2YRWA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
419
structure length
413
Chain Sequence
HMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
molecule keywords Phosphoribosylglycinamide synthetase
total genus 120
structure length 413
sequence length 419
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrwA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrwA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrwA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrwA04
2QK4A 2YL2A 1A48A 5JVDF 4ME6A 3MWDA 4ZOLF 1IOVA 1B6RA 4TV8F 1JDBB 3R23A 4MAMA 4EABA 1Z2PX 2W6MA 1EHIA 5LOVF 3KAKA 2DLNA 3VMMA 3BSSA 5JH7F 4YAJB 1EZ1A 2PVPA 3VPCA 3TW6A 2R84A 4WBNF 1GLVA 4YJ2F 2DIKA 3RV3A 2P0AA 4IWXA 1Z2OX 1JDEA 3K5IA 5H80A 2Z04A 4ZHQF 1I7LA 4FFLA 1M0TA 4EGJA 4O2AF 3NUAA 4NYEA 5BPFA 3VA7A 2NUAB 1SCUB 1VBGA 4O84A 2W6ZA 4DIMA 2HJWA 4C5AA 4I55F 4O7NA 2ZDHA 2ZDGA 1KJJA 4O7TA 4O7VA 4O82A 1JLLB 1M0WA 4O7ZA 3GLKA 4O7YA 3ETHA 1M6VA 1KUTA 2YRWA 3LWBA 2W70A 1BXRA 2W6NA 4GGMX 1EYZA 1C30A 3LP8A 1A9XA 4ZI7F 4HR7A 1PK8A 2XD4A 4YJ3F 4MV6A 4C5CA 1GSHA 3UFXB 1OBGA 2Z02A 2V58A 4TV9F 4M9CA 5KX5F 2W71A 2R85A 4RZQA 1GSAA 2VPQA 4FFPA 1C3OA 4DLKA 3V4SA 5LXTF 4MV7A 4EA9A 3VOTA 4YBZB 4E4TA 2NU7B 3SE7A 2CQYA 5BMVF 3KAJA 4FE2A 5CAEB 5FNVF 3ORRA 4Y8VB 5CA0F 1CS0A 2GPWA 4O81A 3E5NA 1CQIB 3V4ZA 4O7RA 3VPBA 4MV3A 3OUZA 4EA8A 2GQRA 1E4EB 1GGOA 3HO8A 2X0SA 3AW8A 4IZOA 2NU8B 2ZDQA 4O4JF 1UC8A 5JQWA 3RV4A 2HGSA 5IYZF 3DF7A 4C5BA 4YB8B 5KKNB 2NPOA 1VKZA 5BPHA 5JQGF 5CA1F 2YZLA 3I12A 4M98A 3VPDA 4M9UA 4O2BF 3N6RA 3G8DA 1IOWA 1AUVA 4I4TF 3JZFA 4XYMB 3WNZA 2YWVA 4TUYF 3U54A 4YAKB 2VQDA 2YZGA 4M99A 2FPPB 5C8YF 4MA5A 5I47A 4IWYA 5D8DA 3R5FA 1OBDA 1AUXA 3G8CA 5LP6F 3BFPA 2J9GA 4FFMA 2YRXA 2VR1A 5C1PA 2XCLA 5HV6A 2GPSA 5LA6F 2C00A 2GQSA 5LYJF 4O7WA 5CB4F 2R87A 4O83A 2W6PA 1GSOA 1PX2A 1E4EA 4J6EA 3TIIA 2W6QA 4FU0A 2V59A 3OUUA 2R7LA 1KJ9A 3MWEA 4EG0A 1KC7A 2V5AA 1CE8A 4O7SA 4QSHA 5J2UF 4IHJF 4O4IF 2R6FA 2SCUB 4FFRA 2YZMA 4HQ6A 2WYOA 2I8CA 5GONF 3JZIA 3U9SA 4MV4A 1DIKA 2R7KA 4L1KA 5C1OA 5EZYF 3KALA 1CQJB 1DV2A 3R5XA 2QF7A 3K3PA 4O4HF 4WD3A 4EAAA 1B6SA 4I50F 4O7LA 1BNCA 4MA0A 1I7NA 4HNVA 5HBRB 1KJQA 3TINA 3R9RA 3QFFA 3GIDA 1DV1A 1VBHA 4MV9A 2FB9A 1JKJB 3R5HA 3TQTA 1UC9A 3RFCA 4O86A 2FPGB 1W96A 3K5HA 3KREA 2W6OA 1EUCB 4HNTA 3U55A 2DZDA 4EA7A 3BSWA 3MJFA 3TIGA 3ETJA 3Q1KA 2R7NA 3N8DA 4FFOA 4MV1A 4EGQA 2VHEA 2FP4B 3RUPA 2YYAA 4XYLB 3Q2OA 2R86A 1KBLA 3WO0A 1KEEA 2PBZA 4ZQIA 1WR2A 3HB9A 3U9TA 4XZ3B 2R82A 3WO1A 5J2TF 4O4LF 2CNQA 4IIJF 5DMXA 3AX6A 2YS7A 1W93A 1Z2NX 2YZNA 3HBLA 3BG5A 2I87A 1KJIA 3ORQA 4MV8A 2CZGA 2FPIB 2GLTA 5K2MA 2CNUA 2YW2A 3JRWA 2PN1A 4FFNA 4XX0B 2I80A 5JVLA 3JRXA 2CNVA 4HNUA 3BSYA 1EUDB 2YS6A 1KJ8A 2NU6B 2IP4A 2NU9B 2R7MA 1T36A 1ULZA 4FGRA 2OLSA 2DWCA
chains in the Genus database with same CATH superfamily
2ZUWA 1SHLA 4KRFA 1VL5A 3SKXA 3ZY6A 2F59A 2HMTA 1FRVA 3ADCA 3PEWA 3KK0A 2UXBH 1FU8A 4HAIA 4F4UA 3SIWA 1B8VA 2IU6A 2II6A 3FWZA 4OSEA 1CTQA 4BO2A 1I4TD 1M1YB 3OMLA 4HJRA 2FX5A 1RCFA 1L5WA 3DBIA 1ETUA 3NOOA 4TL6A 3BC1A 5AM3A 3GTOA 2I1QA 1RIIA 1K7FB 4NBSA 5IAJA 5IX8A 1EUQA 4KR6A 5BQXA 4V0MA 2QRNA 4RZSA 2W8BA 3H17A 4R8MA 4II3A 5A4KA 1Y81A 1XTIA 3MXTA 3T9BA 3K73O 1CY7A 4QO7A 4MRAA 2QV0A 1KP3A 5AJYA 3KNZA 1UJBA 3VDRA 5SICE 3REGA 1QFXA 4BIMA 1OJ7A 4FVTA 2QZJA 1QRTA 3B12A 3FSGA 2QB5A 2IITA 4WZZA 5F9NA 1NWCA 5B58C 4EHJA 3KKLA 4P08A 3U0VA 1NJ1A 3A32A 1SCIA 4IMRA 5GV8A 2WE6A 1PNOA 5DO9A 3WGZA 1IK6A 3N42B 2EYUA 2P41A 3FMFA 1IUNA 3FSEA 3NUZA 3WGVA 5GJBA 3KBOA 1D1SA 4IEIA 1AQYA 2XX3A 1FJGH 5HJ5A 1BG6A 5EJ7A 3UMJA 1C9KA 1HG1A 4LWQA 5EMHA 4TQAA 2HCTA 2FE1A 4PTZA 3LQRA 4UMFA 3V2HA 2XOXA 3KSBC 4CEJB 1NY6A 1OILA 4YMVA 5K8TA 3GGPA 3BJYA 3S2EA 4CEIA 2IXFA 4QXRA 2XXAA 1ECCA 3EXIB 2WTEA 3AR7A 3Q7SA 2ZIZA 1WHTB 2G7MC 1NDHA 4EEQA 3FETA 4XI9A 4MGKR 1TZKA 4NYEA 2OEPA 2F4NA 3CBGA 3CHYA 4P4NA 1PJBA 3ITDA 3R40A 1DCTA 3PIIA 4H7DA 2RGNC 1ADBA 4ZO7A 4ZVMA 4LY3A 4C43A 1VBGA 3SJZA 3OQIA 2V45A 4W5TA 2I99A 2VZ0A 5DNVA 1O96A 2GUGA 1OIWA 1E4YA 5GIOE 2ZRLA 1F60A 1TADA 1UXJA 1XWWA 1CR2A 3N2EA 4GIBA 4WK2B 4PR0A 1T9BA 1OKKD 5G4KB 5F33A 1L4EA 3BFXA 3ZD6A 1BRTA 1HUQA 3AGQA 2C4UA 5TV2A 4ZHSA 2V0NA 1CUEA 3UUWA 4R31A 2P11A 4LCJA 2G9QA 4D4HA 5LP1A 4KR2A 4JVNA 3AYHB 2GHRA 3AHFA 1NRIA 3H05A 1YRYE 4Q01A 4BB0A 3BJIC 5KNCH 2QUHA 3RFFA 2CVPA 4QPDA 3KJNA 1UADA 4UNSA 4YRQA 3VSDA 3OFJA 4RMGA 2ATVA 2WSIA 1HFWA 3HXKA 3OCVA 3S8MA 4IVPA 1JH8A 2QAGC 3H0CA 3MUOA 4UU0A 4CR8A 5B58T 4X8OA 5EHXA 2JLBA 2ZR9A 4LTMA 1XHEA 2CDCA 2PUDA 1HC7A 2QKYA 1YTLA 3C14C 2RGRA 1C1XB 5I5WA 1W25A 5KPJA 4O3SA 1C7IA 1MAHA 1TAHA 4GICA 4FN4A 3SIXA 4AS3A 4BP3A 2QZSA 3P94A 3SBEA 1EYZA 1PR6A 5M34A 2FPOA 1NF3A 2VLIA 2EW1A 4GVLA 4P3XA 2H65A 1NQ5A 1WUTA 5TPZD 2NVUA 3QOFA 3O9ZA 3TX2A 3KU1A 4E6PA 2OH2A 4FJ0A 2EKLA 5DYWA 2J9FB 2X9VA 2DUUA 4K3UA 2DY1A 3LYUA 1OFUX 3D6UA 4OV6B 4A2PA 3OQ6A 2A3NA 1R64A 1V3TA 2B6HA 2FPKA 2Z30A 3F8TA 4FTWA 1NT2A 2NU6A 4XD7D 2VRCA 3OOWA 3WHLA 3KUXA 5AM0A 3GTLA 3GLUA 3OP1A 1N2OA 1WMFA 1KNQA 3FPKA 2KB0A 4Q1VA 3EWSA 