2YRWA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
419
structure length
413
Chain Sequence
b'HMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 413
sequence length 419
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrwA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrwA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrwA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrwA04
4ZQIA 4FFOA 4YJ3F 1Z2PX 1A9XA 4DLKA 2R6FA 2DWCA 2DZDA 4XYLB 1EUDB 3JZFA 4MAMA 2YZMA 3I12A 1AUVA 2YRWA 3ORRA 2NU9B 4IIJF 3Q1KA 1DIKA 5LA6F 2R85A 4FGRA 1VBGA 1PK8A 4MA5A 4TV8F 3HO8A 1KJIA 3SE7A 2FPPB 2YZLA 4WD3A 3Q2OA 1JDBB 4EG0A 5BMVF 2I8CA 3KAJA 3RUPA 2QK4A 2R84A 4FE2A 3JRWA 5C1PA 5LXTF 3HB9A 3GLKA 2YRXA 2ZDHA 5JH7F 3KAKA 3TIIA 4O7LA 3WO0A 2NU7B 2YS6A 2YZGA 5DMXA 2VR1A 4TUYF 4I4TF 1M0WA 4EGQA 4ZHQF 2ZDQA 1T36A 1UC8A 2W6NA 4GGMX 5JVDF 2W6MA 4YJ2F 2PBZA 4HNUA 3TW6A 5BPFA 2VQDA 4M9CA 2HJWA 1KEEA 1BNCA 2V5AA 3KALA 5K2MA 2VPQA 1W96A 3U54A 4ZOLF 5LOVF 4EA7A 4HR7A 5LP6F 4O4JF 2ZDGA 2YWVA 3RV3A 5J2TF 3BSSA 2W71A 3UFXB 3OUUA 4QSHA 3R23A 2DLNA 4XZ3B 2QF7A 1GSOA 3ORQA 3VMMA 3VPDA 5BPHA 3WNZA 4MV3A 1KC7A 1GSHA 4HNTA 2NU8B 4EAAA 2R86A 4C5AA 3E5NA 3N8DA 1KJ8A 3GIDA 4EABA 3HBLA 2R7NA 4EGJA 1JLLB 4IWXA 2W6QA 5HV6A 4O2BF 1B6RA 3RV4A 2W6OA 2Z02A 3LP8A 2CNUA 5FNVF 4O7RA 1C30A 4FFNA 4MA0A 4J6EA 3AX6A 3OUZA 4EA9A 1OBGA 4M9UA 4MV1A 4O7WA 1CQIB 4M99A 3K3PA 4RZQA 4HQ6A 1C3OA 1GSAA 4IHJF 1CQJB 1CE8A 4O7VA 2GPSA 4I55F 4Y8VB 3ETJA 4FFMA 5D8DA 1OBDA 1Z2OX 4O4LF 3K5IA 4IWYA 3VOTA 3V4ZA 1GLVA 3WO1A 1WR2A 5CA1F 1E4EB 3TQTA 2P0AA 3G8DA 1W93A 2R82A 4XX0B 3VPBA 1B6SA 4YB8B 1EHIA 2FPIB 4O7YA 3TINA 4NYEA 3R5FA 2GLTA 1EZ1A 3VPCA 2FPGB 4O84A 5EZYF 3LWBA 2YS7A 3MJFA 1VBHA 2CNVA 4FFRA 3RFCA 1KJ9A 2CQYA 2XCLA 1IOWA 5HBRB 4I50F 2R7LA 1AUXA 5KKNB 4YAJB 2V59A 4O86A 2OLSA 1I7LA 2W70A 2I80A 4MV4A 5H80A 1UC9A 3MWDA 5IYZF 3U55A 3BSWA 3R9RA 1SCUB 2YL2A 4MV6A 3TIGA 4FFPA 1DV1A 1KBLA 1M0TA 2XD4A 4DIMA 2PVPA 2CZGA 5I47A 4O7SA 2VHEA 5GONF 2C00A 3BSYA 2YZNA 3K5HA 1BXRA 2NPOA 3MWEA 4C5CA 4O7ZA 4E4TA 4L1KA 4FU0A 1IOVA 3AW8A 2DIKA 4M98A 2GQSA 2R7KA 4O81A 3QFFA 1VKZA 4C5BA 2YW2A 2NUAB 1EYZA 2W6PA 1A48A 2GPWA 1JKJB 2I87A 5LYJF 1DV2A 2R87A 3R5HA 4XYMB 5J2UF 3JZIA 5JVLA 5CAEB 5CA0F 5CB4F 4MV8A 2X0SA 5KX5F 4IZOA 4YAKB 5C1OA 4ME6A 4MV9A 4O4HF 3ETHA 1GGOA 1CS0A 2V58A 3U9TA 4FFLA 2J9GA 4O4IF 1KUTA 5JQWA 4WBNF 4O82A 2FB9A 3BFPA 3V4SA 3NUAA 2R7MA 1ULZA 2GQRA 1KJJA 1E4EA 3G8CA 3KREA 1EUCB 2HGSA 2NU6B 1Z2NX 4HNVA 3BG5A 3JRXA 4O2AF 5JQGF 3R5XA 4EA8A 4ZI7F 2IP4A 1M6VA 1JDEA 4O7NA 4O83A 1PX2A 4TV9F 4O7TA 4YBZB 3VA7A 1KJQA 3U9SA 4MV7A 3N6RA 2PN1A 2Z04A 2CNQA 1I7NA 5C8YF 2SCUB 2YYAA 2WYOA 2FP4B 3DF7A 2W6ZA
chains in the Genus database with same CATH superfamily
4P93A 1CZNA 1DXQA 4O33A 1C3XA 4QGSA 3H5IA 3VKVA 1UMDA 1Z56C 2C7GA 3U7EB 3I12A 1P80A 2OLKA 3BQNB 4CVNA 4JGGA 1L4LA 3FMPB 3RRZA 1FNBA 2H0QA 2I4NA 2WMOB 2Z5GA 5B58T 1G0OA 4J49A 2VDNB 1AKWA 1OH8A 3GLFB 1NBMA 2R00A 4EMUA 1XZPA 4R6XA 5L3SB 2FPLA 3CCBA 3PYLA 1JPVA 1UF9A 4PLHA 2VTBB 4D5EA 1CQXA 1NYRA 5DISB 2BRUC 4S2EA 4EGQA 1YQUA 1NV8A 5EN4A 1MB9A 5DSTA 4QWAA 4Y0AA 4PSDA 1LJLA 3FHJA 1NULA 2WBLC 4NMXB 3X2FA 3FB4A 3PQ4A 4K26A 3CNNA 4P98A 1O77A 2RDIA 3GT3A 3HCFA 3WMWA 4ISCA 3A8TA 1GA1A 3RV3A 5JR3A 1Z33A 3W5CA 2L42A 4Y2GA 4NWIA 1GGNA 4O1IA 1IK4A 5MN4A 1F8YA 4YMUA 3VVLA 3TDKA 2G5GX 3VNRA 3TCNA 2QQ0A 2Q0SA 4RNDB 3IEMA 2YXPX 1II9A 3OF3A 4EABA 3T7EA 3ETNA 3B12A 1M6YA 4GGPA 1ULBA 1XDUA 3A6LA 5A2QA 4GRDA 5FBWB 4IV5A 1YU6A 1W7AA 5FNVF 2Q4DA 3NBXX 4HOYA 4EECA 3LX4A 2OHFA 5LQDA 1M72A 5IXJA 4I4TB 4X8LA 3C4VA 3GLSA 3OT1B 2ISCA 1X9GA 1TKBA 1Z6XA 1CUFA 4YRJA 2XYPA 3WV5A 5LPNA 5KINB 2UYOA 2D1FA 4MUIA 1DOAA 4QOHA 3JVEA 4DMRA 2IF0A 2C8VA 2RGNA 3VOTA 4Q4JB 3K70B 4NMLA 2VHZA 4D42A 5KFTA 1EFRA 1MVOA 3D3QA 3HEAA 4TV9B 4DUZH 4O7YA 3CCFA 1NPDA 2X6QA 5HM6A 2VZLA 2QTAA 4F6RB 1BVRA 4F4HA 3DWIA 4MQEB 2JIPA 5KFZA 4B33A 2ICAA 3INRA 1O87A 1N32H 1VCMA 3HU2A 1ADCA 5DFAA 1M8GA 4QWMA 1IJFA 4C3ZA 3ER8A 4NMWA 4XJSA 3L1VA 2Z2YA 4BVFA 2ZE7A 4YPFA 1PFKA 4KN5A 3L4SO 5IAJA 3T9BA 4DCUA 1N25A 2C2XA 1I0IA 4OAOA 3FOWA 2C4NA 1R3UA 1LX7A 1QVVA 4F5DA 4YRBA 4EHKA 2VRNA 1OLSA 4NXNB 3VR4A 3PHJA 1HMPA 3QE9Y 2EFYA 5FPRA 3N43B 2E6UX 2B83A 5FWXB 2BLNA 2P2DA 3TSOA 2JB9A 3KS9A 3FOZA 1C7FA 3OOEA 4FZ5A 3ZI7A 2X42A 2GN1A 5I4CA 1TAQA 2YKGA 3FVRA 2IEAA 2B1RA 1H5NA 4JI4H 2H3EA 5CU7A 3GPIA 2FFHA 4E70A 1HH4A 5COBA 3P97A 3G0OA 3SJZA 2CLCX 3B78A 3NLLA 2R7ZA 4K1LA 3MMSA 4OHBA 2HHFB 1O5TA 2ZIWB 3HKEA 4O2AF 3LXUX 3IERA 4U7HA 2HVQA 4DDHA 1NAHA 1EFLA 3LAWA 1G5HA 3TE7A 4WLEA 3KAPA 4K6OA 3UV3A 5BR1A 5DI9A 2HJGA 1WKBA 3MCWA 1VHDA 1A9ZA 2WAXA 2JZOA 4R40A 2L19A 3A1TA 3HR4A 4G2TA 2AFVA 1JW9B 2JJ8A 1QHHB 2RONA 3H6HA 4BNTA 3AONB 4QPJC 1WG8A 2VEDA 3PSAA 3KLBA 4EIWA 5KG0A 3WP1B 2YX1A 3EFOB 2B4AA 5K3OA 4HGYA 2DPLA 1EUDA 1LTKA 3JRWA 1PJ8A 1Q20A 2G5TA 3RB8A 1N2HA 3BKXA 1ESEA 3FR7A 1KOJA 2QRVB 3EVTA 4E5KA 4NENA 2JA7A 2O8NA 3RBAA 3UAOA 5K2MA 2XJ4A 2PLNA 5IZCC 4G0YA 5FLXW 1FS5A 4CTJA 4YAKA 2YV1A 2ZDGA 3EGDA 4XA8A 