2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
2CZGA 2I87A 2W71A 4M99A 1BXRA 2W70A 3VOTA 1KJJA 1W93A 4TV8F 3QFFA 5LXTF 2V5AA 2YZNA 2QK4A 2GLTA 1SCUB 4YAKB 1UC9A 4GGMX 1GSAA 2R7KA 3U54A 1W96A 3JRXA 3TIGA 4DIMA 3GLKA 5KX5F 1IOWA 4IHJF 4FE2A 1C30A 2J9GA 1JKJB 2VQDA 1EHIA 3RV4A 1AUXA 4FFNA 4MAMA 2W6OA 4MV9A 5CA0F 1DIKA 2Z04A 3N8DA 1GSHA 1KBLA 5DMXA 1T36A 2YRWA 2GQRA 4YJ3F 1B6RA 3K3PA 3VA7A 2FPIB 3VPDA 4MV7A 1BNCA 4O4JF 4J6EA 1Z2PX 3TQTA 3BSWA 1KC7A 1KJIA 2I80A 3AW8A 4FU0A 5BPFA 3JRWA 3Q1KA 1M0TA 4MA0A 2YS6A 1UC8A 1OBDA 2IP4A 4ZI7F 4HNUA 4EGQA 3ETJA 2SCUB 4O7SA 1DV2A 1KJQA 1EUCB 1OBGA 4M9CA 2YW2A 2ZDHA 4MV8A 5J2UF 2DIKA 4ZQIA 4EG0A 4WBNF 4EABA 5BMVF 3E5NA 3ORQA 1CE8A 2W6MA 2PN1A 5C1OA 4FGRA 3K5HA 2YL2A 1EUDB 2XD4A 5LOVF 2NPOA 3R5FA 3ETHA 4IWXA 3Q2OA 4C5CA 4XYMB 4HNTA 1E4EA 5JVDF 2PBZA 4HQ6A 2R86A 4O4IF 4C5AA 3G8CA 1ULZA 5CAEB 3LP8A 4TV9F 4IWYA 5J2TF 2GPSA 4FFMA 2FP4B 4NYEA 3RUPA 4O4HF 2CNVA 2CNQA 5JQGF 3HO8A 2V58A 3U9TA 5LP6F 2W6ZA 3NUAA 3R5HA 4FFRA 1GLVA 3RV3A 1A9XA 4E4TA 4HNVA 4O7NA 2GPWA 2ZDQA 3HB9A 1PX2A 4L1KA 4EAAA 1KJ8A 4MV6A 3R9RA 2R84A 5HV6A 2P0AA 2XCLA 3WO1A 3VPBA 4M98A 5FNVF 5H80A 4O7RA 3G8DA 3HBLA 1GSOA 3UFXB 2FB9A 5BPHA 1EYZA 1PK8A 4ME6A 4O84A 1GGOA 2C00A 4QSHA 5CB4F 2YZLA 2R85A 3MWDA 2VR1A 1I7LA 2YS7A 4O7YA 2NUAB 4O86A 5C8YF 2R6FA 3I12A 3TW6A 4YB8B 4XZ3B 1M0WA 3WNZA 1C3OA 4O4LF 3WO0A 4IIJF 2DLNA 2CQYA 3AX6A 4EA9A 2GQSA 1JDBB 4C5BA 1E4EB 1EZ1A 2W6QA 2Z02A 1KUTA 4MV1A 5D8DA 4I4TF 4O2AF 2YWVA 3BG5A 5EZYF 5HBRB 2NU7B 4YAJB 1Z2OX 4EA8A 2DWCA 1KEEA 4O2BF 3KALA 4O7TA 2X0SA 3MWEA 4FFLA 3TINA 2VHEA 2YZMA 4O83A 5K2MA 3N6RA 4O7ZA 1CQJB 3K5IA 4WD3A 3KAKA 3JZIA 3R5XA 1DV1A 4RZQA 1I7NA 2W6NA 4YBZB 4MA5A 2R82A 3U9SA 2YZGA 3VMMA 1IOVA 4M9UA 4I50F 1WR2A 2WYOA 1VBHA 4FFPA 1B6SA 3TIIA 4O81A 2NU6B 1JLLB 5KKNB 1Z2NX 4I55F 2YYAA 4MV3A 5CA1F 5I47A 4EA7A 4Y8VB 5LYJF 2DZDA 2FPGB 3OUUA 2R87A 5JVLA 2R7NA 1VKZA 2VPQA 1M6VA 2CNUA 4ZOLF 5C1PA 4XX0B 1JDEA 1CS0A 4EGJA 3BSYA 2FPPB 2I8CA 1AUVA 4O7VA 4FFOA 4MV4A 4O7WA 3BFPA 4ZHQF 4HR7A 4XYLB 3V4ZA 2R7LA 4DLKA 4O82A 3JZFA 1KJ9A 2ZDGA 5GONF 3RFCA 2HJWA 2OLSA 2PVPA 4IZOA 3BSSA 4YJ2F 5LA6F 2R7MA 2V59A 3DF7A 2HGSA 3MJFA 3VPCA 5JH7F 3KREA 5IYZF 3LWBA 3ORRA 2NU9B 3R23A 5JQWA 3V4SA 3KAJA 3U55A 4O7LA 1CQIB 3GIDA 2W6PA 3OUZA 1VBGA 3SE7A 2QF7A 2YRXA 1A48A 2NU8B 4TUYF
chains in the Genus database with same CATH superfamily
1GAWA 3SBXA 3ASVA 4KLRA 3OEWA 4LHZA 4M86A 2VOEA 3F7TA 4ZO8A 4L6CA 4CIBA 4LYEA 4C2BA 4F60A 3PITA 4X1KB 4R68A 2QK4A 5ADWA 5KX5A 1BRTA 3F6EX 3GLFA 1ADYA 5AI6A 3EDYA 1E3MA 5AK0A 1Y3IA 1SZCA 1H23A 2Q3MA 1EXMA 3QIAA 3ZDQA 2W2PA 5AP9A 2ZBFA 3VZQA 3Q9UA 5BQPA 2BEWA 5JAIA 1PE0A 4ENVA 1T2CA 4NS4A 4NICA 3L92A 1C14A 3EMVA 2JKVA 1EVKA 3OLWA 1KWKA 3D3WA 3NASA 2GMWA 2I2AA 2IOFA 5HE8A 2GH1A 1XC7A 2Y1GA 2AJBA 3EW7A 4MR7B 4XB6B 2IC5A 2L17A 1E1CA 2R97A 4D56A 1T24A 2UVQA 3UMVA 2V1XA 2Y2UA 5BNZA 3BE8A 1J9EA 2Q62A 1ONOA 3JQFC 2AKYA 3FJOA 1K1SA 2GDJA 3VHXA 2PUTA 4L22A 1QYXA 4HDAA 4B47A 1QRUA 5IKPA 3HY3A 1Q0ZA 4A4DA 2W43A 3CTMA 3B12A 4XGKA 1UK8A 1AS0A 5BMVF 4U9IS 1G7RA 3RODA 4WDQA 1P80A 3HUUA 4UW9A 5BNIA 1ZGJA 1MLDA 2RB5A 2DEUA 2YWEA 2J0UB 1ISIA 4GW3A 4H6VA 4Z9BA 4U0KA 2Q49A 2OHHA 3FNHA 4LXUA 4Y9UA 3V8PA 4CYMA 2I76A 4WEQA 2UZIR 3QPAA 5JANA 2P91A 2ZAOA 5ERXA 4G1CA 8ATCA 2VWGA 1YI0A 4MVJM 3W8DA 1SULA 5DHQA 2CL5A 4JASB 2QG6A 3TQRA 3B1VA 4UOZA 4H6WA 5DX0A 2QG4A 4LRQA 1F0KA 2Q4BA 3I2IA 4D9GA 4INAA 3UAGA 4JI7B 2Y1DA 5F2EA 3H4BA 2XRZA 4PBSA 4I4LA 1O6GA 2CXXA 4JEIA 3NYIA 5CHEA 1CDEA 4HN4B 2Y0EA 4UQPA 2E6KA 1IB6A 5IEBA 4YLGA 1Z2CA 2D2FA 1UOEA 1P3JA 2GO7A 3ROKA 2PYDA 1GTL1 2HPAA 1PR6A 2VT2A 3K70D 2F4VB 4LOLA 4QGSA 5I4CA 4LSGA 4PHHA 5EMHA 1PR4A 3I3OA 4ED2A 3LP6A 2GZAA 4OBXA 5KJEA 1C7JA 1Z4PX 3RAEC 2G83A 2QSUA 1EUCA 4LXGA 4W9NA 1HI9A 3FZEA 5AK5A 5CEEA 4JBIA 5F51A 3SQXA 1NUAA 2YZGA 4J9PA 1E61A 3FAZA 2XYQA 3BAAA 3IBSA 1XMXA 1WR2A 4HXGA 4WQMA 4JI6B 2CXOA 2G70A 3NH6A 2PAAA 5A9SA 3R5JA 4UHBA 3KHRA 3AUYA 4DLYA 4OREX 1XTUA 1R9JA 5CEFA 1XTTA 2Z8YM 4J16C 3DZJA 1NDUA 4FYYA 3H75A 4LRUA 2FW1A 5EOVA 2VT3A 4XX0B 4CMBA 3QVTA 1Z3CA 5KFEA 1YK1A 4RZHA 2FK3A 4J0EA 5JPCA 1QQ6A 4UTNA 2JI7A 3HDYA 3PICA 4H7HA 1YT5A 1U6KA 5KWIA 2BFAA 4I9HA 3OZUA 4IH1A 3W04A 3GRRA 1NR1A 1EVJA 2PSFA 3I8XA 1HTTA 4NECA 3HKEA 1BJRE 3FSRA 4G5OA 3FOBA 2JJYA 3GVHA 2GZRA 4PCLA 5ER6A 1HDIA 2WU1A 1YB1A 1RIIA 3AG6A 4X60A 2GUGA 2ROQA 4X85A 3H5WA 1RAGA 3EAGA 4BE7B 1UR5A 1UQTA 1FMCA 4CN9A 3FDIA 1G3QA 4FS3A 4BMOB 3U5ZB 3G0BA 4BNVA 4X62H 2F3UA 3OCJA 1EDZA 4UM5A 1NI3A 1V96A 4QWEA 1T9KA 5C5EA 1IBLH 3QVVA 4E22A 2OLEA 2VDUE 4GPBA 1XXLA 5LU8A 1CB0A 3E8SA 5B3JA 2IYYA 1SD1A 4NU5A 4QBHA 4TVKA 1YTUA 3PUZA 3WNVA 3PXCX 2NSYA 5DK4A 1CJBA 2ZBUA 3R7LA 4UFZA 4PFQA 3KR9A 2OMKA 2GBFA 1QIKA 3CZ9A 5FBZA 3VO8A 3ULKA 1Y7HA 4N0DA 3DHYA 2JFPA 4TMTA 4IMIB 2OHIA 3AL3A 1JQ3A 4RQBA 4M1WA 4DADA 3FKIA 3UAXA 5EJGA 3ZTYA 4NMLA 5AFSA 4LMBA 1Y80A 2K6GA 4IDNA 2JCBA 2HBQA 4F4HA 5K0FA 2ZGIA 1ZVVA 1M7JA 1PJ4A 3B3GA 4HB3A 1PG0A 3BERA 5K6TA 4DLAA 