4Z99A 4WRRA 2C88A 4CLEA 2IGBA 1XRJA 2PZAA 1CY6A 3VKGA 2X7XA 4D4LA 2CFOA 5K0TA 4AQ7A 2FMHA 2HLDA 4O3FA 5DHFA 4P0QB 4FZVA 1UR5A 4HTFA 5IYCG 3K9GA 3R41A 4LOLA 4Q9LA 1VG1A 2I2XB 1GTJ1 4U7DA 1GFWA 2XSZD 3U7RA 3L40A 4KQ2A 2ZB7A 4RKEA 2WF5A 5KNDA 2ZRQA 1OJLA 3ZXYA 2ERXA 3HUTA 1YS1X 3OZIA 2C96A 1HQDA 1NHWA 2FV8A 2PRZA 4HB4A 4KIGA 4J90A 4QU0A 1PFYA 5DBIA 1P4HA 1S3SA 3KYJB 4MWOA 4FYJA 4IIHA 5JPCA 1WV0A 2IH5A 3M49A 1QAMA 4HXGA 1Q1AA 3BFVA 1H2XA 2V9PA 3CLTD 3R7DA 3PD1A 4ML3A 1H8HD 1XCMA 3BHIA 4WNCA 4MTDA 2AOTB 1O9BA 3HI6A 3SZMA 2MCFA 5CFQA 1P4JA 1CIVA 3U5TA 3V1MA 3T3GA 5EESA 3RC7A 4CMGA 4ETSA 2VUMA 1JHRA 5EPEA 2IS2A 3D6TB 5K8CA 1L7MA 3JARA 4JCOA 5IDYA 2NSJA 1W85A 3S27A 3WWZA 6REQA 3HYCA 4OXXA 4C1BA 4MHTA 4DUZB 2AR7A 2BISA 3GQVA 4QYTA 3OUZA 1Y63A 2ID7A 4IIBA 1EGHA 6LDHA 1U0BB 4RH3A 2PUJA 1NVKA 2DLDA 3OA0A 3TK1A 1FFBA 3KX2A 2WJAA 3UN1A 3RAEC 3NHYA 5TEVA 2KBEA 1QFZA 3L6BA 1B0AA 3IKJA 4CN9A 3WC4A 4CYMA 3QBTA 3WSWA 4UZSA 1CBUA 5IZCA 3COVA 4XFKA 1BN7A 2K2WA 5THXA 4IINA 1BFDA 1L7QA 3M6UA 1O87A 2H16A 1E20A 1HOTA 3C1OA 5G1OA 5G4LA 1ISGA 3HCRA 1PWYE 2MSLA 3WKCA 3WYCA 4ZGBA 1SC4A 4TQRA 1AKYA 3STHA 3UV7A 4CFSA 2WVAA 1KDZA 2QLNA 1TVMA 1IY2A 3WXMA 4C0LA 4YX9A 5HM8A 4JYAB 5KFIA 5ED4A 2EVWX 4ALNA 1LPMA 1GNTA 1OI7A 1KIMA 5FUYA 2WICA 1WDTA 4BAGA 3NCTA 4MITA 4U2EA 2SCUA 3ZWCA 2HF7A 1ZC4A 1S8AA 1U4OA 1ZFNA 4E2FA 4ZI3A 4YP9A 3UJ9A 1TYDE 2P7HA 4XYMB 2R7ZA 1T36B 2EG5A 1PFQA 1NXSA 1X38A 4TTQA 3K9CA 5AOVA 5JNRA 4H7KA 2IJGX 1U4NA 2RGXA 2XRFA 4G9GA 1N2SA 4JB3A 3K6SA 1UXKA 3GP3A 4IG4A 4YMTA 3NT2A 1F0NA 1K1QA 1DQRA 3JU3A 4NBVA 1XVTA 2V5VA 1IY0A 5LVAA 3R7WA 5EJEA 4IRKA 1BRMA 4W7HA 3AWIA 1V16A 4BXOA 4AYXA 1EXMA 2Y4NA 2LV8A 2V54A 2ZCJA 2FRXA 1GPDG 1MFPA 1BXRB 4ARUA 3HVIA 3EE6A 3KHKA 3TW0A 1UMBA 2C9ZA 2BUAA 2V7EA 2ZBPA 3LOQA 1PR2A 4PQYA 4WCFA 1X1BA 2ZVDA 1MQ8B 2ZI5A 3TXYA 3LT2A 2GT1A 4ACAA 2D2IA 1N33B 4POAA 4LBYA 4QHTA 1SVSA 3DYIA 4X20B 1P73A 3EZGA 3R7AA 1U2DA 4QDOA 4DC9A 4PZLA 5BR8B 4WPGA 3QUBA 4Q4HB 4ZAFA 1SVUA 3FCSB 1F3OA 3JAWA 1WCMA 1RPAA 4LZPA 3ZKWB 1VI2A 2ZBEA 3Q8SB 1F0KA 1YL7A 2FRVA 2GNPA 1TLFA 2AN3A 4DDKA 3AIMA 1M7BA 2IYZA 4MS4A 3FOZA 2FG7C 5A03A 3PQDA 3AB3A 3NYIA 1FMJA 5A7FA 1Z6AA 3OHBA 3AI1A 2Q2VA 1S2MA 2GPNA 5BRNA 3W2GA 5K8JB 3DKRA 3RRZA 1ET0A 1ISPA 3A3OA 1JDUA 1XN4A 3C6YA 4R8RA 1UBNA 3TZ6A 5EINA 5SY4A 4CM8B 3AHHA 4IL5A 1ATZA 4PG5A 4XIGS 5EWMB 3ZDDA 4CU2A 3PHIA 4GPIB 2JFOA 4G1CA 1KJ9A 3MWEA 5CHYA 4ZPXA 4IDPA 4V0LA 3NAGA 3SJCA 1KR5A 2A5FA 1R9GA 5I9BA 2ZBQA 3CH6A 3DE1X 1ZI6A 4GX2A 1X9NA 2A5LA 2Z2IA 5CT4A 4HN2A 1SIWA 4BQOA 1OSNA 1QH9A 2VAMA 3F5SA 3PW4A 2Q3CA 5J2UF 4DNOA 4RK4A 2CVQA 1HDZA 2YVAA 4Q66C 3K72B 4JUDX 2ZI9A 2R93G 5I5YA 1U8YA 4FS1A 2O23A 1RZ3A 3A36A 3ICEA 2G9UA 4IDFA 2JLYA 3ND5A 3EULA 2A1HA 3RGXA 1N36H 1BVYF 3TJMA 3KPJA 1FUUA 2HHHH 1Y5LA 2WIFA 2H29A 1I3QA 1DAFA 4PX9A 4RABA 3WLEA 4APMA 2FPUA 2HA4A 2GEFA 2LW7A 4Q48A 5E7IA 2IEGA 4ZDKA 2RH5A 1IZ0A 5BSVA 2V7GA 2I8CA 1DWPA 1JQJC 2WYIA 3PXXA 1XHLA 1F8GA 2PL5A 2QJFA 2IYSA 1P5JA 3PGJA 2FK3A 3ZDRA 4F92B 4W7IA 1P45A 5ERYA 5JJKA 4WH0A 2PLRA 5JJBA 4CEJA 4PC1A 5D3MA 4Q43A 3MR6A 4XA8A 3LO8A 2ZVPX 3IHTA 2HA2A 4L07A 4DCPA 5BN3A 1GGHA 1U2PA 1CQJB 1CULC 5C53B 2H4HA 1X13A 2AVNA 3I1YA 4DR4H 2WF8A 4BNTA 5AK3A 4BHTA 4X44A 1RYZA 1K9SA 1U3UA 3RIMA 2YN4A 1IATA 1MPTA 4QPJC 5DSTA 2V7UA 4UM5A 2C2OA 3S4YA 3QI7A 2AZMA 4W8GA 1FTNA 4BV9A 5BSGA 1Q95A 4TLMB 2JIBA 1FFCA 3ZHRA 3FCYA 5EMKA 2B69A 2J85A 3VC7A 4O7LA 2QMHA 4LCBA 5I5SA 1HO3A 4HB3A 2FEXA 4HYTA 3EXG1 1IXKA 1E5XA 4XJTA 2DUWA 5E9QA 2KYRA 1BHO1 5FTJA 5M5BA 4EHIA 2ZRPA 3U5ZB 1JAHA 2HQSA 3OZWA 1N3BA 1IBRA 3U4HA 3QFFA 4QATA 4EA6A 4TS4A 1N34B 5IP5A 4Q3DA 2FZEA 4MV9A 4GWKA 5HMLA 1G42A 5EIAA 1D5CA 5KKAA 3AGPA 4L5BA 4L78A 3UWOA 4COOA 4LF7H 1BCSB 2IS4A 1W44A 2EBFX 3E9DA 4V2IA 4LF6B 2FHPA 5LJIA 3KREA 2I71A 2YX1A 2ZJ1A 3C6QA 1A97A 2H3HA 4M60A 1NLYA 3C3MA 4QPPA 5TGTA 4MQMA 5JCOA 4A2WA 1KOFA 2DFTA 3A6LA 1D8AA 3G5LA 1YQDA 2H48A 2J3QA 1I7DA 2PZGA 2EJWA 1JDBC 2L69A 5C7IO 1PZFA 1OF1A 1WP4A 5BSTA 4N76A 3S81A 1IBSA 1VHJA 3PL1A 4NZZA 5G0UA 3QLTA 3L1HA 3R6LA 4OOFA 1OH7A 5D1NA 1GT6A 1WKBA 3ETJA 3ESAA 3PQCA 5NLLA 1N4AA 4AUMA 1EFUA 4IIJA 5KYWB 3BGIA 3MCWA 1QCDA 3CVZA 2G06A 2HI0A 2JHPA 3EQZA 4KDFA 4KN9S 3SD7A 4BVBA 1NFRA 3EASA 4B3XA 1O94A 3ZE7A 4MCIA 2A1TR 4GR4A 4R40A 2SKDA 4DBLC 2ZETA 2XZOA 2VNJA 2Z2JA 4LRWA 4MKXA 3L4JA 1FUKA 4EGQA 3T4UA 3ZD8A 5LQRA 4TVBA 3M6IA 2ZJ5A 4KYVA 4C4YA 3Q7EA 3ZHCA 3MR5A 1NRXA 4I46A 4RTQA 1A69A 1LW6E 4CTOA 3BFKA 4YRMA 4OU4A 1P5HA 3CMMA 2PKEA 4ZVNA 4B40A 1H8EA 4M76B 4AICA 2XB6A 2XE8A 4WDRA 1OC4A 2CKZB 3D7RA 3SC2B 2UUOA 3HHEA 5J9FA 3R8XA 2ZZKA 3AL3A 5KJ6A 2OAGA 2WYUA 1L1RA 2WB4A 2PWYA 4IQGA 1OXUA 3AUFA 2WM9B 4YDSA 2GKSA 4KR9A 3UG7A 1SO8A 1NP7A 2D2VA 3QVTA 4BP1A 2G1JA 1X80B 4BMYA 4L8VA 3C8HA 5IT5A 3I01A 2UZAA 2JLZA 2H54A 2ZSBA 2AC4A 4PC3A 3KJQA 1A27A 1RAFA 3IYLW 2C20A 3BG5A 3IKMB 1W36C 3NIFB 1MRNA 3IQZA 4A10A 5FJ8G 1THMA 4ZODA 2CUKA 3LPLA 3U26A 2DJ5A 3P9KA 2J08A 3V8VA 2CZGA 1OX4A 1QQ6A 3FYTA 4GOOD 4NV0A 2XDQA 4OYLA 4QELA 3IV9A 5CH3A 5CYFA 3N8GA 3KQNA 3INTA 1MENA 2CXTA 