8LA 2H32H 3ZT6A 2VLJB 5T3XE 5HGBA 2C1PA 4I3RL 3IVKB 1WWWX 3BQUA 2NTSP 4X9FA 4PUBL 3QHZH 4YHKL 1RIUL 4L1HA 1C5CH 2FWOB 3TN0B 3HZYB 3MLWH 1T0PB 2ADGA 3HRZB 3K7UA 1P53A 4UU9B 1W72A 4NNPH 2WIMA 3IDGB 4P2OD 5IJKA 3U82B 1B2WH 5B39B 4I2XA 4NQXA 1KJ2B 1T1WB 4LLYB 5CHNB 3V6OC 3W0WB 5ANMB 2XQYG 3C08H 3NN8A 4P5MB 5I1DB 3EGSA 2DLHA 2DIBA 2VLRE 3QFJA 1ZKAA 5I1AB 4OZ4B 1NBYB 1ORQA 5GGSA 1AGDB 1ZLSH 3Q5OA 3WFBL 2VLLA 4WO4C 3B6SB 3QIWA 4G6JL 1MCOH 3DO3A 3HR6A 1PVHA 4Z18A 2NX5B 4WUUD 4HK3N 1G7MB 4PJEB 2FYYA 2APFA 15C8L 4OZFB 2MQ0A 1MCCA 4O02H 1UQSB 3OJMB 4CU6A 4ZS7H 3TV3H 5D2NC 5AZEH 1P2CB 3T1FB 5IB3B 4OLYL 2GJZA 5DTFB 1CK0H 3OKDB 2HFFA 2ESVE 1FNAA 4U1SB 1FHGA 1GJIA 4DKAA 2BVTA 1TETL 1OT1A 2ARJQ 4K3GA 2LU4A 4NWUH 2DAVA 3QEQD 3R0NA 4UV4H 3FT2A 5FUCC 4AQ1B 3I75A 5KSAA 2UUDH 4IRZH 3WFCL 2VDPH 4LLUB 1VACB 1YQ2A 1FGVL 3GMPA 2WINA 1TCRB 4TUJA 1E28B 5MENB 3CCHA 1MJUL 2IALA 4R4FH 5IEHB 4G6FD 1N5AA 4QHNA 4U6HA 2XWTA 4U6TA 3OPZH 1OAXL 1T0MA 2VXVH 5DD1L 1AO7A 2AEWA 5DJ0A 2CLZA 4XX1E 2EYTA 3JUYA 3D3VB 2FB4H 1MH5B 4Z7VA 4FOMA 4LNRB 2MHAB 4P2OC 3EDDA 1INEH 4ZAKA 1BZQK 1Q9LA 1CFQA 3O2VL 2WNGA 5EZOH 1WBZB 3I02A 2X44D 5DMJB 4XNZC 4XTRC 4LEOA 2IMMA 3DX9B 4JKMA 4JFEB 4GW5A 3HZKA 2AJXH 5GGQH 3T0BA 3C5ZD 3NA9L 3TVMD 3TPUB 3WEXB 4HUVA 2W9DH 1A1NA 2AJZB 5IWLA 2EZ0D 4I48B 2D7NA 1QRND 4XP6L 1Q9KA 4M7JL 4OFDA 2FCBA 1JN6B 5DWUH 5E94A 1QYGH 1U8HB 3B83A 1JNLL 2KQMA 4ZFZA 1IGCL 2ZKHL 5CGYD 4OI9A 4RFEB 3O4LE 5DD0L 3MLTA 4NIKB 2XRAH 1UKTA 1DL7L 1BIHA 3P4NA 5FA4A 5HDLA 1KTDB 2CXKA 2PKDA 5JXED 3EYFA 2BJML 2MTPA 3FT4B 1MI5D 3QDJB 2A1WL 1TTUA 5GRVK 5TF1L 1P7QB 2OXHA 4Y2DC 4KDTC 5HGBB 2C1PB 1M05B 4WHCA 2NW3A 4XVSL 4ALAL 1DQLL 3BQUB 3BJLA 3VXUE 1KLGA 3EOBA 1XGTA 4R26H 3N9GH 1X5IA 2BNQE 5J12C 3WLWD 1YNLH 2ADGB 4ONFL 3RWGA 3BDYL 1N5YH 2DQCH 4I2XB 4NQXB 1WGOA 2HKFH 2DQHL 3LSOA 3NN8B 3EGSB 3ESVF 4O9HH 4L29A 3QFJB 1B4JL 1VGEH 4L4TE 1FV1A 1ORQB 1JGUL 3IDYB 4YEEA 5GGSB 3Q3GA 2D7TL 3WCYA 2VLLB 1J1PL 2GJJA 3AS1A 3TVMC 1KACB 5L6YH 3QPXH 2FYYB 3ZDZE 1NMCC 2RBLA 4H5SA 4OKVA 4WEBH 4BH7A 2WUBH 1IC7L 3MXVH 3BI9X 4KMTH 2EYRA 3HG1E 4GAGH 5IUSA 2GJZB 4UTAL 3KPLA 1F4AA 2HFFB 3T0EA 4OV6F 4QOKD 3KHQA 1J1OL 1NBZA 4YZFE 3TIDB 1QUNA 5H94A 3FT2B 2QQLH 2YPLA 4HWZA 1QG3A 3V6FA 5KSAB 2YUWA 5GGRA 3GMPB 2WINB 2CK0L 4TUJB 3VGEA 3WJJA 4MNQE 4UNTA 1E6OL 3CCHB 5DZLA 2IALB 1PGRB 4KKBC 1N5AB 4QHNB 2XWTB 2IFGA 4OLWH 4QRPA 5D1XB 3BDBA 1T0MB 1RUKH 1DQML 4M61A 1AO7B 5DJ0B 3QDAA 1YA5A 1UCTA 2HLAA 4Y19D 4P9HC 1JNNL 4LARL 4Z7VB 4ZAKB 4JJHA 1Q9LB 1CFQB 3VXMB 4NCC2 1Z5LA 5E24E 4LEOB 1VFAA 3ROOA 4GW5B 3HZKB 3MUZ1 1U8IA 3MBXH 5F3BA 1E6JH 4HMDA 2EEBA 3CUPB 5DJ8A 3CXDL 3HB3C 4HUVB 4JKKA 2KPNA 4QNPF 1XF2A 4QHLB 2OS7A 1Q9KB 2DS4A 5E94B 4ZFZB 5GSVA 1VHPA 1AD0A 3EO0A 4XAKE 3FB8B 4FTVD 4BKLA 5KVFL 4X6CA 4NKIH 3FN3A 3MLTB 1MPAH 1CT8A 3P4NB 2EE6A 5FA4B 3EYFB 3G5XA 4U6XA 1NCBH 3PWPA 2IBBA 2HTKD 2DOCA 2EDXA 3FQRA 3VWJC 2J8UA 3DROA 3IAQA 4LU5H 3PUCA 3CPLA 2W60A 4FFZL 4CJ0A 4M3KB 2WMPA 1XGTB 4XMKL 2DQJH 2H45A 1ZLVK 3RWGB 3JVGC 2V5MA 4OD3L 2P5WE 3EZ8A 3LMJH 4F8QA 4U05A 1NMAL 3W82A 5GRWA 3MODL 2GSGA 1F2QA 1JZ5A 2PETA 3H9YA 3UJJH 3BSZL 2X89D 4QRSA 2ZZUT 3VWKC 2VR4A 1KB5H 2GCYA 4HAFA 5IW3A 4L29B 1G6RL 1KCSH 4DN4L 4FMFA 1FV1B 1A2YA 2ICWI 3Q3GB 1TQCB 2W59A 4GFTB 4LQ1A 4WV1A 5LWYL 3IB4A 3LKRB 1DR9A 4Q74A 5DT1L 1FLRL 4Z7WE 5HHOD 2MMXA 5E99L 4PJBE 4X6BB 4XP1H 4JRXA 5IQ7L 4MJ4A 1YYLH 3K81A 4GW1A 3KYNA 4WTXA 2WIIA 4D9LH 1M7DA 4Y4HD 2WWKT 1EMTL 4IIQC 4H5SB 4OKVB 4BH7B 4PJIA 3ARFC 3VMOA 1P4IL 3WIHL 2EYRB 3FZUD 3QUXA 3FJTA 2GITA 3KPLB 1SM3H 3T0EB 2EDTA 1FZMA 4CW1B 2A6DA 1CCZA 1NBZB 3MYZA 2D03H 1TITA 3MLRL 5H94B 4RGNE 4HK0A 2YPLB 4HWZB 2W0FA 2BSSA 3V6FB 1CFNB 4MWFA 5E2UH 2UZIH 5GGRB 3TZVA 3D39E 3G6DL 1P6AB 3IJHA 2YRZA 2VZUA 4TPRL 1DSFL 1RZJC 3GKZA 1TPXC 1H8NA 5C08D 2HRLA 4QRPB 4LSTH 3CU1A 4M61B 1OCWL 3FFCD 4QTIH 4HIHB 2HLAB 1Q94B 1JPST 3O6ML 2DWEB 3HMWL 5GJTH 4M43L 4D0BA 5DVOA 1NAMA 4HBCL 2FHFA 1Z5LB 1TIUA 1VFAB 5BVPH 3JSSA 4M6ML 1U8IB 5JW3L 3BYYA 4OLZL 5F3BB 4HJ0C 1T04A 5DJDA 4ZYKB 4K7PL 1IKFL 5DUMH 4YDKH 2VKXA 4PGZA 5DJ8B 1XF2B 4MLSA 3M8OL 1TQBB 4LVNC 1CXKA 4CN1A 4YHIB 4NZUH 1XF3A 1XR9A 3VDAA 5L7XL 2FEEL 5IHZA 3S8WA 1AD0B 3EO0B 2I60L 1Z3GL 4BKLB 4X6CB 4GLRH 4JPWH 1CT8B 4OQTL 1FFPA 2HMID 4P9MH 3G5XB 3NIGF 4YUEL 5IMKA 4U6XB 2ZUQC 2W0PA 4HFWA 4L8SC 1DBAH 1OP3K 3BRGC 1OT2A 2J8UB 3DROB 3ZHDA 3QPQC 3CVHH 3O2DA 1L0YA 5J13B 3CPLB 2W60B 1DUZA 4XMPH 3OX8A 4YHZL 1QFWL 4KQ4L 1A7RH 4MQXD 2VDML 4L1DA 2IF7A 1MJ8L 4IDLA 