1EA7A 3UWOA 3AR4A 4F2PA 4D97A 3ASZA 3EJ6A 5ARCA 1AU9A 4AJEA 2VH5R 3UNXA 3GCZA 3OLYA 4KYVA 1JXAA 3QBVA 1QG2A 1MW9X 1JP7A 4MNTA 2X5OA 4PLPA 2P3OA 5TC4A 2BZGA 3PEWA 2H1HA 3G2PA 1NI4B 1L1EA 1P4JA 5KFVA 4DLBA 2UUOA 5AUOB 5EZQA 2BF4A 3KT0A 621PA 4R7ZA 3WRYA 5GOZA 4D9KA 4MS3A 4J9RA 4KO3S 4FMCF 1S1CA 2F1RA 2WVJA 4TMYA 2AJDA 4GPIB 4UCOA 4UEJA 4JC8A 3WZ2A 2GJSA 2XDQB 4RVDA 4AY2A 3JAKB 1ZHOA 3OICA 1P16A 1GTRA 2Y0EA 4G0VA 1E1RA 1A8SA 1UAGA 1NUUA 2YC4C 3FMVA 5AK0A 4FVTA 4ZAVA 1SD1A 5JJCA 2RK4A 4PZ6A 4KWCA 1IY0A 2J5KA 3BD9A 1N5DA 2IITA 5LMZA 1M0SA 1OFGA 3E9NA 2PV0A 2QM8A 4NYJR 1ZJJA 4RD6A 1A2KC 4RFSB 3SIXA 4IDGA 1GPJA 1FL9A 1R5BA 4QJIA 1WCYA 2J6IA 3EIXA 5ULLA 5KKNB 4I8DA 2B8EA 3ZWPA 5DBFA 4FLMA 2QX4A 1ZNYA 2WFLB 5CBPB 2E4ZA 3HLYA 2GZ2A 2B21A 1M5UA 1E9EA 3GRCA 4EB8A 4EATA 4HB2A 1Z0FA 3NP9A 3FFWA 5E3JA 1UMKA 3HDHA 3HDGA 4CMAA 1SXJE 5I3ZA 2YRFA 3AHCA 4R6WA 1ZEMA 3BH7A 3SVTA 1N2CE 2O0LA 4MDYA 4JI0B 2YHUA 4KLAA 4N9WA 3CVOA 3FNGA 4P3NA 3ICWA 2C4WA 3GEEA 3DNMA 4H4EA 4PE5B 4BFLA 1R9NA 1PQWA 4J7XA 4DR5H 2JARA 1XNQB 4UDOA 4ZCRA 5AP9A 4WNAB 1HZZC 5LDGA 4JYAH 3BMOB 3GLTA 3MINB 1K5GA 1D6NA 1Q7EA 3V97A 4C1BA 2VPWA 2ZYRA 1THGA 2UU9H 4OA5A 4UHCA 4B9EA 4TZ0A 2QUIA 3OCUA 3F7MA 3RIEA 2EV9A 4RW0A 3LMLA 3JQAA 4QNRA 4DV7B 3BRQA 1K7SN 1U2TA 5B7GA 2QD3A 5CG2A 1T24A 4ECXA 3UCXA 4IW3B 3EY9A 4RULA 4N12A 5LSAA 3WJ2A 3JVIA 1U1DA 2Y77A 1DXYA 1W5EA 3FPKA 1WUHS 4HNHA 5BSVA 1PR3A 4ED0A 4J9QA 1O8BA 2AWNA 3W5IA 2QYZA 2RH4A 3JZFA 4MYDA 2PXAA 3CY6A 2XI4A 3VTZA 3MTBA 2XQJA 4D0NA 3NHSA 4G1EB 2F3UA 4R84A 1VPLA 2ZQYA 4K40A 1P7CA 4A4DA 4U5QA 4TMFA 4B5LA 2PWBA 5TPWA 1G66A 2XOKA 4Y7CA 5B1SA 4C01A 4U8GA 1H0HA 1F9AA 1Y1VA 1LQ2A 3AB8A 4DA7A 2WJ3A 3BF8A 1X6VA 4D82A 1K3UB 1JAHA 2OENG 2R47A 4IRMA 2XB8A 3N0WA 4KDRA 2ZJ2A 1LKZA 2YNMA 3E61A 3LL4A 2E89A 1E66A 4LZNA 1KRXA 2X6RA 3N2GB 5L9XA 4ND3A 2JI9A 1XDBA 4BWVA 1GSOA 3JVVA 3FKIA 5KKAA 5BWXA 4EHJA 2JLVA 3DBIA 1TC1A 2XCIA 4M6WA 3D6JA 3EXIA 3G23A 1HDEA 3ODGA 1N8NA 3CGGA 4JCOA 1Y37A 1JYEA 2ZYWX 2G8LA 4XE5A 1Z4JA 5KNDA 3T5JA 3QPVA 1HEYA 2EBUA 1V5WA 1MX3A 4MMYB 5JSUA 3M9XA 1R9MA 1U63A 2XMBA 2DSNA 3CO0S 2GKSA 2FRXA 1GNQA 4ZJZA 1ONPA 4DANA 3H9JA 2CUNA 1RP7A 1ZI8A 3PB3A 4HS4A 1CPYA 3D8TA 4HQ6A 2QUHA 3T1HB 5KFAA 2NQ8A 1DQZA 3U02A 3D3KA 2AS0A 5DYGA 1EFPA 4U7WA 3IKMB 1P3DA 2JFVA 3AEYA 3KQVA 1KQOA 3Q8MA 3WLKX 2B25A 2YJZA 2W6JA 3FDXA 2QXTA 3IDOA 2J67A 2J08A 4NYEA 3D2BA 1PUIA 2Z4TA 1QH1A 4ZJUA 2VOEA 1MJFA 2IYYA 4X41A 1CQWA 4L22A 4Q48A 1UJ4A 4E46A 2NM0A 1PKXA 2OLSA 3NFYA 4ZTZB 4NL4H 1AG9A 2GX6A 3HB7A 2V5VA 5CK4A 4FHEA 1RRFA 3N8GA 4J2HA 2PZFA 2EGGA 1HLPA 2V7UA 3QEKA 4NU8X 3L7KA 5KYWB 4M1TA 4ECWA 1EDDA 3A9UA 3S81A 2IVZA 3TLCA 4CEHA 5HW0A 4B81A 3Q3IA 3TWOA 1IQ0A 1TVEA 4LF9H 4GQBA 3PQFA 2X0JA 3TJZA 1LLQA 4RZIA 3M9OB 1BFDA 3DLPX 3PS9A 5L3ZA 3DGEC 2EWMA 2WE7A 5DHUA 2Y1XA 1PZEA 1BMFD 3H5NA 3NIBA 4W5NA 4LYDA 3LV8A 2O8BA 2R8OA 3G8BA 4M49A 2RCYA 3N44B 1ULHA 2QD2A 4WCFA 4BWYA 3H87A 4UNNA 4XQGA 4IH9A 5DM4A 3FI9A 1IMJA 4Z8XA 5HKKD 2HA4A 2G9UA 4IR9A 5FWAA 4OBWA 3CIOA 2W42A 5IX8A 4ZYLA 4BLUA 4R2HA 5A3RA 3L5KA 2UZAA 1GTG1 4X20A 3A6GA 2VP3A 5P21A 1JGTA 3MWJA 4MGYR 4WWHA 3AR7A 3LDFA 3LW8A 5BWOA 4EO4A 1EX9A 3TNJA 4ISBA 3U3OA 5I7SA 1UP4A 1XTZA 2OKGA 3E35A 3VNSA 1M2GA 1GKIA 2O8EB 4UNIA 1B00A 3DV0B 3TK1A 4IY1A 4D3FA 2X0KA 2I7CA 5A5DA 3FNIA 5TS3A 1U9JA 521PA 1L4FA 3NCHA 5KX5B 5FOUA 1W88A 4NZZA 3O4IA 4RSRA 2ZB2A 4BASA 3R5SA 1YZ3A 1DVRA 2F00A 1YR8A 4HN9A 3L8FA 4Z0NA 3G5AA 1C3EA 1UC4B 3F0TA 5F2NA 1IVSA 4KPGA 1Z62A 1CNFA 1XVVA 1Q1AA 4B31A 1CR2A 3R5TA 1UKEA 2BM9A 4EG7A 3EPRA 3LC7O 1EKFA 4CG3A 5DCWA 2MSDB 2O06A 1OFHA 4UCUA 5FT9A 3G1TA 4FR5A 4RL4A 3NDRA 3LZ6A 1BJRE 3CSSA 1G4HA 1XRQA 2H1SA 4PF1A 1NW3A 3OOYA 4BBAA 2HK6A 2FK7A 2F2TA 4JYMA 2W8ZA 5BN1A 4E88A 5KNDH 1YJAA 1QKJA 4Z4CA 3D4OA 1S89A 3WGZA 4V0MA 1VC2A 4OHWA 4K5QA 5H02A 2H5EA 4EVRA 4JI8H 2Q49A 4BTEA 1RBQA 3GJSA 1XG5A 3N8DA 1AQ6A 4H31A 2ARKA 4E22A 1CZKA 3GXBA 4RTKA 2HH9A 1SOUA 2Y0CA 2IGBA 2UVWA 3WL6A 4NDNE 2A59A 2P1DA 1S7CA 4AS3A 1HLDA 3X1ZA 2VT6A 3U3KA 2MSCB 1KDTA 4RD4A 4UCRA 2ZS9A 4HEHA 4LHYA 2FEAA 4PIMA 1HDYA 3V5NA 2IIBA 5KFXA 1ZD9A 2E4WA 3CISA 1HT2E 2IEYA 3W4JA 3K1YA 1P1HA 1JQJC 4O4LF 3VGJA 5KFIA 4QXMA 2ZBPA 2J6TA 4HUQA 3CXRA 4BCDA 3GL9A 1NUAA 3TLJA 4LPSA 3FPHA 3C3AA 4HPXB 4G86A 3GIQA 3G8DA 1SUSA 3JQGA 3F47A 4FOPA 3WNBA 2BFDB 1E2IA 4HN2A 1NAIA 4PTYA 1OCEA 5FR2A 4D46A 4FN4A 3KEMA 3M4ZA 4BFUA 4BFSA 1XKTA 3D5EA 1NMEA 2YS7A 3ZNOA 1YBVA 2O54A 3GAMA 1USKA 2FMXA 4R1MA 4HGPA 3EC2A 1IOLA 3I5UA 1U3CA 1TW2A 3FNBA 3UUWA 3WNQA 3ZYZA 4YHBA 3FSJX 4URYR 1HWYA 4IRUB 2CKMA 4OFWA 4UZFA 1EIWA 1M2VB 4ON9A 2Z1NA 3NORA 3AINA 3U9LA 8ABPA 1ZC3A 2YL2A 1UAAA 5ITZB 2QRJA 1R4MA 4LQDA 3HU3A 4OSEA 3C7TA 1B1AA 5EE5B 1N5KA 1X0VA 2A5YB 2GNPA 3BMCB 1YOBA 4X8HA 1PG2A 1YR3A 1IPFA 1W1IA 4URXR 2X23A 4JNKA 1KP2A 3K1TA 4OY3A 4RKFA 3PZPA 2PBFA 1QQ5A 1XTUA 5EWMA 4C22A 2YXEA 1N0VC 4UHJA 1EKXA 2EZ8A 3VKFA 4AJPA 3ONWA 2PMEA 2JCGA 2HAEA 1C81A 5AW7A 1Y1SA 1KF0A 2EIXA 2Q2WA 1QH0A 4ALMA 4OTZA 3V6MA 1SU4A 5JV5A 4OX9Y 4C0WA 2VUIB 5F23A 1F0NA 4EFLA 4BX8A 