4F8JA 4DN6A 4LF9H 1I2AA 2ZXUA 2WDPA 5EP2A 5FPYA 4AMBA 3DOJA 5BSRA 2FWIA 1MC1A 3JVDA 2EP5A 3S24A 1RM3A 4DILA 1X19A 1GKYA 5ABPA 2AEJA 1JKMA 2BSAA 4XJXA 4V24A 2AMFA 2FEKA 4PPFA 4A0SA 1USIA 2IX3A 1V8OA 4TV9A 4EJ2A 3S1SA 3N43B 1GPNA 4FS2A 1E59A 2GXSA 3BJMA 4AJPA 4FE3A 1ZXLA 4RQUA 4TVIA 2J6IA 1Z3CA 3C16C 3CJRA 4LDPA 2HMUA 5DB4A 1G8GA 5JRJA 4DRXB 2PUGA 4CF4A 1NM5A 3FFTA 2VZLA 1PNQA 4OX9B 4FBLA 2FMAA 2NU9B 1HLDA 3TOCA 4LFCH 4YN3A 3QKRB 1EGQA 1QE5A 3FBTA 3FYUB 3NVDA 4EUEA 3G2KA 5F12A 3RUCA 4NPHA 3ZU5A 2E9SA 3TQSA 4P5DA 1TEZA 1ULZA 1NTOA 1VJDA 1VP9A 2F43B 4BVLA 3CPSA 2W98A 3OIDA 3MGCA 3GLFE 1GG2A 2RMKA 3PGKA 4YALA 5DGXA 4ECEA 1ECLA 2XWPA 2KLHA 1FNDA 4AS2A 2PR2A 2AU0A 3N2LA 1FDUA 2BLLA 3PDIB 5H59A 3DLAA 1HDIA 4HXEB 3QVXA 1EU1A 1YQ9A 3QW2A 4MVJP 5E6RB 5ELLA 3LPNA 1UEIA 4A9AA 1TWCA 3O83A 2WRZA 4CT4B 4G0MA 4EHDA 1GDTA 2FFRA 5KQSA 4KFTA 4WE3A 3W6UA 1IBKB 1G98A 2AV6A 2Z2YA 4Y7CA 3U7EB 4B74A 1T9GS 2OD2A 3O38A 4HGPA 3Q98A 1JMVA 4I4CA 2ZRFA 3M3PA 4N7JA 4AZ0B 1TUBB 3WI7A 4CMJA 5DQIA 1CY1A 1RRCA 3KLNA 3TD6A 3DA8A 3I9FA 5HQTA 3PNKA 1WMBA 4ROSA 3KWMA 4HRXA 4PC2A 5AM5A 4H1WA 3EJ6A 2QTBA 5GM1A 2OSVA 2XNCA 4QDTA 1ZLXA 5J4LA 1UOEA 5LMUH 4DR2B 1XNRH 3GQCA 5AXBA 1ZVVA 1XK5A 4A6PA 3EPIA 2XT0A 4XWKA 4BBSG 3BQNB 3SWWA 3CWZA 4BQIA 2N1MA 4BXXG 2ZJFA 4O4JB 1J9GA 1LS6A 3QX7A 5ENZA 1V43A 5L1LA 1G3RA 4MIOA 1ZVJA 1TB4A 5AVVA 5JAIA 4A15A 1UFRA 5PNTA 3K5PA 5DISB 1DRWA 1MX9A 3RSQA 2ZE5A 3KEFA 1M9NA 2JH9A 2F1KA 3A4NA 4CKEA 2VOBA 1UDBA 4YMWA 2VT2A 3NTUA 4LTNA 3G2IA 4KCGA 2RDIA 1PL8A 4EITA 4W5OA 1GZ3A 1N25A 421PA 4XXHA 2AG5A 2HJSA 3RFTA 4CMFA 1K3UB 3EC7A 1N2EA 3TAUA 1KF0A 1FP7A 2CFIA 2OHIA 3SS9X 3TTTA 4O84A 2PSFA 3AQ4A 3JWEA 3F74A 4A3SA 2GHQA 5THQA 4ZU3A 3CJTA 4ZIRB 3GUUA 1HQCA 2G6BA 1TKRA 2IZZA 3I30X 3RUAA 3JWJA 3SYRA 1YJQA 2FSSA 5KQLA 2XVZA 4B84A 5H0IA 2V4RA 2ZJZA 1BMFA 2VWHA 4EJ0A 1E8NA 1Y9JA 2BEWB 2O7NA 3COPA 1T3HA 1XAGA 1ZQ1A 3B78A 3E18A 2YYYA 5ESDA 4UE6A 4ZJUA 4M21A 3MZ0A 5LUAA 1XSEA 3Q3JB 1DCFA 2OYRA 4G85A 4CI9A 4HN9A 4FNAA 4HH0A 3DZCA 5ER6A 5IHXA 1Q83A 2J3MA 4IR7A 1T8RA 5AOBA 1GUZA 4GPD1 1J21A 2PMBA 3PIDA 5P21A 3S5JA 2V6IA 1FLNA 1Z22A 2WUDA 5EIFA 3RK0A 2BZ1A 4AZVA 1YCHA 1H2RS 4I8XA 4RHUA 1ZHSA 1KY3A 4L27A 3ROZA 1FVXA 5KFYA 5DEOA 3R8CA 1X8JA 1V51A 3NONA 3MUFA 2EJVA 1NXTA 3CWQA 5HK9A 1IM5A 2CUNA 1WB9A 3AHCA 4S1PA 1ZUNA 1SQGA 3N87A 5DVZA 4TM8A 4JITA 1HLFA 4YROA 4R7RA 5DHSA 4E5VA 1N8NA 2AFIB 2ISSD 2QNBA 2KWIA 2OMKA 3TXAA 1O6FA 4IGAA 4JEMA 3P27A 4M9RA 1EFLA 2PUBA 2XECA 1PEYA 1GADO 3MR2A 3T61A 2Z3VA 2VSFA 1SA0B 1DTEA 3CCFA 3FNEA 2HU5A 3AKZA 1A7KA 1JYEA 1PDVA 1XQ9A 4N7BA 1R6DA 1URPA 2XUHA 5AI0A 3RF7A 4A6XA 3ELYA 1B6GA 1AXRA 3L4EA 3O74A 4FIZA 1A95A 3CPEA 4BUJA 3F0TA 3H2YA 4QHSA 4X8LA 1YZGA 4AO8A 3HU1A 1SVIA 1G6Q1 1OHHD 5A6VA 1YIDA 1RLOA 2FKNA 2XGPA 1Q0PA 3RUDA 3IQWA 1DSSG 3OCYA 4O0LA 4PGFA 1MRSA 4YA6A 5KKCA 2RKOA 1SXGA 2YHIB 4GX1A 2WB2A 4JMLA 2YWFA 3RPEA 4YR7A 4L8LA 2OENG 4LOAA 2OSBA 2R8RA 1TQDA 4J75A 3N0VA 1IHYA 3GDEA 2IP1A 4CF3A 4DQNA 5FUQA 5C44G 3CF2A 3KQHA 1ORRA 4UFZA 1ESZA 5ERGB 2JC3A 3MAAC 4IKEA 1EIZA 3KZ1E 2FSGA 2QMOA 5BXQC 3I6BA 4MJ7A 1FFGA 1HDCA 4YRZA 1KEVA 5BR7A 2JA8G 1R3UA 4PF1A 1T3NA 4E07A 1J8DA 3O8BA 1SQSA 1Y4UA 4JV1A 1YMQA 2CHQA 2R3SA 3PZPA 4X1KB 4YV7A 1RYYA 1WKVA 2FJPA 1YC5A 1VLHA 2QZ9A 4JYBA 1QIHA 1P5FA 4RW0A 2X0JA 2AGVA 2OZKA 3DMYA 4OQQA 5F5NA 2O2HA 1QVRA 1QK3A 3TCKA 1YB4A 2UXBB 4F4DA 1V7CA 2HYDA 3OZ7A 4KQ6A 3M9NB 1CR6A 4PAMA 1R0SA 3AT1A 1MJNA 2A94A 2GLUA 4ZT5A 3T9AA 4QT0A 1KO5A 4FC7A 1N92A 3OSPA 4F3CA 2WM8A 2NU7A 1AKWA 4XIJA 5HE9A 3OFSA 3EGXA 4AURA 1IJEA 1SHUX 1ABEA 2Y8EA 5IP7G 1EI9A 1M2KA 1MJGM 4MWDA 4R5HA 4RMJA 3VKUA 1N48A 4HDRA 4B4KA 5HPYB 3A2KA 3ZS8A 2Q2UA 1BE1A 1G7TA 1XTTA 2Y2VA 3U3XA 1XZIA 1CUZA 1TMKA 1KE1A 3FAZA 2HSJA 4HFRA 3U4DA 4KLZA 5TMEA 4HNHA 1Z6ZA 4N5DA 2Z6UA 2C0QA 3FG9A 2VTBB 4Y2SA 3WLRA 1M2VA 2VJDA 1DAPA 1DHTA 4M1KA 4Y2PA 4E09A 1D04A 2XA1A 4OHBA 3N5KA 4N6OA 3VDMA 5LMNH 4GPZA 1GVNB 1M67A 3G6KA 5J5AA 4CLOB 5KNBH 3ECSA 2E48A 4M98A 1BCRB 4WKNA 1E0DA 3EOAI 3KQVA 1EJBA 1WQ1R 2W11A 4KSBA 4JUFA 1TJ5A 5AO9A 3RS3A 3ZE2B 1EFPA 1SR8A 4DLBA 2CWDA 5EQFA 4EB3A 2VA9A 5I9SA 4WLEA 4UTOA 1OBOA 1FVOA 1KAEA 3UHOA 3ZWBA 4IDDA 4LHZA 5KYVA 4XDGA 3FR8A 1HR0B 3LQ2A 1YA4A 2P7IA 4FGJA 3L7OA 3FPSA 3MBKA 2B25A 4NYMR 4JQZA 3UMYA 2V3VA 5I47A 3HYSA 3VNUA 1CKNA 4U2CA 4EYHB 1NJ5A 3LUPA 2XMQA 4FBUA 1ZIDA 2HIAA 3JSLA 3R5FA 4U7CA 3LHIA 2IDKA 1KZYC 3DGFC 3EQ8A 5LP6F 2ARKA 2YNMA 5CD9A 1FXSA 4OSPA 4RF2A 3D8RA 1K88A 3EPGA 1KKLA 1YULA 5IF9A 4AKHA 4IDGA 1E9DA 1LFDB 2PRIA 2TYSB 3L04A 4MIYA 3EPJA 4HMOA 1ZIPA 2O54A 4H16A 1WMDA 3RVRA 1AT1A 5JYCA 3DC7A 4QOFA 1N5MA 4WERA 4WNIA 2XUIA 5DNUA 4QM6A 1MEEA 4DOMA 4EJSA 1KMHB 3OD1A 4Y9UA 4FNMA 3AOGA 2O2GA 1VXRA 3QKRA 2IY8A 1LD3A 1KYQA 2P79A 1Y8CA 3GVIA 2PTGA 1CY8A 4FUTA 1P0CA 4CG3A 2ZKIA 1U81A 2X15A 3HBAA 2EEPA 1CF2O 4WDQA 2VPIA 4YB8A 3GTKA 1LLCA 2ZWMA 1U8XX 4C04A 3FFWA 4XWOA 1Z4KA 1R18A 1CJUC 5A1TA 3EQ9A 1JSLA 1FNNA 3OUUA 1E1NA 4YP3A 1Y3FE 4XLLA 4DPMA 1ZZEA 4MIKA 1Z0AA 3GLGE 1DI0A 3FD8A 1DBVO 4O3OA 5MGNA 4BPBA 1G0NA 3NBZC 1MG5A 