2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
molecule keywords Phosphoribosylglycinamide synthetase
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
5JQGF 3U9SA 4IIJF 2YW2A 4WBNF 4EA8A 3K3PA 4O84A 4MV8A 4MV1A 2W71A 2GPSA 1C3OA 3U54A 1OBGA 2YZMA 4EA9A 2YWVA 2XD4A 3AX6A 4YAJB 5LXTF 5C1PA 4FFOA 3BG5A 3G8CA 1GSAA 1EYZA 5I47A 4M9CA 1GSOA 1M6VA 1T36A 1KEEA 3BSWA 4QSHA 5H80A 4MV6A 1I7LA 1KC7A 4C5AA 3R23A 1GGOA 4O7YA 1KUTA 4IWYA 2R85A 5KKNB 2W6PA 2CNVA 4ZOLF 3JZFA 1C30A 5LYJF 2DIKA 5BMVF 3MWEA 5DMXA 2YZNA 4GGMX 4O7SA 1W93A 2FP4B 2W70A 4O7RA 2CNUA 3U55A 3TIGA 4XX0B 3MJFA 2W6NA 1BNCA 1B6RA 2V5AA 1JDBB 4MV4A 3VOTA 4RZQA 3HBLA 4MV7A 2V58A 4IHJF 4O82A 2W6MA 4YBZB 2ZDQA 3LP8A 4O7WA 2DZDA 4Y8VB 4O7VA 2YZLA 5LOVF 1W96A 3VPBA 4M9UA 2NU8B 3WNZA 2SCUB 3I12A 2FPIB 4O7LA 1WR2A 4J6EA 2YYAA 5CAEB 2GPWA 4TV9F 3TINA 4YB8B 2VQDA 1EUCB 1PK8A 2YS6A 5JVDF 1CQJB 2R7MA 1EHIA 3V4SA 3RUPA 3TIIA 3E5NA 4MA5A 1I7NA 4FFPA 2QF7A 2ZDGA 3VPDA 2HGSA 3Q2OA 4I55F 2IP4A 4O86A 5HV6A 2HJWA 1SCUB 1AUVA 3U9TA 5FNVF 4XZ3B 1IOVA 5C1OA 2R86A 2J9GA 1M0WA 2PN1A 2R7NA 3K5IA 3N6RA 2FB9A 1JKJB 5K2MA 1A48A 2VR1A 1AUXA 2R82A 4L1KA 3QFFA 5C8YF 2Z02A 3TW6A 5JVLA 1DV1A 2VPQA 2X0SA 3KALA 2ZDHA 5CA0F 1UC9A 1B6SA 4MA0A 3ETHA 4WD3A 3KAKA 3ORQA 1IOWA 3R5FA 3AW8A 2WYOA 5JH7F 1KJ9A 1CS0A 4EABA 1KJIA 2YRWA 2NU6B 1DV2A 2R87A 3VPCA 2W6QA 4M99A 4XYLB 2OLSA 1E4EB 1VBGA 2NU7B 2R84A 2R7KA 4HNTA 3R9RA 3G8DA 3OUZA 4ZI7F 3HB9A 2XCLA 1Z2NX 5GONF 3RFCA 4MV3A 4O2AF 1PX2A 1JLLB 4HNUA 3GIDA 1KJQA 4YJ3F 2FPPB 2PVPA 1KJ8A 3KAJA 3UFXB 3BFPA 1Z2PX 2QK4A 1EZ1A 2NPOA 3GLKA 4E4TA 5IYZF 4I4TF 1E4EA 4TV8F 4EA7A 3K5HA 4TUYF 5CA1F 1KBLA 2P0AA 1VKZA 3DF7A 4O4LF 3JRXA 3BSSA 4C5BA 2DWCA 2PBZA 1OBDA 1GSHA 5CB4F 4O4HF 2I80A 1Z2OX 3WO0A 3KREA 1CQIB 2NU9B 4EAAA 2R7LA 4C5CA 4FGRA 2NUAB 4DIMA 4O2BF 5BPFA 2VHEA 4HQ6A 2GLTA 3VMMA 3ETJA 1GLVA 4ME6A 2R6FA 2FPGB 4MV9A 4O7ZA 3JRWA 5LP6F 4O7NA 4M98A 1UC8A 3ORRA 5D8DA 5KX5F 2GQSA 2W6OA 5HBRB 2W6ZA 3JZIA 4FU0A 4EGJA 4DLKA 2YS7A 3LWBA 2C00A 3OUUA 4NYEA 2YRXA 3MWDA 2I8CA 3VA7A 3R5XA 2CZGA 2YL2A 1DIKA 2CQYA 3HO8A 3V4ZA 4IWXA 1BXRA 3RV3A 2V59A 4FFNA 1M0TA 3SE7A 4HR7A 2DLNA 4IZOA 1EUDB 4I50F 1CE8A 4ZHQF 3WO1A 2CNQA 4O81A 4XYMB 2GQRA 4EG0A 4YAKB 5EZYF 1ULZA 4O7TA 5JQWA 4MAMA 3BSYA 3RV4A 1VBHA 1JDEA 5J2TF 5J2UF 2Z04A 2I87A 4O4IF 4ZQIA 4FE2A 1KJJA 4EGQA 3NUAA 5BPHA 4FFLA 3TQTA 4YJ2F 4O4JF 3N8DA 4FFMA 4HNVA 1A9XA 4FFRA 5LA6F 2YZGA 4O83A 3R5HA 3Q1KA
chains in the Genus database with same CATH superfamily
5JQGF 3K2QA 5DI3B 3RBVA 2NYAA 4BNDA 1BXZA 1D4ZA 1ICEA 4TL8A 4LRTB 2XUGA 5KVSA 5LQJA 1KO7A 1T0HB 3L0DA 3MTBA 4JB0A 3OQJA 3GIKA 1ULAA 3NDRA 3UUGA 4DNQA 5JAMA 1WIWA 1XPJA 4GLBA 2I4LA 4CCAA 1ZHSA 1PWHA 2P6UA 4MROA 4XJVA 1FUUA 4CMBA 2DERA 2O8FB 4NPCA 1CUZA 1W5FA 1PQ4A 4DIDA 1DG1G 4KQ9A 4EUSA 2HI0A 3O2QB 3P9SA 4JEIA 3K5WA 2ZVPX 3QEMB 3CR7A 1DUSA 5B1EA 1ZK2A 5AKJA 1K7FB 1KF0A 5AW8A 1Y3FE 4PO9A 2WIKA 4E11A 1AA9A 3CTMA 5LQDA 2V3CC 3AT1A 1QTNA 2I4TA 4NKRA 2JW5A 1DIOB 3D3KA 4JN6B 2UZ1A 3INYA 