3ITEA 1PF7E 4K1XA 4NCIA 1L6IA 5KCZA 4PNHA 3CQ9A 5C35A 4JN6B 2QA5A 5J2TA 1UT8A 1L8OA 3BFPA 4BVGA 4KWTA 1Q92A 4E13A 5CRIA 2O3JA 3CNLA 1Q3TA 3S40A 3ZBUA 5JYDA 1OFUX 4JV1A 3Q98A 3D3JA 4QEZA 3O3NB 3SKVA 4AUMA 3D2AA 1FDSA 1DL5A 4DIBA 1NJFA 2OB1A 2VUGA 1C9MA 3R0QA 4KR6A 4QOEA 4F4XA 3S5UA 4DLSA 1A5TA 4HDNA 2XQFA 2AKAB 3EPHA 4DIOA 3CW8X 1N9GA 3LTEA 4J1NA 3OJWA 1VXOA 5EVCA 1WM1A 3GUZA 2Y9MB 4DNPA 4EYOA 3PCTA 5HK9A 1PJ4A 3ORRA 1URPA 3TLKA 5KSWB 3KJIA 3C1UA 2OOKA 1IWPB 3N8HA 2JGAA 5DTQA 3T3IA 1Z13A 3G6XA 2C84A 2DBYA 4DT1B 2ZM6B 3FDJA 3HCWA 3T8YA 4QGFA 3KAJA 2Y05A 3KKEA 3LLVA 2PUDA 1XF9A 3VHXB 5KYUA 2N42A 3UAYA 4OAQA 4BQFA 1I2CA 5HA5A 4HZGA 2CXOA 2DPHA 1BWSA 2ZI4A 1SD5A 4ECVA 2IWRA 3OPXA 5CT4A 1YTUA 3B85A 5CNJA 2ZIGA 3FPBA 1IEVA 1QUFA 3LVQE 5DCLA 5F21A 4MW2A 4J9MA 2VNAA 4O4JF 3DDHA 1IEXA 2D7CA 4AF7A 1IC6A 2OXTA 3THYA 4EFDA 5TF0A 3SZLA 3HVRA 4I4CA 5K7SA 3DWEX 3QLUC 3P7MA 3H8VA 3M3HA 5FCDA 4CG2A 4MO2A 2BGKA 5IYZA 1A9RA 3DO8A 4J9LA 3GJYA 3EIFA 4TQUS 1GQRA 1T2UA 2OYSA 4P4UA 1W5FA 2CLLB 3PA8A 1V5EA 3TFWA 3NKLA 4YI5A 1EM8B 3P71T 1NJ2A 5ICFA 1GAEO 3Q6MA 1F7UA 2B61A 5I7WA 1VE7A 5LR6A 2COGA 3INGA 1SEPA 2J6HA 1X7YA 3ACBA 4U02A 3PC8C 2H00A 4L0CA 4YJHB 2XR1A 2W57A 1DOZA 5IP5A 1MEEA 3JSLA 5CX1A 3BWVA 1JJFA 2RHBA 1BCRB 4NE2A 5F52A 1HKHA 2QTHA 3DUFB 1JJBA 5HILA 1SCJA 2X9VA 5CDFA 3A6EA 4E09A 3QLVA 3EAQA 3IBSA 1CLUA 5BR8H 2DBVO 3D8HA 1E3JA 4M0KA 3KM0A 1X1DA 1ISSA 1JEAA 4EH1A 2CJPA 4TLDA 3CF6R 4KVZA 1TU3A 4EGSA 1V48A 4N3NA 5KPDA 3D8BA 2WWTA 3U19A 3ZVMA 2EQAA 2E1RA 3D6VA 3FCUB 5K45A 1G20A 2PSFA 4RPHA 1E1DA 5F3DA 3CT4A 3K16A 3KNZA 4U2DA 2NZYA 2V7WA 4LHEA 4NYMQ 4RA6A 2OLJA 4R98A 1JXQA 1FP2A 3J80W 1M2NA 1VM6A 2W22A 1I2MA 2VJMB 4B3FX 2HNKA 5DHFA 4ZOQI 5E8RA 2JIMA 4RZRA 5HGXA 1QFMA 1CJVC 1TAHA 4RPKA 1OILA 1PD0A 2QVXX 3EYAA 4E5VA 2P79A 3CXUA 4ZRNA 4CTMA 4ID9A 4ZAWA 3ORFA 5FLMG 2G3YA 4UXHA 1IQRA 1IIBA 5LMNB 1G3RA 4B4UA 2JCVA 4H4CA 4OHPA 3W5VA 2JHGA 4XLLA 3GDWA 3MS7A 1XCOA 1ODCA 2Q2QA 3JAMW 3DDCA 4B6FA 2IFTA 2IYOA 4IDNA 1SELA 1CZHA 2UXBB 3VR6H 4N9QA 4M4SA 2QL7A 4IIGA 3CS3A 4Q3EA 2VSYA 3BK7A 2QNBA 4LHVA 3SOPA 5A7FA 4M9QA 2JGFA 1R8JA 1XCPA 5K8TA 1NC3A 1DRJA 1NQTA 2W2LA 3QHQA 4Q3OA 1RZ3A 4A2CA 4MPTA 1CUDA 4IEFB 3MERA 4OVKA 2FUNB 1RHRA 2ZXEA 1UZAA 1OE0A 3AETB 3LGXA 2COJA 4EX7A 2ZE5A 4O5AA 5AHXA 3Q9LA 3R3VA 4BNKA 4BTVA 4CHTA 1E0SA 3F78A 3QA3E 4NNPA 3M89A 1F06A 4PYNA 2GVZC 5CB4B 1NASA 4W1RA 3UHOA 5HEKA 5J4YA 3BZUA 5A03A 1I6KA 4U00A 3BFKA 3IAEA 1J0CA 4MK4A 4FX5A 3LI2A 1SU6A 4F2DA 2GHQA 3PENA 2W2PA 3HB4X 1EIZA 1NJ6A 4UBJA 5T8KA 3D5QA 3WDLA 3I30X 4BV2A 1IQUA 2ASJA 3TLMA 1NQXA 3AMVA 1G16A 1PT7A 2RHRA 2C4TA 2GXAA 5DV9A 1GRRA 1T5SA 2H4JA 3U4CA 3QXCA 2JIRA 5FPOA 4F4WA 3QENA 2JHAA 2NSHA 5FULA 1A77A 1TD1A 1OW3B 4FMBB 3HY6A 3H9EO 2WICA 3R77A 3I2GA 4BKMA 2XTJA 1WABA 3RWMB 2GN8A 3PHGA 3NC0B 3EG9B 1ODFA 2NXWA 1ZJ5A 1SQ6A 3VXKA 2KSQA 6YASA 4IS2A 4EF4A 1NE2A 3WYCA 4H1WA 1Q74A 1WTAA 1HYEA 1BQ3A 4KIGA 2JLWA 2HPHA 2G88A 1TUBB 4WFJA 3IHLA 5AW2A 3I0ZA 1JBKA 2WM8A 1V1JA 5LDHA 4IJUA 4DWWA 1NYTA 2BR3A 4P8RA 2M6KA 4BPRA 3F7NA 1RQXA 3PEUA 2DXIA 3TQCA 3WB2A 4HH4A 5KFMA 1OF1A 2P9YA 2OBXA 2Q21A 3HKBA 1LDGA 3RVPA 5CD9A 1L5MA 4B87A 4TX1A 1NXPA 2VN8A 3F4BA 4Q7LA 1CF4A 1FRZA 4TMVA 1XNRB 3TD6A 2ZIXB 5AK6A 5DN6D 5E8JA 1Z2OX 1Y3AA 2RGCA 2GKGA 4Q9AA 2VUSA 4EHAA 4G89A 2OCIA 5JNSA 4KDCA 3WP0A 5D7BA 1WE2A 3A4IA 2P9JA 1S97A 3RO7A 3UGQA 3FSGA 4MKHA 2RGAA 2NZWA 1XD2B 1EHIA 1FYVA 4B6PA 3VDXA 1KJWA 5CMLA 5IJXA 2DUJA 2G1JA 3FKJA 4BXOB 1P5FA 3RFCA 4DB4A 3ND6A 2WAYA 1ZUHA 1E61A 3DE6X 2QMHA 3NOOA 4DV3B 1RWPA 3BHNA 2RSLA 3HVIA 4KUEA 2W70A 3IEUA 1T91A 5KNCA 4URWR 3KJQA 3H2GA 1A8IA 4MV6A 5ALXA 3IOMA 3L1IA 3T5DA 2DFVA 3ZXYA 1DEAA 2TMDA 3MA0A 4MPRA 1YS4A 1FW6A 2RJ3A 3OZAA 3RYHA 4IQ0A 5CYGA 2FKAA 4DYDA 1ZAYA 1U3UA 5AVXA 4WPGA 5EQJB 4IX1A 1SG9A 4YJKA 2ZANA 2YVAA 4QWCA 4ZT5A 1AVTA 4I4IA 3HV2A 5TXGA 2P78A 5IANA 3SI7A 1P77A 5KFSA 1CS0B 1AGPA 2Y76A 4ECYA 4NP6A 4KE9A 3QEMA 3W05A 1X77A 3PITA 4X1OA 4LRTB 3S29A 1I3KA 5HMMA 2O2ZA 4HLQB 5LQMA 1NRXA 1PBNA 3FYTA 1N6IA 3MLBA 2XSZD 2PUGA 3ESXA 1XMOB 4OHOA 4AJ9A 5E6RA 3AHGA 1DIGA 4CMBA 4MWGA 1AOXA 2JHCA 3U6BA 1QYRA 2GAIA 1QO0A 4J0QA 3IJ5A 3A1FA 2WG0A 3CHYA 4C14A 3W4KA 2A30A 3TTXA 3I9KA 1Z25A 3R5XA 4CCSA 4KSBA 1X1TA 5KG5A 4IJMA 4JI3B 5TQ2A 2AF3C 1EM6A 2I33A 2OBFA 5THXA 4RK5A 2X4LA 3GLHB 1UODA 1G1MA 2G0NA 1J8QA 4UREA 1U8AA 1YB6A 2JJ2A 4YMVA 1RS0A 2XGOA 4YMWA 1YUBA 3Q3VA 5CDHA 6PFKA 1U7UA 1KKUA 1KJIA 2P4HX 1W0KD 5KYNA 3DD1A 4IVQA 2Q50A 1ZD1A 2W9BA 1KAEA 1TWAA 2D5BA 1USWA 2NV6A 3BMQA 3SQNA 3BIJA 2QLNA 1EX1A 5EAIA 3UAWA 5DP2A 2PJDA 3TRFA 2WPDD 1Y4AE 4K8RB 3BWDD 4R51A 1JIQA 4LTDA 3AM1A 4XDHA 1G3IA 1GZ4A 4RDCA 2OSVA 4JFAA 4F4UA 2XZDA 1EDOA 4PZPA 2DE0X 4QSHA 2DKOA 3IIEA 4JLBA 2PQMA 3HCRA 4C2TA 3UMYA 1G8MA 1U1GA 1QNLA 4NH4A 4XVQA 4YP7A 2DHCA 4EFKA 1U1CA 3QEAZ 2WB1A 2KPOA 3JQBC 4EBFA 1NXOA 3BXPA 3BN3A 2QENA 3EZLA 4FQ5A 2WJYA 1Z68A 2E4AA 1QZTA 2FSIA 2X0EA 2W00A 3PUIA 3H9BA 5SZIA 1PAUA 4JI2B 2KM1A 3D2LA 2BDUA 3HXQA 4QDJA 5EG5A 4KCGA 3BWYA 1TQDA 1CQIB 2AQ8A 3PFWO 3M4XA 3RUAA 