4G24A 3QQPA 4UD6A 5EMMA 4AM8A 1RLTA 1EGMB 2FDXA 2OZVA 1IJBA 1LB1B 3OEHA 3NDJA 2VQEH 2XD4A 1QIHA 2WAXA 3W5VA 5KFJA 2Y1OA 3B6IA 3WZMA 4NY1A 1N34B 5KTRA 1SMKA 3UWMA 5K6AC 4LJ8A 5IDVA 5JVDF 2CB0A 3OKAA 1J90A 2GOYA 4O3RA 3T5LA 2J6IA 1Z0FA 3DJYA 3KYIB 2CNNA 1XGKA 3PQEA 2AGQA 3PUYA 4QEKA 2ZROA 3D8RA 3A1DA 1M54A 4LRYA 3FXAA 2OFWA 3G85A 1G8SA 5I9IA 1GTMA 4EZEA 2GZDA 2HA7A 3GJTA 3S7ZA 3EGEA 5EN4A 5JCOA 2WM2A 1RP1A 4HNQA 4PLYA 2V7BA 3JWJA 4MXDA 5KUTA 2QQGA 2VHUA 5FT9A 2C5HA 3DZIA 4QSHA 5CLHA 1RHJA 3EARA 2ZRIA 3NVAA 1IQ0A 1GZ3A 2I6SA 2ESRA 3ITNA 1IE3A 3FFTA 2DT5A 2Q7OE 5T8KC 1T9DA 2GD0A 2RH5A 3FOFC 4MRPA 5D01A 3QPBA 1W4LA 2C5SA 2Z95A 4O0LA 2GAIA 5E3JA 3UAOA 4MTCA 3BB4A 5K8LA 4PVDA 1I1QB 2ZIXB 4F4JA 1L7DA 4M1OA 2A5FA 3RAGA 3HL0A 2Z1DA 1VPDA 2G76A 2Q2WA 3O3OB 4EJ6A 3UJ9A 4F3CA 1QCZA 3HVKA 4KREA 2O8FB 5ELMA 1H3NA 2JRCA 1Q22A 4IDQA 4KE7A 4CKEA 5BP7A 3OY7A 3LBFA 3W6ZA 2C9YA 1R8QA 3SLGA 5WRFA 4MDEA 1I6KA 2A59A 4UE3S 1P1FA 3H3VH 2C92A 3BH7A 1YULA 1WTAA 3NIBA 1UODA 3BXZA 4J3JA 3OSNA 3BK7A 4HAXA 2WRZA 1ZW6A 1EFHA 2D8MA 2R8YA 3I2FA 3PLAE 2J5KA 4I1UA 2RH8A 2AXPA 4O8CA 1GN8A 4HDMB 3HCDA 2PGNA 1BVHA 1A5SB 1ZCAA 4DLKA 5MGBA 5GQSA 4FI3C 4JZKA 5BWNA 3THWB 1NBMA 4Y2TA 1EINA 1T25A 3N8NA 3SJUA 3VI3B 2ID8A 2TMDA 1CSEE 4E30A 1X7DA 3AHIA 4B2IA 1CJMA 3IP3A 5F9FA 3H3FA 1HFJA 3GJYA 1MC8A 5GADl 1KDYA 2RONA 1KGSA 1ZU5A 2C2HA 2QN9A 3RS2A 3P9CA 1S9FA 1YZUA 2O06A 2BGKA 3URMA 2NU8B 2RHBA 1SGWA 2ZWVA 5LMNB 3JQ6A 3ELYA 3S28A 2WICA 3F5SA 4W4TA 2GASA 1D4OA 3H9BA 5BV7A 5CLQA 2ZUWA 3LUHA 2QLMA 3ZBPA 3KQYA 1S01A 5DMHA 1BFUA 1DIHA 1ZKDA 5BVGA 2V8OA 1ZGAA 4B33A 3HGQA 5KWVA 3VU9B 3LDHA 1NUPA 4JV5B 4C9BA 3KYCA 3NC4A 3IHTA 3W2IA 7ABPA 1D0VA 3ESYA 1MEEA 5DSZA 3LF1A 2VPZA 2C2KA 3BCHA 3KOYA 3ZS9A 3AXSA 5JARA 3HJUA 4J2TA 2F9MA 3QTBA 1XXHE 3H16A 4QPZA 2HSDA 2QRJA 4FR5A 5TPZA 3N58A 4NU6A 1NRJB 1M0TA 1B23P 2IXAA 4MQMA 1SRRA 4FMDB 1EVZA 1PK9A 1IJKA 1QZXA 5H7XA 3NNSA 5BMVA 2ZDHA 2CUNA 5BWOA 4Q5IA 5LBUA 4ZQIA 1XEXB 3UHAA 3S3TA 4FYPA 3NO4A 4BFSA 4DNPA 4U8GA 3G59A 5ES3A 4H4DA 3A58B 2I2BA 1EZZA 4ECTA 1O54A 4LH6A 4AZTA 1RPZA 3BQNB 4RKFA 2NU9A 4URYR 2R8ZA 1NT4A 1K9VF 3FPHA 4CE5A 1P4SA 3KPYA 3RYHA 1BMTA 3NT2A 4AJ9A 1CCWA 1UZAA 1LLCA 1GLVA 3QUTA 4QJFA 3RJ0A 3S1AB 4HBZA 2XKAA 4ERNA 1EK2A 1A9SA 2LW7A 1GILA 3DMPA 4C3UA 2K2QB 4C78A 4O6VA 4UUNA 1NUHA 4ZPXA 4F5EA 4QGHA 3P5BA 4KRFA 2O3JA 1IMOA 2I2CA 1WD5A 3GCDA 4LE0A 3SJ7A 1E1KA 4WJLA 1F20A 4YJGB 4DC1A 3UWPA 3NDIA 1GA4A 3FOAA 5ICFA 1QFZA 1G8GA 2AMLA 3AP2A 1JEQA 3LUCA 5DWDA 5M5BA 4BMVA 1C80A 3OM0A 3R7BA 3HKCB 1Q3KA 2OVFA 3JTMA 3B6EA 16PKA 1OH5A 3OECA 4Q01A 4URUR 2C82A 2QYZA 5IBQA 3SS7X 3P96A 4GOMD 5IK2D 4MPJA 3MUFA 3HDQA 4J9KA 5IHXA 3SIRA 3B1FA 2B8JA 1GY8A 4HQKA 5FV7A 1V9PA 5FIUA 4UEQA 3QFHA 4RTRA 4M37A 1ECJA 3DBOB 3B5JA 3DOFA 5AJTA 1DQYA 1R74A 2AR7A 2GRJA 1KK3A 3TEMA 3R6LA 2QUBA 1RQ2A 1XFAA 2Q27A 4ZT2A 1KO5A 4DHEA 3WKAA 4KXFB 2PD4A 4OEHA 3N2GA 3QEOA 1L1QA 1ONSA 4TX1A 1OJLA 2HN9A 1Z33A 3R8CA 3RIHA 4R4JA 3ROFA 1FVXA 2NV2B 4HMOA 4J3NA 2OSBA 4PFKA 4KQ2A 3R9WA 3TDNA 3RLIA 3MOSA 4PXAA 4YREA 2QTLA 1P1CA 4CLDA 3KXPA 2OKGA 4IFEA 3HUTA 1Z0KA 4RF4A 4YV7A 3NHBA 9ATCA 5EXPA 1U28C 1HGXA 3FAKA 3S2FA 5JQWA 5EWLA 1Z7GA 2R8PA 2WHPA 4IKPA 4EJSA 3V9PA 4PZLA 1ZNXA 3RF6A 2R00A 2O8CB 4ZARA 2YFQA 2XQGA 1U4NA 4FN5A 1ODTC 2ZYDA 1WRVA 3V80A 1BCSA 4HTFA 3WIVA 1L4HA 1IWBB 4Q0MA 3I01A 4UKDA 3JQBC 4ND2A 2CLCX 2VO1A 2XLBA 4E46A 1X15A 2NW6A 3IBTA 1TW3A 2PKQP 1O08A 1C3VA 3UWDA 4RVUA 3V8VA 4IH4A 4ZZIA 1ZOPA 4FYJA 4LBVA 2XKBA 3C8UA 5F23A 3UK7A 2ZJTA 4QM6A 4FJ2A 1EWKA 4F6CA 3GB8B 3DYBA 1DGSA 4O2LA 3SP1A 3VDXA 1G8PA 4ISCA 1Y9AA 2MCFA 1MIHA 5JWHA 3TQIA 1TMOA 4XUCA 2QSYA 4NKRA 5ESDA 1RPNA 2NT3A 2HV8A 2ZQYA 2ZJ4A 1VHTA 1QKIA 3CSDA 3FRHA 2BGJA 1QGZA 3M1IA 2P3OA 1R9NA 2ZOSA 5A0TA 3QY0A 2C96A 5JG7A 5D3MB 1NG1A 1E2FA 2FKLA 4LDPA 4LOJA 3ZK8A 1BVRA 1I3NA 4YRSA 5B4VA 4EYIB 4J75A 4H08A 2HY7A 4OX9Y 3CN7A 1NSYA 1DV2A 2FLNA 1IY0A 3U4DA 3N2LA 3NBQA 1B1AA 2ONYA 3B8EA 3TUJC 2Z08A 1UBUS 3VDMA 2TMYA 3C5VA 4UQOA 5BXQC 3BHJA 4UBOA 1Q3HA 5DCLA 2NPOA 4QARA 5JVDA 3TNJA 3CVVA 1Y1TA 2WG2A 4BP8A 4KFCA 4R8UB 1BW9A 2QE7D 2OWDA 4LRSB 2HHCA 2B69A 1KI2A 3FNGA 1F8XA 1BFKA 5LBIA 1VPTA 2R48A 3CVJA 5KEIA 3R3HA 4II2A 4W5NA 4L9RA 1TVKA 4DXDA 3BXFA 2CHQA 1YB5A 2O2ZA 3CUVA 2GO1A 5CDUA 1PZMA 1VFNA 1J07A 4RLHA 1W19A 2HGXA 1G21B 1ULBA 3U13A 1E7SA 4PZDA 2UXBH 1HE3A 2I3BA 1N5JA 2ASJA 2DT8A 2VT7A 5DBEX 3EVTA 3UFXB 3LC0A 3OZWA 4KPGA 1Q6ZA 1EYZA 3OPVA 5IUJC 2OD7A 1U7OA 1MBZA 5KINB 1FLVA 2BZGA 5C7LO 3O2QB 3T7TA 4ZC8A 3KC2A 4DTCA 3VOAA 5IRCD 5JXJA 4J0KA 1S8AA 3MHPA 2G0AA 2CN1A 4P0QB 4BLOA 2WJGA 2RD2A 3RPEA 3EF0A 4JSTA 1E89A 4S1NA 2Q4OA 4X45A 2Y0CA 1ZI6A 2J45A 4MR9A 4G09A 5JCOC 4U0JA 1T34A 2IXEA 1F6DA 1NQVA 2NXCA 3PFFA 2RCNA 1DAOA 5LQUA 4BVEA 3LPNA 4XJSA 2B5VA 2CKDA 3UW1A 1YH3A 3NG1A 1FY2A 2TMGA 2IYVA 1AVTA 1QH1B 3ILYA 1D2MA 1T36B 4HVAA 3OPQA 1YIAA 2O03A 3VXKA 1C0IA 3C85A 3NALA 5CA1F 2QP3A 3RAQA 2NO5A 3A05A 2MR5A 2JDIA 3LVRE 1KNXA 3C39A 1E3WA 3AUAA 2O2EA 4RCYA 4MRRA 1OX5A 