3F58L 1MFDL 1RQ5A 4KI5E 3WS6C 2NY1D 1NDGA 1AJ7L 5MP6H 5GGVY 1QLFA 3TP4A 2GSGB 5HHPA 3PWJA 4QRSB 4G8GE 3QDHA 3CMOL 1NLBH 1G9MH 2GCYB 2GAZA 5AEAA 2MKLC 5A16A 3QRFM 3GSXA 1EO8H 1A2YB 1KN2H 2O5ZH 4IRSC 3KS0J 4QRRA 1U8MB 4XC3H 4JRXB 1HEZA 4GW1B 5I73B 4KJPC 3KYNB 4J4PA 2WIIB 4Y16C 5HI4D 1M7DB 4U7SA 3QI9D 5I16A 3IDJA 2BHZA 1KELL 4PJIB 1NSNH 1DBJH 1QPPA 1U93A 4V2BA 3QUXB 5TQ0L 1G6VK 4GSDH 2GITB 2AV7A 4P4KA 1FZMB 1I3RA 2R4SL 2YK1H 2A6DB 5HYQA 1JF1A 3S9DB 2Z31B 4AMKL 1ZEAL 4HK0B 1CZ8L 1AKJD 1MWAA 2BSSB 2W0FB 2KZWA 4MWFB 2G5RA 3NFNA 5T5NF 3JTTA 4XMLL 3TZVB 1KJ2H 1ZLWH 1NCTA 5C6TL 5D7IA 3HZVA 4UT7L 5FHBL 5B21A 5IVXE 2BP3A 3L5WA 4PJAE 4JO3L 5FYKH 5EOQL 1D3CA 3QHTC 4U4BA 3S3PA 3GRWA 4E41D 2YXMA 2I5YH 5LBSL 5CJOL 12E8H 4DZBA 1WCBA 3ZTNH 2NY1C 4D0BB 4R9HA 1NAMB 4LSSL 5DD5H 3O3EB 5DMGD 3RKDD 5LGJA 1KCLA 3GSUA 1T04B 5DJDB 5CJQH 1FFOA 4FZ8H 3CSBA 4Y7MA 3ZE1F 4NKDA 3OJVC 2HT4D 4PJXB 1EPFA 2EXWD 2ENSA 1D7FA 25C8L 3H9ZA 1J8KA 1E4XL 1BECA 3HUJA 4UNUA 3DYPA 5JIPA 4M1DL 1XF3B 2XPGA 1YMMB 1XR9B 4BQ6A 2ED7A 3FOLA 5HI4C 5IHZB 5SV3A 3FN9A 2DI8A 3IFLL 3LS5L 3KPOA 4QGYA 2FATL 3LZFH 4F33A 2ED8A 2A6IA 1FFPB 5FF6A 4ERSL 4OV5A 3MRKA 5GS2D 2L7JA 5I8CA 5IMKB 4PB0H 5JOPE 3ARYA 1GIGL 1U3JA 3QDGB 4HFWB 2Q3ZA 4YR6B 2DWDA 2RB8A 4PRHA 4OD2A 2FBJH 5IHUH 3KXFA 5T3XD 4GBXC 1PBYA 3DPBA 4OLEA 4J8RA 3EYQD 2B4CC 1DUZB 4U6VL 3SDYH 2CLVA 3OX8B 3BGAA 4WVRA 1GCFA 4I5BA 4XPTL 3KDMA 2Q87A 4N8CL 1B6UA 3KLAA 3S36H 1B0RA 4TQEH 4U7MA 1NDGB 1JCKA 4OBRA 4RNRA 1QLFB 3DVIA 4HMEA 5F1NA 5FGRA 1A14H 5HHPB 3LV3A 3PWJB 4AEHH 5J1AA 3LVEA 3MV8B 1NGPH 2GAZB 2SEBA 4JPVL 2VLRD 3GSXB 4PY8I 2HFGH 3E8UL 1OQXA 4MJIE 3B4NA 4NN7B 4QRRB 3U48A 1K4DB 5CMAA 1XIWD 4EIZC 1HEZB 4N8PA 1IC4H 4GO6B 4XRCA 5D96B 2H6PA 2XXMB 5I16B 2DRUA 1F6FB 2I26N 3IDJB 3LKQA 3TT3H 4ODBD 3PNWA 5GS3A 3RHWF 1U93B 3HNVL 4FABL 4BUHA 4P4KB 2ESVD 1I3RB 2E27H 3U0WH 5EBLA 1JFQL 5HYQB 1JF1B 5ICYA 4Q0XH 2V9TA 1IKNA 1W72H 1GPOL 1MAML 5AD0A 5BOZG 1BP3B 1EXUA 4GG8A 3BESR 3RIAF 1MWAB 3ZSTA 4XBPA 2WW8A 3P30L 4HS6A 3NFNB 3PP4H 3JTTB 1EFXA 2Y72A 2PTVA 1U36A 2BOBA 1H8OA 1TVBA 1N6QL 5D7IB 3HZVB 4FQCL 4U1NA 1JWMA 1HZHH 3WKML 3ZKXC 3SDCC 5FUZL 3L5WB 4YEFA 1QD0A 5C6PB 3FCTA 4JQVC 4NO0B 5ALBH 2N1KA 5IR1A 5JQ6L 1YN7A 4EBQH 1UFUA 4CVUA 3S4SG 4DZBB 1DUYA 3QDME 5BQ7B 2IAMD 4LGRB 2J6EH 4EI5C 5K9JL 2X4RA 3L3DA 3MA7A 5HHNA 3ALPA 3GMMA 2R4RH 2Z8VC 4JZNA 5D72L 5EOCL 5LGJB 4G3YH 4DJMA 1FBIL 3GSUB 4Q97A 3JTSA 3T0VA 3RNKA 1U42A 4PRPA 1FFOB 1NGQH 5TE6H 4NKDB 5E8DL 3V0WH 3P4LA 1LO3L 3QT2A 5D7LE 3HUJB 5GJSL 3V52L 4XPGL 1BWMA 2HP4A 2GEEA 3FOLB 4MX7A 1G0DA 1Z9LA 5D8JH 2YA0A 3U9PL 1WT5A 1T7WA 4OF3A 3KPOB 3LRSA 5A2IH 2Y25A 4EI6A 4JDTH 2VDRH 3O4LD 3DETD 4F33B 2BHYA 2A6IB 4OV5B 3WD5L 3MRKB 4QXUL 2YMXL 5I8CB 4KHXH 2ZPKH 5ADOH 3P0GB 2A9MH 4F9PA 2DWDB 4PRHB 4WW2F 3KJ6H 4DOHB 2VDLH 4OD2B 3KXFB 4LFHG 4J8RB 3BKCH 1JRHH 2NY5L 3VXUD 4L8CA 2CLVB 3B9KD 3EAKA 1YY9C 5ESVA 1KTKE 1TNNA 2BNQD 1RFDH 4I5BB 1JGLH 4YHLH 3KDMB 1JHKH 3MBEA 3NZ8A 3KLAB 3RBGA 1B0RB 1Q0XH 1AP2A 1GC1L 5J0BA 4RNRB 5C0ND 5F6HI 2VLJE 5SWZA 2VNCA 4V1DA 5F1NB 3LV3B 4G5ZL 4OF0A 1T5XA 5SX5K 2BX5A 3GKWH 2SEBB 4D0DB 1L7IH 2A73A 1M71B 2DKSA 3ARGC 4L4TD 3FT3B 5I71C 1PSKL 3A6BL 2LQRA 5JO5A 1XCTA 4YHML 1JZ2A 3KPRA 2NTFA 4S1SH 5CMAB 1EH9A 1J10A 4KXZI 2C3VA 3O8XA 2XKNA 3W0WE 2H6PB 5ANME 3CFDA 3LKQB 4R7DA 4XAWH 1FO0A 4HXBH 4JY4A 1DBML 3PNWB 3IJYA 5K9OA 4J3WA 1P7KA 5B8CA 4WI7A 3RTQD 3HG1D 5FYKE 1GGCH 2LU3A 2IQ9L 4JQIL 2NX5E 1JPSL 1EK3A 1P6FA 5EBLB 3E6HA 3HC3L 5ICYB 3WIIH 4E9LA 4PJEE 5E2TL 5F1SA 3C2AL 4GG8B 1CXEA 1EXUB 5I1KL 4XBPB 1HSBA 5I1JH 2Z0BA 1EFXB 3HNTL 3PJSA 5CUSL 4QRTA 1R5VA 2BOBB 5LCVH 2AABL 4PG2A 1TVBB 4MNQD 4PJHF 4PJGF 4ELMF 4ONHA 1JWMB 5CILH 5E8OA 4TNWK 3EFFA 3SEPA 1L7TH 4KV5E 4DGYH 3B9KC 4LSPH 2UYLB 3FCTB 4BZ1H 3NOIA 5IV2A 3QJHA 3M07A 1DUYB 5MENE 2D2OA 3BKYH 3VG0H 3SQBA 3S96A 5AAWA 2X4RB 3L3DB 2KL6A 3MA7B 4I13B 5HHNB 4KTDH 4R97B 4YFEA 5A2JH 3GMMB 3DURA 3MNVA 1E27A 5JDSA 1N3NA 3MRGA 4Y4FA 35C8L 3U4BL 5D7JD 3RNKB 4PRPB 3JWDL 3D3VE 1TNMA 2IPUG 1LDPL 3OQ3B 1R3LA 2EE9A 2K7PA 4MDIA 4AIZA 1HOCA 3L9RA 4KVCH 5KANI 2R69L 4GMTH 4MXVE 1EVTC 1N64L 1T83A 3B2UC 4KJYA 5DUBA 3AXLB 1MFAL 1ED3A 4JFEE 1CL7H 4U3HA 2CH8A 5INCB 1U6AL 1AC6A 4FFYL 4GUPA 4XAKD 3ULVF 4EI6B 5E2JA 3GSOB 2FGWL 4LLMA 5JORA 1KJVA 1CFBA 1D5BA 3DVGA 2P5EE 2BY1A 4DK3A 4OZIF 3OKLA 3O6KL 4M5ZL 1OGAA 4PRIA 3SDDA 2DICA 3O0RH 1I1AA 2JELH 3LKPA 4UOW1 1F02I 4PJCF 3DLQR 3C60C 4L8CB 3AMKA 3HE6B 4ORGA 4YO0A 3R0MA 3PGFL 5ESVB 1KG0A 