4GPBA 1CQJB 1CE8A 4CLRA 1PTKA 2WMDA 4RHEA 1ZPDA 3E58A 1K5HA 4QG3A 4W7SA 3IVCA 4DRZA 2X86A 1VJ5A 3ZJVA 3KR0A 3T5GA 3ZGOA 5DBIA 2CVFA 4M0MA 1USIA 1MAVA 3WK5A 5CIWA 4WA7A 4Q5IA 3RHTA 2XYHA 3LLUA 1M8KA 5KT7A 5KNCH 4EYSA 1DPGA 3M6MD 4V02A 5C31A 1BEUB 2OBNA 1CZLA 1TLFA 3QVGB 4YR9A 2YBDA 4DA6A 2W7OA 2GSDA 5F9LA 1JFTA 3Q3GE 1M8PA 4DE5A 3HP1A 1MEOA 4HWKA 1T5IA 3G2JA 2XKAA 1CC1S 4GAEA 5HF6A 1ACLA 1GZUA 2G0TA 1JLMA 4OMUA 5CXQA 1ZMBA 1V51A 5I5TA 3EMKA 3RYCA 1YI8A 1KBLA 4LWQA 1N5LA 2HPZA 3AF6A 4UUQA 1TAGA 1IPEA 1KXZA 4MLCA 3HWSA 1WXEA 2EEZA 4FBUA 1H4VB 2Q5CA 4KQ6A 1SKQA 3K71B 1ZCFA 4YJ2B 3ITKA 4L9RA 3KUDA 2BEVB 3KEOA 4MQMA 3GT0A 1W36C 1N33H 4K9QA 4JEUA 1KIAA 1UAYA 3RSHA 1JQ3A 2CE7A 3G7NA 4ZVOA 2X0IA 3WRVA 4ROSA 4GPD1 3AZQA 4A3BG 1A3CA 3FMIA 1BG6A 1FTYA 2WOOA 1C7JA 2XEXA 3GC6A 2XCRB 1V71A 2EFEB 2W6ID 1D8TA 4MP8A 1VSQA 5CA1A 1E5XA 1ZN2A 2IYQA 1V16A 4JROA 2HSJA 4RGBA 3L4KA 5BV8A 3LECA 1REQA 3HR7A 1ECPA 3CF4A 3W8NA 1X92A 4PFQA 3IQFA 1AIPA 2CW8A 3VGPA 2O9JA 3C3KA 3L04A 2B30A 4UNQA 1ABFA 5EJMA 2V7XA 3H1FA 1NZDA 1VYUA 2H8KA 1BHO1 3TJMA 2RGEA 4BE4A 1FXWF 2HSGA 1HO3A 3FZQA 3B3FA 4UASA 5K05A 3VSAA 3WR5A 4M2LA 1ZAUA 3KSDO 1JWBB 2POCA 1BAPA 4JLAA 4M9SA 5BWVA 3ZD8A 2AXQA 1SU8A 4INZA 3WMRA 1WKVA 3N41B 3ZNPA 1JZTA 5E1MA 3T0FA 3KQHA 4MQ4A 3UYLA 4PYQA 4IIFA 4XDYA 3IAHA 4TXLA 5B64A 3DFIA 4RJTA 2X8LA 5FFMA 3HEBA 1I10A 4Q0MA 2C2DA 3O8NA 1KYIA 3PLAE 1UM8A 1ZU5A 3RR5A 1T25A 2NU7B 3LPAA 2K7FA 3TSYA 1BU8A 4WY2A 4YCJA 2AXPA 3I2FA 1U2GA 3CZRA 3JD3A 4EEYA 1DE0A 4GGMX 4QYXA 4BVAA 3TS1A 2XCQA 3P9SA 1OUMA 1KGSA 5AJVB 4CM4A 1M2JA 6ABPA 5J4KA 4GSYA 2BGWA 3LPLA 4PC7A 2RBEA 2FG7C 4GL2A 1KEPA 2R8ZA 1U94A 2GESA 3UWDA 1KRWA 1GQOA 1AUQA 2JDID 5IKOA 2OZVA 1P1KA 1TVKB 5DJ5A 2ERYA 1WSDA 4DC1A 5JPIA 5K0FA 1J1UA 4POAA 4RBNA 1HYHA 3UENA 3B51X 5KG6A 1OQAA 3GQVA 4RK4A 3NGLA 3T7TA 2FPXA 4C0XA 1YE5A 2XECA 4GE3A 2GPYA 2VRCA 1O94A 1QDLB 4NEQA 2HT6A 2I1LA 1FPMA 1FFBA 2HIVA 2PD4A 4QTUB 3SVLA 2J9FB 2V7EA 1PUXA 1R6BX 4D9FA 2CZCA 2PLRA 4JELA 4QOFA 4NJMB 4MJLA 5IJ0B 5E2AA 1CZRA 4P5DA 3VHRA 1FFEA 2ZAMA 3H11B 1TGVA 2ASDA 2HWWA 1XELA 5IRCD 4UOQA 4CMJA 3GLFA 2QZJA 1WR2A 5L3SA 1O89A 4FCTA 2ACKA 3KCQA 1RXYA 3GZNB 5D01A 2VTBA 1NXSA 1JXOA 5EFOA 1I6UA 4BZPA 1W30A 1YFZA 2FZWA 3TOVA 4ZI3A 3CWCA 2I6GA 1KJ9A 1CKEA 3SEZA 4UPVA 1FJ2A 5A3JA 3PQ6A 1K7YA 2NYAA 5ESWA 2ZI7A 3QVWA 1C7RA 4YDHB 3DOFA 2CGEA 2ZEJA 3PXUA 3CZ4A 5EKDA 3AESB 3T4XA 5BXYA 1ZW6A 2I2FA 4LPKA 4CLEA 1M1XB 4QSMA 1IEWA 1JDZA 2DYKA 3AM3A 1YS7A 1J25A 5E2BA 1RQ7A 2B3TA 1XMQH 1RADA 1NHWA 1MQ9A 3NTVA 3URKA 4YEDA 3FA2A 3RK4A 2Q4BA 1SFOA 2Q2NA 3S2SA 5CHYA 5LP6B 3IEKA 4TSFA 3UWPA 5JAIA 4I4TA 3I9V1 3A1EA 2YASA 1TVMA 3SSMA 3WK9A 3TJRA 3OFSA 1VSUA 1W47A 3W5JA 4V39A 2FW1A 2PTHA 1ZRNA 1P45A 2R7MA 3ZX5A 3R7SA 3LWDA 1M1NB 3WYAA 4ZU3A 2WUDA 4BNZA 1TT5B 3UJ9A 1ODIA 1N4AA 3EW9A 3ZNNA 3MGBA 2AGVA 3FCAA 2JBAA 4YROA 5IYDG 2LCFA 3GJ3A 3W8RA 2PKXA 4CEIB 4JYBA 4UTXA 1JG3A 1EHYA 4FCVA 3AP2A 2QLMA 4RTMA 1TQ2A 4JOSA 3AL3A 1H8EA 4JHXA 2AH5A 2F1KA 3IT0A 1GZ3A 4NV0A 2P90A 4UFPA 1JG6A 3VSCA 4IMJB 1JDBB 3W7VA 3AEZA 3WVNA 4XYLA 1GV1A 2PH5A 4Q1BA 1P6UA 1EX7A 2PGDA 3HRHA 2LCIA 3ZQKA 4AKGA 4V03A 1IUPA 1EZZA 2I7VA 3ZTWA 2QIOA 3HA5A 1ZD3A 2B2NA 2YXLA 1H0RA 2G9VA 2GCNA 2WTNA 3DEKA 2NV0A 1EQAA 1UJCA 3ZZ0A 1JG2A 1Q16A 1BGWA 1GG9A 3OZTA 5FR9A 5C51B 2QSJA 2BFPA 4DARA 5KWJA 4C4YA 1NIPA 5K20A 2J9ZB 2Y27A 4OI1A 5BP7A 5F9NA 4QD3A 4M89A 1JTEA 1RWKA 2CMGA 1CU1A 3M1LA 3ROMA 1RNLA 3VYTB 4JDUA 2B4RO 2WRZA 4PO8A 1SKYE 2JLXA 1H23A 2NVXA 2FYTA 5AKIA 1JG1A 3E1SA 2ODTX 4XCVA 4IIEA 3VR4H 1Y8QA 4IWXA 5HIAA 1NGSA 1XAHA 4RV5A 5EWEA 4B3GA 1WMFA 2IDJA 2GB4A 4YT8A 4P7GA 2PUBA 1UWCA 4Q9LA 1JJVA 5BWTA 3N2KA 4BOYA 3IIKA 2I78A 1U3VA 3QFCA 3H05A 2KB0A 2RARA 1DKLA 3VR5A 5KTSA 1NQOA 1XHFA 4OK3A 2BFBB 1QHHA 4AP9A 5LWQA 4EUHA 2C7PA 2IQIA 2ACEA 1QVAA 5A0FA 1K1QA 4Q3AA 3EFOA 5BNFA 1B74A 4OX9H 3EJWA 4B3RH 3CT6A 2AN3A 3COJA 4O4IA 4LZAA 4D41A 4X1IB 4J1QA 2ZUWA 1YR2A 2H1RA 1WSBA 2O5CA 1U80A 4MCIA 4AG5A 2GLTA 1TAEA 4XD7D 4H7FA 1PNOA 3F90A 1P0QA 3TXYA 1KIFA 1WU8A 2BHTA 1GFWA 2ONJA 3SQOA 2J59A 1E6WA 2FXVA 4TRNA 3DZHA 5F1YA 1JG4A 3IP5A 3AWDA 1J33A 3K9LA 5L1KA 2ZYIA 5IH7A 5C5JA 4G5HA 4YT5A 2YYSA 1J7KA 4LZLA 4J0IA 5CLHA 4RLSA 4FT4A 3AJ9A 2PMWB 5NULA 3GTKA 1YQTA 1NVVR 4I5EA 4A2QA 2P9HA 3F9CA 5GONF 3FROA 3P2MA 2ZPUA 2O8CA 3H0GA 4G3IA 2DTEA 2WF5A 3ZE8A 2V6IA 4KN6A 1NLZA 3TQQA 1W9HA 4DJJA 2EOAA 3LOQA 5J5CA 1JHRA 5FPPA 1DCKA 2B8JA 4ZO8A 1A27A 1GO2A 5B36A 4Q4AB 4CC6A 1K0FA 1JMKC 1LI4A 2IP2A 3IXMA 5DWQA 5FUWA 3T5MA 1I2AA 4WOPA 1BQEA 3LJKA 2ZULA 4KYIB 5E2IA 2WTFA 3FYCA 4MV8A 3AR2A 1NLFA 1HDIA 2VA3A 5JUMA 3LQSA 3TKLA 1G17A 1ZD4A 2XDQA 4WGGA 3TLXA 3N40P 4X66H 3JAKA 4DLYA 4P3XA 4FFVA 2DY0A 1PGNA 4N5DA 2VHJA 4DQ0A 3UC9A 2EKPA 3F6YA 1QPBA 5T7BA 4QYIB 3B6MA 2PSJA 3C3PA 3EF1A 2ASEA 4H17A 2PMBA 3WGTA 4YCNA 1W2HA 4I6EA 4WIAA 2ZM5A 3RPEA 2FSVC 1DBPA 1OXKB 3B9RA 3NNDA 1PX2A 2OUIA 2H0AA 1Q57A 3THWB 4RFSA 1QVZA 3FYDA 2AZMA 4ZAZA 4BCCA 2MMGA 3KHHA 3SNOA 4CUKA 5EXXA 1EP9A 3PEEA 1ODTC 1Y6ZA 3OM9A 2DZDA 1A8QA 1DHTA 4JNCA 5A5VA 