3QBTA 2IYUA 2GPBA 4CCAA 4WJKB 1RKQA 1Q1BA 2F43A 3DLPX 4CC5A 4BFCA 2QU8A 3N2YA 1NA5A 4FSXA 2VDJA 4LYYA 1KY5A 3MGBA 4XYGA 3PD7A 3UJBA 3ZLJA 4CTNA 3E22B 3AUSA 5DXJA 1F5SA 1V9SA 4UTZA 2DQZA 3K70C 2E82A 2OV4A 4YRFA 2YY6A 3F2VA 1TE2A 1FFEA 4XB2A 4J1TA 1NY6A 4FLEA 4DKJA 4H15A 4B8ZA 5CD9A 3COYA 4HHEA 3EDOA 3P9KA 4BQNA 1RRFA 3SF0A 1MAAA 2EFDB 2F9LA 3FSGA 3IODA 4NEHB 3LPMA 3PW0A 2PXXA 5K09A 4RXMA 3ER6A 3GJ6A 3NEJA 4L16A 3WFZA 2X19A 3V8BA 2PTHA 4DLSA 2W4IA 3A70A 5PNTA 1B4DA 2HDNB 4XIYA 3RTXA 1L8LA 3JVUA 3D3NA 4V0SA 1XVLA 1SNYA 4GOND 5KG5A 1Q17A 2AQKA 5TQ2B 1ZJWA 4JYCA 4N9QA 2AJTA 2M9MA 4WECA 4EB3A 2NVOA 5K01A 1RZRD 2HBYA 1W36B 4PY2A 3REQA 1XHEA 2V55B 4AKHA 3EAQA 4DXAA 3OIYA 1GCOA 3TBHA 4M60A 2QZJA 1DBPA 3QFRA 3AM4A 3ZD7A 4KWHA 4J9MA 2DRIA 4U6NA 5E6UA 1IHYA 3NGXA 2XMZA 3C7TA 4Y1GA 1P6XA 3A6KA 5L3QB 1GPBA 1NNSA 4JV1A 2P6OA 2IRWA 2WE8A 1XQ6A 2XUIA 3ENVA 3DT6A 4RIGA 2E4VA 4P4SA 5JCXA 3SGIA 3E03A 4QU0A 5A1JA 3I6ZA 1K0FA 5CPBA 3ZV4A 1Z2AA 2CNWD 2G82A 2R8IA 1RS0A 1KO8A 2BI7A 4X97A 1HE5A 1I1NA 2QLBA 1CUVA 2P62A 2JHGA 3COSA 4N12A 4ND8B 4JBXA 4RUKA 2CL7X 4CF4A 3UGQA 2PVSA 1D1PA 1XDUA 4RIFA 5FRDA 3WV5A 2X6TA 3LUKA 2ZYVX 1YA8A 2DYKA 1YI8A 3N2KA 1LDGA 4IGIA 2Q3DA 1NHWA 1M2WA 4OV6B 1YR3A 2OCXA 4TOIA 2XCLA 5C81A 1Q7EA 3W8RA 5M3BA 3B51X 4TKVB 4MYUA 3HB0A 1AKRA 1I36A 1LW7A 4HQFA 1AHPA 1K8ZB 1MX9A 4BB6A 3WADA 2VYFA 1T2NA 3TXYA 1I6WA 4DRYA 1BYUA 5KTPA 2AQHA 1N9GA 4UMDA 3UAWA 2XYGA 3RTDA 4WX2B 4UCWA 4G3XA 5JY1A 3BA1A 4RQAA 4EKEA 1Y6FA 1P8AA 1G19A 1NURA 1R1DA 3AR6A 3M6FA 4DIOA 5D8DA 2YWVA 4TSKA 4DLTA 5CXSA 1JEOA 4LISA 1SH7A 1CY1A 3MWEA 2EG9A 3DWEX 1QORA 1TM2A 3K5IA 2V7XA 4DC9A 3O1JC 5JYBA 4CFZA 1ZVQA 4EY5A 5H59A 3UYKA 1YS1X 2WBLC 3GIIA 2AV6A 1QGYA 3O94A 1BKSB 3AI1A 3SLKA 1QM5A 4DCVA 1J2YA 1WOMA 4IP0A 3FIJA 4KE9A 4PCUA 2HU7A 2E21A 4AP5A 1QJCA 2FSUA 1QO0D 1UJCA 3KETA 3FRIA 3ZY5A 4IZ6A 5KQPA 3HWX1 5J63A 2CNUA 1JLMA 4J7CA 1HE8B 1JQBA 3QV1A 1VC2A 3GMTA 3CSUA 3R7DA 1ZNQO 3CF2A 3O4JA 3JALB 9MHTA 1USKA 4JI7H 5K20A 1EX9A 2I22A 2O50A 2Z43A 1EVEA 4M8NE 3WMGA 4L4UA 2AUTA 3LG2A 1S6YA 4X92A 2XNDA 2HLNA 2IWRA 2XA2A 2RB4A 4Q39A 1JBKA 4BVFA 3EPHA 1Y3DE 3BZBA 1ABBA 3RAFC 2BFDA 1VLLA 3BRQA 4NJEA 4QTTB 1IXRC 3HJNA 4JP8A 5TEWA 2OZKA 3R3VA 3ZD6A 3LUFA 5K3WA 2F4VH 1Q57A 3QUBA 5EHQA 5IT9W 1U3GA 3MS4A 4TUYF 2HREA 4G25A 1FNNA 5HA5A 13PKA 1O97D 1J8MF 3AKYA 5F64A 5FEMA 2BSAA 4IDEA 5BV2P 5CLFA 4X3CA 3IYLW 4FMCB 1SG6A 3KHTA 1DBVO 1IOWA 4IHJF 1XAHA 5JAPA 1YB6A 5B7QA 4NONA 5JLJA 5KZMB 1WCMA 4IJWA 4JI6H 1LX6A 2JIMA 5EP2A 3NGDA 3ICPA 5IJ9B 1ML4A 2EAUA 4OQNA 3FWKA 4EZIA 4B6GA 3M1LA 1LS6A 3LE8A 3OJLA 1NN0A 4H60A 4C0XA 1ETUA 1PR1A 3FFBA 3C1AA 2ODAA 1G1MA 2IYQA 4LDRA 2C0CA 4DYHA 4XPIB 1NNEA 1O4WA 5EUCA 1V48A 4F4UA 4EY6A 3NHKA 5HQ3A 1EBFA 2JFOA 1XXHA 3QXGA 5A4MS 1JB9A 1NI4B 3OG9A 3LY5A 5AVOA 2FWJA 1IZ0A 4JT2A 4AB1A 4ZI7F 3MR2A 1IEVA 1Q44A 3EYWA 2H06A 3ZU4A 1M75A 3P9YA 1E1LA 5HS6A 1KJQA 3UW3A 3L1VA 3QE4A 4E0BA 4C4OA 4N7MA 4BY9E 1MQSA 1F6WA 4PTLA 4TYPA 3E7WA 4INJA 4IPTA 3ER8A 4RA9B 3WIBA 5AQ1A 3CLHA 1CUBA 3T9CA 3DOJA 1XVTA 4I6EA 4RW0A 2O7NA 1XNRB 2B63A 3M6AA 4ZK6A 4G5XA 1N5LA 5EWFA 1P4JA 1KA9H 2JIZD 1JU9A 2WMOB 5IM4F 4QBIA 2WAQE 3A11A 1AM4D 4KL8S 3QEMA 4WVLA 3I53A 4BECA 1W4BA 1ZMTA 1TYEB 4QPDA 4HO1X 1J23A 2P78A 4WKCA 3OO1A 4BLUA 2EYQA 1CULC 3LYLA 2GQ0A 1EE9A 2ALJA 4Q19A 2BBWA 1T5HX 4ER5A 2L42A 1P9OA 3GOHA 3ZWQA 3IR5A 3P4UA 2IUUA 2CJFA 1GPJA 2WTAA 3LL4A 4BVAA 4AXXA 4JI2B 3JARB 1BCRB 1NBME 3F78A 3H0GG 3M2PA 2YJ5A 3CH5A 2VQ3A 3V34A 2AN4A 1RWNA 2QY6A 1SR8A 4KAXA 2X9VA 4L3VA 4DA7A 3CW8X 4G56A 3NWOA 4HDOB 2LCIA 5FPPA 3QFTA 3WA6A 3SZMA 1OFUX 3RRJA 1ECCA 3IEXA 4BO6A 2W2VA 4AZVA 1NXQA 4G85A 3BF7A 4K05A 1WUJS 1ND6A 3HFGA 2HRDA 2AOXA 2XWPA 5AM4A 3L8CA 3FDXA 1JBEA 1N34H 5M2QA 1V71A 4A27A 2F55A 3O83A 4JJ6A 2FMXA 2E2IA 1G5RA 3PHLA 4MPDA 4OLHA 2H5EA 3G6YA 3O8LA 2FY8A 3TZBA 5CA1A 4F4FA 2W22A 5KKNB 2G9ZA 5JS7A 3RF2A 4KQIA 1ZA2A 4OHBA 3EFHA 3QKSA 1PLJA 3IR7A 1SCUA 1KS9A 2PS9A 4ECUA 4HKTA 1N2ZA 2LP4Y 1JTFA 5IEJA 3ZJ5A 1ESNA 4C7MA 4PAWA 1PZXA 3LK7A 3R9KA 5IVPA 2BWJA 4QDKA 2IV7A 1QIEA 1WV1A 4EPWA 1A7UA 5I45A 2UXBB 3CNBA 1I2MA 3HXPA 2QTHA 1S2OA 4G89A 3U31A 4O1IA 2R7LA 3IFSA 3I76A 3TB4A 3GFTA 3OQBA 3R3XA 5T5QA 3W5OA 2BGGA 3EPKA 2UYCA 4ZDKA 3A36A 1CIJA 1AK1A 2XKJE 3OOSA 4FGKA 3UQYS 4HJXA 1V5FA 1PFGA 1G5TA 2GKSA 3INNA 3OZAA 1HMYA 3FF4A 3BXHA 2WG0A 4GC7A 4W82A 4F2WA 2FQYA 5BW5A 4OHUA 4G5RA 1FYDA 2G04A 3G5LA 1A04A 4C0WA 3VYWA 1VE9A 4FC6A 3U7GA 2XADA 3RF7A 1ID8A 2WMNB 4P3KA 3IRUA 1JDPA 3GV7B 2GEBA 2XMRA 3KHUA 5DI3B 1CKNB 4U4AA 3K9QO 1RI4A 4OQQA 4G0OA 3KFVA 1P1IA 3FROA 2HCFA 3PWSA 1HDYA 3JYQA 3AVQA 2IX3A 4ZD6A 1HNXB 4KU4A 1DJLA 3EGDB 3UMJA 5K9ZA 1M6VB 1PJAA 3R44A 1GLGA 2E4WA 5IABA 2IYXA 5LR6A 4LXXA 1QZ3A 3AZPA 5DLEA 4ZXFA 1Z5GA 4N03A 3OHAA 1HQDA 5FOUA 4ZO7A 5T4EA 3C7DB 2PH7A 1PNVA 2IXFA 4OUDA 2ZUSA 3N6XA 5A3JA 4REMA 3LGAA 3N39C 1OWOA 4H0FA 2D1FA 4X84A 5TVKA 2Y4OA 3E2MA 1M8GA 4GZ5A 4ZQEA 1DRUA 1GUAA 4HQOA 1A7KA 4Q4JB 4U2DA 3D0OA 5B7NA 1X7ZA 3QX8A 1UBOS 3DVSX 