3OU7A 4M76B 2JBAB 1JBEA 4AKTA 3B9BA 2C9MA 3NRCA 4L5JA 1PEDA 1ZKMA 1GSOA 3T7KA 1G1AA 3PRJA 4I1IA 1T36A 1J97A 4NEGA 2FAXA 4GRIA 4YIHA 5JCOC 2VAMA 3DE1X 4U7DA 1LEHA 2F3RA 5EJ6A 5K3EA 3NHWA 2Q28A 2JK0A 2Q49A 3GDGA 3H2BA 3MNFA 5T4BA 2ERYA 3D0RA 1WHTA 3TQCA 1GXSB 2RE8A 1FSSA 2GPAA 3PHBE 2O8FA 3F6CA 2QM0A 7MHTA 1JFVA 2DSTA 2JJ2A 3AEYA 4QYIB 5IP5A 1DWPA 3OPXA 3V7FA 5KSYA 4UBLA 3F6PA 1JMVA 1B1AA 2G88A 3OIFA 4RCZA 4JBHA 4XRRA 3TQFA 2DBQA 2Q2QA 2QUIA 4D0NA 3DSRA 2Y1EA 3FN4A 1E20A 2JEOA 1SKBA 2PMCA 2YWXA 2ZYWX 3B8EA 4UPDA 2ZATA 4W5OA 2E5WA 3HA7A 4H77A 4PWYA 1U0HC 3QA3E 4UU8A 2XMBA 3QEJA 1XKLA 3W9YA 4LNUB 1JKIA 3RGZA 3WRXA 1ESCA 1O96A 4JDPA 4DBLE 1FJGB 1KY5A 1YZVA 5JPIA 3VR6D 2VWQA 1RRFA 3MWEA 2E3JA 2W6IA 3FPKA 4Y1FA 4ERNA 1Y98A 4F1WA 4PWQA 3CW8X 2J33A 3L8HA 1Y34E 5F9MA 4AF7A 4HZGA 2W70A 2FP4B 2AKEA 2HBQA 1IJEA 2VNKA 2VP6A 1A2OA 3VGPA 3OTQA 3LUBA 5IKMA 3FTCA 4RA9B 2VOJA 1VHDA 1LSUA 2VP5A 4YYZA 1MV5A 4I1VA 4TQAA 1FXUA 1RAIA 1S6YA 2OBFA 3FUTA 3EE6A 1NP7A 1CUDA 3MEQA 3RFVA 5KDDA 1W85A 4DB4A 1CJKC 1H2RS 1Q21A 3MBKA 3NJ8A 1NC3A 1FP4B 3HBLA 1Y3HA 4PVDA 5IBQA 1V8FA 2DWPA 2HIMA 4IDEA 4IDQA 4PG5A 3OSUA 1P19A 4CG1A 2HV9A 2V7VA 3VYVA 2H1CA 1Z7BA 3F5QA 2VDMB 3N0TA 3ONNA 2Q1UA 3IJEB 4AJEA 2I4MA 4L2IB 1IBMB 5FLMG 1E0DA 1JEQA 2XZTA 3EFEA 3ZWNA 5JI3E 2BEKA 4HPJB 4HX9A 3KLBA 4R3UC 1I1KA 3WGHA 5FAKA 3I12A 2V6IA 3A28A 1ZH2A 4PG6A 2FW8A 1JP7A 1FFYA 5K3OA 4QXRA 3SHQA 1PK7A 3WLTA 5K20A 4P5DA 3F4LA 5TJHA 3UCEA 4TQRA 2P1ZA 3DZFA 1PJ8A 1J1UA 2QORA 4NMHA 1UIRA 3PC8C 3OIUA 5ELLA 1QE3A 5F21A 4EW6A 3ZWOA 1H9BA 3Q9LA 4ZYUA 1D1TA 2C9ZA 4TVIA 1XTZA 1XEXA 3N5CA 1CG6A 3DAAA 1Y63A 2A57A 1YF3A 1CY4A 5F12A 4YUZA 2V65A 1OU0A 1E69A 1P74A 3K6RA 4KXUA 1DKNA 1EVIA 1CJTC 4P4GA 2VRCD 1WXQA 4IQFA 3ZHVA 1SOAA 1Z4PX 1FVHA 2QW0X 1LSJA 4HQOA 4QQNA 4AX8A 3GGJA 3GRUA 4UUQA 1V9PA 1W36C 4J9KA 4TV8B 1SCBA 3QU9A 4TRNA 1G6KA 3E5NA 1F8GA 2HU7A 1RJQA 2H7CA 5FR1A 2LDBA 3C8UA 4JMPA 1OFIA 2YDYA 4MQ4A 1SO8A 4P22A 4Y7CA 4C2BA 1L1QA 3GJZA 1UJBA 3GZNA 3NYWA 1NT2A 3S2IA 5FAXA 1N9ZA 3M89A 5EDWA 4MQ6A 2IH2A 1V3UA 1AHPA 4B6PA 3G0DA 1M67A 5H7XA 4LFBB 5TXGA 2QRKA 2ZT6A 4NU6A 4P4SB 3PX7A 3QHQA 2GD6A 3RE1A 3D2LA 1ZJ6A 1DIBA 1DQRA 3C45A 4KHPB 2PSHA 1KOGA 3FCXA 2C9DA 4I9NA 1GZ6A 1U8XX 2FQYA 3EJ6A 3HNRA 3HSYA 4RKQA 3UWKA 1YB6A 4G67A 4AQDA 1DAOA 5KYYB 3VR4A 4C4AA 2PN1A 1I7PA 1KH2A 1V8PA 5H3HA 2O8EB 4I1SA 2XCQA 3KEOA 1OE0A 5L3SA 5LP6A 1TAEA 4ECUA 2IPXA 1CHNA 1FL9A 3I6QA 3UMMA 3B12A 3TR6A 1GZHB 5AVWA 1T4CB 2WJYA 3R3VA 4L27A 2X86A 4PSDA 2ORED 2PCLA 3GTMA 2JIQA 2GBPA 4BY1G 4B3JA 1FLAA 5JAZA 3KELA 4E94A 3EYYA 1ATZA 5C7YA 3I62A 5FR2A 4F9EA 3KALA 2EVWX 3BXZA 4RC9A 2DFTA 3FDSA 3N9IA 4KP7A 2ZAMA 3BILA 3SEZA 4ND2A 3BMCB 3TFOA 4LZZA 5E8RA 2WAOA 3M6XA 1V0JA 3P94A 4K9NA 4RHUA 3QELB 1J39A 1YULA 2VIIA 1KARA 3OE4A 4X20A 2X42A 5TJ9A 5CFZA 3QKWA 6NULA 3B6MA 2OV8A 4RTQA 1UC9A 4HVTA 5REQB 1AMOA 4OXYA 2B98A 3W3AH 1P77A 1WZ2A 3M9MB 4LF6H 3HKEA 4TVBA 3PDUA 4DRXB 5FPKA 3W8FA 5TC4A 3KHHA 4DJJA 4B6QA 4ESOA 4R3NA 4KQXA 1DMRA 2NZ2A 1BS9A 1E1NA 