3BPLC 3HPLA 2NZ9D 3MBEB 3FO9A 2F5AL 4P2RA 3QDJE 2P5WD 3SCMA 1AP2B 4LHUA 1QKZL 1NANI 5HDOA 2VH5H 3ULVL 5SWZB 4V1DB 4YWGL 1TZHA 4LLDA 1CLCA 3R4DA 1X5GA 3SO5A 1T5XB 3BPNB 2XA8H 1ZLVH 1XGUA 4Z0BH 1GZPA 1V7MH 2DM7A 2JKXA 4GMSH 5ICXA 3SGDH 1PDKA 5JO5B 1XCTB 4HCRA 2NTFB 3KPRB 5EUOF 4I2XE 1SY6H 4RMRA 2EC9U 3K80A 2C3VB 4UINL 4DN3L 5JW4R 3CFDB 2XKSA 4R7DB 5DA0B 1FO0B 3VI4E 3IJYB 3QFJE 4DAGL 3E3QC 3RZCC 4ZOEA 2BVOA 1P7KB 1GOGA 4Q6IA 2OQJA 1YNKH 3HI1A 3SE9L 3Q6GH 5DHVB 4PREB 4U3CA 3U7AA 5I1HL 1JTTA 1Q8MA 5D1ZD 5C2BL 3P0YH 2DIAA 3E6HB 3ZE2E 3TEUA 2IPTH 1J1XL 4XPFL 5A1AA 4RGND 4LQFL 2CKNA 1HSBB 3AM8A 3ZKNC 2A38A 1YEGH 4JO4L 3MX0A 5DRZA 3D39D 3PJSB 4MQTB 1OARH 2GK2A 4QRTB 1R5VB 1A7PH 3EJYD 3GHEH 3IFNL 3MCLH 4XI5C 4GAFB 4ONHB 5E8OB 3KR3L 3EFFB 5HI3C 5EFIB 3MV7A 4DKEL 1OSPL 7FABL 4HS3A 3HE7A 5EC1A 5IV2B 5IHBA 5GS0D 5GISH 1TJHL 1YJDH 2BY2A 1NC2D 5I8OH 3IU4L 5T3XL 2V2TA 1XEDA 2AK4A 2P49B 4AENA 3DUUA 3WNPA 3DURB 3MNVB 2N7AA 5JDSB 3HR5A 3UTQA 3MRGB 4Y4FB 1J9CT 1BFTA 5JUEL 1AO7E 2PXYB 2YC1B 1SEQL 4Z7VE 4XP4H 1R3LB 3A6CH 5DYOA 4MDIB 4AIZB 1BQLH 1H3VA 1HOCB 2BVPA 3L9RB 5MI0B 3TIEA 3QCVL 5I1EH 4XPHL 4KJYB 5DUBB 4WCYH 1N8ZA 5E6IB 4MHHG 1HQRA 2BY3A 5BZWA 1ED3B 4NQSA 4JKLA 4NWTH 4X9HA 3BAEL 1TLKA 4PGDB 4GUPB 5HI5C 3GBNH 1NAKL 1I9RH 4N68A 2VLKA 5CINH 4LLMB 5JORB 5T1MA 1JTPA 5JIIA 3IGAA 1T0NA 1D5BB 2R0LH 3C5SA 3DVGB 1F3DJ 4WFFE 4D3CL 5D1ZC 5C1MB 3OKLB 5FYJU 1OGAB 3MOAH 4PRIB 3SDDB 4RGNC 4GG6A 2X4NA 1I1AB 2ARWA 3LKPB 3OJDA 3PL6B 3TT1H 4NUGL 1LO4H 3O6LH 1NUFA 4WFGE 5LGHH 4YO0B 3ARDB 3MRDA 3RL2A 5BV7B 1LHZA 1NBVH 1U0QA 1X5KA 1C7SA 4WTZA 3FO9B 4OCRL 4P2RB 1U9KA 4ODSH 3SCMB 4KI5D 1S7TB 3D69A 2EIZA 4AEEA 3ZYOA 1TZHB 1YEDA 2QTEA 3KWWA 3MLVL 4LLDB 4JO2H 2VR9A 1OPGL 1PLGH 3DECA 4I18C 4O5LH 5FUOH 4F37K 4G8GD 2V9RA 3OMZA 2JB5L 2WK2A 1RUQH 3RVWD 4WGWB 1XGUB 5F7DA 3RVTD 1RZKL 4DFIA 1GZPB 4BFEA 4UQ3A 2Y6SC 5DUPH 2GI7A 5ICXB 5F1KC 2VXUH 4X6DF 3T1WA 4IM8A 3OGOE 2W1NA 4JHWL 3CX2A 2NY7H 4WO4A 1UM4H 4BSJA 5IFAL 1CFVH 2BVOB 2OL3H 4Q6IB 1OLLA 2CJUH 2WBKA 1QEWA 4HJJH 3CVIH 3HI1B 4LSVH 5BRZA 3MUY1 5D2NA 5DMIH 5I76A 3CLEH 1CU4L 2WANA 3S5LG 4F7CB 4BH8A 1RZ7L 5DRZB 2R2EA 4WHYG 1A6WL 3LD8B 3T0EE 4XVJH 3RWIB 1JZ8A 2XZAH 5H35A 2X4QA 4ZXBA 5HDQL 1G7HA 1LMKA 2YPLE 1NCAH 4CL7A 4HS3B 2HTLC 3PE9A 5EC1B 4JY6A 4AG4L 2D0FA 1MJ7H 3WHE1 4HGMA 3HI5H 4KI5C 3HLAA 1UWEH 2IG2L 4WI9A 2V2TB 2AK4B 2VDQH 4OSUH 4AENB 3DUUB 1AGFA 4QRPE 4M1CD 1ZGLM 3HR5B 3UTQB 2YD5A 1YQVH 3IF1B 5D1QA 3ZDZF 3RVWC 5KS9A 1CICC 1PD6A 1H5BA 4P5KA 4FA8A 3TYFA 4F3FB 3HMXL 5DYOB 4B7IA 3LEYL 2BVPB 3TIEB 1F3RB 4OI8A 4D9RE 5CJBA 3MOBL 3AU1A 1P4BH 1N8ZB 3BMWA 2APTA 4HWEL 2YXFA 1HQRB 5BZWB 2C3HA 5A3ID 1GL4B 2NXYD 4NQSB 4H8WL 3RJDA 4KTEH 1A6VL 4YZFF 1IQDA 5CD5C 1JNJA 5JHLH 3D48R 5EU7E 2QADD 2VLKB 2HJLA 4DKFL 3FQNB 3UJTL 3IGAB 1HXYA 1T0NB 3FMGL 3C5SB 5DO2C 5JOPD 1GVIA 3GRWH 5E2VH 1ACYL 4GG6B 2X4NB 5GRUH 3SPVA 2IADA 3DSFL 1WCQA 2YD7A 4X6CE 5EORL 4YHPA 1RHFA 1YPZF 4W70A 1RK1B 2ITCA 5DK3A 3RL2B 3MRDB 4Y2DA 4KDTA 4J3OC 3HI6H 3VW3L 2J5LB 5I75C 1KN4H 3D69B 2DQUH 2EIZB 2J8UE 1YEDB 3KWWB 3D18A 3W2DH 3BZEA 3MLZH 4OIAA 4R2GC 3C6LA 4MD4B 4P46D 5F7DB 1HK6A 1O7VA 4MXQC 3H3PL 4UQ3B 4MAYC 4MJID 2GJ6A 2MPAL 4JPKL 5DJYA 1FPTH 4TUKH 3SKUD 2ZCKL 5L2KA 1X5HA 4Y5XC 4ZUWA 4YXKL 4GQ9H 4K7PX 1NC4A 2EKJA 4JM4H 4WO4B 3MJ6A 4LOUD 3PDGA 3DMMD 3EKCA 3BYTA 3MJ9A 3KLSA 4HQQL 3FO1A 4R4BA 3GSRB 5GHWL 5GRJH 3CFEA 5A3IC 1CGWA 1QEWB 3O11A 2QR0A 3K2MC 5BRZB 5D2NB 3QCUH 4JRXE 1T6VN 3QHFH 3RJQB 3FN0L 1W0YT 3LEXA 4BH8B 4J6RH 3IT8D 4PJIE 3QNZA 5TPWH 1MCRA 2N4IA 4XNUH 1UWXK 5BW7C 1T2XA 2NXZD 2IBGA 4WEUD 5I19H 3VH8B 5H35B 1MEXH 2X4QB 5E5UB 4NNPL 5DEGA 2RAMA 1BF8A 1E0OB 3EFDH 2HWZL 4WY7L 1CLYH 4GOSA 3C8KA 4JY6B 1MFBL 1GXEA 3EDEA 3QDMD 4G9FA 3HLAB 2GIYA 1ITBB 4O51A 3LHPL 5ACLA 2EO1A 1EBPA 4PJBF 1AGFB 3MLSH 1RAMA 2WWKO 2YKLH 3CFCL 4LRIC 4EVNA 5E2WL 4N0YH 1FFQA 3RU8H 3IS1X 1S9WB 5T33L 4ZFFA 5D1QB 1QZ1A 2YR3A 5KS9B 1ZTXL 2R23A 4XNZB 1H5BB 3NZHH 3TYFB 5B22A 4ESKA 3GNML 5CJXA 4ZS7L 3I6KA 5D7LD 1OAQL 3WXVH 3AU1B 5KVDL 5DZNA 2HLFC 2FR4A 3C09C 2NLJA 4O58L 1IQDB 5CBEB 4FQIH 2I9TA 2HJLB 2FH6A 4LPYA 4Q58C 4GAYA 4PJXE 2IEPA 2DJSA 4XXCA 1HXYB 2NW2B 2C4XA 2QQNH 4JAMA 1YMME 3RRQA 4ACPA 4PIRF 3TO2A 4NKQB 3SPVB 2E6QA 4EOWH 1JPTH 2VSCA 3G5VA 2AJVH 3UTPD 3B9EA 4YHPB 4P59H 3K8KA 2OTWA 3P77B 4HW6A 1FL6B 3P9WB 2ITCB 1NFIA 3VWJA 4U1MA 2DYPA 4Y2DB 1MCJA 1XGYH 3ESUF 3RGVD 4X4YA 1UACL 4HKZA 3QDGE 1EZVY 4CMHB 4ZSOA 2VLJD 4TULL 4F7TA 5J12B 3EOTH 3D18B 3JVGA 4F15C 