1AXEA 3UEOA 3A2MA 5KFOA 1ZVKA 2FQXA 3M1IA 5I9TA 3ZI7A 2QW1A 3FXAA 4C29A 1M8FA 1X0VA 2PZLA 2QJTA 1PJ4A 2VHQA 1EP3B 1YFZA 3LU1A 2F3UA 3TE7A 3G17A 2H08A 2R25B 1VIAA 3LHSA 1FOEB 4RHCA 5SY9A 1ZUHA 4R98A 1XVUA 4URYR 5KYGA 4Z6KA 2W58A 3EMBA 4KQHA 3LQ1A 3LQYA 3LXMA 5ALKA 1SK8A 3ICOA 2QTNA 4QAQA 2XGQA 5ILGA 5C3EG 1Y3HA 2HH9A 1XNGA 3HYLA 1QIIA 2EZTA 1R6BX 1Z4MA 3STWA 1JJAA 1JQAA 1JJIA 4AJHA 1OZHA 4NJEA 4XWGA 3FHJA 4QA9A 3T7EA 3OHSX 1UZLA 4HTAA 2WJHA 3VZCA 3N2IA 3ZCVA 4CM1A 4ES6A 2RHWA 5KMGA 1CKEA 1ECGA 1C5KA 2A7XA 1SNYA 1E62A 2OPBA 3C3EA 3L7DA 4Q3OA 3SVZA 2HMWA 3HDTA 3UCXA 3THXA 1H3EA 1EVIA 2CCJA 3RGWS 1J0BA 2EZ9A 3DP9A 1OLUA 3KSRA 4JENA 2HO4A 3OIWA 4IUDS 4CKCA 3DWGA 2REQA 4MO9A 4EDFA 1C3LA 2GO7A 4EFEA 4RIEA 3KE8A 2ECQA 1JE1A 2WMYA 2YV4A 2G4CA 3PWKA 4RF3A 3DDWA 5JNVA 5IPFA 1DAHA 4HQFA 1FMLA 4DMMA 2IBSA 1YNOA 1Z9BA 4R9SA 2Q1SA 1JLRA 1KVTA 5J1SB 4CMIA 3BQ2A 1A9YA 2HX1A 2YWBA 1S2OA 4LJYA 5LUBA 1KOGA 5B6JA 2JGIA 1SC6A 2REQB 3LKDA 3JQFA 1V41E 2ZUDA 3IP5A 4A3FG 1G8JA 3U31A 3ZWWA 4DZZA 2FYTA 3MINA 4MUYA 1FDSA 4YUWA 2QU7A 1E89A 1MAUA 2PYZA 4ZYYA 5KU1A 4P38A 1IZYA 3C2QA 4HOYA 1JLSA 1H2YA 1W8IA 2MYNA 4LC0A 4R83A 2V97A 3KQSA 4G5HA 1F2UA 1UBFA 2GK6A 4WGFA 2R1UA 4M0PA 2X86A 5LQSA 4QKQA 4OMCA 3HGTA 5EIOA 4CL8A 5CD1A 1EA5A 3S2SA 2W2QA 1XRMA 5FDFA 3BF7A 3ET4A 3GIDA 2CSUA 4H77A 1DKQA 1WZEA 3H0GG 3DFKA 4OBBA 4YRLA 4CEHA 3A6FA 1CY2A 4K2HA 4G8DA 1WE2A 4YCJA 2ZTMA 4LVUA 5BOVA 3LT4A 1ADYA 4C01A 1VYHA 2I03A 4OH7A 2ZJAA 1M10A 2HBYA 2VDJA 2OECA 3RFCA 3JZDA 1FP4A 2XA9A 4JC8A 1B33N 3HPRA 3JZMA 3S3TA 1CSEE 2GCOA 4I7HA 4CCWA 4JYAH 1PW7A 4D8YA 1G64A 4FIDA 1SG0A 1I94B 4L9SA 1FTSA 4NG5A 3HDVA 4HS4A 2BW0A 4HNTA 4QD3A 3PL5A 5IUJC 1K8RA 4MWZA 2QT1A 2ZAYA 3NO4A 2NADA 3DCIA 4JVOA 4R7TA 2EWWA 2W83A 4RB1A 1R4AA 2Q1UA 2WAAA 4JUAA 3EOZA 1NQAO 2ONKA 3PQ8A 4C20A 4E94A 2JGFA 3QVGA 3KYCA 1ONNA 3L6UA 4GLJA 4TSFD 2JGMA 4E4YA 2HCRA 3JV7A 4ZZIA 3CLSC 3DONA 5FI0B 1LVUA 4IV8A 3WK6A 1U1IA 1AHIA 1GSIA 2B4AA 4ARVA 2VF8A 3GHHA 2AUNA 3IHKA 3U16A 4WFJA 4IWNA 2RCNA 3RVBA 4RZRA 2XVXA 3EG9A 3L8GA 4NAUA 2ZSIA 5A5DA 1YQTA 4G0XA 1V8DA 1RWQA 5LYJA 3ZQ6A 2OYCA 3H2BA 3TL2A 3WKBA 1TVKA 4O4HB 1ECFA 3BAFA 3OE5A 1L5GB 1V3VA 5A6SA 5EKTA 3QE2A 5HFAA 4BTVA 5F23A 1F4VA 1NKTA 4EUHA 1SKMA 2WG0A 3DE3X 3VV2A 3GLSA 1YR7A 3SHTA 3G0IA 4EQZA 1BYUA 5C5CA 1ORWA 4B3TB 4H27A 5I8PA 3AF2A 4J9LA 4Z4QA 3S29A 1FMTA 2Q5EA 1H9BA 5ARCA 2BBWA 3AO0B 1N1DA 4I9GA 3R3JA 4C21A 4CLDA 1PR1A 1U1GA 5LZ5A 1UWVA 5ESRA 5KX5A 3I5XA 5T64A 3THWA 2XWQA 3D6AA 4Y6RA 1FFDA 4H3SA 1ZPDA 2H9YA 3JQBC 4RDIA 4NMHA 3X1DA 4OG2A 2VWPA 4CDGA 2NTVA 2HTEA 4LDRA 5FAKA 1R6XA 3P71T 4L2IB 2X0RA 4YP5A 2WHQA 1RMQA 2F7SA 3ZGVA 3HEAA 3Q1LA 4CMEA 4I1YA 2COKA 4MCAA 4ZVKA 3T1QA 5AQEA 1PV1A 1R5JA 2WOJA 2DY0A 4BGDA 2BGTA 3KELA 2DTEA 2VS1A 1XZBA 3KTFA 4RX1A 5BO5A 1J2EA 3EC1A 1FRQA 4NCNA 4DF3A 1AZLA 3W0LB 5CRIA 3MMZA 2AI3A 4UUPA 1Z16A 2EIHA 3FNFA 4NYJR 4C4RA 4CCYA 2PVCA 4GOLD 1R27A 2Q9UA 1S2LA 2PGIA 3T3OA 5LXTB 2H1SA 2PZEA 1SG9A 1YJ8A 5LBIA 1L4YA 3AERA 4HDNA 4MUFA 4BFYA 1EJ2A 2PX3A 3L1IA 1K6IA 2FR0A 4FD2A 4ND5A 3K4PA 2CXUA 2XTZA 3GNLA 3DE2X 4JDUA 5DT9A 4D79A 4WJLA 1L5MA 5CE8A 2C8JA 3PEEA 2BFEB 5DM0A 2BMJA 4G23A 5U1PA 2VH1A 3HA2A 2VPTA 1OU0A 1KY5A 4N8EA 4WVFA 1T9AA 3E53A 4ON9A 1E0JA 2C2GA 1T36A 4FGRA 4JB8A 3PB3A 5EVJA 4CKBB 4HDQB 1UPAA 2ZIAA 1MVLA 1IBMH 2DF8A 2OFXA 1VI5A 3HB5X 3PX3A 5LA6B 4ME6A 1F14A 4FGLA 5EIWA 1HOXA 4KE9A 5AMXA 5EZSA 3UXHA 4CHGA 2LDBA 3VJKA 5J23A 3WRYA 1B6RA 1THGA 2V8OA 2F48A 2BMDA 4GLOA 1T4BA 2I6QA 2C07A 3W9UA 5B5SA 3WBBA 5BSEA 1XNQB 3GTPA 3D0OA 3MM4A 2ZYUX 5DBGA 5CT9A 2YXDA 4D9JA 2QRVA 3UMSA 2J7PA 4UHEA 4EG8A 3QWBA 3TI9A 4JP2A 5B1EA 2GUWA 3FDIA 4WECA 4F1KA 1GU7A 3MHPA 3HKZA 2Y71A 4LDAA 1SKBA 3T3NA 2R84A 5JZ9A 4TN5A 2C29D 2PZ8A 3F5FA 5GJVC 1S68A 5KDLA 4II2A 2WWRA 4OQNA 1E2UA 3M5WA 4NBUA 2NUPB 1QB8A 4P32A 5B53A 4U6QA 1L5YA 1ESMA 1TI7A 2F8LA 3VU0A 2YICA 3A9VA 4A2CA 3ON5A 4X65H 2AGQA 4PV7A 3L7YA 4RWEA 4BO5A 2QTAA 5A0FA 4OM7A 3DR3A 3Q7PA 2Q9BA 3SZLA 1C4XA 4B3MH 2D1RA 5EN4A 2VJMA 3T41A 1NN1A 1H6CA 2R4TA 4DLNA 4DWOA 5FOXA 5BNWA 3WMWA 1DBWA 4JBWA 5B1DA 4J7UA 3GJQA 3P4XA 2HA7A 1VSBA 2ERYA 2LPMA 1FP2A 2JDID 2MSDB 3RUFA 1WTAA 1H3FA 1YZKA 1T5SA 3H11B 3ONEA 2YJ3A 5CTJA 2GZDA 4IIXA 2XVYA 4CTKA 3OIGA 1S0NA 5AKYA 5I5UA 4HFMA 1F1BA 3WRXC 1PVOA 1M2FA 2R6DA 2TMDA 4WXYB 4DRZA 3V4LA 2HJGA 4MAFA 2DXIA 5DHPA 2ZR8A 1SB9A 4Q3NA 1L7BA 4HZGA 1Y4ZA 1JR3E 3VA7A 2GA9A 2ZT7A 4UC0A 2PH3A 5I7FA 3W4IA 3PC7A 5FD8A 4A0QA 2H0RA 2JVJA 3GPDG 3IAFA 1K1SA 2WWIA 4DNFA 4DZTA 3PWZA 1CDOA 1G7SA 4Q0YA 1NQXA 3CR3C 4L9RA 5JALA 1B23P 3UYKA 3O8QB 4DAAA 3NRBA 4TXNA 1UPUA 3TI7A 3DQZA 3L93A 3AJ9A 3B53X 3KHSA 3MRXA 3Q8XB 1UBCA 4R1OA 1OBVA 3GFOA 1N6PA 4I55F 1QE0A 1WJGA 2FCAA 4IDAA 5TXGA 3SMQA 1YC2A 4N0EA 4BZWA 5EIEA 3CB2A 4W8HA 2QD3A 4MLPA 4YT4A 3B6IA 1IN6A 3FUXA 3C7AA 1HT2E 2GBPA 3KT0A 3EG9B 5DDIP 4F5EA 4P31A 1UXIA 4OJYA 4F60A 2NYUA 2COJA 2YY7A 5CTAA 3M9LA 2MHCA 2R6R1 4MW1A 1T8WA 5KFZA 3COYA 3BXHA 1JE0A 5CFPA 5JQGA 3ETHA 5AI8A 4KRYA 3HCWA 4NQZA 4DJDC 3C15C 2PS0A 4DVJA 1X7ZA 3PFGA 2N47A 2GN4A 