1LC3A 2WUWE 1GITA 1NT4A 4P38A 3W1GA 1RAGA 4PC1A 1SO8A 2XLCA 3OUTA 3ZW8A 3FWPA 2C2EA 5AM3A 3E8MA 1J8YF 3GUYA 2QR2A 4JKIA 3WLAA 2XIJA 1ONBA 4AYBE 3T5PA 3BEDA 1UFQA 3BXZA 4A8JB 2FZ5A 5E4JA 4TMZA 4C7XA 1H1LA 5GM1A 2TMYA 2JZNA 1N0HA 1PYOA 4PS0A 5I9LA 3A36A 3H5WA 4DV1H 2GFHA 5IKMA 5JVDF 4MKFA 3WKDA 4H77A 3P8ZA 2V6FA 3ZKAA 2PCJA 1XEAA 1BXZA 2H51A 4EUNA 3FRIA 2XBMA 4OU5A 3LCMA 3RABA 4HEA1 5JCJD 2CV0A 3PXXA 3DLBA 9LDTA 2C0QA 5C8XA 3OT4A 1XQ6A 3I9NA 3UV6A 2YCLA 4INAA 5C0OE 2FWNA 4XJXA 1BXRB 1K66A 1GV0A 4L8VA 4OBXA 3LQRA 5GMOA 2QW0X 2RGBA 2AKEA 1M7BA 4DR4H 5DPMA 2MIIA 5F5NA 1R6UA 3RAQA 1CR1A 3FPEA 4YT4A 3BBPA 1IPHA 3RK1A 3ZK7A 4DCNA 3T3EA 1GKYA 5L1JA 3QUCA 5C3MA 3EC1A 4ZC8A 3KOMA 1DAFA 1QORA 3WADA 4CQMB 5DNUA 4WKNA 1NNLA 2GGSA 3HBFA 3X1YA 4XR9A 2P77A 2CVZA 4DUGA 1GFZA 3MTIA 3OHMA 1PP4A 4JIMA 5JY6A 3OPMA 5CCXA 3EDMA 4ZEWA 4R9SA 4BP9A 2ZZNA 1J4AA 2IU0A 3K9HA 3ZE2B 4Z53A 2LZ0A 3VR0A 1I94B 1H1TA 1DDIA 4E5YA 4YUZA 3CG0A 3L8MA 1PNTA 1YBAA 3DE3X 4PQFA 1JB9A 4OYYA 2J0SA 2Z3WA 2WNHA 5YASA 4FOLA 3PBKA 1RCFA 1BKDR 4YB8B 4CV3A 4AFNA 4KRGA 3VYVA 4B44A 2AI2A 4WZ6A 2H1OA 4HLUA 2GRAA 3WA6A 1YVRA 3W2IA 1ODKA 4RPJA 2WWRA 4ZVLA 1O95A 4LWPA 4U2FA 2PLAA 4DSTA 1T9DA 2HADA 4B3DA 4CKYA 4JB8A 3WJ1A 2Q4OA 3N2GA 1JS1X 3DNFA 5FO0A 5EERA 5FDFA 3TIXB 4LN1A 2V6BA 1GPYA 4BVEA 4EG1A 1MB4A 2EERA 4O7SA 1PR6A 1MXFA 3BSYA 1EAMA 3FUTA 4RLHA 4C0QC 5K09A 5F9MA 2J6UA 3R7LA 5DO9A 3IURA 2WSBA 1YVPA 1W0JD 2FK8A 1ZU4A 2ZBUA 4AZVA 2G6TA 4KNVA 4NCNA 3E9QA 5HDBB 2BVNA 5DE3A 4LDRA 4WLUA 1X7WB 1JMVA 3A6HA 4B6QA 1AN0A 3ZJYA 1NI3A 4LBVA 4XTRA 3H1AA 4F46A 4ZU6X 1P1BA 4TXHA 1KH2A 5FBLB 4EPRA 4IHQA 4MWSA 1AF4A 4DCVA 2H1LA 3D54D 2EW8A 2JKYA 5HNEA 4G8JA 4W1QA 2ZB4A 2HF8A 3P9YA 4NK5A 5JWRA 1TEXA 4RWEA 1Y6FA 2XWSA 3B9PA 2OYRA 4OBEA 3CVVA 2EAUA 2F1IA 3JASB 3OX4A 3BZBA 4YGYA 4AQYH 2BHSA 3NBFA 3TTTA 1ZCBA 1DPFA 3BWMA 3H5OA 3H7AA 2PM8A 5EXEA 3FGZA 5AVUA 5D00A 1YDHA 4FHCA 4WN9B 3EUWA 4K05A 4HXYA 2VUHB 3LDHA 1LLCA 5CM2Z 3IS3A 4JP8A 3OT5A 1OX4B 2EJ0A 5AI9A 4PYIA 4TYQA 3MBOA 4HH3C 1OGYA 5FI1B 5F4ZA 1K1EA 3L01A 5LA6F 1XZHA 4YQYA 4QQKA 4J0CA 3ZU4A 1EE2A 2WJJA 4DR7H 4UAUA 4AJOA 5K4AA 1FXSA 3GEMA 3ESAA 4RHYA 3IAS1 3T12A 5JOQA 1PQYA 3B2NA 1FP7A 2BOVA 4LQCA 1N6KA 4IMIB 4LBYA 5KTMA 3D02A 1ZM9A 4JGIA 2EJ3A 1MX9A 3CKKA 4MVJA 5ERGB 3C1AA 1BXGB 3R0ZA 5I7VA 1A50B 3NHZA 4Z54A 1BA2A 1MEJA 1U8UA 3LWNA 3GLGA 4JBGA 3OZIA 2IKSA 2XYGA 3HJUA 3KZ1E 1NW7A 4UBMA 3WL5A 3L8EA 1MO2A 1U9IA 1HNXB 3MR6A 3QEJA 5CVVA 4CTNA 4C2MA 1C41A 2IF2A 3RYIA 4CG0A 1CKOA 2IHVA 2OFWA 2JFXA 3GVXA 4PQRA 3ETEA 3AF4A 4LDNA 3EGXB 1FA9A 4J9PA 4ZZ1A 4UTVA 3RFVA 1D04A 1P1RA 2RH9B 3LA8A 4GPEA 2A0UA 4CCWA 2JLZA 5C4IA 2BGIA 1VCHA 2CJWB 2XVMA 2KS6A 1T3LA 2WSSD 3GEHA 2WJ4A 4Z7JA 5ER9A 1VBFA 2DMRA 5LBUA 5F78A 2YWCA 3TPZA 2QX6A 3FGPA 1JRLA 5BSWA 1BZYA 1RBZA 2VDQB 3WYFA 3ZDZB 3RCBA 4LJ4A 1MABB 4CL2A 1Q2UA 1T0JB 3DV0A 4M60A 4YC7A 3NOXA 4U2BA 3EVFA 3PI6A 3VZSA 3IO5A 1P4HA 2J6CA 5ALWA 1CTQA 1X3LA 3QE3A 5KX5A 1G291 4YUVA 3BM5A 2Q6LA 2O4CA 3H13A 3USCS 2YHIB 1G19A 1XTBA 4YP1A 4ETNA 4ZMRA 4RSHA 1TWHA 2Z8XA 4FB4A 1L7VC 5CT9A 3LPCA 2ASVA 2XKKA 2D3WA 5E4YA 2R44A 2J3HA 5JDCA 4C7OB 5FBZA 1TJ3A 3R6TA 1JHPA 1SHKA 1SXQA 4H7DA 3NHYA 2A88A 3NANA 4RVGA 3OA0A 2O2YA 1XXHE 1NNEA 4DDMA 5D6NA 5HUQA 1ZIDA 4H0FA 4DMHA 4JZYA 1QR6A 4R05A 4TVIA 2XRZA 4KK4A 2C2OA 5DK6A 4HLNA 3PO2G 2Z3VA 4AY3A 3FJYA 4W4TA 1JQBA 1P5JA 2OAGA 2XD4A 4K9RA 3QEBZ 1YZHA 2QVZX 2VBGA 2ZU0C 4GNKA 4E1VA 5JEEA 4H0NA 2ZYDA 1XVTA 3PGMA 5JFOA 3HOWG 2PX5A 3BJIC 4IGAA 2VZEA 4U6SA 1VKOA 2CB9A 5I7AA 3AW8A 3FKSD 1LH0A 5DCUA 3WL8A 2QQ5A 3QFFA 4JI5H 2QRMA 5FLEX 2AVDA 2EKDA 3RI3A 4RNNA 3DVRX 2NUAB 4P32A 3TY5A 1LDYA 1NSFA 4F5EA 1HQKA 1YB1A 4P34A 1JHZA 2A57A 2VJKA 3RRBA 2HJVA 3V4FA 1DWQA 2JLSA 2JBWA 3DTFA 3ZDCA 1VSTA 4BGIA 3DHWC 4MR9A 4PG8A 3IX7A 1ZWLA 5FUVA 4QW8A 2R60A 2DR3A 2OCPA 4MDHA 5M34A 4X62H 3SR0A 5AOVA 4PO1A 4P86A 1ZJ4A 2PZJA 1WUKS 3GRYA 1GP2A 4K46A 4BY7G 4P54A 2LXNA 3NYWA 3CMCO 5IXSA 2BFDA 1UK8A 1AKMA 3PR2B 5FQOA 3MJVA 4UVEA 5KFOA 5HDQA 4OYRA 1FF9A 1X19A 7MDHA 2ECPA 2D00A 1FFDA 4AZSA 1W1WA 3M6WA 4FD2A 1EUCA 4MO9A 1VPTA 5ALLA 4Q3BA 4MXDA 3PKIA 4E21A 4KO8A 2PX8A 3H9UA 1M2VA 5LYJB 2YRWA 1E0KA 3WDSA 4MVJH 3NATA 8OHMA 2ZJ8A 4ASUA 3HCDA 2YIDA 4BMXA 1WHTB 2O7SA 4X45A 1YHZA 3C1OA 4E33A 4GXNA 2HJSA 4OXXA 4HSGA 4BFCA 2E4UA 4IOLA 4BP8A 3C45A 3AUYA 3PLRA 3MB8A 5B58C 1GNPA 3Q5EA 4TYMA 5KFFA 3B5IA 2DQYA 3K6SA 1JIXA 4G0MA 2J3MA 1W96A 3UHFA 5LOVF 5ERXA 1A7KA 3I3OA 1H3FA 1GEGA 3H2JA 5LUAA 3SC4A 1T1GA 1COZA 4AU1A 5H83A 1J2JA 4XZ3B 4XJTA 4DF3A 4MUXA 1OFTA 1VHLA 4DCSA 5FHRA 1Z5WA 3UT5B 5A0TA 3R0XA 4RV4A 4NU0A 5ALUA 2JGMA 3I0MA 1ZUIA 1KJ8A 1JEOA 5KAMA 4RGVA 4I66A 2IY8A 5DGCA 4OQMA 4N18A 1HSOA 3PICA 1KHTA 3ZHBA 3LUDA 4MQLA 4LJSA 1YFJA 3AQ4A 1TI7A 1OU0A 1L7OA 4PR0A 2WKPA 5EJGA 3A7EA 1RXUA 5ERYA 3H2ZA 3GCDA 4Z7NB 4US1R 3DZKA 2PMZE 1RAEA 5BN5B 2WWWA 1KEVA 2FDCA 5CBKA 4Z99A 2A1HA 4L02A 5AVRA 2DETA 4EJFA 1M8JA 3ASVA 5DYIA 3EAFA 4AXBA 2R8EA 2VQFB 4XDZA 3ASUA 1DAMA 4DQDA 3AKZA 4OYHA 4M1YA 3BK2A 1HFEL 4GRIA 3G0BA 4DT1A 5K3DA 