3BZEB 3G5YB 2VXQH 2Z92B 3C6LB 3NMEA 1OTUD 1G7IA 1PEWA 3R8BB 4R4ND 3TN0D 4R8WH 1S9XB 1JF5A 4U1IA 5DJYB 5T3ZL 3QUYA 5L2KB 3O9WC 3BH9A 3JBG7 5SX5H 1OAYH 3GBML 1QYGL 4ZUWB 5GS0L 3LCYA 2Y1VA 1NC4B 1PEZA 3W0WD 4NJ9L 3RBSA 3MV8E 1V3LA 3H7BA 5DQJA 5ESAA 1WWBX 3FO1B 5D6DC 4FZEH 4R4BB 1L9NA 3QQ9C 2XRAL 1RJYA 2FECI 3CFEB 3O11B 1T80A 2QR0B 5FYKD 3RIFK 4HDIA 1NMCB 4QRRE 3OR6A 1JI2A 2NX5D 3ARFA 5DC4B 3UPCA 1QA9A 3LEXB 4JKPL 5DFTA 1G7PA 3QNZB 1QNZL 1X5FA 1D5ZA 2AJSH 5FGBC 1F5WA 5T1KA 5H8DA 4R26L 3N9GL 3L5XH 3FL7A 2UY7A 1G9MC 4AH2B 1NFDA 2E6PA 4C57C 4U31A 2P42B 5DEGB 2YD2A 1S7WA 3MO1B 3NACH 3TNNA 4L9LC 3DUSA 3C8KB 1G0XA 4JN2A 1X3DA 4UZGA 4UBDC 3Q2CA 4G9FB 5AG8A 5MEND 4O51B 5D7IE 2NY0C 3WUZA 1MCLA 3V6ZA 1CDYA 3ARQA 4XCFH 4ZFFB 1WISA 2R23B 4YAQA 2V7NA 3TN0C 3D3VD 5F44A 4OIIL 1T7YA 4ZDHB 4PRAA 3I6KB 3PP3K 3SDAA 4YPJA 4GXVL 1SEBA 4GAGL 2FR4B 4YQXL 1A6UL 4JFED 1A9BA 5JW4N 1FZJA 2X05A 2NLJB 1RUPH 5HYFA 1W8NA 2FLRT 1MFNA 5A40E 2I9TB 3O81A 4BSWA 3S3JA 3RAJL 3I3BA 1F45A 4GAYB 3ULUH 2OI9B 4KHTL 3REWA 3HUJE 2VO5A 3VD5A 1KLUB 4RA3A 2P5ED 1H3TA 3OKKA 4JAMB 5IVXF 1K9TA 2BSED 5HJ3A 1FL3A 5EU5A 4MLIA 3RQ3A 1LP9A 2R56H 4K8RH 5SWSA 1KIRA 4NHCH 1RUKL 4L8SA 1NFIB 4P23D 3VWJB 4U1MB 2DYPB 5J1TC 2FZ3A 4X4YB 5EWIL 1KJ3H 2CO6B 5L8LB 5C0RL 4HKZB 3ZZ1A 4ETQA 3QDJD 1VEPA 1GOFA 3VCLA 1ZHBB 1BQHA 3PABA 4PRHE 4ZSOB 3E0GA 4DOHE 4M6AA 3KXFE 4F7TB 1CXFA 1DZBA 3UPAA 2J4WH 1D6EA 3BQUD 1JIBA 2AK1H 1CLZH 4L4JA 3WS6A 1B90A 3DIFA 1G7IB 1T4KB 3LQAL 2CDGA 1GGTA 3QRGH 1YEHL 2CQVA 2XA3A 1A5FH 4IOFC 3VWKB 5DURB 3WSQH 3QUYB 2XICA 5C3TA 2R8SH 2R29L 3BH9B 1FG2A 3Q0HA 2K7QA 3DV4A 4IRSA 4Y5YA 3KPPA 3H7BB 4OTXH 5ESAB 3QFJD 2QJDA 5F9WC 1CGTA 1RJYB 5GZND 3EUUA 4Y16A 1B3JA 4YDIH 3MACH 4MZ2A 3QIWD 4HDIB 5BMFL 3OR6B 4M6OH 2P24B 1WBXB 5EH1A 1CE1H 3NCFB 3ARFB 5BV7H 4GRMA 3Q5YA 1S9KC 4JVWA 4X80L 4KUZH 4OF5A 2OK0L 4LU5L 1F4XH 1R5WA 1G7PB 5DVLA 4KKLD 3DARA 5D71H 5T1KB 4NKOB 1NFDB 2DQJL 2QQKL 4UILH 4OI7A 1EDQA 2DLIA 3T04D 3QG7L 1BFVH 1ERNA 4P23C 5JMOC 4G8FA 2ATPA 5KSAD 3TNNB 5DJ6A 1WZ1H 4M6NH 1TPXB 3DUSB 3IJSA 1VFBA 2Z4QA 4JN2B 3ZKMC 1KT2B 2ZOLB 3UZVB 4RMQA 1YDPA 1HYSC 3QEGL 4ZNCD 2HT2C 5D1XD 3V6ZB 3BQUC 2VXTH 1DBKH 4EUPG 2Y07L 4HMCA 1AO7D 1UCBL 4ODTH 4YAQB 2V7NB 5DC9B 4G6ML 2J2ZA 5JW5B 2B7DT 3BD3A 5IJKC 4ZAKD 1G7JA 1SEBB 1LQSR 1A9BB 2NY4C 2YD3A 3UXFA 2CRZA 4OIBA 4PRPE 4KMQA 2E7CA 1U92A 4X5LA 2HH0H 2XG5A 2V7HA 3K4ZA 1BX2A 1SBSL 4LCWA 5GZNC 1X7QB 3QIWC 5E2UL 3REWB 4OT1H 5JW4M 4HEME 1SJXA 5I8EA 4OCYL 4WFFD 3OKKB 1UT9A 4JVPA 4FQ1H 5HJ3B 1FL3B 4MA3A 4MNGB 1LP9B 1ZOXA 3BZ4A 3MA9L 1KIRB 1RD6A 2APBA 3IDIA 4X7EC 3BIBX 5IROC 2EH8L 4L8SB 1OM3H 8CGTA 4WFGD 2FZ3B 4GBXA 3FTGA 4ETQB 5TE4H 3KLDA 3VCLB 1BQHB 3PABB 4KVNH 1EHXA 1YY8B 3MYJA 3QP3A 3LS4H 2VKWA 1D6EB 1HQ4B 5ACMA 3DIFB 1ADQL 4YDKL 4LHJB 2CDGB 5KZCB 1ITCA 1M4KA 1XF4A 2JCCF 1PW3A 2G5BB 2R0WL 4Z9KB 2HG5B 3P0VH 5SWZE 4V1DE 4LP4A 5CCKL 3Q1SL 1FG2B 1RZGA 2P47B 3VGBA 5FB8A 3DV4B 4IRSB 4Y5YB 5DHYA 3KPPB 4R96A 1FSKB 3DO7A 2VZSA 5CSGA 5CZVH 4ZAKC 5FXCH 1UWGH 3D0LA 3ROLA 3O3DB 2E3VA 2OZ4A 5F96H 4Y16B 2MQ3A 5F72S 3ARBA 1MCPH 4GRLA 4NN6C 3T8XB 4P9ML 4OUOA 3KPRE 3CK0H 3HHRB 3BW9A 1A0QH 3S34L 4GRMB 5I6XC 1KF9B 5IWLC 2CRIA 3RGHA 3PQYA 5KAQF 3QXDA 1R3IL 1R5WB 5DMKA 3LEVH 4NP4L 4KGLA 1ZS8A 3ILPB 4LIQE 3T0ED 3T65A 2OMNA 2CGRH 3OF6A 4KK5C 4F58H 2COQA 3ARSA 2YPLD 4G8FB 2ATPB 1EZVX 2G2RA 5DJ6B 3IJSB 1VFBB 2Z4QB 3A67L 3SDCA 1ZVSA 3FQUA 1ETZA 4KMLB 4JQVA 3ELAT 1YDPB 5J9PA 4M9OA 2VRAA 2O5ZL 4QRPD 3ULUE 1KEMH 3JV4A 1J11A 2P44B 3QIBA 1JGVL 2WSKA 4EI5A 4LMQI 1AH1A 3HC0A 2PYEB 4LEXL 1FDLH 3SKJH 1IC1A 4B53A 1X5XA 3EYVA 4MQ7A 4D9RD 1G7JB 1KIQA 2ZOKA 1QQDA 2VL5A 1EGJL 1HSAA 3GGWA 5E6YA 4ZO8A 4PJEF 4LNVA 3RY6A 1IGIH 3MRIA 1RIVL 4MDJA 2V7HB 3PV6A 2BNUB 3H6JA 4LCWB 1TQCC 4RWHA 4HC1L 2EKSA 5EZJA 4UIMB 5I8EB 5C70A 4ELKA 5KJRH 3OWEA 5C0CA 4UAOC 3O41A 4KY1H 4G42A 4MA3B 4KV5F 3L1OL 4P48A 3F5WA 3BZ4B 2E8ZA 3IDIB 2CLRA 1F8TL 4RAHA 3OV6A 4K9EH 4GBXB 4KPHL 3FTGB 1CQKA 1SJHA 3GMQB 5ALCH 2RJMA 3RWJA 1EUUA 1I8KA 1OGAE 4P3DA 4PRIE 5TGBA 1CDCA 3MYJB 2F54A 5H37H 4R90H 1G7QA 3BPCA 1QBBA 1MLBA 1FFNA 2X1XR 2ZJSH 2I24N 3WJJC 2YN5A 5IVOA 4WI6A 2OR9L 2AJUL 1G9EA 1HN1A 4P2RE 4Y5VA 4YHOH 1UADC 2OP4H 1AQDA 1NEZG 4U3XA 1BLNA 1ZV5A 1UM6H 1KGCE 1ZGLA 3VXNA 2PUQT 2BVYA 1RZGB 1JUFA 4JFHE 5FB8B 3BOVA 1DANT 5DHYB 1TENA 4R96B 3G9VA 4LMQE 3D0LB 3DJ9A 3U4AA 4XXDA 1V05A 2VYRE 2BVEA 4S0SD 3ARBB 4GRLB 3P4MA 1IL1A 2Z91A 4JG0H 3WUWG 1FNGA 3BW9B 4JRXD 3C5JA 1CVRA 5FKPA 5EU7C 2G75A 3PQYB 