1VE7A 2X22A 1C80A 3CX6A 3QU5A 5A5VA 2O14A 3V6LA 4KW7A 3QEKA 3ZE9A 4QO8A 4JGIA 4J9QA 2ZUCA 1VAJA 2MR5A 4AK9A 1VIYA 2PA0A 2XRYA 4QOSA 4B71A 4R05A 2PJUA 3NLLA 2ZATA 1RWBA 2BM0A 5A2QW 3A4LA 4LRXA 5IC5A 5LB4A 1K86A 5FWXB 2HSZA 3ZGNA 4LWPA 1IXYA 4HTFB 4M88A 5GTDA 1Y7IA 4YPOA 2QUKA 4W1PA 4RYDA 3HH8A 3RAGA 1JQ5A 1Z82A 3H84A 2GN9A 1UBSB 3PHLA 4WXEA 3TECE 5DGAA 3BE8A 1KA9H 3G88A 3ZIAD 4F96A 3M4NA 4GC9A 2EJ0A 4UQOA 3W1EA 5LYJB 2CNBA 3O91A 4DMHA 3TUJC 2A5GA 2PGXA 5J3JA 1Q0QA 3HVKA 1QIDA 3ROGA 3WB1A 4F38A 1RC8A 4GC6A 1F06A 3A1NA 3O73A 4Q1BA 5DHUA 3IERA 4ED7A 1ONBA 3LLMA 4H6WA 4AUEA 2IVFA 5F52A 1C1XA 3U49A 2RGAA 4RB3C 1DJQA 1SOMA 1T4DA 4BQSA 4CRWB 2VNKA 4J3FA 1KYIA 3TBHA 2JA5A 4XIFA 4BCBA 4MB6A 3IURA 4X6XA 4BBPA 2OAP1 2NVUB 1BXKA 2WTMA 4PAWA 4X71A 3A4IA 3IIMA 3WGYA 4DM7A 3DVAB 3L0IB 2GD1O 2RHCA 3A1VA 3T5HA 2X5OA 2H51A 3C1TA 4BY7G 1S0OA 2R8HA 4PLCA 3RVPA 4B85A 2J45A 5LOVB 1SCUA 2C99A 2ZAIA 2W2LD 4DWVA 4X54A 1ZA2A 2P3LA 4PLYA 4AF7A 7REQB 4Q3LA 4J0JA 5BMVA 1K97A 1VSUA 3A9WA 1WHSB 3KHLA 2OTCA 4Q4AA 5CH5A 4M7OA 4DV0B 2ASVA 1WW8A 4IEFB 3FA2A 1SKAA 1DG9A 4R6WA 4L85A 4RVFA 5B3JC 2HPHA 2AN9A 2OHHA 2IEYA 2ZUTA 1R12A 4TQ9A 1E77A 1CT9A 4DCJA 3DB2A 4D9BA 3F5QA 1CQIB 1LBSA 4M9XA 1HT0A 4RENA 1HT3A 4HQRA 4J0HA 3OTIA 4L57A 4R8UB 3NQ41 3ZHBA 3IEVA 4P7GA 4X64H 2B5OA 3V4ZA 2O0MA 3VPBA 4HEJA 3MK31 4PTYA 1KFCB 3TLCA 3MTEA 1XF9A 3E8XA 5MFZA 2HA3A 1GLGA 2F1RA 3NHPA 5FAXA 3KJIA 4TLCA 1DMSA 3W9SA 2MSKA 1TK9A 1XVVA 2IXAA 1JT2A 3MWJA 1VCOA 4DLZA 1M5UA 1Y8RB 1PGPA 1CQXA 1U0TA 2GZ3A 2AQHA 2IYWA 2B8NA 2BGUA 1YK0A 2UYYA 1FDRA 1TEXA 1VCIA 2WNIA 4NH4A 1UBRS 5IAKA 5KTKA 2HIXA 1RWOA 4I6JA 1A0GA 5IVDA 3R8FA 1LSUA 2B1IA 1NYRA 2I6SA 4BUCA 1FYFA 4CG2A 3D2BA 1Z28A 2CKMA 4HX5A 5CT5A 3M83A 5BPHA 5JQGF 5K1ZA 3THYB 3Q10A 1YB6A 5EZYA 4CEIB 5F3DA 2I54A 1Z38A 2Q99A 5KYUA 2YUIA 3C70A 2VJKA 4ZGGA 1V8ZA 3T38A 1NVUQ 3FZGA 3H6HA 4KHZA 4NV3A 1VMKA 3MFYA 4HNAA 4OJNA 1XVLA 3LK7A 1NVGA 4MUEA 1VB5A 1KFKB 3DMDA 1YASA 3D0QA 2D4HA 3ZBTA 3G9TA 2ODNA 4MZDA 4BKMA 4BLWA 1C50A 3GU3A 3MC1A 3JYOA 1PUIA 5A02A 1JXLA 1E6WA 2HU7A 2B1RA 2ENUA 2WSBA 3IAXA 3PRYA 3GA5A 3LL4A 3Q0TA 4X6YA 5FQNA 4TYWA 4JI2H 5SZIA 2IUUA 4D4IA 2DR3A 4DJTA 3UJDA 4LQCA 2IBTA 2XD9A 5DULA 2H07A 3N2NA 2Y1FA 2LCQA 3I2FA 1QQ7A 4DA8A 4JJ4A 1UJ2A 3KC2A 5G0TA 3MIIA 4YJHA 3HFSA 1N8KA 3SBOA 3COWA 1C4KA 2FPGA 3BQ0A 3MERA 4ND1A 3HJRA 4V03A 4Y7DA 5DFAA 2HXYA 4QGFA 4NYIR 2ODTX 4LWZA 1T24A 2GX6A 3CKKA 4FPXA 2REOA 1M8GA 4M54A 3UNXA 4L0MA 2HL6A 5G1NA 4CM8A 1RQGA 4LSXA 3HSSA 3QVJA 3BM5A 2ZPAA 2HHJA 3K9WA 2OHOA 1KFEB 2JFBA 1BOOA 1J49A 3H16A 2G07A 2PXCA 4C6TA 5K3WA 3KOYA 1H22A 2VIIA 4KSYA 5AI5A 3IIIA 1TC2A 3HQ4O 1NXOA 3P4UA 3VBCA 5C0OE 3T34A 4FEYA 3VNVA 2PYIA 5E8JA 3IA2A 3K4QA 2O7RA 4M7PA 4MGIR 5AK0A 2BLNA 4O4IA 4NS1A 1YRAA 1QK4A 1YAHA 2FUNB 3VMFA 1A77A 1PD1A 5DHQA 5F7XA 1ZCZA 1GUDA 3LW8A 2XRZA 3EVBA 1D4AA 4AF6A 5FLXA 4MW9A 2ZGIA 1PX2A 1WDKA 2IEDA 1ONSA 1LFAA 3P9CA 1R4NB 1XCLA 4QJBA 4U2BA 3N59A 5JCJA 2YV1A 3K35A 5EJ5A 3FVRA 4DV2B 5F3WB 5JNWA 1VJ1A 3NH9A 1UC5B 3PQ3A 1KYVA 2WPDA 2IS1A 4OI1A 1TW2A 4K9SA 1RWNA 3HC7A 4ZCPA 3HBFA 3VH1A 3VR5A 1YDHA 2XPCA 2PZJA 4XQGA 1CE8A 4TOIA 1QAOA 3AKYA 4YCAA 1NQVA 2O8CB 3EBLA 1SEIA 2FXIA 2WFLB 1MJGA 4F5WA 1YU6A 4KAAA 1OWNA 4M49A 3OCXA 4AWBA 5AW0A 1QTQA 3WWDA 3B6MA 3GUCA 3MB5A 5BNZA 2QMQA 3PUYA 4C08A 5THKA 2O2EA 1I1MA 4EHFA 5JDCA 4LYFA 1EM8A 5KT6A 2OHXA 4L50A 5E2IA 1G8YA 3AETB 4YYEA 4DIKA 2VP9A 3FAKA 5K0EA 4BX3A 1LK0A 2QM8A 4FC6A 3NJRA 3GUYA 1E3DA 5FHRA 2R6FA 4IHKA 3RVLA 5GQSA 4I08A 1JW9B 1N2XA 1O9HA 4LXUA 3L0OA 2JASA 2ZIXA 2BM8A 4TMKA 5I7AA 3GG2A 3W2TA 1DJMA 4Z4HA 1YDEA 4NXNH 2GYWA 3LVFO 3WNQA 4FOOA 4FB5A 2DMRA 1E2QA 1JFFB 1S3IA 1UBHS 2D5IA 3L6RA 4HL6A 4CZ2A 4D3DA 2XYPA 4N54A 4JI2B 1UFKA 3SHVA 4AQYH 3WGGA 4G0UA 5C1IA 2ZROA 1EGMB 2E2IA 1GPYA 2E87A 1GPJA 4GI5A 3FWPA 2PFKA 4I3GA 4MCHA 1D6MA 2XYVA 1DV2A 2BVNA 4UZFA 4MK4A 1D2NA 4DDTA 3B6KA 3QUTA 1P7VA 3ZI0A 3G0DA 3OLVA 3H1BA 5IYZB 4KJXA 2H2FA 5FPKA 1DAIA 5JNTA 4Q0MA 3VU8A 3S70A 3NWBA 4LJ8A 2DQYA 2V74B 2BWJA 4UPDA 5I7WA 3B5IA 4ENTA 2DT8A 2WY2D 2VLBA 1WCXA 1AGYA 3OM0A 4JL8A 1Y37A 1BA3A 1BNCA 4PICA 4TPKA 1VKHA 4O4LB 1AV7A 4Q4JA 2W0MA 5BNIA 5IBPA 4G07A 1KZ9A 4BNDB 2D6FA 3PFCA 3RJ9A 1H2EA 5CNJA 3UOGA 1NVMB 1W9HA 2XF2A 4EJFA 3LFTA 5HJ7A 3C6ZA 4U3JB 5C32A 3KEMA 4CHTA 2ZBUA 3R5HA 1QV7A 5JO0A 5A9SA 4YMIA 1NVXQ 1T1EA 1J1ZA 4DIFA 1QCCA 1PJ2A 1E3MA 1CS0B 2J3IA 4O86A 2FLPA 3MCTA 4NU6A 3FKJA 2R8IA 3H4TA 3DOIA 2J8ZA 3ZQKA 4B3DA 4JJKA 3VSCA 5BWBA 1QNFA 4QNMA 1W4BA 1VMAA 4XD7A 2VDUE 5AKLA 4HX9A 4OK3A 4M8KA 3TTWA 2DPJA 3F2IA 3LT0A 2X2OA 1KMQA 3BA1A 4Q15A 4WGGA 3S2GA 2VUIB 3A14A 3WZLA 4OHMA 5DP2A 1U2TA 2PK3A 5L45A 4KV7A 2DFDA 4P83A 2EHJA 2XQJA 1I0LA 2IV3A 4DUPA 4YXFA 5LMZA 2EL9A 3OM9A 1GY8A 2G7ZA 5JDIA 2VXCA 1XYVA 2R7NA 3VNAA 1PRYA 2L19A 3QG5A 4TS3A 1JEQB 2HDHA 2X7HA 2OE2A 4TM7A 3GXBA 3KKPA 5AI4A 2BQUA 2VF2A 1TVEA 2JEFA 2O8EA 4MS3B 1MABA 3NAMA 1CZKA 1R9NA 1VJRA 2ORIA 2E89A 4FD3A 4IVRA 4KO3S 3UFBA 2RKWA 4FONA 3WNDA 4P82A 4XYLB 4TVKA 1HLGA 4L2IA 4MQ5A 2YXEA 5E7MA 3U60B 2LKDA 4CR7A 2FVXA 