1SBTA 3FTPA 4FSDA 1Z0JA 2OP1A 1K8RA 1KJYA 4TMKA 3X1YA 1KKMA 2KHZA 4M46A 3DO8A 3VR2A 1NAHA 2H06A 1CS0A 4MW4A 3VX3A 2QIPA 5IZ4A 2Q3LA 1M6VB 3VZBA 4EABA 1O4WA 3IC5A 2CYCA 4V39A 1ZESA 3ECAA 3ECCA 1N34B 3AVPA 3E1SA 4NWIA 3K9NA 2J5KA 2PFKA 5C5JA 1ZHQA 1E89A 2CVOA 4RU9A 1NJFA 5IPFA 2Q1TA 3BRSA 3LC1O 4L6IA 4MGIR 5JSQA 3KZVA 4CMAA 3CC8A 1YCGA 5K3SA 4YJHA 1D4FA 1VBGA 2AI2A 3Q9NA 3ZBQA 4DAEA 4A3FG 4RSGA 1N0IA 2WOJA 5I01A 4A3KG 4NOLA 2UUBH 2FEWB 2VF2A 5IYZA 3IL2A 2F2TA 4MJLA 2ZSJA 3DH0A 4NCXA 2E4AA 5EXDA 5KJEA 4KE9A 3A4TA 2CNOA 2P79A 3B70A 3LHFA 3BXXA 4TUYA 2FMKA 4Q9HA 1R0XA 4ZJPA 3L1IA 5KFMA 4JROA 1YB1A 4RS3A 4DV3B 1Q14A 2Y0EA 3VR4D 1E4FT 4G8BA 4M0FA 3ZJ4A 1P8AA 4MEAA 2Q5CA 2B4AA 4UOZA 2CNBA 1TIPA 3II6X 2VL7A 3NP9A 4MMZB 2R93A 4MUAA 1GUAA 2XHZA 3OKPA 3CH4B 1OF1A 1E2MA 1Y5NA 1DUIA 4M60A 3LPDA 4HB4A 4UEWA 3CF4G 4X7RA 1KJ8A 3KAJA 4BMCA 3ZI4A 1LV8A 2UYOA 3GLHE 3HXPA 4FSXA 1PJ2A 4EYKA 1A9YA 4F11A 2P9HA 2VH1A 3PDWA 5ITSA 3QLJA 3RF6A 3V2IA 2C7BA 3D1LA 1PFQA 2FE3A 3AJ8A 1R16A 5KNCA 2HWWA 4CLOA 2HU5A 1AUPA 4N40A 5JY6A 3SY8A 3PQ6A 3RYIA 3ANNA 4IEIA 3JVDA 4PZUA 1GV1A 2Q9UA 4RFSA 4QNMA 4YRRA 3VU0A 2H65A 1V39A 3F5SA 5H3LA 2SICE 4HADA 4O8ZA 3RSOA 3G3EA 2A9KA 3STHA 1GTJ1 1ZYUA 2PU7A 3V3TA 2QRUA 3JAKB 4H6PA 3IERA 5HF5A 5ULLA 1WKVA 1NUHA 5E1MA 3BJZA 5BSTA 2ZTUA 5EGSA 3CPJB 3GWGA 1CU1A 3UYYA 1AQYA 1I4LD 1T6BY 3SNOA 1YUNA 4ETSA 1HFEL 1T25A 1RPNA 1XD8A 1V1JA 2FSPA 4TMZA 4YAJA 4PCVA 1Y1KE 2AC2A 2JFUA 1R9MA 4MZDA 5ALEA 1YUMA 1Z6QA 2ECQA 2A6PA 3UJ8A 1GSHA 3GV7B 4QBIA 2V03A 2FSHA 2HR1A 4F91B 2QEQA 2IA6A 1D2NA 1YIOA 2OZEA 4LY0A 4EO9A 1OYWA 2GETA 4YX9A 4MVJH 2FW1A 4RPIA 5JMTA 2GEVA 4R40A 4EAAA 1BXGB 4HH1A 4XOUA 1T94A 2ZCJA 2B8EA 4KPGA 3BAFA 2R1TB 1MN6A 1PD0A 4M9XA 3T5CA 3JY6A 2BPOA 9ABPA 3GFSA 4NBLA 1OR8A 4JBGA 3IP5A 4RLFA 4AZWA 1PJSA 4ED3A 3UJAA 2QAIA 1XCLA 1CCWA 1OTYA 1SA0B 3D6TB 3EGXA 3H2HA 5FA5A 1F4LA 4JOCA 1VCMA 4XVHA 5IAEA 4EW2A 2ZVDA 1N8NA 2XOXA 3S8YA 1OCEA 2QX8A 1TAHA 5K03A 5FD6A 4O7ZA 2R6HA 3GN1A 2IYPA 3GMIA 3C3XA 2BFDA 1US8B 1V5GA 1UNNC 3AHEA 5LP6F 4MW9A 1JPUA 4BMSA 1H5QA 1UMDA 3E7PA 2I29A 3C5HA 4CIWA 2ZIWB 2XE7A 1H0HA 3H05A 3TL6A 2JI7A 3BC1A 3NH6A 5B55A 4Z1MA 1FSZA 4RE5A 2RBGA 2MYPA 2FMAA 4OYHA 5EJEA 4KDEA 1WXHA 1VKNA 1T5LA 1Z38A 3S2EA 3NBKA 2YY6A 5MN4A 3T9DA 4AYBA 1PSZA 2F90A 1GFWA 1YJCA 2P68A 4RLQA 5DEOA 1RYSA 4PXAA 3FFWA 2YS7A 3EPGA 5T64A 2P5TB 4B4KA 1AY0A 1JHAA 4QEDA 2EBWA 1T1EA 4LCEA 4XGRA 2GARA 4JBNA 3SZGA 3W8NA 4OJTA 3Q10A 4KGDA 4CNQA 1USVA 4CEHB 4HYKA 1T35A 1II8B 2AMVA 3TKLA 4L4UA 4OH1A 4K6MA 3M9OB 2YIDA 1J7JA 4JVOA 1JJ7A 1T1GA 2OC4A 8LDHA 1B16A 4V1CI 1MZBA 2GUWA 3T3OA 1LFDB 3OSPA 4ITRC 3SBXA 4V38A 4B7XA 4JYAB 2G5GX 1R18A 2JB9A 2NSYA 3ZX5A 5B5SA 5E6SA 4D81A 4RF2A 2G3YA 2JVJA 2I8CA 4UM7A 5EHQA 4GX2A 1EFHA 5FYDA 1T2FA 3R5JA 5TGZA 3JWJA 1FU4A 2C0PA 2FSFA 3GDFA 3P0IA 3O7MA 2EIYA 1OYVA 4PICA 1JLHA 5TPZA 3T1YH 4WDRA 4ZJYA 3GLFE 4A3BG 2GI4A 1W7AA 5D3QA 4CM5A 2VXCA 1YJXA 4BE9A 1B7GO 1E8NA 4CL8A 3G0CA 5LMZA 4ZC1A 4P86A 4LJYA 1PTJC 1H6AA 2WUEA 2X8LA 4LQDA 