5E6ZA 2FBJL 4DVBA 3QXDB 4PGBA 5D4QA 1AXSA 1P69B 2PN5A 4JEGB 5DMKB 3L7EB 2AQ1A 4RSVA 4G7YL 3QUXD 1ZS8B 2V5TA 2VXSH 2X6MA 2VJXA 2R2HA 3CXHK 1JWSA 1K8IB 1BAFH 1YUHA 3S36L 1QBLL 5FCSH 2BSRA 5CFHA 2D4DA 5JHDB 2HJFA 2HRPL 1IAIH 1WFOA 4H1LA 5SX4I 4N9OB 1OHQA 3TJHD 3U1SH 1ZMYA 2G2RB 4GXUM 3BXNA 4DVRH 1UWXH 3TZVD 2DM4A 2VE6A 3SDCB 4K94H 1YC8A 1ZVSB 3FQUB 1JNHA 2CXGA 2GTWA 3STZA 3SBWC 4F80A 3MJ9H 5J9PB 4NCDA 4X6EA 5M95B 1WUNT 4I3SH 1PY9A 1Q0YH 4PS4H 3JWOH 1WIUA 3JV4B 4PLKD 1QLEH 3QIBB 4TYUA 4EI5B 2O26U 3HC0B 4Z0XA 5FCUL 1HCFX 5AZ2H 1VPOH 3VG9B 1DFBH 1BVKA 4XCNA 5F1IB 4BK4A 3EYVB 4MQ7B 3VI3F 2V5RA 2DQEL 4YFLI 2AK4E 3B9DA 2ZOKB 5C0EB 1QQDB 3MV9A 2VL5B 1N2RB 1HSAB 2QSCH 3GGWB 4OUUA 3TJEH 3ZE2F 4BZ2H 1UKSA 4PTTA 2AEPH 3QWRA 3MRIB 4Q0XL 1ZT7A 4RIRA 4WV1C 4KKCD 2EKSB 3MRFA 1B0GA 5EZJB 3MFFA 4X99B 3W9EA 4ELKB 5C0CB 3O41B 1YMMD 1X4XA 3IS0X 1MRCH 4G42B 1YJDC 2H41A 4MCZB 1U3YA 3F5WB 4RFOH 2F19L 3T3ME 5CP7B 4NFDA 3VFUB 2CLRB 3GSNA 1H3PL 3J8F7 2VLKE 1I7ZA 4PRDA 3BPOC 1J18A 2IANA 4J1UA 2DDQL 4YC2C 5JLZA 1HI6B 1I9JH 4ISVA 3AS0A 2W07A 3C60A 4U6YA 1SJHB 3QDGD 4GRWH 4ZOCA 3RWJB 1I8KB 4LF3B 5C9KA 1I75A 2PYFA 1MHPH 4GG6E 1JZ4A 3TJHC 5TGBB 5J3HD 1IC5H 2F54B 5LAXA 1SMOA 3PHOA 1G7QB 3BPCB 1MLBB 4G3YL 5HHVL 1HHJB 1CDUA 5D7SH 4MYWB 3DX7A 1S5HA 1H3UA 4Y5VB 1UC6A 1I3GH 3ECBA 1AQDB 2Z8RA 4PLKC 2XZZA 1KCRH 4TSCL 4JO1H 2BMKA 4NKMA 3ARGB 1ZGLB 4OM1H 3VXNB 5I71B 1Z6JT 1JUFB 3L5JA 1MLCA 4LASL 5D8JL 3S35L 2VAAA 1A7QL 5ESQA 5CKAA 3MV8D 4NZTL 2B0SH 4JN1H 5KVGL 2X1OA 2NY3C 4MZ3A 3V6OE 4JB9H 1D6VL 3P4MB 1MELA 4QRRD 1TJIH 2Z91B 4BM7A 1FNGB 4WFHE 5FKAA 3RZCA 5FYKU 3C5JB 5FKPB 2A9ML 4J4PD 2G75B 3KJ6L 1A3LL 1CGSL 1G9NH 4DVBB 4PGBB 3D6GA 1VB9A 1VERA 2DQTH 4HG4K 5EOTA 3BKCL 3CU7A 4N1HB 3CFKB 2WUCH 1OAUH 4P4KD 4AYFA 2DTMH 5FFLA 5BRZE 1RFDL 2R2HB 2EDFA 3AVEA 5D2NE 1JWSB 1RU9L 1YUHB 1Q0XL 1KCVH 2BSRB 3KNBA 1PFCA 2HJFB 4QHUA 4KRNA 1AR2A 3WKNA 3BD4A 3BXNB 4L3EA 2VE6B 3SDXF 3REVA 1EVUA 2JJSC 2GTWB 5FUCE 2BFVH 4LHQB 4N9GA 5EIVA 3MRHB 3STZB 4OCXL 5J3HC 3I2CL 3MLYH 4X6EB 3WFEH 4JZOB 1OWRM 4QYOA 4P2QA 2ATKA 5CWSA 4NO0D 4Z0XB 3OB8A 4XCCH 1OSZA 5TE7H 4XCNB 4HUUA 3VMPA 1IGYA 3MV9B 4ODWA 4HIXH 1F42A 1W0WA 4EKXA 2F53A 4OZFG 4PTTB 5KS9E 4RCAA 3WIIL 4M7KH 2EDRA 1ZT7B 1BD2A 1Q1JH 1T21A 3PP3H 1T1XA 2NPLX 1NMBH 3MRFB 1B0GB 2MSPA 3MFFB 3W9EB 1SBBA 5E8PA 1S7SA 2Y23A 1CG9A 4QY8B 3KPNA 4J4PC 3MRRA 2APWA 1RUAL 3SGJC 4UIKL 3GK8H 1HILA 1T5WA 3ZT5A 3G08B 3GSNB 2WBJC 1MNUH 1I7ZB 2M26A 3HFML 4PRDB 2IANB 4J1UB 4OCMC 5JLZB 2XZCH 4YIQA 1Z0NA 2B8OT 5EG6C 1ORSA 1ZE3C 3IDXH 4PJ9C 4ISVB 5HPMA 3C60B 4U6YB 1IAOB 2CKBB 2PYFB 3MZTA 4PRHD 3BPLB 5I1CH 3KXFD 5LAXB 1U41A 2PO6A 1NUGA 1KXVC 3PHOB 4ODHH 3T4YA 3ZO0A 1MCBA 5ACZA 5T1LA 2EDLA 4C55A 2ADJA 3EYUH 5F6HJ 1W2KT 1F90H 1NCCL 5JTWA 1S5HB 1RURL 1I9IH 4ONGL 4C56A 3ECBB 2UZXB 4JFZH 3N1FC 4NKMB 3WIHA 3QEHA 1TXKA 1CL7L 2GY7B 2O93L 2F8XC 1MLCB 4S10A 3BKMH 5ESQB 4TSBL 3IKKA 1B0WA 3WE6B 4HX1A 4P5TA 1RIHL 4YBQC 3R1GH 1D5IH 3UEZA 2CD0A 3EYSL 3WLBA 3K4DA 4Z7NE 5L2KE 4GJTB 5SV4A 5FKAB 3RZCB 1L9MA 4YXHH 2DQGH 5ENWA 4LAQH 4X6CF 2JELL 3V7AE 3KPTA 5FDWA 1S78D 4HWBH 5EOTB 3NCJH 1JZ7A 2LAGB 3LIZL 2FD6L 1GOHA 1MFEH 1FNFA 5F7KC 3UJIH 4Z7OE 3BT2H 1K85A 2J8UF 2YD4A 4DQOL 3ARUA 3J7HA 5I1IL 1SJEA 3OR7A 4UT6H 1ZANH 3O6FC 5F88A 4DGVL 4L3EB 2QSTA 1EFXD 4HS8L 1KB9K 3REVB 4K2UL 4M8VA 2J88L 4N9GB 2EXYD 1BHGA 3GBLA 4Z0BL 1WK0A 1V7ML 3V5HB 4XHJD 5EUKA 1MIEL 1S5IH 4QYOB 4P2QB 2ATKB 5CWSB 1MHCA 3ZL4L 2UY6A 1FC1A 1OSZB 2E7HA 3PIQA 1IFHL 4KDVA 4HWUA 4G9FE 4XHQA 4HUUB 3NABH 1CICA 5B38G 1VA9A 1IGYB 4RGMC 1X4ZA 4ODWB 1CR9H 1AFVH 1JP5A 4OQTA 1IT9L 1W0WB 3SKNB 3ME0A 3B5TA 2F53B 3TF7C 4PRPD 1AQKL 1J8HA 4KROC 4M9PA 1BD2B 4PJIF 1A1OA 1T21B 2M8XA 4TTDC 1T1XB 4FQLH 3Q6FA 5E8PB 3I3DA 1CG9B 1A7PL 1Q9OA 3GHEL 3KPNB 1JPFA 1A6ZB 2ICES 3S37L 4Q9CA 2Q6WA 1EHAA 1HILB 1T5WB 3QR2A 4TVPH 2C3WA 5C07A 1DLFL 2Z9TA 4YIQB 4NQEA 5IB2B 2BC4A 3GSWA 4OFYA 1ORSB 3D39B 5JOFA 4D2NA 1DEDA 5ILTH 1JTOA 2E9BA 4IOIB 1KEGH 2X4PB 3V0AC 4KU1A 3OB0K 4YPGA 2PO6B 3T4YB 1AD9A 2RFXA 5ACZB 5T1LB 1WLHA 3BMVA 2ADJB 2XTJB 2I07A 4XP4L 4HF5H 3MBED 1UVQB 5INDA 4I18B 4XHJC 4C56B 4TN9A 5I1EL 4G6AC 1QFPA 3N85H 4ZSOE 4WCYL 5SWZD 4V1DD 1P4LA 3QEHB 3F65A 3BN3B 1CD0A 1RY7B 4J12A 4MAYA 4XNXL 2V5YA 3QUML 1H0DB 4PJXF 4HX1B 4P5TB 5C71A 1U95A 4R97C 1KIPB 4WGVB 5F9OH 4XP5H 5IEKA 5FHAL 2O5YL 5H37G 3WLBB 4OF8A 2R9HD 3ARVA 3KPRD 5F7WC 4PJ5B 1ZT4A 4X9IA 4MB4A 4AJ0A 5ENWB 1AI1H 1O0VA 1KC5L 5T1DH 3LRGA 1X6LA 2FEDC 1C16A 1NAML 