5C18A 2RJ3A 4A4DA 2H1IA 5BVGA 1TYEB 4RNCA 5IXSA 1RSZA 1CFJA 2AXEA 3ILHA 5TR9A 3KTDA 3OE7D 3PFBA 5TGZA 4G3IA 3H19A 4YUYA 4TZKA 3WDLA 3KQKA 5DIFA 1NOJA 1MAAA 2FP4A 3GWZA 1Z6QA 1KU0A 3GZNB 2RHHA 5JYEA 3WMXA 3UPUA 2IYFA 3IUSA 1D2CA 5CIQA 2QZPA 1I94H 5EMNA 1KQNA 3R3VA 1FNMA 1NF9A 3LECA 1JDVA 4G1EB 4KACA 4Q03A 1Y80A 4HNGA 3JAMA 1G8FA 4FINA 3ZKAA 1KK2A 4Q19A 1W93A 5T4EA 3C3KA 4Y6GB 2X0IA 5C81A 2BFPA 3G49A 2XZLA 3BD8A 4DRXA 1GILA 1TRKA 2JHCA 3ZC3A 2Q1WA 3VR5H 4KIWA 3S44A 4NMMA 1XMSA 2DWOA 3R3SA 3FPLA 3ORQA 3BA9A 1NBIA 2JAPA 1U9ZA 5LZ4A 4D0GA 1DZIA 2V7XA 3W5CA 4MVJM 5CPBA 4KQMA 4OQFA 4TKMA 5KHLB 5P8WA 1WSBA 1SWVA 1SMKA 5LM3A 1CE8B 1H85A 1U8AA 3A28A 3O3OB 4OGLA 4G0OA 2VQFH 5FT9A 3G68A 3H2JA 1I50A 4ZQGA 1GIAA 1L5NA 1U1CA 2HUNA 3OJCA 1D0VA 2AYXA 4UXJA 5FTMA 3E58A 3LCRA 5E1DA 3REFA 4B44A 4TKUA 3VZQA 1AGXA 2W7TA 4I19A 5CFZA 2YS6A 5I5TA 2AK2A 4A03A 3X1WA 2ZRGA 3ELBA 1T5DX 2H6EA 3LC7O 2C8KA 1QPGA 3M6MD 4RVGA 1EEXB 1F5SA 1Z6PA 2YXNA 3BBPA 2GEBA 2AOWA 2OWOA 1SFRA 2CVOA 2EWMA 3CLUD 3L6EA 2QPOA 4JK3A 1TZBA 5C4XG 4YJFA 2NVWA 3ZDCA 3WP0A 1OX4B 4F6RB 1K3FA 1R0WA 2BFBA 3NETA 4KITB 2CJPA 1Q50A 1QIEA 4J0QA 1KHTA 5B2ZA 1MQAA 2PS9A 3CUWA 3FDJA 4PHFA 4YJGB 5ITVA 1HE3A 2FCRA 4NNPA 4LJ6A 3RVDA 1KQGA 2KQUA 1M2GA 1NVFA 3H9UA 5JBIA 1RBYA 2XCAA 1G8PA 2C7BA 1F17A 2ETXA 3RS9A 4ZJZA 4B4WA 4BE4A 4MUGA 3IH5A 3S2FA 1EM8B 1U7PA 2DBVO 2Q8NA 2YYSA 5E1MA 4DC0A 3AUUA 5HCIA 4J3NA 5AVUA 3WGHA 4YAIA 2ID9A 1I3LA 2XCIA 1SQFA 4ER3A 3KL4A 4U9UA 4UZEA 4ALLA 1N1MA 4CIAA 4UATA 3GV5B 1WEHA 4G8BA 1Z25A 2QDXA 3WLAA 3W06A 5ITZA 1AD2A 2D5BA 5DTMA 3SHWA 5H83A 4XZ3A 2QRPA 3W78A 4YREA 3N8HA 4HAUA 4LJLA 1L1EA 1D4FA 1JIXA 1ZQ7A 2WM2A 2CVHA 4PBTA 1CJCA 4YLEA 3TPCA 2CEAA 5BWLA 1E5DA 3UZOA 4AN4A 2P0AA 3QNUA 2AOXA 3GBSA 4LOJA 1ZGBA 4EJSB 1WXEA 3H1AA 1Z6TA 2C5AA 3NGXA 3Q7QA 3G0CA 4QOIA 3ZVMA 1P17A 2B98A 2HWUA 3OKPA 1U6KA 2EKQA 5BV8A 4Z4IA 3AHGA 4E13A 5LNK6 1WSAA 1WH2A 4MS1B 3KJHA 4YRGA 3N7UA 2X4DA 2ZITA 3FLBA 3LO5A 4IIJB 3UWKA 3ZHXA 4EGJA 3AU9A 2BHRA 2AT1A 4OB6A 4RA6B 4EIWA 2B9EA 3CQ9A 1ILEA 1NNEA 3VR6H 1QPZA 1BEEA 3SAJA 2I1WA 3K9BA 5E4FA 2WJVA 2IHJA 4CTMA 4F8EA 3T1YB 2PSHA 2VRNA 3O7WA 4J16C 3OZSA 1YQEA 1P2VA 1FYEA 3ZZTA 5KVAA 4GM1A 5BW6B 5LZ2A 1QDEA 1UXHA 5AW8A 2CD7A 4GPTA 3INGA 1Z0UA 1E1KA 1O8CA 3BTVA 3DPSA 1CUHA 3P0HA 3QXSA 4URFA 4NL4H 4W1RA 3DMNA 1GU0A 4L8YA 4RORA 4QW9A 4XLTA 4BN4A 3U6BA 4ZI7B 3VH4A 4L51A 3LF2A 4N3NA 2C1ZA 3QEBZ 3ZK9A 3EMKA 4NE7A 2VWGA 3O31A 3V2GA 2JKZA 4OAQA 1XCOA 4C5AA 4HF7A 1GO2A 3KSMA 4GUAA 5DTQA 4A27A 1CEEA 4HJXA 2ZDGA 4BFCA 1X9GA 2FFHA 2ZBVA 3Q9NA 4JXJA 3HVJA 4MGHA 4ZOLB 5KFRA 3AV3A 4TV8B 4NLLA 1WZ2A 5HF9A 1WSCA 3I0MA 1MB0A 4JI6B 2Z57A 2VDWA 1HRKA 1CB0A 2VUMG 2QG4A 2WP0A 3BRQA 2OZLB 2IU0A 1AUOA 2QP3A 5DTJA 4LJSA 1WD7A 3RB8A 1EK1A 4LF9B 1XKXA 3W1WA 4Q9JA 5JAPA 2FZ5A 5JZVA 3K8ZA 5JS6A 1KWKA 4UHBA 2FOLA 1M7GA 2CHVA 2VJAA 1DT5A 2XNDD 3KYIB 4RPCA 3C6MA 5EOVA 1QRRA 3G79A 4RD4A 1X39A 3VAZA 4ARAA 4CLRB 2B4RO 1RI2A 2MT9A 3I1FA 3DP7A 4P93A 2BFDA 4MDYA 4QOEA 2E5LH 3WQBA 1Z75A 1KETA 4N41A 4YQFA 2YU9A 2H00A 4KWHA 4RE6A 1SXHA 3RJZA 4FGWA 4OHRA 2D74A 1A9XA 2EC5A 3OJEA 5TC4A 4UUBA 4NJOA 2Q1XA 4HFNA 1PK8A 1PBTA 1NBMA 3OMXA 2NIPA 3Q6IA 1SPBS 3EARA 3IE2A 3KEGA 3IAEA 4MX8A 1GSHA 1Z6YA 3L79A 3RIZA 1Z4LA 1JZQA 3WGNA 4QJ3A 4WZBE 2VPWA 4UMEA 1XEXB 2IHNA 2F6RA 1KMHA 3BZUA 4GPEA 1VL0A 4PLGA 5FH9A 5GJCA 1P9WA 4PC6A 2W6CX 4TXMA 3TG2A 5EKXA 5F7ZA 4CQLB 2NV2B 4KDEA 4JLPA 1FS6A 2W6IA 4QU8A 5HRCA 5LD2B 2CV0A 4UXIA 4RKQA 4A3BG 1IZ9A 4G0ZA 1FJHA 1XO1A 1GSAA 3T7KA 3HL4A 1STOA 3ZIAA 4F4HA 2XADA 4UTXA 2FLWA 5A5EA 1T15A 3TD9A 2MINA 1FF9A 4D46A 2HEGA 3CT4A 1C1DA 2GZ1A 3EDMA 2CBXA 3W8EA 4ZN6A 4F46A 2P2NA 2JLWA 2IHYA 3BCRA 4FR0A 3HV0A 3F67A 1JG4A 4IZHA 2BF4A 5KVSA 3ZDFA 3AF1A 1GM5A 5DWVA 4Z4CA 3I64A 1OCEA 5GZ3A 2C4VA 4IDCA 4QWMA 5KYXA 2HGZA 4L9AA 1GTSA 2NU7B 3STYA 4B8ZA 4MUHA 3W3AA 4ZAXA 3L8EA 4R2WA 3SKVA 1WBJB 4JOBA 4YVFA 1L8LA 1NYLA 2GJ9A 1WCIA 1HA3A 4I3HA 3ZUPA 1SC1A 2VHJA 4XSHA 4IAJA 1WAMA 4EG4A 2GAFA 2PLNA 1DAKA 2YN0A 1ORHA 1SIBE 4WEOA 5GONA 5MFPA 3THSA 3AKEA 2VJBA 3BERA 4DWJA 3KYDB 2O8VA 4Q3KA 3THXB 2PUFA 3MHTA 1F7UA 2C42A 3AR9A 1J24A 2BEKA 5JUWA 2W2LA 5D3MB 1U0JA 4MP6A 2A0FA 5G0WA 2RARA 1T94A 4DEYA 4HEHA 1PSDA 1SKYB 2B21A 3IAAA 5SYMA 5FWDA 2JCXA 5GZ6A 3K9NA 3PTAA 2WB1A 3OI7A 1YFJA 1KZ6A 3PBKA 4KPGA 1ID8A 4JC5A 3S5UA 4C0AC 3EEYA 4H0NA 3NTRA 3HO8A 4F04A 1DIBA 4HAZA 3C3XA 2VZ8A 4DL6A 1CZRA 2KM1A 4FEAA 1JHDA 3L0BA 3L7BA 1V48A 2QL7A 1RXUA 1UAYA 3KQWA 4IDOA 3PRJA 3QVMA 3RIEA 3BWXA 4BNVA 4C2BA 1JXAA 4C78A 4TWRA 1RADA 1G9TA 1PO7A 1XQYA 4ECXA 1EEHA 1ENYA 1X6VA 2QLTA 4M83A 3H8WA 3K32A 5K0NA 1SPXA 4TRRA 5HS4A 1DUVG 3CVUA 2ZJ2A 1IN4A 4MVJE 1DE0A 2DHRA 1FMFA 3H0GA 3NWPA 1NR5A 1DS6A 4UTNA 1HKHA 3C8DA 3DV0A 3OQHA 5TVKA 5ITWA 3QUQA 3S2IA 3ZLVA 5CA1F 2ECKA 5FIUA 2QIOA 1XRSB 3D2CA 1MW9X 3LC0A 1YF3A 1XTUA 3GZ4A 4M4SA 4OH1A 4CT0A 5C8YB 7ADHA 2E1RA 1KVUA 2IZ1A 3AM3A 4MKHA 4P4SB 1FUEA 2XDWA 3ICPA 3H40A 4R9VA 1DIOB 3MWDB 1E5VA 1PEKE 5D5HA 3WLPA 2YNMC 3IPYA 3QVKA 1J0AA 4PHCA 1AK2A 1DXOA 1XDUA 4QPCA 1FUIA 3AF5A 