5TQJA 1MOQA 4PINA 4JODA 4Q21A 4HZUB 4DL5A 3CN9A 1JDBC 4DQKA 5JNLA 3F5MA 3VKFA 2J9YB 3C3YA 4XYMB 3RODA 4R31A 3WKCA 2OR3A 4KPFC 3DDZX 2VOEA 3N0RA 3K6KA 3SFVA 4J9VA 2NYVA 1ODSA 2G1KA 5G0SA 5U4XA 5JQWA 1UMCA 1NI4A 1XDUA 3T9CA 3RV4A 3V4VB 4PV7A 1ORHA 4D8WA 1VBMA 1QPZA 4QRHA 2XXAA 1JDEA 2R8RA 3TTVA 3ZGYA 1DXYA 2IUSA 3SICE 5E6SB 3HA3A 4R9UC 5EHGA 3LUFA 4E32A 4ENSA 1UH5A 3CJTA 3MJVA 3KTAA 4NE2A 121PA 1ZJ5A 1NVBA 1SOVA 3H0KA 1U94A 4PZ7A 5FTWA 5HCNA 2PT7A 1LDBA 3O1IC 2WPDD 1U8CB 5E0KB 2CDNA 2FNAA 4Y67A 3CZCA 2J0VA 3ONEA 1DEKA 1U6JA 4UJ3A 1M9NA 3NNSA 5HQTA 3A36A 2ZAYA 4MAAA 3T34A 2ZRLA 4RMIA 3RQSA 4QU5A 4YMHA 2W83A 2GAJA 3CH5A 4DSZA 1U5BA 2CF6A 2BI7A 2UU9B 1JN0A 1TZKA 5HQ3B 5BPHA 2NV6A 3DE7X 1MQ9A 3T06B 5CR5A 4ZCLA 1F51E 4PGMA 3RYCA 5JFOA 3FDFA 3EGWA 5MGBA 1IQ0A 2B69A 4WL0A 3DFUA 4H7KA 1OWLA 1QK3A 4MI3A 3PC6A 2EJUA 2OT3B 3R5TA 4XWTA 2IPAB 2NTNA 1TEZA 4E46A 3DCJA 1RI3A 1GDDA 2G1AA 4GMDA 4HKTA 4D44A 9ATCA 1KSGA 3PE3A 4A8PA 3BCUA 4C0LA 1OIWA 4Z7NB 1IXRC 3QVKA 4XXHA 1ISRA 4B76A 1JZSA 4DVJA 1TUBB 4UAGA 3GAMA 4QRIA 4WJZA 2I67A 5JCXA 1JAZA 1UJ4A 3DT8A 4HNHA 3KXKA 4ZYWA 5BWUA 4YCMA 5KTYA 2HDNB 1E2UA 2DTDA 2Q0QA 2YIJA 3TDMA 3CEAA 2VQEB 5GZ1A 1R6BX 5JRZA 2XYPA 2R6AA 5A7GA 1E2DA 5C46F 2P3QA 1IG0A 1S2IA 1OLXB 2NO5A 4YRMA 5K0EA 1SZJG 4JV5H 4MYHA 2CVPA 4DC0A 2L2QA 5BSHA 1FP4A 3DGFC 4E5SA 2QUHA 4IV8A 1Z82A 3CBQA 1IBLB 1YJ8A 1TM3E 2E0IA 2H08A 4JYPA 4JI7B 3EARA 3QZUA 3KCNA 3ICOA 4IBOA 5FTNA 1SQ5A 4U7CA 3CWCA 3SLGA 1QO0A 2X5OA 5C7IO 4M53A 3LYLA 4EBEA 4OBXA 2BM9A 1FK8A 3MCVA 1V3VA 3VH1A 1O75A 4DMHA 4BNUA 2F3QA 2ATIA 4PQRA 4Q4LA 3HDYA 2A0YA 1RLIA 3P9XA 2R6DA 2CJXA 5LXTF 3DZGA 4Z3OA 4S1OA 5B57C 2D5AA 5JSZB 2RGDA 3KHLA 2QG4A 2COGA 3TOZA 2G4CA 1JFFA 1QRDA 4BWYA 3DGEC 3ETLA 5FI5A 3VC7A 4XCXA 1CF2O 1KI3A 1GP2A 3S29A 1KMMA 2DECA 1XZDA 5KFZA 2WHRA 4FPXA 4TVOA 3UUEA 4LG1A 1FRZA 4LQLA 2QTRA 1P4JA 1P80A 3VZQA 1JECA 2V7GA 3CF6R 2WLSA 2SKEA 1VBNA 1R6DA 3K0CC 3NCTA 3OJOA 1SWWA 1BC5A 4XEHA 4BAGA 1ENZA 1DCKA 5ED0A 2CBZA 1TCCA 2BDEA 4GLFA 3ZE2B 1TM7E 2FPOA 3IO3A 1S3IA 4HH4A 4JLJA 4UZFA 1YRLA 5D84A 4Z8XA 3LOUA 4V24A 1YJ5A 1NG9A 5CEFA 1LRLA 3IV7A 3NWJA 4YRZA 2FX2A 2HHCA 3G7SA 3LF2A 2A0UA 3UMBA 1KI8A 2Y1GA 4TV8A 1HTWA 3BGOS 1JJAA 4BO8A 4AUEA 2Y6VA 3T52A 3VDXA 3FLBA 4FMCF 4L22A 3WSTA 4P7JA 4EYOA 2VNAA 1MENA 1I2LA 3C16C 4AMGA 1ARZA 3DV0A 4CL2A 4Z4EA 1GL6A 3CUYA 3O8OA 4MGHA 1P2FA 3E8MA 1EZZA 5DASA 3NETA 2C2EA 4ID9A 1YRYE 5LNK1 2WTFA 1H2EA 1FVXA 1T5HX 2VP2A 3ZI7A 1Q1NA 1Y5MA 1T8WA 2YZNA 1UOOA 2XC9A 3NIFB 4V02A 5MN6A 4LF7B 2C77A 5A3QA 3MG9A 4FYHA 1PWYE 4GS5A 4DL7A 4FOOA 3R9IA 4PFSA 3TIGA 4C76A 4BLRA 3FVTA 2NW6A 4B3DA 4UUNA 5F3WB 3PZPA 2HCTA 4JI2B 5DGAA 1J1IA 3MLEA 3NR2A 4KREA 1CDOA 1N2CE 1DOHA 1L7PA 1RWVA 2WUDA 4UNNA 2C4WA 3I01A 4WDQA 4BO6A 1P45A 3RD5A 3FUWA 5J23A 2GZ1A 2W0MA 4JYBA 4X5OA 2FPLA 2ZDQA 2ADFA 4EH1A 4C0QC 2UVVA 1D2GA 1HC7A 3H84A 4GEKA 4PFJA 4YHBA 4CG0A 1SD5A 1JR2A 3QEMA 4O59O 5LCXA 4EVIA 3T1NA 4WZBA 3F6SA 2WM8A 3IR5A 1W52X 1PU2A 5JNVA 4F72A 1U65A 1T4BA 3EPIA 1N36H 