5FDWB 3O6LL 1EV2E 5ADPH 4Q9RH 4J3XA 2FL5A 2EDNA 1WT5C 4JJ5A 4KJWC 4ODSL 4JY5L 1R6VA 3N1QC 1MF2L 1SJEB 5KSUA 1RZIB 1KB5A 5BW7A 3OR7B 2YPVL 3MUGB 2NR6C 4WU5A 2VIRB 5F88B 4JO2L 2HN7A 5TF0A 1PLGL 4ENED 5JOEA 1G1YA 1NFDE 4F9PC 1M1SA 5K9QI 5CKGA 5D5MF 1XZ0B 3PWNA 5EUKB 2V2WA 3ULUD 3F7VA 3QWQB 3CH8A 4OZGA 2VXUL 2FX7L 1UEMA 4RQQA 1MHCB 2O5XH 3NVQA 6FABH 2YUXA 1BWWA 3OJ2C 5IBLD 3MBEC 1UM4L 3H8NA 3PIQB 5ELIA 4LRIA 4ZO7A 5EZLA 1YEJL 2B1HL 3S4SB 1CICB 3O2DL 1KLFA 3VFSB 4OZHB 4Y4FD 1I85A 1R0AH 3UP1A 5MERA 4KAQH 2PXYD 4OKDA 5IESH 1RPQA 1J8HB 1A1OB 4RGOL 3WNOA 1X6NA 5DK2A 5JXAH 5HVGB 5TFSL 3Q6FB 5E8EA 5E6ID 4HD9A 4UV7L 4EXKA 5L9DH 5CEZL 1Q9OB 3O8XC 3OAUL 1JPFB 4XVJL 1F00I 2R0KH 1WITA 4PJ7B 2Q6WB 2HFEA 4JCLA 2JJWA 1AR1D 1KENL 5B8CC 5C07B 1MFCL 3DVNA 2ZUTA 4M7ZC 4NQEB 2UVFA 2BC4B 3GSWB 3CFIC 1GGBL 3LB6C 4NT6A 3VA6A 4LSDA 1JPGA 4KH2A 1VDGA 4X98B 4Y1AA 2AEQL 5JOFB 1UWEL 4U49A 2PR4L 4JFQA 1OGAD 4PRID 3SDDD 3VD9A 4MNGE 1LP9E 1X5JA 1I1AD 1BF2A 1KFAL 3PL6D 4OSUL 3WNKA 4MVBD 4YPGB 1AD9B 2RFXB 4OBSA 4UQ2A 1LE9A 2Y4SA 1A7OH 1CXLA 4PJAB 1XF5A 1H3WM 4ODUA 2I07B 2V17L 1DLHB 5INDB 1OTTD 4P2RD 5CP3A 3MJ7A 3SCMD 4LHUD 3ULUC 4KK6D 3CIQA 4R2GB 5HBBA 5C0JA 1MWAL 4W4OC 1Z2KA 1BGXL 1KGCD 1P4LB 3QWOB 1PKQA 5F3HA 4JFHD 5IBLC 4MAYB 5B4MD 2HYMA 3H9SB 1RIUH 4YHKH 3ZHLA 1F97A 2DJUA 2OJZL 3O9WA 5GGTA 4AEIL 5K59F 1U95B 3PF2A 4K8RC 5IEKB 1BEYL 1T2QL 3WHXA 4JFFA 4ZFGL 5DFVD 1A7NL 1T2JA 2ICEA 3EDKA 3P3YA 4JM2C 1ZT4B 5IT2L 4H88H 1C16B 1DANU 1MCQA 2A6KA 1T83C 3G04A 3OGCA 4TNVK 5F8RC 4JPIA 2EYSA 3WFBH 4D94A 3VFGL 3U7WH 5HGGS 4G6JH 4OLUL 3ARZA 1CGVA 4FXLA 4JJ5B 3S3SA 5FGBA 3HI6L 3BD5A 3QULA 2VL4A 3BIKB 5KSUB 15C8H 2Y06L 5J56B 1KB5B 3TBSA 4KZDL 2WP3T 1S3KL 4WU5B 4EIGB 1MHHA 1BOGA 4MA1C 2FECL 5IG7A 4OLYH 4KKAC 5FYJE 5FO8A 1I1AC 4L9LA 1S9YA 1TETH 4OM0L 3PWNB 2V2WB 5EBMA 1FPTL 3F7VB 4OZGB 4DK6A 3RA7L 1J5OL 3PXJA 4PBWD 1XAUA 4RQQB 3WFCH 5BV7C 5DS8A 1FGVH 4M1GH 1CDJA 1FL5A 5CJ5A 3KGRA 2G60H 2VN7A 3K1DA 5CSBA 1O7SA 1B9ZA 2MNUA 1MJUH 3RY5A 2VISA 2AK4D 2W65A 2EE2A 1OAXH 5B4MC 4KTYA 5DD1H 3MLUL 5MERB 3RIAK 1J0YA 5F97E 4HH9A 2PYEE 3C09B 3X12A 3UO1H 4Y4HA 4HJGA 5DK2B 4J6RL 2X70A 4H1LH 3QUZA 5HD8D 5DFVC 1RMFL 3O2VH 1J7VR 2IBZX 5E8EB 2WV3A 4I0PC 2DIJA 1U3HC 2DQFB 3T0XA 4AIOA 5I15L 1VSCA 1II4E 3DGGA 2LABA 3NA9H 1BBDL 4NYLA 4K07A 4LCWE 3TCLB 2VLKD 3M1BA 5KVEL 3DVNB 1MQKH 1CDGA 4NT6B 1I1YA 1JPGB 2XY2A 4Y1AB 1JNLH 4K71B 4JFQB 5GSRB 1IGCH 5HY9A 2ZKHH 1FYHB 3AM8C 2GTZA 4NQCA 4UQ2B 5DD0H 4U2YA 1QTYT 1LE9B 4AM0B 1XF5B 4ZUTA 4ODUB 4YK4C 5KOVC 4XVTL 2BJMH 4F15B 3UMTA 4XZUA 3MJ7B 2NY2C 2X09A 3TBWB 5C0JB 2D3VA 4Y8AA 1DEEA 2YRPA 3HE7C 1PKQB 4XVSH 4F8TA 4ALAH 5KTEH 3BIAX 4L3CA 3I85A 3O9WB 1MCHA 5DD6A 2EDKA 4ONFH 3TA3C 1MCKA 3BDYH 4IRJC 1TJGL 3WHXB 3AS2A 3GSNH 2VQUA 4JFFB 2ICEB 3CVHB 5JA8B 2YD8A 1UH4A 4FRWA 4WFHD 4XT1C 4WO4D 4LSRL 1RV6X 3C2SA 1QSEA 1B4JH 2GY5A 1JGUH 3G04B 3OGCB 5L8KB 4X7SH 3MRLA 2EYSB 3BWUC 2FH8A 2EH7L 5AG9A 1XGYL 4IMLA 3IETA 5BRZD 5I8KL 2V9QA 1FFRA 2L4OA 5I74B 7CGTA 1IAKA 3D9AL 1Y6NR 3PQYE 3TBSB 3FRPG 3VJ6A 3S5LA 1MHHB 4HKXA 1BOGB 1YEIL 1IC7H 4IDJL 1JBJA 5IG7B 1JHLL 2OMBA 5FO8B 4M5YL 3MRMA 3R8QA 4L9LB 1S9YB 4PJHA 3ALXA 4ELMA 1J1OH 4ZXBD 1U8OA 5JHDE 4XNYH 3HA0A 1JGDA 1P84K 3VMNA 1IRAY 4HLZH 5FV2A 1MHEA 3HCVA 2NY0B 5DS8B 4I0KA 1FL5B 2CK0H 2J5LC 5GGVL 1PJ9A 2NNAA 4OFVA 2FHBA 2VISB 2W65B 4NRZA 2EO9A 3T3PE 1DQMH 3FRUA 4BFBD 2P46B 4RMSA 5D1QD 4XNMA 3NCYP 4HH9B 1SYSA 4XTRD 1JNNH 4LARH 4HJGB 2XG4A 2X70B 2B5IB 3B2VL 3QUZB 2AJSL 4N0CC 4XPAL 3MR9A 2PTTA 2VOTA 3CFJA 5BJTA 3L5XL 1GGYA 3WN5A 3DRTA 4XWGL 1H8SA 5BVJA 1HWHB 4I77H 4NYLB 3CXDH 4W6YB 5GRYA 4JR9L 3RKPA 1DQQA 2LU7A 1FORL 3M1BB 3HPJB 4U1GC 4OB5L 3NACL 2J6EA 3UTOA 3HAEH 5C0CE 5IROA 4JDZA 3S36X 1EJ6A 1C7TA 1KPVA 4U2ZA 4OZIA 1FO0L 1T66C 4GAJL 5HY9B 1IM9A 3RX5A 3RX7A 3UTZA 5KOMC 2GTZB 2D0HA 4NQCB 5HGDA 3T0DA 2W91A 4EEEA 2WLZA 5CGTA 4LIQL 5HYSG 4PJCA 4Y2DD 4ZUTB 1OAKL 2DQIL 4Z5RA 1LILA 2Q76B 1FIGL 4XZUB 4RWYL 3EJZD 1JJUA 4ZXBC 2JB6A 4LPCA 4ZOAA 3BRFA 4WDIA 2ZUUA 1ZA6A 1DEEB 4M03A 4JLRA 2F54E 5GZOD 2AP2A 1JHTA 4K23L 2VC2H 1RJZA 4M48L 3K1KC 4L3CB 1RUPL 3C6LD 4XMKH 5DD6B 3I9GL 4OAWA 4OD3H 1WTGT 3HS0A 4K9EC 1NMAH 1X5LA 3JXAA 3MODH 5D6CA 3FO0L 1LD9A 5D1QC 5L2KD 5F9WB 1H5BC 1OY3B 2HKHL 5EUOA 3TBVA 3BSZH 1NC4D 3OHXB 4JFPA 3UAJC 1QSEB 3FAXA 3UTSA 1G6RH 4JFDA 4DN4H 4NHCL 3MRLB 4IMLB 5DT1H 3IETB 5IQ7H 5BZDA 2P5EB 4RFNC 4WUKL 3MRBB 1IAKB 3EJJX 3K3QA 3I6LE 4JFYA 4YBHA 3WDIA 2DI7A 3VJ6B 1EMTH 1EIBA 1WEJL 5DJXA 3S5LB 