1MR3F 5I5SA 4J9VA 1G5PA 3V2IA 4OKIA 1KBZA 1C8LA 4KJZA 3ZJYA 4XAQA 2PUGA 4JUBA 3I32A 5JSQA 3C41J 5LNK6 4Y9SA 4RSGA 1FPMA 2G28A 2GCOB 4R7GA 3R5SA 1ZU4A 2PZLA 3P9RA 1ACLA 4ZQFA 4HS9A 5FA8A 1XELA 2Q5IA 1VRVA 5LMNH 1D8TA 1JQEA 1W73A 5IT5A 3D8NA 3QMPA 1OREA 5E4TA 2RHJA 3MQ2A 4BNGA 2PRKA 1J8QA 8ADHA 5JU6A 1C1DA 1Z3IX 1CDDA 2P1RA 2G77B 3KOWA 3EIXA 1N8TA 1FLAA 5CH3A 3U9TA 1HDGO 1DCFA 3IUEA 3RSSA 3PIIA 1UJ2A 3DZFA 4I1RA 4A6XA 3G7NA 1WW3A 4HLUA 3SHTA 3R9RA 3KDAA 1FP1D 3KKEA 3OPYA 5LPNA 4LOHA 4MPPA 3UPTA 4AS1A 5JIBA 3K94A 3Q12A 2JZNA 4N7BA 1E94E 1VE5A 3MTJA 2VJOA 3EW9A 1SU4A 5D85A 1ZUIA 4F50A 3COPA 4RV5A 5JLAA 4EFBA 2ZBQA 1ULAA 5AI4A 1XRNA 4UXIA 3OF3A 3UPDA 3A9UA 1NDHA 1XMQB 3OZEA 4ZRMA 4Q6WA 3E1KA 1ORWA 2P9ZA 1U5AA 2FZEA 4RA6A 2CNKA 1PZHA 3K0FB 3TD2A 2KYRA 4PLGA 4U6QA 3SZLA 1AGXA 4ZAYA 1RM4A 5KTOA 1RKXA 2HM7A 2DMRA 4OHPA 1MTOA 1QVVA 3KQVA 2XWSA 4G67A 1UM8A 3NYQA 5AOCA 4Q18A 4AY6A 4B8WA 2YZMA 1M5RA 3VVCA 5K0NA 5BN5A 2XVAA 4YP1A 4P2GA 1GU0A 2WZCA 5AJWA 3BVPA 1ZJZA 4HH0A 1E96A 1K4YA 3PHJA 1FDVA 1J99A 2YV5A 1AUQA 2I29A 3A1NA 5KG3A 3W2EA 1QP8A 3RC1A 1LNZA 4QICA 2RGEA 5EYPA 1U3VA 2X8WA 1YHNA 5K4GA 3ZCRA 2Y0DA 5FBQB 1TC1A 3T1YB 4Q4DA 1Z5PA 3ONVA 2R7NA 2EWVA 4V24A 4DUGD 3GXOA 2JGJA 4QWAA 2HSZA 1RXCA 1I0IA 2C98A 2GEUA 2CLFB 1L1EA 1HR0H 4IVQA 1U9JA 4YP9A 2I4TA 1JPJA 1PFQA 5EP4A 3G1WA 2VK1A 4H2DA 3VR4A 2GJ9A 4EUKA 8ABPA 3FYTA 1GUBA 5AW5A 4IV5A 2WSIA 1I8TA 3OM9A 4CIWA 4BMXA 1EAYA 4MEAA 1OWMA 1Q92A 2HA6A 3T9DA 3VZDA 3THYA 4HUQA 4P84A 2B25A 1JG3A 4BNKA 3I9V1 3OMWA 4G0PA 4C6TA 2HEGA 4RJIA 3Q5GA 3J7AK 4IDGA 2B0CA 5T3YA 3WRXA 3LHFA 3ABSB 2YHSA 2D54A 2RHHA 3STUA 2A0YA 4IHJA 3QFSA 1JXAA 3NTUA 2NU7A 4L2IA 3G5MA 1DNPA 1GYFA 1JSXA 4Q3AA 4PZ0A 3QBEA 5IG2A 1REQA 1GRCA 5JAUA 2VPXA 1FDRA 4YJKA 4W8GA 2Y66A 1XCJA 1PUIA 3E1SA 2BKLA 2FHPA 4TL8A 5AIBA 1CG6A 4ZT5A 4ACBA 2XUKA 2G3YA 1HFKA 2PNJA 4RVGA 1RXSA 4U7GA 5INTA 4QXRA 1AKTA 2R93A 2AQ8A 2FF7A 5BSGA 1X14A 5T4HA 2O1SA 3ZTTA 3T7DA 3N0RA 4X66H 4LG1A 4ZI7A 1ECGA 3DTGA 3AV3A 2WFAA 5HGXA 4A2AA 3OTOB 3URKA 4O7SA 1KAQA 5FO0A 2JLVA 4HNGA 2QL7A 4WKPA 2Q2VA 3NWBA 3NAQA 3TLXA 4R5HA 2LUOA 2VUSA 4EP1A 4GVLA 4XWGA 4CF5A 1FDSA 4QXMA 3JWHA 1YDGA 4TM5A 4CI0B 1IYEA 1HE1C 4WLNA 4MWSA 3ICQB 2B98A 4KN6A 5IM4A 4AY4A 4F3TA 4BBSG 4A23A 1NNLA 4B4KA 2VHQA 3MJRA 4L4SA 2ZR9A 1ISPA 3ZW7A 1NBMD 3WHLA 5BR4A 3K09C 5CIWA 3HXOA 5HEKA 4A3CG 5KNBA 4NAUA 4CM4A 4P2BA 3JZ6A 2EJ3A 4F04A 3QWUA 3PUKA 2CFCA 1NVVR 2J32A 3IGFA 2QMZA 2AKEA 2MSWA 4FKBA 4C06A 3F47A 1T94A 1Z39A 5KYXB 1ZLXA 5GVSA 1CJTC 4NEQA 1Q0RA 4X1IB 3ZWBA 3JXEA 5CNIA 4JLSA 1QH8B 4DDTA 4LPSA 4BMNA 2RI0A 4EL5A 1W47A 1GL6A 1TUBA 1K5DA 4CQMB 4EVIA 4RMNA 4GP6A 4GRAA 4TV9B 4NL4H 4QG7A 4C2AA 1RLIA 1S3FA 3FUUA 4RL4A 2JFZA 4XB1A 4US1R 4ZCLA 1U2GC 4W5TA 4OIMA 2ZYIA 4U7WA 2Q1YA 3GGSA 4TVIA 3FNFA 2CMDA 4WZBB 2IOYA 2H7CA 5JDCA 121PA 4AURA 2FE3A 3IUBA 3GQVA 4JUAA 5BSRA 4UTRA 1N6RA 3PC7A 3KSBC 4P7BA 4DXHA 2WABA 3PU6A 1W87A 3NEYA 3CEBA 2ZIGA 2WIKA 1ESMA 1ZHQA 1AHNA 4UAVA 4KVGA 3C97A 1I7SB 1O0SA 5BR7A 4JJ8A 5CFQA 4L07A 1V16B 4LI3X 4LXQA 2JFGA 2Q5OA 5IC6A 5AKKA 2XNCA 3GHYA 4KGZA 4P53A 5HIAA 2IXDA 3O1LA 4B87A 3N05A 4Q21A 3U61B 2O7RA 2YBDA 5H68A 5HWSA 1XB2A 1Y9EA 1CVRA 1X9HA 4ZMRA 3L0DA 4BFZA 5P8WA 2B4YA 1SXJE 1MFZA 4CQLA 4FVTA 2XHZA 3KFXA 3VHQA 3AEUB 2AFVA 1K7XB 4EHDA 5DSTA 1RC1A 3HP1A 1VB5A 3FWYA 3FCXA 1IEWA 2IZ6A 5KTNA 1MC1A 2HGSA 4K9MA 3ZWYA 1J24A 3E9RA 1Z34A 2VWPA 3DBLB 5KFVA 3SYMA 4TTAA 4GYWA 3TR6A 4BCBA 4DPMA 2A9QA 3BOSA 2WAAA 2W5UA 1H1LB 1OAOA 4HYKA 1U0HC 5EIOA 2A5YB 4N3AA 4ZAWA 1G17A 1H1DA 1TIKA 1G2IA 1X0XA 4DIEA 1R18A 4MCHA 3JSXA 1GL9B 4JJGA 2B4QA 2H85A 2PR2A 1ZK1A 1IXKA 1KSGA 3WGKA 2ZI4A 3G13A 1KJWA 1XN1A 3K2EA 2FZVA 3QOYA 1JIJA 2DY1A 2QYTA 1HG0A 1U4SA 4OTZA 3RK4A 3LCRA 5BWUA 5CLIA 3TVTA 3OD5A 4Z8YA 3MB5A 2R25B 5G0WA 3MWGA 4UCSA 1OMOA 4P4GA 1FU7A 4MA0A 1L8XA 1TAGA 5KVCA 1NIPA 2CV1A 1DCMA 4COOA 5C4MA 2PQ2A 2M1XA 5LCXA 3CZRA 1WAMA 5DGCA 3SYRA 4FZ3A 1E3JA 3HKZE 4DMFA 4MKGA 2P4QA 1B00A 2G5PA 5GIOE 4ID3A 3E5NA 1M9NA 3IOMA 4LKOA 3U40A 4TWIA 1NLMA 1O97C 2VAMA 1PG5A 2BMJA 3NU1A 2NXEA 3DDHA 3DNPA 2VTBB 4K46A 4AUNA 4E88A 3DZDA 5JXWA 3O2JA 1Q7TA 1U7TA 3OE1A 3HN2A 3WI7A 4JVSB 3DQPA 2JEOA 3TTUA 2NVBA 1BMDA 2BGMA 2NSJA 3I0ZA 3Q3JB 4YV1A 3I92A 2XGPA 2WAQA 4YFVA 2HPVA 2YFYA 1O8CA 1A3CA 4HDNB 1N6IA 5DYIA 4ILEA 2ZDQA 2O6HA 1ETHA 3JR7A 3RB6A 3OZGA 4GMKA 3OX2A 4GQIA 2ZJAA 2PQ6A 4FILA 1E2HA 1YMUA 4Q9KA 1EFLA 3ZKAA 2NV0A 3FWPA 2REQA 4ZVPA 4FKMA 3G2MA 1K83A 1JHXA 3PR3A 1T8YA 2EJVA 2PKRA 4NYIR 3IP9A 4OJNA 2PKXA 4JMLA 2CLEB 3FUXA 3FR7A 1G20B 4JK3A 3KXLA 2VJYA 3TZHA 1CKMA 2NSHA 4Q82A 4YP5A 4RYDA 1TECE 3MWFA 4FS2A 3LZCA 3WMWA 1UBFA 1E3LA 5FAKA 2E4YA 2XUJA 3UA4A 3AEXA 4QLAA 2WJ6A 3IPLA 2PBLA 4DSAA 1INLA 2XC9A 5BSFA 1TIPA 1ZMBA 4AWAA 4D98A 2G1JA 4EHBA 5EXTA 1FKAH 1X3LA 2QR2A 5GOTA 3F8WA 4HAZA 4RK4A 5IAGA 4DF3A 1SIUA 2ZRHA 5I5UA 3J81W 4UU8A 3DEZA 3HXQA 3FZQA 2HFJA 3CW2A 2ZTLA 2JCVA 5DPMA 2VFAA 3DPIA 3M49A 2I66A 3VAAA 5C35A 3PV0A 1I4TD 2JLZA 3ZDAA 5JISA 2X4GA 5LD2C 