2DLDA 2RGCA 5H1YA 3MYYA 4JJ8A 2Q6OA 2OWEA 3O90A 5JMPA 3SZLA 2ORYA 2YRFA 4WASA 2F3TA 2BMJA 3PJGA 1T0PA 4FLFA 3FWNA 4HBZA 4CV0A 1YJBA 3KSAC 1O8BA 4FGJA 4MUNA 3F67A 5I45A 1B6TA 2C59A 5F3RA 5AIBA 5ICSA 1M8JA 3A4NA 3THXB 4IS3A 4B3IA 4Q3DA 3DMGA 2CNNA 1CF9A 4ND8B 3FKIG 1DIRA 2C4MA 3OO1A 1NBEA 3K05A 4A27A 5TIIA 1JEAA 3N0WA 1I51A 2JFHA 3M6VA 3J81W 4ARBA 1QH0A 1S2LA 2BMFA 3L93A 1KMCA 4IVQA 3ZWQA 3KQKA 2IS1A 5AM0A 1WABA 2FPWA 2GZ3A 3F6YA 3KOYA 3VR1A 4C7JA 5IVKA 1COWA 1CR0A 3QENA 4O2AB 5H3CA 1T1RA 1W88A 1Z7GA 1WBJB 1F12A 4S35A 4WA8A 5KC8A 2ANCA 2MSNA 1JWLA 4UEOA 3KJZA 1U8FO 5EJIA 4ZI5A 2B92A 4XKJA 4R68A 3OFNA 2XGGA 2ATVA 3QX8A 1EFAA 2WJGA 4YLGA 1E9CA 3VU1A 3IQFA 4LE2A 4WEQA 2Q1XA 3AR5A 1PGPA 4FNGA 4UXHA 3R0XA 4EMBA 5BN1A 1SVNA 1DJQA 3T1HH 1K6XA 1NQAO 3VHXB 1IZ7A 2GCPA 2XTMA 1GITA 3UHPA 5K4AA 5IYZB 3OQNA 1VA5A 3L7CA 1ZR4A 5KT7A 4LW8A 4WWHA 4OHBA 1BCSA 4ZV9A 5DLFA 1L5QA 1I3LA 2L69A 2LRHA 2H0AA 1AUVA 3A4VA 3IOBA 3QXGA 5LU8A 3AP3A 4L8LA 4M1MA 5DISB 4ZXPA 3FPGA 4FW8A 5FLYA 1IATA 3EXG2 3CPEA 1HE4A 4DV0H 5F5LA 1P39A 2CCKA 4ZPJA 1E2HA 2R8JA 1J70A 1E96A 1RIFA 5C1OA 4RAOA 3ZXUB 2ES4A 3B2NA 3M4ZA 2CXOA 1MDFA 4IXDA 4GI5A 3BTVA 3HVIA 5DLEA 1VHLA 3AGQA 1KY4A 4W63A 1Z2EA 2CDBA 5FO0A 5JS7A 3AF6A 2CNWD 4C3VA 1XJ0A 1CUIA 1CB0A 3G0OA 3I2HA 3TCXB 2WABA 4TGLA 4W8GA 4BUJA 1HNWB 5H5JA 1SD1A 1HXHA 4NU5A 3A6FA 1CULC 4OGGA 3PN1A 2FSVC 3OJXA 5CM8B 3QFFA 1K6EA 3SEQA 3UZOA 4BRZA 4B3XA 2HMVA 4KTTE 1SC4A 4NNJA 1N2GA 3T5HA 4DL6A 1KYWA 1Q1ZA 4BNXA 4JUFA 4L4RA 1NUPA 4KIUA 1G2QA 2WWVD 3RHSA 3E3OA 1SBHA 3G2QA 4JKYA 2DU8A 2YZ2A 5I5YA 1P7ZA 1SN7A 1XK7A 4RH3A 1GA4A 1U9JA 2KLBA 2VLBA 5DHAA 3ZJTA 5LR6A 4GRDA 3DV9A 3T9FA 3H99A 2JAPA 2Z8YA 5IFKA 5HE8A 4F93B 5EWFA 3L02A 1GQ2A 1GT91 2IIBA 5EIOA 2CNKA 1U04A 4WXHA 2V7XA 5A2QA 4GR4A 1HEYA 1NXVA 2GSWA 3W3AD 4XQ9A 1SXJC 3AHIA 1KS2A 2DCMA 1X7GA 5HF9A 1ZIXA 3T5GA 4CKCB 1M5RA 5AYVA 1U8AA 4GL4A 1KMHB 4HDNA 1D6SA 3DQQA 3M4YA 4FBMA 4IYRA 2BQRA 3AZPA 3KVRA 3OOYA 3T7TA 3TX6A 4ZK6A 5G1OA 4LFBH 3NTRA 3AL3A 1QG0A 5IT4A 3W2HA 1EP9A 2PL9A 2BKAA 2Q3FA 1XX6A 5K51A 1U7ZA 4Z0NA 4WGFA 2NU6B 1EK1A 3I45A 1KAGA 2B99A 1RW4A 2R1TA 1RRVA 2R87A 1EGQA 2VJLA 3BORA 3CNEA 3Q0EA 3QM1A 1NBOA 1C7JA 1VG9B 4V0OA 2OLSA 1D2MA 1T43A 3TW7A 1VFPA 2VJBA 3EGXB 5CDHA 1TB4A 3IPCA 4N3GA 2R84A 3FDZA 3G2KA 4JUCA 4ZDJA 2EC5A 3OKCA 3A6PC 3E9NA 4CR7A 1XTKA 2I03A 3RW9A 5MHTA 4I36A 3F8SA 3WSWA 2W6CX 4GG1A 3FGZA 1JQLB 3R3YA 5BUZA 5JNRA 2F00A 3H0GG 3TK1A 1VPLA 2IBMA 2BR5A 3ZCVA 1PQYA 1K75A 5AOAA 2IH5A 1E8DA 3MTAA 2BMAA 2QRQA 3L04A 4YP6A 3MJEA 5F33A 1N33H 2I2WA 2LGJA 1ZH0A 2XQVA 3TBHA 1G8PA 1HM5A 2J7KA 4R2JA 4UULA 5IK2D 3IIMA 3U4AA 4MPPA 2YHIB 5CFNA 3B1XA 3EIHA 5FLXW 3KC2A 3B51X 2C5EA 3N1UA 3VZPA 3RB6A 2VDUE 3HACA 1M2KA 2PQ6A 4EZEA 4N39A 3WGZA 2D6FA 4DTCA 4Z4CA 3IP9A 5LQNA 3WLHA 5FUMA 3PJEA 4KN5A 3GILA 4C7KA 2YIMA 4ZREA 4AL4A 2C84A 3TJMA 2X13A 3RTEA 4ZDWA 3WLJA 4DN6A 4KQKA 5K0ZA 1F8UA 1UPFA 4LXGA 2FDXA 5DP2A 2CV1A 4R8LA 4GLXA 3GLKA 4FGLA 5FLKA 3EVZA 3EVTA 3FSRA 2PRZA 2FEOA 4B8YA 3A6DA 3IHWA 