1C5BL 4QGTA 4HKXB 4HKJA 1P4IH 3WIHH 2Q1EA 4X7TA 1F11A 3UROR 3VRJA 4P23B 5FM5M 3O4OC 3QRGL 5JIKA 3MRMB 4Y4KA 4EDWH 3GIVA 3JV0A 5C86A 3OL2A 3LN4A 3P9LA 4PJHB 4ELMB 1U8OB 2GKIA 3WHE0 1J0JA 1CDHA 4XP9L 1JGDB 2R8SL 1MHEB 3HCVB 4KKBD 5DEZA 4WWKC 3CSGA 3G6DH 4ZMAT 3EJZC 4PD4K 2UWEF 4G9FD 4FQXA 3LKSA 4OTXL 4TPRH 4CMHC 2NNAB 1DSFH 2OM5A 4KQ3L 4JHAL 4O4YL 3TGXA 3Q5TA 3BFOA 1A3RL 1IBGL 3QO0A 3NCCB 4NM4H 4NRZB 5GZOC 1W72B 1HKLL 1BREA 3FRUB 4YX2H 2B2XL 3C6LC 1OCWH 5BV7L 5IMOA 3S35X 4XNMB 3EYOA 3M17A 1SYSB 3ZKQD 1YEFH 2NY4B 5J4MA 3HMWH 3LDBB 4M43H 1F4XL 3SGEH 2H3NA 1UGNA 4HBCH 3MR9B 3CFJB 5BJTB 4K94C 3HB3D 3MV9E 3H2WA 4M6MH 4NSKA 3DRTB 2RCSL 2ESVA 5JW3H 3QIWB 4OLZH 5BVJB 1QFUL 4K7PH 1IKFH 2FX9L 3EDJA 4YGVA 2ZCLH 1DQQB 3K2UL 3MMEA 3B9VA 3JWOC 5EU4A 3M8OH 4OF6A 5F7EL 4OGAC 4HCRL 1WZ1L 3D2UA 3P40A 1QHOA 2YPKA 5AUMA 2Q7YA 4C59B 5L7XH 1KPVB 2F58L 3TYGH 4OZIB 3GUTA 3IXTA 1KTRL 4ZUVA 1WTLA 5HGDB 3WDHA 2LFGA 2IANE 4OQTH 4PJCB 3VWJD 2DYPD 1F4WL 5M94B 1WIPA 4DUXA 3I75B 3L3OA 4ONOA 4YUEH 5A2KH 3WIFA 2JB6B 4TRPL 3OB0H 4Z7UA 1X5ZA 4WDIB 4K3DL 1ZA6B 4JLRB 4U6HB 1JHTB 1DVFA 1DE4A 1RJZB 1QFWH 4KQ4H 4P0DA 2CLZB 2EYTB 1FNEA 5C0DA 2VDMH 1GAFH 3P11L 1N0XH 3U0TA 3F58H 1MFDH 3PWUA 4OLVH 3VWKD 5DURD 1AJ7H 5ABDE 3QUYD 4FQHA 5D6CB 1LD9B 2D9QB 4X9BA 3I02B 2X9YA 2F8VA 4FQ1L 3T3MF 4X6DA 4RDQF 4ZQKA 5EUOB 4JFPB 5CJXC 5IFHL 3CMOH 4NN6B 1C1EL 1YEEL 3UTSB 3LOWA 4JFDB 5HYEA 3O4LA 1OM3L 2HVJA 1HWGB 1IGTA 5I6XB 1A1NB 5KN5A 4ZO6A 3DHJA 3RVVC 4GG6F 3E3QE 1K6QL 3ARFD 5BZDB 1LO2L 1QPXA 5TE4L 3E2HC 2X4UA 4TVSa 1MCWM 4PB9L 2OI9C 4XXCC 5DJXB 2MCPL 5J6GA 1KELH 4HKJB 3KYAA 4POYA 3FHAA 3OKNA 5T1KD 4X7TB 1F11B 5TQ0H 3VRJB 3EHBC 4PG9A 1SY6A 2VLME 2R4SH 5EU6A 3MLXL 4Y4KB 5LJYH 2DBLH 3P9LB 1UB5A 2L0DA 1DBBL 1ZEAH 1CZ8H 5EC2A 5IMLA 4L3EE 3SBWA 3WFHA 3FKUS 1BMGA 2NW3B 3NH7H 4XMLH 5DJ2A 5DGRA 4NZRL 4LCCA 1KLGB 1G9NC 3EOBB 4LRNL 4FQXB 3LKSB 4MS8C 2DN7A 4UT7H 5FHBH 5I30L 5E7FA 3V4VH 4YFLF 1FRGH 1RZFL 4JO3H 4P2QE 5EOQH 2EC9T 4MA7L 5IMOB 2XT1B 3M17B 5FO9A 5LBSH 5CJOH 2AQ3A 4DW2L 3LSOB 1N26A 1CIDA 4HJ0D 1NLDL 2H3NB 4NZJA 3QUYC 3CXHJ 5F9DC 3SDAD 3GSQA 3SOBL 5C8JA 4NSKB 1NBQA 4JG1H 2F53E 3TBYA 3W9DA 3EDFA 2QLVB 4YGVB 2CGRL 1AE6L 4UAOB 1KPRA 1BD2E 3MMEB 5EULV 1T3FA 2GFBA 5EU4B 1IARB 5DA4A 5DR5L 25C8H 3MRJA 3D2UB 1E4XH 4AEFA 1QRKA 4QNPE 4HFUH 4IBLT 4M1DH 5AUMB 3V79C 2Q7YB 5LXGL 5KBNC 4O2CA 1BJMA 1OL0A 3B8SA 3KJ4B 4F9LC 1YEKL 3IFLH 3LS5H 4H1LG 4WNQA 3GUTB 1U8LA 3IXTB 4ZUVB 5SWSD 1KEML 2FATH 1NJ9A 4EN3C 3VFMA 4A6YL 3DRQA 2D0GA 1YPZA 3QPQD 4OCNC 1LK2A 3VFTA 3ES6A 1GIGH 3WIFB 2YRLA 4OGZA 4Z7UB 3QIUA 4JGJA 4LLWA 2DMKA 3IFPA 4OJFL 2M2DA 4TSAL 1JWUA 5FYLH 1DVFB 4EZMA 5KS9F 3H3BC 1DE4B 3VU2A 4U6VH 4PRNA 1IGIL 4CADA 2XTJE 2I25N 3MUJA 4G8EA 1FNEB 5C0DB 1NCDL 5KZCD 3U0TB 4N8CH 3PWUB 3IDMA 4C56E 2W9EL 1LDSA 3RX8A 1UZ6E 3VXOA 4P4RA 4FQHB 3ZYZA 1T1YA 3L3IA 4X6DB 2ENYA 4ZQKB 2ZCHL 3ROOB 1XT5A 4IRSD 4MCYA 2ADFL 5IB5A 5HYJA 3SDAC 4JPVH 2KBGA 3E6FA 1FVCA 4HBQA 1J86A 4KJPD 1IGTB 4OGYL 3E8UH 4Y16D 5KN5B 1WAAF 4AT6A 2XIDA 4TOYH 3F6LA 3WDJA 4PJ5E 3S37X 5ALCL 2X4UB 1REIA 3QNXA 5CP3H 4NC2B 5GSVB 1INDH 2F15A 5J6GB 4OLXL 3D85A 3RPKA 3S88L 2ZJSL 3HNVH 4FABH 1FNLA 4PG9B 5FYJD 1M6OA 5EU6B 2AI0L 3UYPA 5GGTH 1JFQH 1UB5B 2ZG1A 2JJSA 1TDQA 3PWPB 1GPOH 1MAMH 3FQRB 1UM6L 5EC2B 5HTSA 3OSKA 5IP4A 3QA3A 3P30H 5IMLB 3WFHB 4IEFB 2OL3A 2MJWA 5DJ2B 1KULA 4LCCB 1HH6A 1N6QH 4FQCH 4PJ8C 3W5MA 2A77L 4RA0C 3VXSA 4Z7NF 3WKMH 4FQ2L 3QB7C 5FUZH 1NCWL 3KYKL 1OD7A 4HG4J 5JQ6H 5FO9B 5CIPA 4EUPA 3ILQC 2PYED 2YEZA 2F5BL 3CZJA 5K9JH 4OCWL 4HLZG 4Z7OF 5C8JB 4WV1B 2BHUA 2VAJA 3LPWA 4OZHE 5D72H 4U1JA 5EOCH 4Y5YC 4NFCA 2A0LC 1FBIH 1FSKC 3TBYB 3TCXA 3W9DB 1J8HE 2RQ8A 1V7NL 3PDOA 1KPRB 1P5UA 1AIFA 2FBOJ 5CS7A 1UYWH 4LCWD 5E8DH 4HULB 1T3FB 2GFBB 1L4IA 2H2SC 4GS7B 1LO3H 1N4XH 3B43A 3MRJB 3SGJA 2UUDK 5BO1L 4XPGH 2WBJA 5D9SA 4NCC1 3RUGA 3BPOB 4O2CB 4YC2B 3RI5F 3V8OA 5LQBL 4KZEH 4PJ7E 1BFOA 4S11A 4PJ9A 1A02N 3T77A 1U8LB 4YXLL 1NJ9B 5C07E 4X9GA 3VFMB 2DL9A 4NQEE 3WD5H 3STBA 1YPZB 4G6KL 2YMXH 4QXUH 4GBXD 1L6XA 3VFTB 1RK0A 3ES6B 1F4YL 1K3IA 3IJHB 3QIUB 4LLWB 3IFPB 5EDXA 3TNMA 3WS3A 3WO4C 4X6FA 4ORZC 1JWUB 3V4UL 1H3XA 2VDKL 2QSCL 3HAEG 2NY5H 4PRNB 1LO0L 4CADB 4WENB 3QUKA 5HHXL 4G8EB 3VFVA 3JV6A 4RZCA 3ORJA 5CBAA 3IDMB 1VFOA 1GC1H 3VXOB 1IAIM 1F3DH 3VFWA 1DQJA 1T1YB 2NY3B 4G5ZH 5FGSA 3BP6A 3GHBH 3U4EA 1WZMA 4YE4L 3H9SE 3B5HA 4MCYB 5IB5B 5HYJB 2FDBP 3MV11 1YMHA 4POUB 1WICA 1FVCB 4P9HL 3NCEB 1PSKH 3A6BH 1X5AA 4AT6B 1Y0LA 