2ZWAA 2OGUA 4WXEA 2PFSA 1ZQ1A 4WASA 3RIXA 3VHXA 1GNLA 4DV0B 5EP4A 4WBNA 5CFQA 1ISJA 4J43A 4X65H 3E7XA 2X2FA 3I1FA 2O0JA 2UYGA 2O8DB 1I1NA 3OCCA 5SZKB 3TCKA 2ZCVA 3RR2A 2XCLA 3C5VA 4KACA 2FR8A 4EFEA 3G2NA 3U48A 2QPTA 2QAGB 4OHFA 1IVYA 1BJTA 4GKJB 4FFSA 4O86A 1M8FA 4X90A 3L7YA 1FBNA 3HM2A 1N6HA 3K0CA 4KDEA 1JFRA 3Q11A 2OA0A 2X0RA 3R9RA 1A88A 4LXIA 4RUCA 3VNBA 3NOQA 4J94A 2ZXUA 3GI1A 1SUIA 2CSXA 3DE7X 2PDAA 3C6MA 2YHSA 2WA1A 1YQWA 1TO2E 3H84A 3FLMA 2NNLD 4BQQA 3HJRA 1R10A 4BNYA 1Y8ZA 2KQUA 3AXTA 1Z5ZA 3CF2A 2XMPA 4M0CA 3JSNA 1TC2A 4E07A 3PPIA 3SD7A 4FCWA 3PWTA 3RLIA 4ETMA 3VSBA 4ND1A 4M8KA 2GCEA 2IMWP 5KT5A 4PV7A 5K3SA 1L5HB 5TARA 3S1SA 1W36D 5CVDA 5EXPA 1DT3A 1HZJA 4YJHA 2AQIA 4L6IA 3TQIA 5T41A 3H5RA 3BCHA 3KXLA 2VP5A 1B8VA 4BLRA 1HRKA 2WE6A 3L05A 4LF4B 4Q66C 1I5RA 3M9NB 4I1YA 1L6RA 1U7WA 3KDSE 3EA5A 3K9BA 4RTNA 3OO1A 4BB9A 5HJEA 2QN2A 3IRUA 4ZCLA 1ZNWA 4DA4A 5FI0B 4AJ1A 2XZOA 5EQTA 4OREX 2PMKA 3KE9A 3H1GA 1ZYUA 3GQBB 3EEFA 1LWNA 1DKNA 5FKJA 3MJCA 3ZXSA 4QXRA 1ZK2A 4JUCA 2J0UB 4D3ZA 1OZFA 2FPOA 2NUPB 5AESA 4RADA 3BCSA 1DT5A 5FOVA 4OHKA 3RIYA 3GQCA 4O3RA 2HIHA 2FW9A 1M5RA 1DIKA 3RVKA 4Q19A 5IP7G 4GYYA 4OQEA 4TV8F 4B2YA 2H06A 1ZISA 2ZTLA 3KZVA 4PPNA 4YAGA 4B7AA 5ED0A 3DNPA 5JJLA 3BD6A 1R7RA 1Q1QA 16PKA 2H31A 3TSAA 1X1CA 3Q7QA 4PR3A 4JBHA 2Z56A 4KYTA 3S70A 1V7PC 3JY6A 2E5LH 1WBJB 2VJMA 4RDHA 3RRFA 2D2EA 3E5RA 3OPQA 1EEHA 5K0CA 1KO5A 3MWLA 3LSYA 1HDXA 2W98A 4QAQA 1D09A 2PR7A 3PDWA 2V5AA 1T5OA 3O93A 3KHRA 1EVLA 1ZFNA 4Y2RA 1P72A 2QV0A 3KT3A 2I4MA 2GAOA 5I5XA 4PZ0A 3QQ5A 1Q7TA 4ZVUA 5K3EA 1J8VA 1FP6A 5TVKA 3NBYB 3T06B 5T6MA 1V8DA 2EHJA 4NG5A 4L5AA 1YRYE 4HNTA 5D86A 2CFCA 2ZYTX 1C30B 5KWIA 5P8WA 1NLUA 2XVYA 3RODA 2VDVE 3H65A 1QM5A 3UZOA 2WP0A 2J5QA 3DZDA 1M2OB 5DXAA 5B3JC 4TS4A 4YK7A 5B4TA 1EA5A 1E1NA 2CNUA 1QPZA 4B3XA 1UWLA 4Y0VA 5EYPA 5BVHB 1IWOA 5IK2D 4UPEA 3PE6A 5EVJA 4UM9D 3BA6A 2Z9BA 2GARA 3AETA 3W2HA 4BX0A 3C5EA 1GUAA 2NT4A 1ZD2P 4XFJA 1MCZA 4FYPA 1Z0AA 1W6UA 2A9OA 4J7AA 4R0MA 1MT3A 3R4CA 2IZOA 3GDHA 1T9CA 1SHJA 5B3AA 5CB4A 4LSXA 5ISMA 3E03A 2PIAA 2Y6VA 3K09A 2LNDA 3TG2A 3TMAA 3IE2A 4P3PA 3LBIA 2AKYA 4II7A 2R7AA 2P4UA 4IO1A 5C37A 1SMKA 4HFMA 2AFRA 1X70A 3LYHA 4JJ6A 1ZGHA 1TJNA 1QGUA 4WNYA 4R3WA 5FFFA 2YN4A 4O84A 2GOYA 4X7PA 4ETWA 5DP1A 3KVOA 5IF9A 3DE1X 4X8OA 4BQIA 2PPLA 2XE7A 1FNSA 3QQPA 4LJ5A 3AK4A 4G85A 1OJ7A 1J42A 1QFJA 4QTTB 2OFOA 3U7GA 5C8YA 2X1HA 1M83A 2HMYB 2AJCA 4ZZIA 4ML3A 5B7QA 4R3UC 5BMVB 1JDJA 3S44A 1UJNA 4YRZA 3PFKA 3N28A 1W4ZA 3MRTA 5BYKA 4RSMA 4LMRA 1MD9A 1NU6A 3PIRA 4IYJA 1CNMA 4KOAA 1QGOA 4IEEA 2WWYA 3N76A 2H7XA 5IXYA 4L6CA 2PK3A 4YCDA 1N2IA 1JNYA 2G77B 4PZAA 1CG6A 3LYAA 1M2EA 5BV1A 3FMFA 1EVZA 3LQQA 4KRFA 3W9YA 1XJ5A 1DAIA 1FJGB 4P83A 5TR9A 1E98A 1EVYA 1FVOA 4EJSB 3EHEA 5CPBA 1RAHA 5I5UA 3ZEIA 4ZOCA 1Z12A 4YT2A 5ADUS 4WFIA 4XTCS 4XWYA 4WKOA 1FFCA 1JJIA 1XX6A 4BNXA 4MV0A 5FA8A 3V7FA 2WZDA 5EEGA 4QICA 1Z2NX 4HDMA 3Q8KA 4ZCTA 1XD2A 5JQGF 4LECA 3RC7A 4EHIA 2GILA 4FYKA 3LX6A 3NUGA 2WKQA 4BXOA 1VHJA 3IDZA 4YJDA 2BFOA 3E15A 4LOKA 2GBLA 3AUAA 2GEFA 2GZ3A 1NY6A 4K9PA 3IQGX 1C4WA 3CN7A 2C1EA 2ZIUB 1VYVA 2HMAA 3WMFA 4R2WA 4Z1MD 2F3PA 3PUJA 4BY1G 4GG1A 1B04A 3GNTA 2VCHA 2A9KA 3SHWA 1PHRA 4PWYA 3QHPA 4BB0A 1VGVA 4B80A 2X4DA 2NYRA 2WILA 3ZZMA 2IXFA 3BAZA 3NBUA 2IS1A 2B99A 3V2IA 3W9UA 1P9OA 2BFFB 4JL5A 5ALIA 4HGOA 4LW8A 4MAFA 4NJEB 2IOHA 4D3YA 1F4LA 3HU5A 1ND6A 1KDRA 2Z9CA 3KAQA 4GMXA 3EA4A 2W0SA 3SFTA 3AHFA 3IAAA 4UHBA 3ORSA 5LMUH 3GIKA 2YIMA 4D96A 1BVYF 2W90A 4GLJA 4RFLA 3MTAA 3AHEA 4CMIA 3CLHA 5B3KA 1IBKH 1OBVA 1GVHA 2EF0A 4IVPA 2QLTA 5K8JB 4NOLA 2L82A 5KG2A 3D3NA 3SLRA 1UDAA 2ISSD 3WLIA 5KQSA 4EQ6B 2OO3A 3BCUA 4V0QA 3A6FA 2O2IA 1VFPA 2H85A 4HRYA 1M66A 5KFJA 2HB6A 2PU7A 2Z1DA 3RUEA 3GLHA 1AD2A 1E62A 4PAGA 3R7AA 1SIWA 4B7ZA 1DXOA 1XMSA 2AFIE 3IUPA 3FZEA 3T9FA 4IHJF 2ACWA 2I2XB 3EIWA 2CXPA 5LZ9A 4U2GA 1C1XB 4FFMA 1RYHA 1XU7A 3NC4A 1D5CA 4V1CI 5SICE 2MSEB 5BT8A 4P84A 3H3FA 3MSCA 3SICE 4MPPA 2XKBA 5LNK1 2P5TB 1T5LA 2YY6A 4RFVA 1N36H 4D9IA 2A5FA 3HZRA 2C7OA 1IXKA 3VPHA 2YYYA 4IFTA 2M98A 1VCNA 4BATA 5C1BA 3JQ7B 1M34E 1WU7A 1FYFA 4GMFA 4KLZA 4LTNA 4QUEA 1MZVA 1R0YA 1E60A 2ZE8A 2XQIA 3I61A 3EZ9A 3EA0A 4MW1A 4QELA 4EITA 1RJ9B 3F46A 4FLEA 1D7AA 3ZGZA 3MCUA 1E6MA 1IBMH 5AHKA 4YP0A 2FW6A 1TIBA 3SNKA 3ANSA 3HBAA 4FEGA 5IASA 3BQMB 2Z8ZA 3RVSA 2PL1A 2IOYA 4DSOA 5KAPA 5AI0A 3CM0A 3JAWB 1LRLA 2LGJA 1V45E 3OBIA 2YUTA 4Y98A 1NRJB 1CRZA 3P2YA 3O1HB 3TXAA 2XADA 2Y0BA 4EI2A 4FWTA 5BUCA 3WWPA 3ROPA 1LTHR 5GVSA 2QL6A 3QWFA 3IVXA 3F6PA 1N5JA 1A4UA 2GN9A 1G98A 1R0KA 4E6PA 2BTEA 2NO9A 5G3YA 2IPXA 3LUAA 4D43A 2I62A 4JT9A 4Q9JA 4M7PA 1QQBA 1UPXA 5HX7A 1ZEJA 2F1OA 1CQJA 2BKXA 4DJFC 1H2ZA 2VNJA 4XLTA 3UPDA 5IWAH 4YHHH 1L7PA 3B38A 2QN8A 1JTVA 1Q2XA 1M2WA 3SQMA 2Z5LA 3SCZA 4M7WA 3THOA 2BR5A 2GETA 1PTJC 3FLBA 4D0RA 2GQRA 3T9CA 4MEAA 4LXGA 1AT1A 1JDPA 2C78A 3KREA 1V1RB 2QW1A 5ALQA 1WUIS 3BA9A 3CA8A 2VDOB 4CMFA 2QTWB 3GTMA 1IHUA 3G79A 3IQEA 1EKPA 2IOQA 3QVGA 5MN5A 4KR9A 4E3WA 4D9BA 2ZW9A 4FFOA 1CFJA 1DAGA 5AUNB 4YCMA 1XKLA 4N5LA 4LAFA 