1KQOA 2BGRA 3OU6A 4JELA 5CLIA 4LDRA 3OMLA 3FDZB 3NC4A 2PGAA 2E2WA 4NXMH 1KI9A 2BFCB 3GJRA 1SCJA 2VDKB 4V0NA 2CFCA 5HX7A 4ZN6A 5JMWA 3BKWA 4J94A 5CA1F 4IIFA 4HEHA 4NYMQ 2VOBA 4IVPA 1YONA 4WUTA 1OQAA 1ORRA 4BQRA 4GZ3A 3HU3A 3FSJX 3DF7A 4AVYA 1R0CA 4PPFA 3P4YA 2WJPA 1FDOA 3EH1A 5ERYA 1KDZA 2SCUA 4B7UA 4BRUA 3O91A 1AU9A 2QW1A 2VXYA 3FCSB 3IHKA 3T7EA 4M0PA 4DY4A 4HDRB 5CB4F 1ZWKA 1AKVA 2BEVA 4AJLA 2P2ZA 3A1CA 4GR5A 4IDPA 2AWNA 4OATA 4AG3A 1YI8A 2IZ1A 4EJSB 3I4LA 1J8YF 4DR6H 1JEJA 1JWAB 5CLGA 1P7VA 3DKIA 4EOGA 2QN6A 3EPRA 3PX3A 4HAOA 1NP6A 1P1BA 2RFLA 3H18A 4R69A 5KNCD 3KJEA 3Q2KA 5TEVA 3C4JA 3OCCA 4JUZA 2ISCA 2IYOA 5HNEA 3C3JA 3KZOA 4WZAE 3F3YA 4MHSA 3ETJA 3G2PA 1FFEA 3H8VA 2WAQA 3V9AA 3DOIA 2ZUUA 3PD0A 3W5JA 2QQGA 1SVKA 1G21A 1P5HA 1P8JA 3B36A 1MCZA 5E9AA 2M05A 3WGNA 4EG3A 3OQMA 2VDWB 2IOFK 3HGQA 2JEIA 4EFNA 5B36A 1RAFA 3TM4A 1MU0A 4N0PA 4BECA 1ZA2A 2ZR7A 3KB6A 1QTQA 1BOFA 2ZRKA 1UP7A 1QVVA 1T0IA 4GWLA 4LCJA 5FFMA 3GMTA 4TUYB 1XZAA 2OHGA 3BQ0A 2R79A 4XGIA 2AF3C 1JVSA 2DQZA 4PWZA 2Q2UA 1GTRA 1ZK3A 2JCBA 4WQMA 2A67A 3PQ5A 4PXSA 4L74A 1PUJA 2RGBA 5D87A 1G6HA 1OH6A 5KX5F 2ZQ5A 4RABA 1WNTA 3I64A 3VOAA 2GQSA 2W6OA 1IB6A 1JFFB 1ML4A 4QBKA 4A5SA 3OE7A 4FU0A 2FP4A 2WHYA 3S24A 1L2TA 3MOGA 4Y6RA 3JYOA 5FP0A 2QMUA 1IHDA 2WHXA 4OX9Y 3PA6A 1C0IA 1M73E 2A3RA 3BJMA 4M83A 4RKWA 5B3JA 1Y81A 2CY0A 3E4CA 4KPUB 5AVQA 3G0HA 4JS0A 4AWBA 2FEKA 3RSFA 3JSNA 2BN4A 4Q0YA 1KETA 1ZEJA 2JI6A 5KFTA 1XQWA 3OUUA 3LLCA 2D1TA 1RJWA 4O4LA 1BMFD 2ZJ6A 3ESAA 2HK7A 3ABSB 4C3OB 4D4JA 4AJ1A 4PDBA 1IN8A 3DDOA 3TL2A 1A2QA 3GUVA 4EF4A 1ESMA 3TTXA 1Y6RA 2R62A 3JASB 3QUSA 2EFGA 3HY3A 4OF4A 3H3JA 4K3VA 2FSIA 1G6OA 1NW5A 1G3UA 2B1QA 2CHQA 3A2NA 3F7OA 3PHJA 3Q3IA 2C2BA 2WT9A 2HIAA 4WX2B 3V4OA 3J7TA 1TF7A 4IHQA 2UAGA 3QLEA 1EA7A 3HBJA 3HO8A 1PFWA 4GOLD 4RD4A 3V1TC 1XTBA 1O6FA 4H08A 1BSVA 4N3BA 3ZNNA 4ALIA 5ICGA 1SD2A 2EV9A 2POCA 3GF4A 3C6KA 4WE3A 3FWPA 1U0EA 1LW7A 3PPVA 4RA6A 3S1AA 3T99A 5E1DA 4BEBA 3WLEA 5A62A 1L5KA 5JIBA 1NDQA 3ISTA 1H4TA 5JSYA 1U63A 2C07A 1JXOA 4Q4JB 1I36A 1A7KA 3FTQA 3WJ2A 4BNVA 2ZUCA 5E0OA 4G9BA 1C2YA 4D3XA 4NCKA 3SNKA 1G63A 4DYHA 3R1IA 1X19A 4X6YA 2M2IA 3ILXA 6CHYA 1OX6A 1MPXA 3KHUA 3LX8A 5FL7D 3SZRA 3ERCA 1W4CA 2ZAOA 3NEAA 3U3OA 1YOVB 3K1YA 3ZIAA 3QY0A 4D0LB 3IR6A 3DFFA 1E58A 1NASA 3MGGA 1QHEA 4IDHA 3TVDA 4ZTUB 1GNLA 5KB3A 3BULA 4G5YA 3OSZA 4NOMA 2JIBA 5IK2A 3MR5A 2AG1A 3EC2A 3L0SA 2P77A 2WDPA 4YXFA 2M1XA 1SKMA 3W5AA 4XJXA 3PEVA 5LLDA 1NQTA 4KMRA 1MFPA 4MYUA 1JDVA 2C8JA 4O4IF 4CWAA 4B6RA 2GHQA 1DADA 3FDJA 5EKUA 5J2UA 3HXOA 1IEVA 4J6FA 16PKA 5F51A 1E18A 1ULTA 2H6EA 4NBWA 1C8LA 3OQHA 1Z4IA 4HWRA 4TLDA 3ZHRA 5DHUA 4CM4A 3I9JA 4NESA 3BJEA 3RB0A 4RA6B 1KWGA 4UCUA 1N5IA 1BEUB 4D2IA 4DBVO 5AUNB 1KFBB 3TQTA 1QQ7A 3PPIA 3O3MB 3GK3A 4R7GA 2YU9A 3QUBA 1M72A 5L4SA 2PZEA 5EL0A 5DKFA 2HDKA 1A9XA 4RY8A 3UV3A 3X44A 1H0RA 3EXEB 4WINA 1N2IA 3F9IA 5D1NA 1JSLA 3FPLA 3PD1A 5KU1A 3K1TA 3LQRA 4PANA 4OKIA 3WIBA 1D5WA 4REQB 4YJFA 4K6GA 4KWEA 1A95A 3TIXB 1CDEA 3TAHA 1WDLA 4LF7H 4KGZA 