2VPQA 3E8MA 4PNEA 4N40A 2POCA 4Q9DA 4NCHA 5JFTA 1BTOA 2Q45A 3C3DA 3B1XA 2HIXA 3H5OA 2ZU0C 2P6PA 1VSTA 1TQ8A 3ET4A 1R4NB 1ONNA 2G6BA 3CLUD 1S2NA 5F5NA 3G6VA 1KHTA 4OP3A 4OU5A 1KY2A 3G9UA 3J80W 1DOHA 2BM9A 2Y1CA 1E3DA 3FNEA 5K99A 1PJ2A 4H35A 1WMSA 2FFJA 4D0RA 4ZOQI 1PW5A 2AN9A 2IS2A 1RQGA 2PX8A 3VSCA 3OY2A 1OLSB 3EGXB 3DMTA 4MNTA 1ZNZA 4UASA 4F1KA 3RM3A 2UVUA 2IPOA 4KPYA 1L5HA 3H9UA 1TYBE 1AGRA 1CB7A 4KHZA 4YAGA 2IYSA 2PQ0A 4UM9B 4NYJQ 3KP1A 4JUCA 5JZBA 1TM5E 4OMCA 2RBEA 4P80A 4IR1A 5HKLA 1A8SA 3A9WA 3IRVA 2GTIA 2ZM5A 3IBCA 4HYEA 3PVCA 4IUBS 3C7CB 3PCXA 2FF5A 4ZOLB 4XUDA 1CEXA 2F48A 5EIBD 1AQLA 4YMHA 2FWBA 2Q1TA 4D5EA 1IFXA 1V39A 4C29A 3H3JA 1W85B 1CF9A 3WK6A 5DXFA 4A15A 1GDDA 3IC5A 4UCOA 4W5JA 4V0LA 3ZHUA 1TZBA 4NP6A 1E1DA 1X2EA 2B1RA 4HDQB 2M6LA 2FPRA 1HR0B 1KBOA 1TU3A 5EJ2A 4JT9A 3BSWA 4KRYA 3UWSA 3IT2A 3R4CA 3ZGYA 3Q1KA 3WNDA 3PNQA 4HMPA 3KQWA 2W8LA 2COUA 4UFOA 5E0OA 4ZYWA 2D13A 4ZALA 4IRCA 3GJRA 4M9CA 1PJ8A 3LW7A 2WV7A 3GJXC 4CDRA 4FCVA 4AYXA 5FBWB 3CPEA 1ZGHA 1XZLA 1PLKA 1Y6QA 4H59A 2VYVA 4JMPA 3KL4A 3KQHA 2DSNA 1AE1A 3AFIA 4NOLA 1YZ3A 4IMRA 1TZMA 5FB3A 2FMHA 1VFPA 1T1GA 4BFTA 1V1JA 4Z4EA 1FRVA 3WSWA 5C1IA 4EX7A 1WP9A 1Z0IA 4ARAA 3I9NA 4LZJA 1GO3E 1VLMA 4EHAA 3MD9A 3ACCA 3OCWA 4HQRA 2RKBA 4NPAA 4BEBA 2YFKA 5KMGB 2PKQO 4DMGA 3LECA 5JJKA 4TL6A 1DPGA 4TVSA 3CNQS 2DPGA 4MPRA 2OBYA 4X91A 1EGAA 5ANRB 1WQ3A 5JH7B 1BSVA 1AXEA 4MQLA 4W9NC 5DGHA 1EX1A 1IHXA 3MBKA 4X66B 4MO9A 4A36A 3ZHXA 5FI3A 3WLNA 5E2IA 5TARA 3TW6A 5KT2A 5K0SA 2VZ9A 2XTMA 5AESA 2PJDA 1CRLA 4BQEA 3FPEA 1BN7A 1BRMA 2CVPA 4JODA 2XNKA 1EZ1A 4PLPA 3GT7A 3QKTA 4NI5A 4F2DA 2OC4A 1EP2B 2G9NA 5DASA 2ZIEA 2BEVB 1H2FA 1QV7A 2A8YA 3B85A 4OB8A 4RABA 2UYHA 2BC9A 2QMHA 4FEEA 1X1SA 5FWXB 3IVAA 3V42A 4IUDS 3SNHA 4AUKA 3CLSD 3DKIA 4QGAA 3KUUA 3LQRA 5C2JB 1YOVB 4TN5A 1QO9A 1UWKA 2II6A 1XNRH 4PC2A 1AQIA 4NFLA 4JR0A 5KREA 1CY7A 2SNIE 5FD5A 4KAJA 2P2LA 3GRFA 3Q6IA 4YMSA 4JR1A 3TB6A 3W79A 2QLNA 1QTRA 5IUNC 2XB2A 3I4FA 2UZAA 4EKYA 4KH0A 3GPLA 2GSDA 3TLKA 1ISHA 4IV8A 1DEAA 2WKSA 3V1LA 1GXSB 1K5PA 4WXHA 3VZCA 3WLMA 4M89A 1W581 1KC1A 1SU6A 1EJ6A 1TADA 1E98A 3RKUA 4JI2H 2HDKA 1Z37A 5FNZA 4YEDA 3T1NA 1TEHA 5KQLA 5CE8A 4I3FA 4MA4A 5B3JC 3Q7RA 3IHWA 4MUFA 3VR5D 3NORA 5IWAB 4RKRA 1BXKA 3PNPA 4GH5A 1QR2A 2Q3EA 1B04A 1Z6ZA 3EC1A 2PD3A 4Q4LA 3I42A 2QZ9A 3C24A 2OC9A 1PT9A 1T0PA 1OGYA 2GR9A 4EW1A 5FBVB 2BIFA 4MUXA 2X1MA 4IRDA 4BS9A 4Y6LA 5LWQA 1ECLA 2B2CA 4PFSA 4LXIA 3BXXA 1HRDA 5EP1A 2G1PA 4TQAA 3KB1A 4IFIA 3RRBA 4DLXA 2XGOA 3D0RA 4G9BA 1O94A 5JS6A 2DBYA 4LNUA 5BR1A 2ZRPA 4LV6A 2NN3C 1FFWA 3RS4A 1Z82A 2AOUB 4PG7A 2BI8A 1R8YA 2XH8A 4GLFA 3MG9A 5KSPA 4L0DA 3L9XA 3L6RA 2LR0A 3UWOA 5JXHA 3CNEA 4OFWA 3LRXA 1NV8A 4E5NA 2HX1A 4LDQA 1K7FB 3OE4A 4Q9LA 5L3SA 3NJ8A 2RKOA 5JZVA 4P34A 1MAVA 2JAXA 4TRMA 1JJFA 1M8PA 4N7RA 4UUAA 2AHOA 3E7XA 2E0IA 4HAIA 2YNMA 4NV1A 4XYLA 2XYRA 1IN8A 1XCMA 3EAFA 4TN1A 5KG7A 1WNTA 4PIMA 3GCWA 5SZKB 4EYGA 2BMEA 4W9MC 1VSBA 1UWLA 1C9NA 3BGSA 3HKBB 3T95A 3ADPA 1V1MA 3ETHA 2MTBA 2XTZA 5HJEA 1CUXA 4DEVA 1WXIA 2WC1A 4ENRA 2ZIXA 2GILA 2ZANA 2BT4A 5JTUA 3IEVA 3KQSA 2ZB8A 5KQRA 3VJKA 4B4WA 4FHEA 5AW6A 1B8OA 1YZKA 4XSHA 1Z6GA 1V41E 2P9YA 2NNLD 3U5TA 3IAS1 4F6RA 1HNXH 2IPXA 1F17A 1U7WA 2XNDD 2I6FA 2Z8ZA 421PA 2JB9A 4DZTA 3ZCUA 3SC4A 5CG1A 1A1VA 5FOSA 1GDHA 1Y8QB 3N8KA 2QD5A 5BN3A 4OXRA 2QM8A 1DAPA 4MWZA 2R4QA 3ZW8A 1D0SA 4RY0A 3ZBTA 1MX1A 3JQ7B 1BEZA 1NJGA 4GC5A 5DHUA 4HN2A 3JATA 5LB4A 4A3DG 2GXAA 2YXNA 5F1PA 1F3LA 4ZEOA 4DBLC 4PEVA 4J0CA 4FUTA 1DJPA 1ST3A 4IICA 1KY4A 3W5CA 4NZPA 5GJVC 3W06A 4HDMA 4XYBA 2BJWA 1Z62A 4ZYUA 1WCWA 4KIWA 4X61A 5JUMA 1T5BA 3AX6A 3B7GA 5EUMA 1ZSYA 2QT0A 2QX8A 2MMCA 3IAM1 4J9LA 4I4TF 3GROA 4WASA 2Z0MA 4CR8A 4FFLA 3CX4A 1JR4A 4JT8A 1G63A 3H6HA 3IPAA 1EDEA 1H1TA 2FX5A 1YQUA 1Z28A 5CB0A 3W3AA 3Q0TA 3WK7A 5IX8A 3MA0A 1MZPA 4V0ME 4M9UA 2X2EA 4ALIA 3ZHTA 3KXDA 3HVUA 3CFYA 3EVDA 2FEAA 4Z5XA 3SDSA 4Z49A 4CTOA 1DUIA 1DUVG 2VSFA 2G9RA 3PGMA 1W30A 5E38A 4P3NA 2CW8A 5HGJA 2IYRA 4RLFA 5HKOA 3NETA 3CQ9A 1SBTA 3PO3G 1JWBB 1CUZA 1ZN7A 4LMRA 2XIJA 1E0JA 1OYYA 2PLAA 2GJAA 5IASA 4Y2JA 5EWJB 4L6AA 3R5KA 2JGDB 2QIPA 1PR3A 4KR3A 2N0SA 1IBRA 1SVOA 2HSWA 4EHNA 1CE8B 4JP3A 5KNDA 4R1MA 5JBNA 1VKRA 1QV6A 5EE9A 2I67A 4MJXA 3S1SA 1SXJA 1Y4DE 2AGVA 2AVDA 3PYMA 1XMQH 3CLTC 4AYBA 3AIIA 1P7PA 2PRJA 2YYZA 3ZC3A 1JAZA 1UBEA 5FEUA 5EJ7A 2QQEA 4Z8XA 2QF7A 1E6MA 3ZXIA 3A0UA 1VI5A 1Q0PA 5HNEA 2MHCA 4TQGA 3P9SA 1V6SA 5I5WA 3JAMW 3FDJA 5GVRA 3V6KA 1CUIA 4IZHA 3CXRA 2GK3A 2RG1A 1UPBA 4D4LA 4HWOA 5BQ3A 3OCZA 4RM2A 3DLIA 3MQ4A 4TRRA 1C3EA 3Q3GE 4JU9A 4M55A 1WB5A 4ES6A 1CRWG 2C2EA 3T1YH 4ZODA 4JXZA 2JHPA 3P0FA 2Z5GA 1EE1A 1HEYA 1M1UA 2G9QA 2Q0HA 4ZXPA 1TMGE 1AF4A 4PZ7A 2XRFA 4OA5A 4IMJB 3BH6A 1JQ5A 3O8BA 2C28A 1RZVA 1Z38A 3IDSA 1P4GA 3ZV6A 4WKBA 3VOBA 4GFDA 3AGQA 4PCAA 4GLXA 2DBRA 5B1DA 1VHDA 1X9GA 2Q3FA 3HKZA 3IO5A 1TQ2A 3QYJA 2ZUFA 1NKTA 3UYYA 1XMOH 3SICE 3D59A 1JAIA 3FETA 3T5PA 5FWAA 3WR5A 2YOHA 2M98A 2HSJA 2VNHA 1EK1A 1P39A 4LDJA 4GOXA 