1MFZA 2QYOA 2JFZA 1IN5A 1BFKA 1OU4A 1GQYA 5DNDA 1II0A 4I6JA 1VJ1A 1I36A 4PPGA 4I14A 4EKGA 3MZ0A 4BJ5A 3RVQA 3ILXA 3MHTA 5LXTF 4FMDB 3TIIA 1SKUA 1WVGA 2H2AA 4LE2A 4D25A 4K87A 1XGKA 1SVWA 3AG5A 1CV2A 5KHOC 3S27A 4WAUA 5BQ5A 1UOOA 2O5EA 4WEQA 4QNNA 3S99A 4OXKA 4HBGA 2FZLA 2Z4RA 3NHLA 1AQYA 4OMDA 3PJDA 4BZWA 3V55A 3L6CA 1DUVG 1K6XA 3DEHA 4DVGA 1XAGA 3NM6B 4H2DA 3R9WA 1DHRA 4N0MA 1OXBB 2MT9A 5BO5A 3ZW9A 3ZBPA 3ENZA 5DXFA 2JFGA 3W6PA 1W2WB 2GBFA 1P7WA 3B6JA 2J46A 2FLPA 5KVAA 3W2GA 4WBSA 2A7QA 2VAVA 3L18A 2XA2A 4DJ5X 3D7SA 1VSBA 1CUHA 2XAUA 4PWQA 2BSQA 1ESZA 5K3CA 2HCRA 4IQ4A 3UTCA 4L4RA 1W85B 4UJ3A 4MUYA 3ITDA 1BTOA 2GLXA 3DMFA 1VG9B 2QIPA 1T9GS 5KIAA 1JHQA 4I8IA 4H3SA 2X5RA 4HYYA 4NPHA 1S9HA 2GM3A 3UJDA 3I23A 4UDYX 2GAJA 5I8WA 1ZN9A 5B3LA 2PZMA 3T5LA 4I46A 2ST1A 1P2FA 1QP4A 3OT1A 3PF8A 3UMCA 1E4EB 3K53A 2P2LA 2GPNA 2BV3A 3OZXA 3K7EA 2Z08A 5TY0A 3AVYA 1U0HC 1Y9ZA 1U2EA 3QNWA 5IEJA 2CC2A 2DT5A 2CXRA 2R6GA 1X2BA 3TX2A 3RJZA 3SE0A 4Q4JA 4OM7A 4MUFA 2PUAA 1RVDA 4YFVA 1S2NA 4JJ4A 5HRCA 1P8JA 1SY7A 4O3PA 1WEHA 3MJRA 4TV9A 4D1YA 4WT7A 2C2GA 4MI6A 1XTPA 1PJQA 4YUWA 3MTJA 3TIGA 4JJEA 4F6RA 1T6XA 1E4VA 1S2LA 1U5BB 4MQEA 5EFZA 4EENA 4OK5A 4N0PA 1DJLA 3ZCTA 3IDQA 1S0OA 3ONEA 3R3YA 1CJBA 3ABIA 4KR0A 1TM1E 3AY6A 2R0QC 1TKRA 3N2YA 3LUPA 1YZQA 2AIRA 4GOMD 4ZHQB 3FLEA 1P7PA 3QF4B 3ZHXA 1Y1LA 1O5IA 1UIMA 1I1QB 4J9UE 3C4QA 2PO5A 3LYUA 4HH1A 4CIBA 1YB2A 1XK5A 4DVJA 3B3JA 1EEXB 4J4BA 3WYGA 1CYEA 4IILA 3OLVA 2J9FA 4N3GA 4KJXA 1Z47A 1JSZA 3UTDA 1F7VA 2F9LA 3V8RA 4NJMA 3O38A 1OAKA 5IJ0A 1E6CA 1ZM3A 1Z88A 2ZS8A 4FYMA 1SQGA 3DKRA 3RG2A 2I1VB 3W9SA 5FWXA 4U1RA 1XPJA 3AW9A 3A3OA 2A78A 1KEUA 3UAXA 3R5KA 1A9XB 3C8HA 3GZNA 3WK4A 4ENQA 3TEKA 4B8ZA 1OXSC 2HYDA 5ALVA 1YS2X 1TYBE 3CCCA 4ZEOA 3CX6A 2D2XA 3EPJA 4MKZA 2SCUB 2C22A 5DBEX 5IT4A 1T43A 1HUQA 4ZYXA 4QE3A 4IZIA 1Z82A 4DLKA 2PYIA 4K9LA 4C07A 4AICA 2HHFA 3LA6A 4C43A 3N7UA 4MAMA 4EYQA 4P80A 4MI3A 1VDZA 2I71A 2EU8A 3G9UA 3AESA 4Y2JA 4MR8B 2FDXA 2Q46A 2BY4A 3P9PA 1DX4A 3DWGA 1OVGA 3N5CA 1FP1D 3B1XA 2G09A 4MRAA 1TTQB 4P7BA 4AG6A 1FRQA 4PZ9A 1AC5A 3FUXA 1M7GA 4B3MB 3LM8A 4D5GA 2B7LA 1H9AA 3NGXA 4UW9A 2OHHA 1H2XA 1TCAA 2VK2A 2BH2A 2BGNA 3SVZA 5G1PA 4D4GA 3PDHA 2QGNA 3L06A 5AVOA 4NVRA 3TBHA 5L95A 3GEGA 3THRA 3RBDA 4JFRA 1T0IA 2UYHA 2I3ZA 4NF2A 1YTLA 1SHLA 3GGDA 3GWGA 4CGZA 2BGTA 5JDIA 3JYHA 2C3MA 1CWUA 3CIFA 5K6RA 1YS1X 3ZJUA 2B1IA 4YLGA 2QRVA 2VDWB 4CWAA 3M4YA 4C7VA 2ZLBA 3WMXA 4LNAA 1GT6A 5EKSA 3N58A 3L1JA 1XMPA 2KJQA 3AQIA 1N2ZA 3U13A 4XGNA 3I5YA 4EEZA 2Q4RA 1B15A 1YGPA 2WP8J 4HVLA 1TT5A 1V2GA 1TNDA 1KS9A 2W6QA 4JVOA 5JSZB 3PPXA 3R7DA 2RHDA 4NX2A 2C31A 3WBJA 4BLPA 3B2EA 2I6TA 2JFQA 1NUSA 1G42A 4LOLA 1KI8A 2X7HA 5MF6A 1II8B 4U9UA 4EA6A 3JYQA 1NI4A 4REQB 3DVAB 4JYCA 3L1HA 4CM9D 3KLNA 4A3IG 3OZVA 2MHCA 2X7XA 3TTUA 4I55F 3N0RA 3ZTTA 1AURA 1JQAA 4ZOLB 4A91A 3U0GA 1Z26A 3GB8B 3N2EA 1OXMA 2A0XA 5JO9A 3TW4A 4P3KA 1OSNA 3AHJA 4DSAA 3SS9X 1JEYB 2PO7A 5TDHA 3H0KA 1AV6A 2P9GA 4ENWA 2F17A 4WTOA 2QJRA 3R3ZA 3PQ3A 1AGNA 5TPZA 1OT5A 3ESRA 1V4YA 2ZSBA 4DYHA 1GCUA 2OFPA 4TXJA 3L6DA 1OV6A 3VPGA 3S4YA 3HI6A 1PYGA 2HHCA 2L0XA 3FCSB 3MJEA 3ZE7A 4X8MA 1KY2A 1U3WA 3QTBA 2YXNA 4DIMA 4BKRA 1NBIA 1DEKA 1IY2A 1PX0A 4WXRA 1HETA 4BDTA 3IAM6 4QT4A 4UEKA 1EGHA 1C29B 3Q5GA 4Z3DA 2WFLA 5CBPA 4UJ5A 3QU5A 4FZRA 4NXNH 1ZXLA 3AJDA 3IPCA 3WWJA 1R00A 3KVYA 3IKTA 3QSYA 5CITA 2XCUA 2EWWA 4CU2A 3EVCA 5CA0F 2ODBA 3KZXA 3HOXG 1Q91A 4WADA 3WOHA 4RVNA 2COEA 1ML4A 1TUIA 2OD7A 2BFEB 3O8DA 3QPCA 2CHFA 5ELMA 1L5FA 1GL7A 3R40A 4RF4A 3JZDA 1SXJB 2A1UB 1SVUA 3ZBTA 3QNUA 4IRDA 1RWXA 4WNAA 3BMOA 2YQZA 2DP4E 3MINA 3OZFA 1MC1A 3EPPA 4X1IA 2Y92A 1N2CB 3AI7A 4G5XA 2OAP1 5FPQA 5AM4A 4INPA 3PZRA 4EGFA 3EH2A 3CNBA 3V2UA 3TD2A 1EFDN 3IPYA 3IJRA 3WGGA 2F1JA 2VA2A 2OC9A 1JPNA 2WDPA 1KI3A 2SHKA 5KYKA 1JFFB 3CNHA 3VR5H 2IWHA 2OO5A 4Y9TA 3F3MA 2AC7A 4I99A 1E5DA 3I2JA 4DIUA 3EFEA 1IBSA 2BCJQ 4B5KA 3DV2A 5ALYA 2IEZA 3H8SA 1SEVA 4RDIA 3D0OA 4HFRA 3GDGA 1T6ZA 1JMYA 2J3KA 1W76A 3BIXA 1MNQA 2WIFA 1JX6A 3D8SA 4CE5A 2ZJZA 1KZ9A 5D3QA 5SZHB 1JH9A 1UKBA 4IHAA 1TM5E 421PA 3VV2A 4PZLA 1XN1A 4BE9A 2HRZA 1JAYA 4PQGA 5SYMA 4YP9A 3LKVA 1CEXA 1FTSA 4WZBE 1JLRA 3NTRA 3NWOA 4QEKA 3QBTA 4IXTA 1QK3A 3ET5A 2EJCA 3SJCA 2J9YB 1FUEA 1SKMA 4UU8A 5DT2A 4RNCA 4ZYUA 1B14A 5K6AC 5EXSA 3R24A 3LQ2A 4AO8A 2VDMB 1ZGJA 1ZLYA 3U7HB 3SKYA 1L7QA 1EGQA 2FWIA 3MIIA 5HMLA 1LF5A 3LBHA 1U3GA 2I22A 1NF9A 1Y6QA 2V4MA 1RYBA 2G83A 2G0AA 2E2WA 1FSFA 1HV8A 1L5OA 4XB1A 1R27A 1RYMA 3MXTA 1NFRA 2P2YA 1PD1A 4O7WA 3NB0A 2ZJ4A 3PQEA 4KAJA 1OAAA 4DMCA 3OMLA 2QRGA 4WOCA 4BZZA 3F6RA 3CH6A 4W5WA 1K63A 5KNBD 1VIAA 3EPIA 1YB7A 4IF6A 4FXPA 5EI5A 1QUEA 4A2PA 1CD5A 5FV4A 4A8JA 1W2GA 4G4GA 2N1BA 1E3EA 4U5XA 2ZIZA 2ZUVA 3ROZA 1ADYA 5FWYB 5HOEA 1T35A 1OKKD 1DTSA 4MCHA 4CGYA 1YA6A 2C9YA 3O31A 3EPGA 1EFAA 3F73A 3BABA 1QH9A 3LP6A 4I19A 4WFQA 2X5KO 4H7PA 1M2KA 3BDVA 1Y7IA 3I6YA 4FUQA 4C0AC 1U4OA 1Z29A 1K3TA 3M8KA 3DLCA 4LH7A 1BYUA 2K4MA 3J81W 3QU7A 3UKOA 4EHFA 2CLEB 2FPUA 3LKZA 2V97A 3BXEA 3QBDA 5IABA 3DAHA 3UAGA 2F9MA 3F8WA 