3ARBD 3FB5A 4GRLD 4YHMH 3BP4A 4N1CA 4L5FL 1IJ9A 3NTCL 3QNXB 3W11D 3PQYD 8FABA 3GJFK 1EHLL 1DBMH 5JZ7C 2P4AB 1D9KC 3D85B 4U0RC 2X4SA 1I7RA 5GQBA 3MTRA 5DI8A 2IQ9H 3O6FA 1M6OB 4JQIH 1JPSH 3HC3H 2R39A 4HPOL 1MCSA 3OF6D 4WI3A 4MAUL 2LVEA 2D7MA 4PV8A 5E2TH 3EO1A 5JHDD 2Q8AL 5I1KH 3VGAC 1PG7L 2K9UA 2BRRH 2OL3B 2GUOA 4X4ZA 3HNTH 4ZUUA 3SDCD 3I84A 2AABH 1HH6B 3H42L 2DD8L 5E9DA 3RWEA 2R1YA 4WU7A 5IF0A 3VXSB 3DYMA 4GLRI 3OAZK 1JYWA 3UX9B 2A9NL 4TNVF 4OZGE 3SHSA 1UJTA 2BSTA 2XXCB 3QIBD 4EI5D 2YD1A 5CIPB 2CMRL 4EUPB 1QBMH 2YEZB 4J3SA 1OD9A 3VGHA 3W81A 3CDCA 5MEQA 4FQJH 5A16B 4PGEA 1NFKA 3UC0L 1OAUL 5FDYA 3GI9L 4U1JB 35C8H 3U4BH 4NFBA 5JQHC 3JWDH 1KCVL 3PDOB 4WHYH 3S6CA 5IB1A 1RVFL 1AIFB 1WF5A 4PGJA 3G6JA 2R69H 3ARBC 4GRLC 2Q7NA 1N64H 5J57B 5DD3H 1NFDF 5FYLE 1MFAH 1PX4A 5C0CD 1INQA 2WBJB 5D9SB 5AYUL 3RUGB 2BFVL 2EIBA 2AV7B 4HGWA 1OAZL 1I7UA 3W11C 1VEMA 2C4FT 5CEYA 2DB8A 3MLYL 4PJ9B 1JF6A 3T77B 3ZYIA 5KSBF 4H20L 5AWNL 3IYLW 2VABA 3TO4C 4Y1AE 3QCTL 2ZSVA 2IGFL 4M5ZH 3WS3B 3TNMB 1YY9D 4X6FB 3CX5J 2F54D 4ZTPL 1RULL 1NCUA 3FO2A 3MC0A 1B88A 1WQVT 3QUKB 4G8IA 4Y0GA 3VFVB 1RUMH 3JV6B 4RZCB 2F5AH 5CBAB 5L88L 2WAHA 5EPMA 1WCBB 1NMBL 1QKZH 1WFUA 1Y6KR 1RZJL 3BKJL 3ULVH 3QIBC 4YWGH 1DQJB 3VFWB 3ARGD 1OVZA 1PKQE 1NEZA 4H26A 3U4EB 3TH3T 3VG9C 1GGUA 3MRNA 1UM5L 1YMHB 4LCIH 2QKIA 4URTB 2XZCL 4JFFE 3IFOA 1Y0LB 4LPWA 3FB5B 4Z8FL 3RY6C 3BP4B 1TZIA 2XPGB 2B1AL 5EZIL 4UINH 4DN3H 4ZO9A 3WUWA 3I6LD 8FABB 3KYOA 5I1CL 3X17A 4PJFF 4ODHL 4DAGH 2C26A 2BERA 1MCNA 5CZKA 1FNSH 1DN2A 1K2DA 3L3KA 5DI8B 5FO7A 5FF6B 3O6FB 1MCEA 1ZSDA 5I1HH 5HYIA 3F6IA 1I9IL 5C2BH 4DCQA 1J1XH 4XPFH 3EO1B 4LQFH 4MA8H 1J87A 2YUVA 1MY7A 4JO4H 4ZUUB 3UTPE 3L5HA 4YDLC 5E9DB 3RWEB 3IFNH 2R1YB 4WU7B 5IF0B 3R1GL 2NYYC 4YNYA 4UT9L 4K3EL 3CLFL 3KR3H 4MJIA 3LAFA 3V0VA 5I18H 3PWVA 2HJKA 2BSTB 3X11A 3ZDYE 4AK1A 5GS2H 1CN4A 4RGMB 1ULVA 5J1AB 5HDBF 4Y5VC 1TJHH 4LKCA 1MIML 2JK5A 5MEQB 1MCDA 2DF3A 5T3XH 4PGCA 4QXGL 4KROB 4WIQA 5L2JA 3X14A 3L3HA 4NN5C 3MV9D 4NQDA 2WP3O 5JUEH 3BT2L 4XPBL 3W39A 3B2UD 3HZMA 1SEQH 1JK8A 1CE6A 1V3JA 5IB1B 1VFUA 4XRCB 2X2YA 3THMH 4XBEH 3G6JB 3NIDE 3QCVH 1PX3A 1FGNL 4XPHH 1CD1A 1INQB 5EBGA 1ADQA 3P4OA 3BAEH 1I7UB 5CEYB 1WFTA 1A8JH 1NAKH 5AD0B 2IAND 5FEBA 2VABB 3BO8A 3E1F1 3VFOA 5F7UA 2CK2A 4HS6B 3WXWL 3VE0A 5T5NG 4D3CH 2IFFL 3C60D 3G9AB 3SE3A 2ZSVB 1X44A 2ORBL 3PGCA 4U1NB 5LG1A 2H9GA 1AFVL 1BVLA 4W68A 4NQCE 2GK0A 2EIEA 2Q20A 4C4KT 4XVUD 4X4XA 4M93C 4G8IB 2C7UA 2QL1A 4LPXA 5FYJL 5D70L 4W4OA 2W38A 5IR1B 1YN7B 4DGIL 5EPMB 1CF8H 2I27N 5EO1A 5EB9A 2D9CA 2JCCA 5BS0A 3MLVH 4Q7DA 1NEZB 2VQTA 4H26B 4JZNB 1A21A 2JB5H 3U83A 1RHHA 5HVHC 3MRNB 4F2MA 3JTSB 4BQCA 2QKIB 4JM2A 5C92A 1RZKH 3VA2C 3IFOB 1UJ3C 4JANA 3ULSA 1FE8L 1TZIB 3SKOA 3RZCD 4FFVC 4HHAA 2QBWA 4MNHA 2PCPA 4JHWH 3WUWB 5ITBL 3KYOB 4MX7B 1QSEE 5IFAH 4WJ5A 1F58H 1OTSD 5FOJA 3LRSB 4CU8A 1U8NA 1AXTL 1YYML 3ZLQC 1EEZA 5GIRA 1AGCA 2ZP0T 3L3KB 1K2DB 2QSQA 5FO7B 1MAJA 1OGTA 2VLMD 2AJ3A 3EO9H 3MGAA 1ZSDB 3TFKC 3ZKND 2AS5M 4DCQB 1CU4H 3D25A 1H15A 5EA0L 4XI5D 3N06B 3F7YA 1RZ7H 4L3ED 4QEGA 1KCUL 3B5GA 4UB0L 3QH3A 5HI3D 1CFSA 4O00A 5I66A 3IRPX 3KVQA 4YNYB 4UU9A 4OD1L 3NZ8B 4PJHE 3BE1H 4ELME 5HDQH 3V0VB 4HC1A 5GXBB 3PWVB 4XVUC 2HJKB 4P2QD 1LEGA 3BEVA 5KW9L 1NGZA 5MEPA 3PWLA 1JMXA 5T1DL 2B4CL 5ERWA 2Q8BL 2XQBL 4LKCB 2JK5B 2IG2H 3TWCH 2A73B 1AGDA 5L2JB 3QNYA 5L8JB 3X14B 3L3HB 4NQDB 1S7QA 1JRHI 1MCFA 4PLJC 4BYHA 2F53D 2DLEA 2NX5A 3BP5A 5F21B 3HZMB 1LK3H 1JK8B 1CE6B 4ZFOA 4I0PA 4OZFA 3HMXH 1BD2D 1U3HA 3O8XB 2XKNB 3LEYH 2I9LA 4PJDA 5HI5D 3SY0A 3MOBH 4JY4B 4HH8A 1P2CA 5K9OB 5F9AC 4HWEH 1GRWA 5B8CB 2H2PC 5HHQA 4P3CL 1T22A 4H8WH 1HHKA 3P4OB 4M7ZB 1ZLWK 5DF0A 1A6VH 1IGFL 3GI8L 1OTSC 3BEWA 2MFNA 5DLML 2XFXA 2OZ4L 5J06A 4DKFH 4RRPG 3UJTH 3ULVE 2HA1A 3BO8B 3VFOB 3FQXA 4LLUA 3FMGH 3VE0B 4K3JL 4ZTOL 1ACYH 4ZUSA 4M62L 4OZIE 1XFPA 3PGCB 3DSFH 5EOCJ 3T3PF 4YBLC 5DQDH 2H9GB 1BVLB 4CRPA 3AC0A 2PO6D 2GK0B 5EORH 5T1LD 3C8DA 2EICA 4X4XB 1QACA 4PJCE 1HIML 2XTJD 4CDGC 5F7NC 3QJHB 4OCSL 4C58B 3VW3H 4C56D 1IEBA 3UZEA 2BCKA 2AKRA 2JCCB 5BS0B 4MXWL 3S96B 2VB5A 1NQBA 3TA3A 4IRJA 4JFEA 5AAMA 1E27B 5JR1L 2Y6SD 1N3NB 3WL9A 2R0KL 3DGCR 1RHHB 2E7MA 4F2MB 3P9MA 1GHFL 4P5TD 4JM2B 3UTTA 1IEAA 3WJLA 1NL0L 3H3PH 3WFDH 4JPKH 3ZT7A 2ZCKH 4JANB 3ULSB 4NQUA 4S1DD 3SKOB 3QQNA 4YXKH 4HHAB 4PJ5D 3V9FA 4MNHB 1FVEA 5EUOE 2PCPB 4EQ2A 2GSIA 2EEAA 1LNUA 4XWOC 2PNDA 4FN0A 4WJ5B 3UTSE 4UTBL 4JFDE 4HQQH 4RFEA 1U8NB 4LKXA 1EEZB 1AGCB 2C5DC 1I8LC 1HCVA 1KJVB