4XWYA 4BPBA 1P2VA 1QC5A 1X1RA 2H4XA 2TMYA 3CG4A 5FPOA 2JHFA 1SXPA 5B3LA 3I9V6 2HO5A 1RI4A 5DK6A 3UKJA 3K9GA 3EIFA 3R5HA 1LPPA 1C3JA 2HIGA 3ZH2A 3WMWA 4C4PA 2PSDA 1YVPA 2JD2A 3F71A 1N0WA 4Z4GA 1NMQA 4KXNA 2FZWA 5ICCA 1S8AA 2DY1A 1L6IA 4WBNF 2COUA 4BQSA 4ED8A 3G23A 2Q5LA 3SC2B 4MLCA 2BJHA 3EXHC 4EHKA 4IJUA 3B60A 1MGPA 4D9FA 2XEXA 1YJQA 1BYIA 1YZTA 1AMUA 1JT2A 4MV1A 3FJOA 3NJ4A 3RRMA 1DAEA 1ISGA 1VIMA 3OZDA 3X3HA 3M1AA 5JYBA 3L92A 1HYHA 3MBIA 2FR0A 1PHPA 2ZRDA 3HWX1 4CEIA 3AESA 3RBEA 4CMKA 3G2LA 1R0RE 4TL9A 1Q0ZA 1FNBA 5LNK6 1MC5A 1W0KA 4KK3A 4D42A 5TLSA 2C54A 1WX1A 4FHGA 4BZWA 1J8FA 2COKA 3ZNPA 4RJKA 5F9FA 4EYHB 2CFTA 2IE8A 1E2IA 3ZW8A 1UBUS 1HLGA 3QPBA 1ABBA 1L7NA 3RU2A 4AN0A 3BG5A 1EUZA 5FPTA 4LF4H 2QZSA 2XNHA 4RV4A 4BYGA 3DVSX 4X24A 5KPDA 3HR7A 1LRKA 3A6EA 5ER6A 3ZYCA 3CLSC 3JU3A 2ONYA 1MAUA 4WZ6A 5F98A 3L0IB 4V0RA 3MJTA 3RWMB 1XDGA 2MIIA 3EEIA 3KTAB 4V2UA 1Z8HA 1GQOA 2CGEA 2W2MA 1Y5RA 2Q2VA 4DLLA 3Q9SA 3MFYA 1NUQA 1XQ6A 4PBCA 1N2BA 2L17A 4L3VA 4QLBA 1QPGA 4OOEA 4B3BA 1BG6A 3ZVRA 4NFYA 2XKAA 621PA 2QZ4A 2HC9A 1GLGA 3HUEA 5AJZA 1A7JA 5FJIA 5IAJA 4DWWA 1RP1A 5L1JA 2ZJ5A 4IWYA 3ZWPA 1OFVA 4TX1A 1EJ0A 1QHYA 1RBQA 2GBIA 4US1R 2NXWA 3M8KA 2O20A 4HAWA 2W6PA 1QS0A 2A1TR 1LTQA 2Q3BA 2RIPA 2X9LA 3RC2A 4RY0A 5BR7A 5CNIA 1XCPA 2JF0A 2VF8A 1C30A 3AEQB 1VXOA 3HY4A 1VYHA 1JG1A 3KT0A 1S2DA 4X1IA 1K6IA 1BJRE 4ZU3A 3CB2A 1ZETA 2D2VA 1KNQA 1NXPA 5BMVF 4KDFA 3T7RA 1GIAA 3HJCA 1LI4A 1TUBA 4TYWA 2CV2A 3MTQA 2X14A 4MKGA 5HG0A 2AEFA 3OH8A 4OHOA 4WN9B 3OE5A 4DWOA 5KTPA 1OWPA 4GI1A 2IV2X 5B2ZA 4RJLA 4M0MA 1FW8A 1NTOA 1CUAA 1DPFA 3C6BA 5LBUA 2P90A 2KB0A 2XQGA 2WZBA 1HA3A 3CLVA 1ITZA 1EE1A 2F64A 3BS4A 3EYWA 1DWOA 2GPJA 4IIDA 4J2TA 5FO1A 1GGVA 2NUPA 4XDZA 3ZZMA 5CCXA 1B0UA 2AUNA 3C7AA 3ZDEA 3B6IA 1CZLA 1BX3A 1QTIA 2Q5IA 4HI0E 4GNRA 1GAEO 1W47A 1V5FA 2VDJA 1PZHA 3IUNA 2NP7A 1TJ3A 4MI9A 1VMDA 3Q3CA 3E5RA 2OXIA 1SXGA 4Q1VA 3GG9A 4RF3A 2EFDB 1HDGO 2V6JA 2XUFA 1WMAA 4G0NA 4G0UA 2QLLA 1TW3A 3K94A 4X1YA 1PBNA 3WNZA 2QD1A 5DNWA 3ZKWA 5BMOA 3UH0A 1P2BA 4V0ME 2IX3A 3DTVB 1OTXA 1Z35A 2IPLA 3PV0A 3A1SA 4K7JA 4UCFA 4IDAA 3ICEA 1ONSA 4D3DA 1ZK0A 4COOA 4GXNA 3GGSA 4EMTA 5HUHA 4N76A 4J0IA 2JIMA 3WIOA 3HFSA 2WUVA 1A8UA 4JR1A 2I6UA 2NVUA 5E4FA 1F7UA 4ITVA 5KVAA 1G8HA 2RGVA 1ZGBA 2Y71A 4YVFA 3TLEA 2AIRA 1LBHA 4AWXA 2QTHA 5IC4A 4CDNA 3ER8A 1JG3A 2ZTHA 4XFKA 2BGTA 2D4HA 1A1SA 1EFVA 4JZYA 1P2DA 5CCDA 4GPBA 2GYVA 4C14A 4CMCA 3TINA 3MJSA 1YR2A 3CVYA 1QDUA 1NFQA 1RWOA 1FTGA 1KMHA 4YQWA 1N5DA 4IHJA 4INJA 3TYXA 2YS6A 2JEJA 1R4MA 5CYOA 4ENUA 1HYQA 2YYYA 1DIHA 2ZXUA 3OC0A 4O0MA 4EKIA 1DFIA 3GTLA 4FX2A 2R4TA 5JZSA 1CRQA 1Z83A 1P2GA 1JKJA 5I7AA 3OJCA 4TXJA 1ZICA 8MHTA 3C15C 2O6LA 1K9SA 3P0EA 3E1KA 3O0DA 3ROGA 1LBIA 3BE5A 2VUGA 1I50A 2H7VA 3T9EA 5C0OE 1DQZA 3EBLA 4RJJA 3SQMA 3BZWA 3CNQS 4MQBA 5UKDA 1Z29A 2JGAA 4DY6A 2FPUA 2EOAA 1I7NA 3LWDA 3MWJA 4AMBA 3B7PA 4OQLA 2QF7A 3O8OB 1I3NA 2O3RA 3IXLA 1CLUA 2CLHB 2IPMA 1V51A 1E6WA 3ESRA 3RB8A 2DGDA 3WQQA 5D3KA 1UKCA 5JASA 1P61B 2WMDA 3DBOB 3DZCA 