1KEKA 4W5RA 2Z1DA 4EYKA 1O0BA 5CDGA 2WVGA 5JEEA 2GEUA 2LBPA 4ZVRA 1NDQA 4C7JA 2Y1DA 3DO6A 4BVGA 4EW1A 1LTHR 1YH3A 5IJ0A 3NC4A 1Z5UA 1XKLA 4BO8A 1I7PA 2ZE6A 4YQZA 5JMPA 3RQSA 4N9QA 2HFKA 1O4VA 2NSLA 4DNQA 2WDTA 2WWVD 1ORTA 1M33A 4RJIA 3WK9A 2NZYA 1NUHA 4B75A 1OBDA 1FK8A 1ZMTA 1PS0A 2AJCA 3DEIA 5DPMA 1XXHE 4BLUA 4EF4A 4DIOA 4IJUA 5EERA 3PRHA 5ALJA 2FK8A 3C0KA 1M0EA 2OV4A 2P5SA 1IY9A 3GMDA 3U1VA 1L7XA 4BNXA 1EVLA 4LDZA 3H6GA 3RBVA 1T1IA 3H8VA 3O8CA 4AY2A 5KG2A 4F4WA 1W2GA 3DVLA 4MKIA 1TJ3A 3LPMA 5CXXA 5KTMA 4AG6A 3UJCA 3ZX4A 3EGDB 4V0QA 2WPNA 2I1VB 3UHPA 3FJ1A 2PMDA 2FUCA 2PCLA 4EUNA 4IFBA 3L5OA 5LA6F 3WZ2A 2GQSA 5K3BA 4AIIA 4KHPH 1DLIA 2OXEA 3A70A 2C5SA 3P26A 4LZLA 2W6PA 2O9JA 1FX0B 3LI2A 4L5AA 1N5JA 1WCMG 2QTHA 1OZAA 1U8UA 2N9UA 2BONA 2OGUA 2Z56A 3MS4A 2PKRA 4FYPA 4I14A 5G1PA 3ZWXA 4CLOA 3GJZA 2A9RA 2HAEA 1XMQB 3WISA 3C7KA 3KPUA 1NLUA 3P5BA 2XB9A 3EIOA 3FFAA 2JANA 5L9XA 4CIXA 4CC5A 1DPFA 2A78A 4Q8EA 2AC2A 3A2LA 1K0UA 4GI7A 4MR9B 1TZMA 3SQMA 1LC0A 5T3YA 2FEOA 4FYVA 8MHTA 3R3HA 3VHXB 3L8FA 4AMZA 2GCGA 3K0BA 4BGIA 2CHUA 1I24A 1SBYA 3JQAD 1R66A 3G9UA 1KZHA 5KX5B 1ZS9A 3I8OA 2FN9A 1KI7A 3VSBA 2ALZA 1AXGA 2YOGA 3BIFA 2VHCA 4LMPA 4WXMA 7YASA 1RKVA 3B85A 2WKPA 5D1OA 2XR1A 2RHMA 2FPIA 4JSRA 1M6NA 3LQQA 3F78A 1GPUA 4FLEA 1JQ3A 3INYA 2MINB 4PBSA 5DWDA 4G0QA 4EGCB 5K5EA 4HEQA 1F38A 1PGNA 1V0JA 4OHCA 5DYGA 4BV3A 5DXAA 1HZZA 1R5NA 2ZSUA 1PT5A 2QIPA 1I0IA 1R6UA 2H1WA 4GLFA 2Y93A 4IX1A 1LRJA 4HB2A 4XYMA 1B0PA 4JGBA 2Y1OA 2ZTLA 1G0OA 4LYAA 3HOUG 3V1LA 1NPTO 3ILYA 2NT3A 3QMVA 4QRDA 3OHMA 3IBSA 4Y6OA 5REQA 1M1ZA 1M1NA 4KAXA 4B31A 3EZ2A 5K03A 3WAGA 2X0EA 1XZQA 1Y5IA 2Y4RA 2XGSA 4PCVA 4X24A 1Y1SA 5DI3B 3VBEA 5JR3A 2BH2A 1G5TA 2H4FA 4GZMA 2YRFA 1Z4IA 2GSWA 4JROA 3LUDA 5E9WA 2GZSA 4TT8A 3SXUA 1DKOA 3F1LA 2QS9A 3EXFA 1ISHA 4CDRA 4E15A 2PXXA 4DV0H 3GLFB 3PFNA 1TGYA 2CJXA 1JDNA 3FE2A 4TMTA 4AVYA 2UUBB 1P8JA 3D2AA 1XTQA 2G40A 2IQIA 4X94A 4DTCA 3HOXG 5C5EA 3KHTA 2JEIA 5TIIA 3HADA 2G1AA 3DTGA 1K4YA 3O4VA 1DC3A 1Z7YA 4RIGA 2QTGA 1EKFA 4X64B 2PKQP 3QVGB 3U3OA 4NP6A 1IYDA 1XMOB 1M5RA 1G16A 1W6UA 2CB9A 2IOFA 2XIQA 4Z4FA 1Q1EA 4C0QC 5CFNA 1KSFX 3UC9A 4OMDA 5AKIA 2XC9A 1Z88A 5F64A 4ETIA 4RAZA 3R9RA 1J6UA 3CCBA 1BD4A 5JAQA 2PR7A 4MROA 3GGOA 1A4XA 2WKSA 4HNAB 2O5EA 3CZ5A 4R9UC 4FYHA 4ZT2A 4O6VA 1R9MA 4ZTBA 1JB1A 4XR4A 5FR1A 3MFHA 1ZOLA 4N5NA 4OHFA 3TL3A 1KDPA 1GO3E 2JVKA 3QHPA 1OIVA 4ND4A 4EBBA 1GFIA 4L8FA 4HVAA 4ARZB 1PD0A 3NEPX 4Q6BA 4QARA 1UT8A 1VDZA 2DHDA 2J30A 2VBGA 1EK0A 1FDWA 1LX6A 1GGNA 1MC4A 1Q19A 1QR6A 1I80A 3GLQA 3NHRA 4MINA 4YBRA 1PG5A 2XWSA 3ASYA 3PHJA 4YJFB 4D98A 4Q7MB 5JNSA 2UU9H 2JFXA 3ESXA 2XZPA 5LSAA 4TV9B 3BSFA 3Q8MA 1G8SA 3VPSA 4JLOA 5ALDA 1DTWB 7ABPA 2IBKA 1UPCA 4OHWA 3UM9A 1E2HA 1MDFA 4B3IA 1XCPA 4HNQA 4KH0A 4EMTA 4OLAA 1FVFA 5SYNA 1G7CA 3QLVA 4C6RA 4ZYLA 3DD1A 3RTDA 2EATA 1CRPA 1KT8A 2AFIE 2OL4A 2ZU6A 4IJKA 2F3PA 1P4GA 2NUTA 5F2KA 4QXOA 4EEKA 1UBMS 2AFRA 2WV7A 5I5VA 1TWGA 1E1DA 1NZFA 2XQIA 2H52A 3RTBA 2RCYA 3C5EA 1AG9A 3TBKA 4MVJD 4OEHA 5D7BA 2I7DA 1LVGA 1WOMA 1PT6A 3B2EA 4BEBA 2D5CA 5JBNA 1FZTA 1XEAA 4YP7A 2FMFA 4JCCA 5GIPE 2PBZA 4CMDA 5KZMB 3FFBA 1DWOA 2NPFA 1RI1A 4RFLA 2ZE7A 2FP3A 4UUNA 4B76A 2JI8A 4ZO6A 1LS1A 2A4KA 4AJOA 3DV9A 4H9GA 1EVYA 4XZ3B 2B6NA 3Q3HA 4QICA 2QENA 5H5JA 3WOVA 2WJ4A 3RU9A 4Y0NA 2HK8A 1YGYA 4C22A 4GG1A 2QE7A 4F5YA 4KPEC 3EH2A 2FZVA 2VK4A 5AI6A 3ZDEA 4A1OA 1T3SA 4HLUA 1UMKA 4UULA 3G6YA 3LNCA 3H2KA 4J3JA 4IMPA 3TNLA 3GPBA 3WLTA 3ZV3A 2YHSA 2VP4A 1X1TA 3O4RA 4ZK2A 4P0PB 2YZNA 2C7VA 3SY8A 1X77A 2AOUA 1FDTA 1ODCA 2P65A 4LV8B 2WHPA 3HP7A 2GEVA 1QF9A 1W2WB 4DV2H 2Q0SA 4NBWA 1OZ0A 1DP4A 1UL1X 2AJTA 3B3GA 3DR5A 4E7OA 2VXBA 2CJYA 3D3JA 1YMUA 3IPLA 3FTDA 2JA6A 2PM8A 3AVQA 4GKAA 3KHHA 2GBLC 3SYKA 5ECDA 1CPYA 2HEIA 1QG0A 2NPIA 2JI9A 2X2FA 3KYBA 4MW2A 3GG9A 4G1FA 4XPZA 4ZCMA 2OESA 1P9RA 4KN8A 3O5AA 4PC7A 5BQPA 3THYA 1TUIA 2YIJA 4DL2A 3L9XA 3Q0IA 2R8JA 3U3DA 4HNUA 3PDHA 1RZUA 3TZKA 3ZU4A 4ZV7A 3EDQA 5E7QA 3UCFA 3FMIA 4MWTA 4FGZA 1CQWA 5CLJA 4ZRNA 2VAVA 5JV5A 1LSJA 4CE5A 4DR7H 3GJ8A 1QB7A 2J31A 4XEUA 3ROFA 5HUQA 4EMSA 2NTEA 2AGPA 2H1RA 3SC4A 2R7MA 2HWXA 3U0BA 2GTPA 4OFBA 1RKQA 1M6WA 2C94A 1GTL1 3DKPA 5HKOA 1VDMA 2PMZA 4LH7A 2PZFA 1ZUIA 2RDJA 2WQ6A 5KC8A 4EHBA 5HF5A 2IOFK 2J4DA 5KFCA 3ANLA 3B13B 3G7UA 5FYQA 5B1YA 2CY0A 2HDKA 4DV4H 2CFCA 3M34A 4M8NE 4Q9NA 5CDFA 1JPUA 3DFFA 3VR1A 1I2CA 5J4HA 1R0XA 3PXGA 5JS7A 4G0PA 4INAA 3K0SA 3PRKE 5CA1B 3RAFC 2JGDB 1JHZA 3JSNA 1NBWB 1T13A 4RU1A 1I2ZA 5FB3A 1DEHA 4ENPA 2B5WA 5K99A 1ZHFA 2HGXA 3GZNA 2WJZB 5CNMA 3EBPA 1MTOA 4O4LA 2CYAA 1EX7A 4Q4JB 4Y1RA 2FQ1A 1KI1A 2FF5A 2EDCA 2NLOA 3G2LA 2IODA 1Q2XA 3GLIA 4DG8A 3OZXA 1H6AA 2GHIA 3L6OO 3UFXA 4ZGWA 1W0CA 1LLDA 3IBCA 2OKCA 4J6FA 3TNFA 2A67A 2EERA 1CUVA 1VRWA 3P9XA 4YJ2A 1L7PA 3KJFA 4LTDA 3V00A 2AX4A 1JDEA 3WTCA 1VLQA 9ABPA 3K9HA 5LMNB 2OGZA 3HP1A 4QQFA 2VJPA 3SC2A 5H80A 3G82C 4C6HA 2GM3A 1U9IA 4DL3A 5CM2Z 4MI3A 4BFUA 5FO1A 3SFVA 1I7LA 5M29A 4IRUB 4RB0A 1K6MA 2UZ1A 4TT3D 1Z4QA 4JL5A 1EBFA 1TYAE 1CZNA 4KXUA 3D7SA 2C22A 1E4FT 3PGA1 4K0KH 3D59A 