4W5QA 5EMKA 1HNZB 1QHGA 1JI3A 2C00A 4Q7MB 4EW2A 4RJIA 3WLSA 2CHEA 4UU7A 2AVNA 3QUTA 1BXRA 5HJ2A 4RXMA 3V80A 3PPVA 2CXXA 1A04A 3PTAA 2WDZA 1SVOA 1W5SA 3L7BA 3IOCA 1XN4A 4NMHA 1QXSA 3OIGA 5KYWA 3SU8A 5DCYA 4JI0H 4ENRA 4EHNA 4NICA 3ZHUA 2FR1A 4AM8A 2XGPA 4N5MA 4AN1A 4V2UA 1DV2A 2QRQA 3F1LA 4TSKA 1YQXA 1PFVA 4OP3A 5ALZA 1Y1WG 1XNQH 2JRCA 3OCJA 3QITA 1A1SA 1QKKA 3DKIA 1P17A 4CF5A 1TF5A 4NZ9A 5HKAA 3NG1A 5E25A 2CMKA 1PGOA 1PGPA 3B3AA 3OTHA 1ISPA 1G5QA 3WB1A 5AOCA 4HG2A 1M6VB 4FFLA 1DEXA 3RM3A 1U02A 1T1RA 3FSRA 2PEYA 1XKQA 2OG1A 1HFJA 1FC0A 3ZKWB 4DV7H 3BGVA 4LSMA 5JS6A 1XAIA 3ZWMA 5DH9A 2W8BB 4R69A 1CW2B 4M8NE 4G4IA 1RQNA 4BX2A 1YR1A 4Z49A 1B43A 4PYOA 2WYOA 3ERCA 2G9RA 3DDNA 3H8WA 2LDXA 2CXSA 4CL3A 4AF8A 1WVMA 5LVAA 2IYSA 4ZOBA 3H6KA 5IT5A 5I3CA 4MW6A 1SCAA 3SMQA 2C5FA 4S1OA 4DXHA 3H2YA 3HJGA 3SX2A 1C2YA 2D1RA 3DXYA 3Q1KA 4D92A 4EM6A 3QI2A 2SBTA 2D2VA 4NEHB 3Q8LA 3FYHA 1T8WA 1O1YA 4RAYA 2O8EA 5H81A 3RRJA 2QZZA 4RE5A 2B98A 1ILEA 2XNJA 1WDMA 3RGWS 2YZGA 1RYYA 1G21E 1P74A 4TUYF 1PE0A 2V9CA 4AJHA 5CG1A 5DVZA 4F7WA 2XH8A 3NV7A 5F98A 3NTUA 1X7WA 4X6UA 4GC6A 3KALA 5U4XA 1KU0A 2H4HA 1UT5A 4I5GA 1H6CA 3A1UA 3WLRA 4HWTA 1Q15A 4AZ0B 1N3YA 3WKCA 3JQFC 4D9HA 4G5YA 3F9RA 4KR3A 2RE8A 5AK4A 4ZANA 1NXQA 5C18A 2DFLA 4MR7B 4MV3A 3AERB 3GHYA 4QLAA 3GA7A 5EJEA 3FPAA 2WWXA 1XTVA 3NIFB 4ZIRB 5FUBA 1IZ9A 1QOZA 2QWXA 4N0DA 4MVYA 3D1VA 4D56A 3HUTA 1NUHA 1U4SA 4FGWA 1RE0A 3RS8A 3IT3A 2V7VA 3WBKA 2OWDA 3ZH2A 4CT4B 3WYDA 1IL0A 1U0SY 1YR6A 3QXSA 2QGZA 4I1VA 2REQB 4J6EA 4QRDA 2YZ7A 4BUJA 4N3CA 3LQKA 5I4BA 4RB3C 3T1HH 2VDJA 1SD2A 4KAAA 1GSAA 1DC4A 1A9QA 3N2LA 1RZUA 4Y8VB 3LC0A 1MXHA 3K31A 1H2RS 1SPBS 1K83A 4TLEA 3V4ZA 4FHGA 2AGQA 1EXMA 5F3RA 4MYCA 3T7RA 4A8TA 1SHTX 2HUPA 4HAIA 4F04A 2WIKA 4X7MA 2O3RA 2Z30A 4Q45A 2W48A 2I55A 3VNVA 3A9WA 4M87A 4DBLE 2BSAA 2QJOA 5C44G 4RS4A 3K4QA 3EQ6A 3JVUA 2VPSA 5K0GA 5T57A 1NF8A 4QXQA 3EXEB 4FOSA 3WLJA 1F8UA 5BRNA 3O1JC 1KMNA 4ALLA 2H7CA 1EPUA 3BSWA 1J5XA 1G2OA 3ZH9B 1Z2DA 5HHTA 4Q01A 3CZPA 1QNFA 4UE3S 1R4NB 5GZ6A 3EGXA 4HDAA 1IHYA 4GUAA 2QN1A 2ZYVX 5CW2A 5ECYA 2NZXA 2GKOA 5JS7A 2UAGA 3GPDG 2CJWA 1YDGA 4O8ZA 2YVUA 4B7CA 5GOTA 2EP5A 5ITZA 3ZCPA 1U7PA 3BQ9A 3O2NA 4K0RA 3BMCA 3SK0A 5JIBA 1M54A 1HTTA 1TAUA 1FQOA 1A76A 1MABA 2OM6A 2LVBA 4F1WA 1L3IA 3JQDA 1L7DA 4RVSA 4JUAA 1V8OA 5BOVA 2C83A 4OQQA 3CE9A 3URMA 5CVTA 2OGTA 3T1TA 4Q21A 2MYTA 3VU9B 4FNOA 5KYXB 3TFOA 2WKRA 4ZZ3A 4I4LA 4MB6A 2XUHA 4B4OA 2ZSDA 2YHIA 3OCYA 5JD3A 3G8CA 5GJBA 2Q2UA 1N7IA 2CE2X 2A6PA 3OPYI 3H6GA 5B4VA 2H1WA 2AI3A 4C7OA 3ILHA 3A9TA 1KEWA 2R2AA 3RFFA 5M2QA 1EX6A 2YDYA 1T5BA 2H5LA 3QKRB 1UADA 3NYRA 3C7CB 5CEEA 4LRXA 5JD4A 1ZK3A 5BORA 2Q6IA 1ZDMA 4QDOA 5KFUA 1P5HA 1C80A 2HU5A 4PM4A 2BJVA 3TF5A 2PZGA 4FEAA 1MFPA 4OYLA 3EODA 2WSLA 3BDIA 2SKDA 4EY4A 4Y1EA 1PVOA 4CFZA 2M6SA 4YVFA 3KELA 1RPJA 4BNUA 4M38A 3PNVA 5DB4A 5F35A 2HY7A 2AD1A 3AF5A 4L5IA 4LS3A 2J0VA 3WHIA 1MV8A 3RRNA 3K2QA 2D5IA 4BAUA 4LZZA 1NP7A 4B9AA 4D9EA 2HQRA 1QO9A 2PU5A 3OCWA 2NUAA 4Y67A 4NC9A 2B0CA 2O8VA 4ZT4A 3VV3A 1FNDA 2C77A 4I1SA 3V3TA 1YONA 1DG3A 5CCDA 2J3LA 1CVLA 1Q1EA 2R8RA 4YXFA 1ZMTA 2PXHA 2AJLI 4RK1A 2IW3A 3RUCA 4XWTA 2FFBA 5LU9A 1TTHA 3CZ9A 2O2XA 1WV1A 3FG9A 4BRWA 2R1UA 1KJNA 3I9FA 4KQ9A 1S3GA 2HVRA 3R75A 1QBKC 3TI9A 3ND9A 2YFYA 4ZAXA 4EP1A 3C41J 4TKVB 5A3QA 3C6ZA 3UAVA 4WHXA 4YRFA 1XDZA 1XMVA 2Z6UA 4CDNA 3RV4A 4JV2A 3TIVA 2P3LA 4J29A 4C7KA 1NW4A 5DTMA 2VNSA 1U8FO 2ZT8A 4IJQA 4RTLA 4RVOA 1RM4A 2NXJA 2GEBA 1OXTA 3BRWA 2QUJA 4NCHA 1UCFA 1Q5PA 4WOKA 3CKMA 3C8DA 2HJ9A 1EUZA 1P0MA 2JZCA 2DFTA 3LHIA 4RZQA 1EM8A 4YYEA 5LYJA 3OA2A 5ANRB 1BWRA 3ILSA 3OEYA 2CWWA 4B6OA 1EFRD 5LB2A 2R8IA 1DWPA 4QFDA 5KOIA 3JD2A 1SUPA 5JJKA 1YQQA 1JV2B 4W9MC 4JB2A 1VIMA 1ZIYA 3VNAA 1QOQB 3ANLA 3IP9A 1KSGA 3WRXA 3CPHA 1H4TA 4NYMR 1LS6A 3I2IA 1L4HA 4KVFA 4ZYYA 1BCRA 1WY7A 3DUFA 1GDHA 1WQ1R 3SY8A 4JBYA 2G4VA 4NR0A 2A5GA 4CV0A 1WMDA 3KZMA 2HF9A 4HDSB 3RT7A 1W5TA 2C2HA 2Z95A 4B76A 2VLBA 4GMHA 1EUQA 4GFDA 4OXIA 2HO5A 3TQSA 4D44A 3O95A 3WKAA 4R1LA 4LC9A 2VCEA 2GYWA 2ZRQA 1VKJA 1BWQA 3O2QB 2QTTA 3VU1A 5DMHA 4OKIA 1B93A 3QMWA 3VPXA 4H1VA 3U4HA 2D5LA 5FUMA 5JBQA 1WXDA 5C1DA 3DR3A 2A9VA 4I9HA 4FBMA 4LXUA 1H2HA 2E9SA 2G17A 1LSOA 1JVNA 1L7RA 1V1MB 1GEEA 3I6ZA 4DL2A 4IFEA 5BRJA 5J2UF 4F2GA 1L5SA 2BM8A 2GN0A 2AGPA 2OMKA 4FW8A 4G1VA 4J2OA 3ZEAA 5EWJB 2ZBQA 3BYZA 4Q3LA 2XTMA 5C81A 2B7CA 4HTFB 4MINA 4PHCA 3NHPA 5BQ3A 4GKKB 1OBFO 3WBBA 1GGJA 2AYZA 5KVSA 1PT5A 1Q0PA 5BNTA 3M4IA 4K81B 3NYQA 5ILQA 3IKVA 3PQ7A 4RM3A 3G13A 2NSDA 5IVKA 5B6JA 3T5HA 1U0FA 2QSUA 2GK6A 3IC5A 3T5BA 1G7CA 4BVBA 4OLAA 4ZYWA 1N34B 5CB0A 3H5VA 2HZBA 4OQPA 5JCOC 1FSSA 4GYJA 4YQWA 1HDCA 2W2VA 3DULA 1SFRA 3E3AA 5B2FA 1MTOA 3HY4A 1NNUA 3AZOA 3LP5A 4A2BA 2D1TA 2C9CA 1MF7A 3TZKA 1Z2AA 4H7EA 1E3DA 1XJQA 4CQJA 1G6Q1 3KHLA 4PXYA 3MAJA 1L5KA 4WUTA 3ULKA 2KLHA 1AGXA 3W4IA 3HUFA 2ZM6H 3ZQ6A 4BCBA 1XDWA 3G2IA 3G2KA 4W5RA 3GTOA 1EBFA 1PLLA 2D1YA 3E6AA 4TM5A 1W0CA 3IHTA 4WY8A 3LVRE 5HF9A 1OH6A 4XM0A 1WEKA 3ZDBA 5IULC 4S12A 3DL0A 3ZV5A 1E8NA 4CCYB 5T4EA 2P1RA 4YR7A