3O4HA 3P2OA 1I6UA 1EB9A 2G1UA 1I1MA 4UARA 1NX9A 1U6IA 2ANCA 4XARA 2DPMA 4UREA 3ZNPA 4NULA 2IXBA 4D41A 4X20A 3TE7A 2OVBA 4MW6A 4PQGA 2ZJ7A 1ZHHA 1IJEA 4R2KA 4Q7JB 2AG8A 3PGVA 3CF4A 3VQTA 1YAJA 1CNMA 3KEMA 4DMHA 3D5EA 3EPJA 1WSBA 3ESDA 1MTZA 4Y98A 1JKMA 4ZOCA 3RC8A 1QHXA 2OPHA 4REQB 2YN4A 4KTTE 5BORA 2LZ0A 1WV0A 3F7OA 4ZICA 1WVIA 4OQEA 4DUPA 1B16A 5ITZB 3JQRA 2X4IA 5AM3A 1ZM9A 1MB0A 3OTOH 3GG2A 4EG1A 3E9QA 4X00A 2IY8A 1X38A 4GLJA 4BZQA 5IYDG 2HT1A 2JGNA 1K4KA 2W9XA 1XD9A 3WIOA 4AYTA 4DJJA 2JLSA 3NHJA 4O7ZA 4EYSA 2J07A 2GHIA 4J1SA 2NTVA 3H1TA 1GWNA 3LU1A 2NYVA 1I7NA 4LRTB 1RFGE 1TK2A 5KB3A 8AT1A 3RO7A 1SKUA 5IZCA 5CD1A 3NV7A 3UGJA 1IM2A 1IQRA 5AUQA 4YUXA 3O91A 1XHFA 4S1OA 1LBTA 3EGIA 1JH8A 4TTVA 1KYYA 1OXXK 3LUJA 3H87A 2WB4A 3Q7SA 3KAQA 4XYMA 4EA7A 4UEJA 2PL9A 2P4EA 2CBZA 4K6KA 2FPUA 3W5DA 4OOEA 1KEUA 2AI2A 3VGPA 3CZQA 2HTFA 4DLVA 4FMCF 5KQGA 3T3PB 4TMZA 4EJSC 3HCPA 5LZ2A 3SF8B 2R00C 1JZTA 1C7RA 1O6BA 1U0BB 1XTJA 5LQRA 2Z2JA 4ZV9A 1AUVA 2YV2A 1JDBC 3CV3A 1SCNE 4E21A 3DMDA 4A3LG 1Q7CA 2XGGA 1TAEA 2R65A 3K9GA 5JNUA 1ISGA 2F9FA 4EUNA 4D02A 4KBFA 1CLEA 3PZRA 3SOZA 1Q6YA 4OQMA 1Z74A 1BAPA 1Z29A 1C9YA 1NG9A 4F1JA 3OJOA 1I9CA 1Q2XA 1L5NA 1HEIA 3O4RA 4AQYB 5CYPA 4LYFA 1CYEA 1S0NA 4HWRA 1E79A 2GFHA 2A1TR 3JYOA 5EWMB 1P0QA 1MOZA 1MO5A 2EWMA 4ZVNA 3OQIB 2IEAA 2G8NA 1U7ZA 5AD1A 3SX2A 3WGIA 4UE6A 4LBWA 2VI5A 2FXIA 1SVKA 2RJOA 5L8VA 1SURA 4R8UA 4I5FA 4CV2A 2XMDA 3RGGA 1V95A 4PYJA 9ABPA 1JEEA 1XL0A 4FWIB 1X8JA 1M8JA 3HADA 3LXRA 2ZTSA 3W9BA 1L3BA 4LC9A 4MQEA 2P6NA 5MFZA 2FEKA 3GFQA 1G59A 1DAEA 3GUZA 2SBTA 4U39A 4DJTA 2DJ5A 3VKVA 2WHXA 1XALA 2FW9A 3CLUC 3PWZA 4OU4A 4U02A 1ZIPA 1Y89A 3LQ4A 4MIOA 1YB7A 4U1RA 2QRLA 4Q37A 4BLSA 1VCHA 2D4HA 3H9JA 4Y7CA 1YCDA 4KWEA 1GIAA 5T4FA 5FPKA 1OI4A 3FTNA 4UVEA 5BSMA 2I1VB 4ERXA 4O02B 3UFXA 1A3GA 2A5GA 2IY7A 3ZCPA 2Q6IA 2QUAA 1R6XA 5I6DA 4JHLA 4TV8B 3ZE7A 3HZOA 2W6MA 2WHYA 4B9EA 3O3NB 4LBYA 2Z83A 1E6KA 1G55A 2P3LA 4RJ2A 2WJAA 4HQLA 2F8TA 1E5VA 1GRNA 1G3UA 4HATA 2JA6G 3N76A 3V4PB 2QUKA 2PBZA 4CTJA 3EEOA 2GPSA 4V0RA 5JYCA 2BN4A 5EIBC 1JI0A 3CX8A 2AH5A 1IMJA 2B1JA 3VR4D 2X5OA 5DISB 2Q07A 5ADUS 1NMZA 2PRYA 1BDJA 3RRXA 2G4LA 4Q66C 4M0CA 2GB4A 1R0BA 2WFZA 3KEOA 1FDOA 2R6DA 4MV5A 3O92A 3H42B 4K87A 2P0AA 4PLTA 3WAGA 1CV2A 3JAKA 3OOWA 4ND4A 4QOHA 2JANA 1IHDA 3T3OA 2EBWA 4K6HA 2E3JA 1XAIA 2V4MA 2VKTA 3L7KA 4P32A 4KYVA 3DMFA 1I7LA 4EQ6B 1P81A 4GOJA 1MQ8B 3HB7A 3T3EA 2O8BA 2WF9A 4PTYA 4G86A 5F76A 4TQUS 1NYRA 2O6LA 4I4TA 4AKSA 4KXWA 3NHSA 1XLWA 5L45A 3C3XA 3E7DA 4A3BG 4AZSA 4QUAA 2A3NA 4DR6B 2W0SA 5DO9A 2IHYA 5TF4A 2JLAA 4N6NA 1Z2OX 3RKSA 3BC1A 3ZGZA 3C6MA 2GWRA 4RVNA 1TA0A 2J4FA 1EFAA 1ZM7A 3R0IA 3R5XA 3QBDA 3W0LB 4C22A 1EMDA 3HGMA 2ACWA 3F6SA 4DA0A 4ZVTA 5HF5A 1PI3A 4MVJG 3AFOA 2Q6TA 1ZX1A 3EQ8A 2J0VA 5HQJA 2BM8A 1S8NA 3KO8A 2ZRFA 2IODA 3HLYA 3UK0A 1Y8RB 1DP4A 2ZVQX 2WHQA 4I5IA 4QYMA 4AW9A 1MDFA 1XZKA 1QHIA 1N2BA 4YK7A 3L77A 4J1TC 4AC9A 4MIEA 4PGHA 3A4IA 5ELXA 1AGNA 3K92A 5IVIA 2OO5A 3A4NA 5BSEA 1DMRA 4BJ5A 2X22A 3RREA 4E4RA 1USWA 3VKWA 1XWWA 2VHWA 2BCGY 4PYNA 2OUKA 5GV7A 2Z4TA 2FEXA 1RJEA 2D2EA 4RZXA 1L2TA 3DC7A 3M89A 4L75A 3AR7A 3L8DA 1UT8A 3EC2A 3BHNA 4KIGA 5KNBD 1X0VA 2O2DA 5E4FA 4NXMH 4BNTA 1QIGA 3CLSC 3OZXA 1EA7A 2BFEB 3M3DA 3OQJA 3A1EA 3BK1A 3W1WA 4MDYA 5I7EA 4C30A 2CVHA 4DLZA 4CM7A 5JASA 3FNIA 3DDOA 3P71T 4EFDA 1WUKS 4FFDA 3H83A 1E7MA 4MP3A 1CS0B 3UT5A 1QAMA 2O1EA 2QN2A 1G2QA 2Z3ZA 3W6UA 5CFNA 1NBAA 3D8UA 9LDTA 2CFSA 3A3KA 3GNTA 4WOKA 1XRSB 4PSAA 1QWSA 2E7ZA 4EY8A 3NRBA 3MR3A 5I5YA 3NWEA 2AB0A 4C3ZA 1BU5A 3H9GA 3MMXA 2ZB4A 3UQZA 1LS1A 2ATLA 4K6CA 5CVJA 2NZJA 4YYZA 3BDAA 5KFKA 2D1YA 2JIQA 1J1IA 3ZKWB 1RCTE 1JR2A 1WOYA 4UVIA 1QIMA 2ZSUA 5G0UA 2Q5LA 4NZMA 5ALMA 1YSCA 3UICA 4G1FA 1GQFA 2ZSDA 1N2HA 4TS3A 3O7WA 3BXEA 3TSCA 4MV8A 1IG0A 2QX7A 2VJBA 2WQ6A 3VPGA 4QUBA 4FT4A 2QAGB 2R6ZA 4EG4A 5J58A 4HEQA 3KT3A 1XTRA 2I65A 1T2EA 4PAGA 5LYJB 1GV0A 4RTNA 5AJYA 3ESRA 1ZISA 1DFIA 2R5FA 4YAIA 1Q12A 3R8XA 1BX0A 1NATA 2EARA 4IIYA 4LVOA 1DAIA 3V3TA 5TQ0A 1B26A 4F21A 1HDXA 3A4MA 4DV7B 1F6BA 1YQ9A 3H7AA 4CUZA 1GO2A 2QEQA 4GEGA 3BGOS 3LPLA 1O95A 3MJEA 1YC5A 1ZMOA 1E6CA 2AG0A 3OEHD 4QRDA 5KFMA 1M2KA 2NGRA 2NO9A 2EEZA 1XU9A 1YDHA 3KYJB 2GVZC 1TWHA 1K08A 2NUAB 2IS1A 3WFIA 2AOTB 4X1YB 5KFHA 4YB8B 1NQXA 2FWAA 1YDWA 5JUWA 1I4WA 2ZQZA 3VVBA 3JS5A 1QC5B 1V1RB 4MYSA 3IOBA 2GQSA 1KUTA 1H42A 4EG5A 1TCCA 4UNSA 1FPQA 1XMOB 1NHGA 4TUYA 5HKKA 1H2ZA 5ENDA 1XZPA 1Q5PA 3OJCA 2QN7A 1R8JA 1SVSA 3RTAA 1C0EA 4GLLA 4JOQA 3P8ZA 1A9QA 3AIMA 4Q3DA 1GTZA 2I6GA 3JZAA 3TIIA 4V0MA 2H9IA 3B3QA 5L9XA 3ORFA 5EJ4A 1B8VA 1PS8A 1Y82A 1N48A 2NYUA 3WIDA 2JH3A 3Q2KA 3A0RB 3OJ0A 2V4ZA 2O2GA 3KL2A 1RYSA 1X2BA 3ENWA 1Y1LA 4BVLA 3FCOA 2H1RA 3LWNA 3AJAA 3KQTA 4POOA 3PTAA 4DQDA 1J97A 1GD1O 4W5HA 2WTEA 5IJ9A 4XM2A 3PKJA 4MX8A 2YWGA 1XVIA 2QYSA 2PMEA 1Y3FE 4ZJYA 2IELA 3S99A 5FX2A 1ZH6A 3T41A 3SX0A 5K8VA 2JKZA 3UPUA 4DC0A 3GDEA 1KDTA 2BDTA 1O58A 3UJ7A 1EFTA 1PT5A 2AC7A 1KE2A 2FGKA 2XCUA 3TGPA 3LHDA 2IV3A 3GIQA 3P2JA 