3WMRA 5H3HA 1RZRD 2POQX 1M8PA 3I32A 2WE7A 4KQ1A 1MEOA 4ZI2A 1U3DA 4X1IB 3OOJA 1K6EA 5HZGA 5LLTA 4H7JA 3L07A 4DLTA 2G88A 4D81A 1S89A 2MSEB 1JBEA 1GRCA 2J6CA 2WF9A 3DMTC 3D7KA 5AXAA 3W8RA 2WA2A 3N8NA 2IHKA 4MZXA 2H8GA 3I2GA 3H5TA 4LF8H 2B20A 3IALA 3QF4B 5IMBA 1PF7E 2QA5A 4IRXA 3M5CA 2E0IA 4Q34A 4E1BA 1WMSA 2WAMA 3IDOA 3OBBA 3RVOA 3G2JA 4JUCA 2I2FA 4RQAA 1NX9A 4I5DA 1E8MA 1RPJA 1H8HA 5BW4A 4J0CA 5K3DA 1HSZA 1G5IA 3M1LA 4CL2A 3PX7A 3VSAA 4ASUA 5F7OA 1V96A 2V6MA 1A82A 1HRDA 4KQGA 2VDMB 1U2DC 4IEEA 4DV6B 5EQTA 5JH7A 2AGOA 1RM4A 3A25A 5EIHA 4X63A 2EAUA 3WGOA 5HTKA 1I8TA 3L1VA 3WGQA 4Y18A 2O0HA 1KSGA 2R47A 1MR3F 2VUHB 1I36A 3E23A 2C2MA 4MR7B 5KFDA 2CXRA 2HLPA 3QGMA 1U7TA 4ZC1A 2OT3B 4BZZA 3D5QA 1QTIA 4P7BA 4QWEA 3JYQA 4C7VA 4ARBA 1FYVA 2UYCA 4Q82A 3MQ2A 2R1VB 2W8LA 3OWOA 5B7PA 3HJNA 5C5JA 2CZCA 1FW6A 3T6KA 4UCSA 3LP8A 3QXGA 5L4LA 3ZJUA 1SD5A 1FYDA 3GIIA 2A4MA 1ACMA 2W6ID 4Q12A 1Z36A 4E5KA 4MV6A 2KSWA 3GEGA 2W6JA 4GBMA 2NGRA 1WY7A 1HNWB 3T5LA 1E9RA 2FUG1 1ZX1A 2GN2A 3LCCA 5ALSA 3SLKA 2V58A 3GDWA 5HZKA 1IBMB 1VSVA 1RP1A 2BQ3A 2NO5A 1ZJWA 5KVCA 5KB3A 1UCFA 1V6AA 2VO1A 5K45A 3RTEA 1EVZA 3VX4A 4YRCA 1Q57A 1IEWA 1L7EA 2PSSA 1X14A 3EMDA 1W73A 3WWHA 1ISFA 2W93A 4PS0A 3U62A 2IYNA 3BQMB 4YJ3B 4DDHA 5JRZA 3TSWA 1WXFA 4Q45A 3LGSA 5EE9A 2VTDA 4MV7A 3FYCA 3A6GA 2WHEA 3V55A 1CERA 2IQ5A 4ISCA 1YZLA 5AHRA 1XVIA 1Q3TA 4Z1OA 4ZV4A 3IVGA 4GKJB 1Z5OA 5ELXA 4IIEA 2GB4A 3FMOB 4X92A 5G0VA 1BJTA 1A2QA 2RIRA 2GERA 3V8BA 5C80A 2JAOA 1S5PA 4RNNA 1NIJA 1MHPA 3O8OA 3ORRA 3OSZA 1MJFA 4DFDA 1UQTA 1WDLA 4FM9A 4LMBA 5D87A 3AETA 4Z49A 4EGFA 4RZIA 2PRJA 4Z86A 3GV8B 1I1HA 4RV5A 5NULA 1SCJA 3M6AA 4Z2YA 3TKLA 1A96A 4RADA 1H1TA 3DE5X 2MWMA 3D3NA 3K0KA 1K3TA 3D6HA 3PDCA 5FI5A 2O2CA 2M32A 1QZXA 2C5GA 3BACA 4JLAA 4E2YA 4JBGA 1U9CA 4L95C 1LQUA 5H9VA 3LLSA 4YYZA 1I4OA 1WDWB 3IBFA 4C2UA 1FP1D 3FGPA 3NT4A 3ZU2A 4EDHA 3DXZA 4IVQA 5IK2D 3I39X 1T1RA 4HD8A 5JWRA 1GCAA 3QWFA 4E5NA 3WRVA 4TS1A 2FPWA 1UC8A 1A7AA 1T0JB 5DNCA 2BZ0A 2GI4A 2QUBA 1WMAA 1XCBA 4B43A 1J90A 1P4RA 2P9HA 2IH2A 1ZJ5A 3BB3A 1RK6A 2NPOA 4KBGA 4W5WA 4YIKA 1IDN1 3G6VA 2AZDA 2J32A 4JLNA 1P0MA 4ZARA 2NO9A 3V6MA 4JXZA 4M7WA 4AXBA 1JALA 5F1YA 4PPGA 2DETA 4UBIA 1K2VN 4QC2A 5CR9A 4KQ9A 1E2JA 5KFUA 4GMHA 4IDQA 1PW5A 5CX4A 3GOQA 4QYIA 3EEOA 2CDRA 2GRUA 3FW1A 1RQ7A 3HFJA 3CUYA 3LV8A 1RLJA 2I3AA 4YMSA 3MOGA 1BEZA 4O8CA 1NW6A 2FX3A 3EUAA 3NBXX 4JBLA 4JU9A 3G3EA 3RKRA 1AKVA 9ATCA 1ADCA 2I6TA 4DLPA 2D8AA 3WIBA 4RTLA 2OWDA 3QOWA 4BE9A 4CV2A 4EWLA 2QSYA 1QANA 1Z4PX 1N7IA 3J81A 2J67A 2RBEA 3PW5A 4NXMB 3AKCA 1P2DA 1VPEA 4ZVQA 4DARA 4LY6A 5H81A 1I51A 2XRMA 5KNCD 2KHZA 2JCBA 2D54A 2WIGA 1SXPA 4NNOA 3N40P 4LQDA 4DR5H 1P9OA 1DEKA 2ZUBA 3PUXA 4D92A 3B5EA 4AQDA 4M0JA 3G7NA 2BEVB 1Z6GA 4HEA6 4F1WA 1JAIA 2CFTA 2G1KA 5JD5A 3PN1A 3IA7A 1AUXA 4HWPA 4PYJA 3UWPA 2VDPB 1NC1A 5DGHA 3H3XA 4OQEA 4PQRA 4N1AA 5JT1A 1M1UA 2IW3A 1ISMA 3MGBA 1N75A 4IJ5A 4FQ7A 5BV7A 3PPVA 2EFCB 5C1PA 4WBSA 2NAPA 1VHQA 5F51A 3Q85A 5DNWA 3OY7A 2AH5A 3P9PA 3QENA 3TLMA 1X7GA 4CIYA 1DEOA 4ECWA 2H7XA 4C4PA 1CU1A 4UCRA 5CA0B 2OUKA 3OO0A 1Y1RA 5LLSA 4XM0A 3N44B 1M34E 4FKMA 1DHRA 5DM1A 4FYWA 1A9RA 2WG1A 1DQYA 1G6OA 3OUTA 3HKEB 4PO1A 4YDHB 5JD3A 1TAUA 5F98A 2FNAA 1G2WA 2F55A 1MGOA 3BQ1A 1JQEA 3B7PA 4BFSA 3HB7A 4R2LA 4ATNA 4JXUA 2NQTA 3CGGA 2UKDA 3BREA 3C4QA 4K7JA 1VLMA 3H2HA 2ZI6A 5EUQB 3ZWPA 5LR6A 1Q84A 1FC0A 1VJTA 3A0UA 3TW7A 3M6FA 4QEKA 4YAWA 3CIFA 4CL3A 3K9LA 1EMDA 1N2GA 1SXIA 2XNKA 2HHCA 5C52B 4FU0A 1A7UA 1Y8QA 3HEBA 2HCBA 5I60A 4JLVA 4XM2A 4IGEA 5T57A 4DLRA 2E85A 2J9YB 3CGWA 2V5AA 3K3VA 2AW3A 1D07A 4HGZA 3U4CA 4G2NA 5DNYB 2W48A 4M0DA 1KDRA 5L7WA 1ORVA 4S2EA 2A0YA 4Q4DA 5AW7A 2HREA 2Z3ZA 3NHFA 4KRXA 5CDSA 1MLDA 1JDSA 3KVYA 2XE7A 3VJRA 3AZOA 3F6BX 1HM5A 2CJWA 2WQZA 1UFOA 3GJTA 4ZXPA 3THRA 1H4VB 1R6VA 1OFIA 1PR4A 5EY5B 5IVKA 4MPPA 4Q4AB 4UE3S 2GGSA 4R2XA 4IGIA 3RARA 4D80A 1QKJA 2P2GA 3E48A 4BBRG 3FNBA 5LZ9A 1EH5A 3GAAA 4BVJA 1CEYA 3QQPA 5EI5A 1ZM4A 1HYGA 1CQIA 2R7ZG 2FUKA 4HQ6A 1ZK1A 2O05A 2WUWE 4G9BA 3FVVA 2OCLA 2NT4A 3WQQA 4B6EA 1UWCA 1XZGA 2I0FA 3JZIA 3SI8A 3U9SA 2RHJA 2VP3A 3P96A 4CUZA 2O4UX 2Y0CA 1LPNA 3L4BC 3WWJA 4A5SA 4KVGA 5ITSA 4G5RA 5A9RA 2OQIA 4WJZA 3B2NA 2JS7A 1PK9A 4M1OA 4REQB 5KFAA 3DO5A 4A26A 4JI7B 4MRNA 3DLCA 4DV5H 4CIDA 2QPLA 4KKXB 3GLVA 2ZIEA 3G59A 4FS8A 2VH2A 4KXQA 4OFZA 1UFQA 2FI1A 1XA3A 5ALPA 4S0ZA 4EAQA 2CW5A 4YJGA 4F84A 1A9ZA 2FSPA 2WVJA 4GYKA 3TS1A 1V47A 1JIIA 3N2GB 1P6UA 4E14A 1IC6A 4NYMQ 4ZI7A 1JMKC 1ZMXA 3ILSA 1I1QB 2Z5FA 3WK5A 2WPDD 1SK9A 3BJZA 4IO0A 4ZAWA 2CVFA 1BDBA 3PQEA 3HO1A 4FDTA 5DLFA 3IPRA 4KLRA 3O2SB 3V4OA 1PBNA 4NNJA 4UHDA 3UATA 2IVZA 4MA0A 3I6QA 3GR6A 2OY0A 1IUOA 2IL1A 3D8SA 3K0AA 4X1YA 2AG1A 1ZM9A 3BH7A 3UJ6A 4Y67A 4DQXA 1KJQA 3F98A 1NUQA 4E12A 4M53A 4PCLA 4TTSA 2H5EA 3U48A 3MNFA 2HT6A 1GDDA 4B3SH 1USKA 3WK7A 5A3RA 1BE6A 3GMSA 1W76A 1U9IC 3CO5A 3T52A 4C4AA 1DJOA 1NU8A 2Q8QA 5FBKA 1PVVA 4EVSA 4UVGA 4YCCA 5DLEA 5JHGB 2DFPA 1OA1A 2BCEA 1DKMA 1QBKC 1YO6A 2IEBA 3CMCO 2ODBA 4J16A 1J8FA 5BMVB 1YVRA 2I4MA 4LXTA 5IAAA 4LN1A 3K5HA 5EWLB