4WCFB 3NV9A 3I28A 4UBKA 1NI4A 4DIFA 2W6PA 1W9MA 3GLIB 4KP7A 3NTVA 3ANLA 2X8JB 3PDWA 4D9HA 3BK2A 1YL6A 3LQ2A 5I5EA 2OXEA 1FIUA 3OTIA 5EKSA 5LP6B 5HUHA 5EJIA 4O3FA 4P54A 1HT2E 4KQFA 4KX5A 3Q72A 2R8KA 4RAQA 3QSGA 3V6MA 4BUZA 3VC3A 5CCBA 3K0SA 4JKIA 3PZBA 3ZZ1A 3P94A 3ZQUA 1CD5A 3IELA 4PAMA 3IP8A 4XIFA 5JJBA 2J9GA 3UT0A 2VHCA 4BNIA 2WYVA 3JQPA 4WEOA 2WDPA 4QG3A 5IBPA 4X6XA 1S2GA 3Q10A 1KPIA 4U9UA 4B79A 1EFCA 3OUTA 1OBFO 2GQRA 1SBNE 3ZK7A 5LMCA 3DZBA 4V1CI 1W5SA 4W7IA 4TZ0A 1VE7A 4L51A 4OYHA 4I1OA 3PVSA 3L4SO 4OGFA 1XTBA 1U5BA 2GK7A 4M76B 2H54A 5A5EA 4LX8A 4ZAVA 3PDJA 2XE8A 4C87A 4JH0A 1EWRA 1JMYA 2N3ZA 4DT1B 1GTSA 5A3VA 3DT8A 4BC1A 4GPAA 1H22A 3P26A 2GM9A 5EWGA 1L5GB 5I7RA 3RVQA 4RUAA 2MSKA 3LPAA 4FHGA 2QTBA 1QGOA 1AZTA 1IXYA 2YW2A 4MGKR 2X4DA 3W6OA 2QUJA 2DIKA 1UJ5A 5T67A 3ORQA 5JMOA 1WHTB 3CLTD 3A1UA 3OF2A 4D0GA 5IF3A 2X8LA 4WNIA 2QX9A 4BB5A 1WD7A 3M9WA 5IWAH 2R92G 4CL8A 2VP4A 3NP9A 1R0LA 2QPOA 2Q46A 3CUWA 4BX3A 1KSHA 3FCYA 5FWNA 3E9YA 1K8RA 2YJNA 4TV9F 3CB2A 2WUVA 3BABA 4BNZA 4PYMA 4KXUA 2QVCA 1Z35A 3TOXA 3AM3A 4KPUB 1K3UB 4WNAB 1L5SA 3ILXA 2FP4B 1TVCA 2D74A 3W9UA 3RUPA 5TPZD 2I6QA 3KSMA 1M2NA 3GH1A 2JEGA 4UNPA 2WSMA 1CJUC 3ZD9A 4OGWA 2A88A 2XNSA 2PM8A 1YJBA 4F38A 1XE3A 2OEPA 2FPWA 1BH6A 4AMUA 3UAVA 1VLVA 3JD3A 2OY0A 1RJFA 3SY8A 2QVLA 4KLAA 4E7PA 4Y9DA 1IL0A 2VPIA 3FYUA 1EWTA 3RBXA 3D7SA 4XPZA 4BBZA 3BJYA 3HBLA 3BUSA 4GM4A 2CNBA 3GTPA 1AKMA 2FWIA 5JCJA 3DC2A 4F4ZA 1P9LA 3KWMA 5C7OO 1PUJA 2BISA 5JPIA 4BNYA 3ZEAA 4B6QA 3SCZA 2O0HA 3EXHA 4AYBE 1ZFNA 2O2YA 1FEZA 2W9AA 3ED5A 4BEJA 4D3ZA 4M49A 1BE0A 1EQAA 3FTCA 4J0FA 2WT8A 4PYKA 5KU7A 3TWOA 5H8WA 3ESXA 3PEVA 1TYCA 4UBLA 2AEJA 1C30B 1NXWA 4QJIA 2DHEA 5H16A 3TN7A 1FLDA 3GLUA 1WTCA 1XZFA 1OE0A 4A10A 2HUPA 4TTJA 2CW5A 1CLUA 1ZYUA 1RD4A 3NBMA 4OFZA 3DAYA 5DI3A 1CKNA 2PX3A 1QOPB 3G79A 3PUWA 3T9EA 2QDKA 3NAMA 2PJRA 4KNYA 4DGSA 1ZQ9A 4FK8A 3VNQA 1B93A 1R64A 1SBCA 3BQ2A 3CCCA 4GYKA 1M6VA 2ZBVA 3EXFA 1KC3A 1I5EA 4FE3A 3GNQA 2HB6A 4Q7KA 4DCGA 1E0AA 4QYIA 2C7GA 4O4LB 4D4HA 4ZDWA 3P45A 3MBOA 1ZGCA 1CDZA 1W5AA 5HDBB 5TSDA 2PBRA 2CMGA 1RYNA 4JD5A 2BHRA 4R6WA 1JHRA 3WYEA 1B0UA 1UC4B 4WFKA 3CUEF 5ALXA 5DGDA 1LTKA 3PL1A 2ASEA 3CEMA 4QLBA 4QVIA 4YUAA 4A0SA 3N44B 2HU5A 4TSRA 2XODA 4AF7A 3A7DA 3OKCA 5G3ZA 1BS1A 5DX1A 2BFPA 1AO3A 4IJUA 4JITA 2ZIWB 4Y6RA 3ASYA 4KIJA 3JW8A 1KJJA 3D1JA 2XWQA 1J2EA 4D9EA 2AFIB 3DE4X 1SKBA 5DNUA 4V3CA 3KLNA 2CL6X 2UVWA 1HY3A 3OE7A 4NCXA 3ZIAA 4Q1VA 4HZUA 4HZGA 3LLMA 4H16A 3E6AA 4P5EA 1NN3A 3EVNA 4Z53A 3RTEA 2C2OA 4NCNA 3SZGA 2UYGA 4U2FA 4MI1A 3MRVA 1Z25A 5F3RA 1UBTS 2EBHX 3VA7A 2BH2A 3LNCA 4PLCA 2IEIA 1HK7A 3HXMA 1P1KA 2X5NA 1RWVA 3A4VA 2NT4A 2F17A 1JTEA 4BQIA 2W48A 2WU4A 3DCYA 3MNFA 5FUWA 3CEJA 5AW7A 2D0DA 1GRQA 2DERA 1QZZA 2FMIA 4UVDA 2BONA 2ZS9A 3ZWAA 2R1UA 2BP7B 3ISVA 1THGA 4TM8A 4EVQA 4EEXA 4HLUC 4B5LA 2W58A 1U0OC 4KMMA 3I5AA 3PBKA 3JD1A 4A2CA 4NXMB 2FPLA 2WIJA 2VTDA 2J59A 4OI0A 2N47A 1YWGO 1VPVA 1JIQA 1FXSA 3LYUA 4XOUA 3V1YA 4E70A 1QOZA 2VPSA 3RARA 2H5JA 2B4AA 2YN2A 1PAUA 4U9HS 4XFKA 5IAJA 2C58A 2YCLA 2AKAB 1SU8A 3H2IA 1Y3BE 4DL5A 4RENA 3TR5A 3P9PA 2I2FA 4XOIA 2J3KA 1U9CA 1JA0A 3PP8A 1YACA 3IT0A 1JEJA 4X1KA 4X7RA 4RPHA 4XLZA 1PWHA 3G8AA 2PLRA 1QF9A 3H4IA 3FG9A 5CFZA 2DU8A 3BQ9A 1QIDA 4D44A 3EPPA 4AUMA 5AM5A 4PLZA 2H1VA 4CM8B 5K0EA 4Q4CA 1YDEA 5CYFA 5BWWA 1XDNA 2NO7A 4R3NA 4ME6A 5IT0A 4EJFA 2CE7A 4L4XA 2KSQA 1ZETA 5KYKA 4QGGA 4OL0A 3TZQA 4K88A 4MR7A 5JOQA 2ZBGA 4RIEA 1VLHA 3DTVB 1O5IA 1TWFA 3WLIA 4WXYB 5JD6A 4UDXX 5I9LA 4R2XA 3Q8WA 3MTDA 4FMBB 3OTQA 4XJXA 1O94D 3SHVA 4X41A 4LQLA 2QHXA 3DUFB 4P58A 2VA3A 5M7EA 4FEYA 2BW0A 1HZJA 3TINA 4FMDF 1G4UR 4BGEA 3GLGB 4MIYA 3ICEA 4EHFA 1G18A 2IYEA 1JB1A 3O7MA 3EG5A 2HG8A 2CSUA 4L5IA 4C08A 3TCXB 4G0XA 3OT4A 3RC7A 1SRQA 1UDXA 2W8KA 1DDIA 2Q3BA 2C20A 2Q9AA 1WP4A 2O54A 2J0UA 1PGPA 2IHKA 1JU4A 4R7RA 2DAAA 2G36A 2YNMD 4ENPA 3DLTA 3JV7A 2FPGB 2FI1A 4ZJPA 5B2ZA 1HF3A 4ZOLF 4ZYZA 4B34A 2ICAA 2BUBA 4TXNA 3OOJA 3WK5A 4LQ4A 2O3RA 3WRXC 1OR8A 5EUQB 3BN3A 4BO8A 3T1HB 2JCYA 1J33A 4ZCQA 2XYPA 1N0UA 2ZJ6A 4IKOA 4DV5B 4FYMA 5SICE 4GSLA 3TSWA 3H5TA 4EK9A 2IXGA 1D5WA 5DBGA 3ICVA 4RTOA 4Q7EA 2HOQA 2P2CA 3SE7A 2JDID 4WK2B 2HXYA 3WLJA 1LKZA 3WWYA 4TWJA 2DHCA 2A7QA 1Z5ZA 3O75A 1XZAA 2X7JA 3ROQA 2QRUA 1OAAA 5JZ9A 3CRRA 1R16A 2JBAB 3TZCA 2XXAB 4BQRA 4AIIA 5FP0A 3A3PA 2CCJA 1DEHA 1G1AA 3BJRA 3BFKA 3UJCA 1CETA 4CPDA 1HYHA 1JDTA 2ZTHA 4MI9A 2QMQA 3I30X 3CVUA 3GEBA 1V7PC 3DV9A 3DE6X 4ETWA 1VL8A 2QGZA 5FOVA 2I71A 4R1NA 4OB6A 1VL6A 4H4EA 4QYWA 4U00A 4TQ9A 4H7PA 1OXTA 1D04A 3FSGD 1F2DA 3W3AD 3AQ4A 4MEJA 2OXTA 2IYFA 2OGTA 2R3SA 3A3NA 1IRIA 2CCKA 4FZRA 2GZHA 4XX0A 3M70A 4MQBA 4AIRA 2PPLA 3QH4A 2VWHA 3MJSA 1RKBA 1TL7C 4R01A 4X1IA 2FQWA 4WAUA 1PD1A 1JIHA 1Z56C 4WZAB 1FXWF 4PGFA 5M34A 4K0KB 3DL4A 4FD3A 3F97A 3ITKA 3S40A 4MS4B 3AILA 3ZD8A 4NBNA 3JY6A 2ILVA 3T7IA 4KXXA 2GESA 4AQYH 2LDBA 3GV0A 4K26A 4LY3A 3SJCA 4E94A 4FWTA 1Z4JA 3R3WA 1DBIA 2H1CA 3K1TA 4D3FA 2HZ7A 4EOGA 5KNDD 4AAYA 1T6XA 3DQQA 3ZEIA 1ML3A 3DBVO 4YTEA 1RWBA 1TYAE 1SXJD 1JKIA 3KUDA 4HYYA 4B75A 4W1SA 2AJ8A 3MS7A 1ISSA 1NBHA 3NXSA 2HHFB 3B9QA 4LXTA 3H86A 3TKYA 1XZQA 1N3YA 1XNJA 5JDCC 2K7ZA 3D6AA 2GAOA 3H8SA 4B3FX 2H7VA 4BQOA 3UJAA 5CHYA 4K9NA 4DLUA 2C00A 3SBDA 2AD5A 3OICA 1K3TA 3CT4A 4IVNA 1QF6A 2GYWA 1ZD4A 3EJWA 3AKEA 1Z83A 1RM0A 2WT4A 1RCFA 1RJRA 3OQMA 3KJZA 4EHHA 4M3NA 4JCCA 1NVBA 1WEKA 7MDHA 3MCZA 1QB7A 3SR3A 1M1YB 2QE6A 3A06A 3G7SA 1Q21A 1MJNA 1W4AA 2XE7A 4L85A 5HBRB 2GUWA 3PUHA 1CZOA 3UT6A 5C3UA 3QNWA 4ODIA 4K40A 4BB9A 1ES9A 3H7IA 3PTLA 2G8LA 4ZCRA 4AQ7A 3ZX5A 1DV1A 3VUFA 4IJVA 4QOJA 4DG9A 4PG8A 1FUUA 3IQZA 2CZCA 4HH1A 1N3BA 4AJLA 3Q9LA 2NADA 4K1LA 4E2FA 4DDWA 4NAHA 1KPGA 4KQ9A 5TC4A 3W6PA 4E5SA 1P1JA 2BFOA 5A1TA 1NE2A 2IHJA 3MXOA 1UDCA 1PP4A 2C5AA 4BAZA 3TTYA 3RJTA 3G02A 4CCSA 3X1MA 2FWPA 1PEYA 5EIFA 1OAOC 4RPCA 1P5HA 3AC0A 3Q41A 3BF8A 2C99A 3GBVA 2ZB7A 4HGPA 3TECE 4IV0A 4DNXA 1WE2A 3B3FA 2ZJBA 2Z9BA 5FJJA 2EZ9A 2YC4C 4BNNA 4BGUA 4TL7A 3PSHA 2R7MA 3D8HA 1B7GO 1V3QE 4RTMA 1VMIA 1MF7A 2DQYA 3L40A 4N5IX 4BP3A 3ORRA 4KR7A 2VP5A 4TLMB 4Q00A 3BMQB 1JDJA 1F0YA 6REQB 2B37A 4KR9A 1CPYA 4A3FG 4CI9A 3ID6C 4DR6H 1FX0B 4CMHA 4A0FA 4OATA 4TQRA 4OMUA 1FYVA 4NATA 2M6SA 1JLKA 3KM0A 3V2UA 1XLTA 2V7WA 4L08A 4TQSA 4ZCSA 4UNQA 2CJPA 1U8EA 3EA4A 1Y0BA 5FBKA 5ICMA 3LUAA 1AZSC 1D5CA 3N7TA 4JQZA 3MSXA 2JJ8A 2O8FA 2GN6A 3RWOA 1TT5B 1KAHA 1VLQA 2NTEA 2P2NA 2YJ6A 4Z9FA 3KTMA 3NGLA 4KE6A 1UK9A 1UKYA 3CNLA 1CHDA 2Q1WA 1NQAO 1W0KA 4RZSA 3I3SR 1M6EX 1KJNA 1H5UA 1RPTA 1YFZA 3CWQA 1GYPA 1KTAA 5JC8A 2DQKA 3K32A 4ZVVA 3I5YA 3V2HA 4LJYA 2EF1A 1B6TA 4Z2AA 1QHGA 4E07A 2L18A 2OWOA 2M6KA 3K9WA 2AI3A 4JI3B 4F4XA 2FZLA 1H2BA 2VOBA 4G3IA 8MHTA 1KYZA 3RC3A 2AC4A 3WLOA 3ME5A 1K7EB 1HSOA 4FQ7A 4AWXA 4X8MA 4R83A 3THWA 3DDWA 4NSNA 2YL2A 1GYRA 4LUCA 3L4BA 3AF1A 1G20A 4A03A 2FUEA 3Q2OA 1FFBA 1XQ1A 3AINA 2QTVB 3QXSA 2AT1A 1JFVA 4ZCMA 1QOQB 5CAEB 2E4AA 4HADA 3GDOA 1QCDA 2VUMA 2ZSEA 3B5EA 4CLOB 1ORVA 4CN8A 1MN6A 1CDOA 2NU8A 3HB5X 1YS6A 4Z7QB 2GA8A 2YIVX 4TWBA 4Q34A 2CKMA 2CLLB 4RNMA 1QG2A 1FFCA 1WPGA 3KJFA 4E4TA 3KNZA 3KJNA 3B36A 3JSLA 4J6FA 3GLSA 2PGDA 5FLMG 3VU9A 4QUJA 1MGOA 3H18A 2VDRB 2V9PA 1VJDA 1IY2A 3RABA 1E79D 1N2OA 4Y6QA 1NJ1A 3VC7A 1I0ZA 4L02A 4WWHA 4U8HA 3DE1X 1L4YA 2O3QA 1YIDA 1K0UA 4H17A 4KGDA 3CRMA 2XE4A 4J94A 5F7JA 1J2RA 1CNEA 1AHIA 2G7ZA 4O7TA 4DV6B 4MGYR 1O7JA 2JK0A 2UU9H 5B1YA 2DETA 1XPOA 3L8FA 4YJHB 3HJGA 5F1OA 1MNQA 1XEXA 4B6SA 3DXFA 3RUIA 3PQ6A 3H2KA 4RJLA 3CURA 3G8YA 3O8QB 3H4VA 3L4JA 2OK7A 3G0IA 1OPXA 3FHJA 1QIIA 3VJLA 2Q50A 3NT5A 4PM4A 5AXAA 4NJMB 3R7FA 1V8DA 4A2BA 3DMTC 4BFWA 3C3AA 1ZAUA 3P5SA 4QFCA 2Q41A 3B78A 3CR3C 1X80B 1DARA 3MOIA 4DV7H 2YN0A 4DSZA 1H0SA 4TTRA 3A9TA 4ER6A 4I4NA 2XZDA 4FOPA 5B3LA 1GNVA 4K9KA 3WL5A 2Q1UA 5FLXA 1T3TA 4CLHA 3DM9B 1F7VA 1ND5A 2JHAA 3TI7A 1A2KC 2ZBRA 4O7WA 4IIUA 2DX7A 2ZAGA 3S1AA 4FYHA 4WK0B 4HG2A 2Z3VA 1G5IA 1KSFX 3E9MA 1BC5A 1E63A 3LX5A 4RWZA 3PFGA 3BT7A 4WA7A 5JY6A 4UXJA 1YZFA 2GLXA 3IQEA 1JXLA 3WYBA 1Y37A 1AV7A 1H8EA 2RGNA 2YINC 3L7OA 1J7JA 2ISQA 4ECEA 4YJGA 2JD0A 4IFTA 4NESA 4W5QA 3ZX4A 2JLQA 1KYWA 2WJ4A 3P2MA 4PXYA 3DEFA 4M8SA 4QPNA 4TXJA 1ISMA 3DHWC 1VP3A 3OZDA 3HKCA 2JAOA 2VUGA 2AEMA 2GGSA 4BJ3A 4RK6A 2Q8NA 5B12A 4BTEA 2F3SA 4Y18A 1X1AA 3CVWA 1DJMA 1KEWA 3AWDA 2GK4A 2H48A 2ZUCA 4ENQA 1UBGA 4QEZA 4W7HA 3IE2A 1OFHA 4H77A 3K96A 5CGZA 4NFYA 5E6SB 2ZKLA 1J06A 4D9JA 1YS2X 1B2LA 3IMCA 3WWZA 3QELB 3UTDA 1T4GA 1DKOA 3LFUA 4J6EA 2QXYA 5KMGA 5H4GA 4D3XA 2J0QA 3Q9SA 1AUOA 3Q8PB 5EHXA 5DRTA 2DAPA 1NQ5A 2Q2NA 1I10A 1XRJA 1JG6A 1LSSA 3I2HA 2RDMA 2EZUA 4BN0A 3L7YA 1FXWA 1F2UB 5AICA 3LW8A 4KK4A 2Q0QA 3C74A 3RU9A 1Z0DA 1KQOA 3IDOA 1Y8AA 1TLLA 5CT6A 2HYDA 2R8GA 5BVHB 3KT6A 4C01A 3DLAA 1COWA 3CMMA 3LKVA 4JP1A 4G4GA 1I6MA 5B4UA 3OZ7A 4DLWA 3OJXA 1QB8A 5FWXA 4MUKA 2O8CA 1WETA 4IEFB 2B6HA 5CFMA 1TZKA 4NBKA 5KNCH 1UK7A 2FSHA 5TQJA 1ZK0A 1A72A 1RE1A 5SV2A 2ON6A 2GPWA 1QRAA 3QRWA 3W9YA 1G9SA 4KKXB 4LF7B 4BZXA 2OYSA 1Y4SA 1YV9A 5KFCA 3DEAA 3QU9A 4GKKB 2W93A 4A6PA 3L0SA 3GBPA 2WUWE 2E18A 4O84A 5AVSA 4QOGA 4TLDA 5DBFA 5JHGB 1Z6TA 3GJ4A 4YPVA 1CUDA 1QYCA 3SFZA 1JDVA 2V7QA 4HUTA 1BZYA 4YCBA 5D3MA 2Q3HA 1T0HB 3H65A 3LT4A 5ALGA 4URZR 1G8HA 4L57A 3GVPA 2WKPA 5IM5A 3EUEA 3DFFA 5CB8A 1FLNA 3GGJA 4G0YA 1P17A 1A98A 3E18A 4YBZB 4L95C 1LK7A 2VLBA 2IZ1A 5CTAA 2QZSA 1P0PA 2FDCA 5CFOA 4MH0R 4RNCA 3IMEA 2NU6B 5F4ZA 4RMGA 2DVMA 5B7PA 3JPYA 3QVJA 5KYWB 2OBFA 2DABA 2I7CA 3FTPA 1L4GA 1JVBA 3TUZC 2ATXA 3U09A 1V6CA 1K7YA 1EXVA 2JKYA 5FA5A 1T6YA 2I4MA 4GQAA 5KHAA 4HDKB 2J41A 1N7JA 3GHHA 4I14A 2PZGA 2AOUA 4CG0A 1F4LA 1BXZA 3F4LA 4RTJA 1DDOA 1WVMA 5JBQA 2ORED 1YUBA 2X23A 3D3KA 1C5KA 3BSSA 1G21A 4D74A 4HTAA 1GCGA 1TQ6A 1WS6A 4JP5A 2B2XA 3F73A 4N4AA 1O94C 3GMIA 2FE1A 5FOQA 1RAIA 1T9ZA 2H31A 4R7ZA 4L8VA 1VBGA 3A3YA 4TZTA 1Q74A 3IL2A 2IMWP 1A9YA 2C97A 3O3MB 3UKDA 2MMGA 4PWZA 4QUIA 3QEJA 4IJ6A 4TV8F 1N33H 1NJ2A 4FBGA 2VK2A 2OBXA 3KZCA 2OHFA 3OIWA 1KFEB 2B21A 4GUAA 5A62A 3HKBA 2IS4A 4YUZA 2LGJA 1W96A 1J6UA 2B82A 4RPKA 5CM2Z 5C37A 3TRFA