4JV2A 4QOHA 4FOSA 1MX1A 1QPBA 2ZBVA 1YWGO 2J08A 2ZTVA 4QBTA 4C0JA 2TSYB 2OCXA 3GFTA 2CW8A 1EFVB 1JL3A 5ALUA 5EP2A 2G67A 4YP7A 3FTFA 4YRJA 4D3YA 4PPNA 1THZA 4I3FA 2J9GA 5BNTA 3LBFA 2B5VA 3MK31 1JXQA 1RM3A 3JD3A 2B0JA 5KDOA 1V8BA 3MQFA 3WYEA 2ATLA 1Z4QA 2O2SA 2AN4A 3LUJA 3OLVA 1T5TA 4GX0A 1L4HA 4PPYA 1TD1A 3TLKA 3Q3EA 3RVBA 4L15A 5LQRA 3DLHA 1A48A 1R0WA 1NOJA 3GRPA 4MQEB 4P93A 4QDJA 2XD9A 2AMJA 2ZW9A 4HVLA 1WE2A 5L8VA 2IS4A 4B3FX 3K7EA 2BUBA 2A0XA 1L8XA 1JJVA 2X5RA 3AB8A 1V11A 2ZSUA 1U5AA 3N87A 2PSEA 2B78A 2R4QA 3D8NA 4OHUA 2WEKA 1QIHA 1H4SA 2VUMG 4RVSA 1ZHFA 5FTJA 2PKQP 4YUWA 5IU6A 3Q3HA 2VPQA 1SG0A 1XDZA 1YQ9A 4MWZA 4MINA 4ND4A 4RVHA 4X7PA 5CGZA 3HO6A 1I1MA 3PPYA 2AJTA 3SLKA 4I5EA 4GKJB 5I5VA 2VRNA 4OQPA 1K88A 1X9IA 3EGDA 4HQKA 4U63A 2RHOA 1KRXA 3AJEA 3ZJVA 2H2GA 1NNUA 4OJMX 1POWA 4OTZA 2BGUA 4J49A 5CCBA 1BMTA 4AF8A 1TVCA 4M1SA 1O9BA 5JNTA 3GHYA 3JAWB 5TNXA 3N2EA 3R24A 5HCIA 1JDJA 2NQ2C 2Y66A 3ODGA 3QNMA 4O4HA 3IQZA 4PPQA 4DLTA 3OTOH 1UWKA 3DPSA 3KAKA 3LRPA 4NYJQ 4YP9A 4R2KA 3W06A 5A7HA 3H5OA 5TS3A 3QBDA 3DMTC 5IG2A 3R5FA 1XTQA 1OH8A 4NK5A 5U1PA 1FUEA 1OBFO 3KHKA 1V71A 4IJ5A 1VMIA 4JP1A 2JCXA 4BFSA 2WP0A 4UE3S 3AVXA 3OT1B 4DYDA 1RE0A 1TAQA 1YC5A 2C8KA 2WF5A 2GASA 3S2GA 1JI0A 5D00A 4X8LA 4XIJA 4H31A 4QTUB 5E9WA 4A7PA 2WHEA 5LQUA 3V1NA 4RHTA 3UC9A 2XIJA 3EIOA 1ODIA 1X8XA 1E98A 2WYVA 4LJ4A 5KAPA 2UUCB 3PQFA 4M99A 1OZFA 1FYWA 2WQ6A 4JI4H 4A3GG 3E0XA 4URHA 1KVQA 3BRWA 4ZVMA 4U2BA 4ZT7A 1NV9A 1Z37A 2PKEA 3O8QB 1APBA 1J2UA 3FRJA 4C43A 1WUYA 2I3AA 2VQFH 1T91A 2VP0A 3QF7A 2O3SA 3PICA 4K6OA 6REQA 2IOHA 3VO8A 3BRQA 3WSVA 3N44B 1ECLA 2RBKA 2HA3A 4IMRA 2RKOA 5JQGB 1N77A 1DCTA 1RWMA 2FF5A 4PO8A 2JAOA 2X0FA 4EX6A 1F4PA 4JA2A 4HMQA 1U3FA 3F9CA 1FDSA 1Z18A 3GOHA 3EB9A 2WYWA 4O2AF 3H3FA 5ICEA 1DARA 1SUDA 4ZZ3A 3OESA 1SCDA 3O4VA 5EWEA 4RADA 2X0JA 1ORDA 5A5GA 3N6XA 3O4FA 5JDCA 4UW9A 2EW8A 3I52A 1RVV1 4YNBA 5GWXA 3NT2A 3PF9A 3KPUA 4GZ6A 4EVRA 3QUCA 2CL7X 2VJNA 2C2WA 1XUOA 2CEAA 1V4BA 2FGKA 2I99A 1IVNA 3N8GA 5IYZF 4K9QA 4QGBA 1SBQA 4RCVA 4PZYA 5GM2A 4CKEB 3M6UA 5BT8A 3LTNC 2BQUA 4P3XA 3HB4X 4C0BA 4C9BA 3T15A 5IT9A 2GCNA 3K2EA 1RBMA 4J4BA 4KOAA 4M55A 4W82A 3RVRA 4JJ6A 3FPHA 2XYHA 3DB1A 3INGA 2OV2A 2WE8A 5DEIA 4AIRA 3HZOA 3IKLA 3UJ6A 4CM6A 3Q11A 1XV5A 2QXTA 3OM1A 3PXBA 2V54A 4DUGD 1L2ZA 4V3CA 3KRTA 4MB0A 5AK3A 1R6UA 3P71T 1ZRHA 3ILYA 1DO8A 1GFZA 2KPOA 4A0FA 5I9SA 1CW2B 3ND5A 1OFUX 2Y4RA 1JALA 2EJBA 4JJKA 3GEEA 3ZW9A 1J20A 2YHUA 2G4VA 1DKUA 4GMGA 3KT6A 3Q8KA 4CC6A 1HWYA 3E2PA 4F06A 1BE8A 3VR3D 1CQIB 2ODEA 2DQ4A 5T5QA 5JV5A 3SWWA 4G0ZA 4IDOA 3LHKA 3U4CA 4KXXA 3U7EB 1PEKE 2A1HA 4KO1S 5E95A 4TTAA 3HXLA 1WG8A 4G41A 5INTA 1D6MA 3HR4A 3RC1A 2CFIA 3KU4A 4WA7A 2VF5X 2UXBB 1E0AA 1VL2A 1DRWA 1Z0FA 4HNGA 3HDGA 2YWRA 1Y82A 5CHYA 1C1XB 5DE3A 2VQ6A 5BQFA 5KFHA 3AVTA 1VGVA 1SEIA 4LY9A 4NU8X 3EYAA 1W75A 5DH9A 1MABB 4C1NA 3RKSA 4NK4A 3C4VA 1M1YB 2FN9A 4PX3A 3HDHA 4RTNA 1MB9A 1XEFA 2PGIA 3NV9A 2VN8A 3NLLA 1L8AA 4C7VA 3CM0A 4RMHA 3QBJA 4KYTA 1BGXT 4JK3A 4LC0A 2E4XA 4DCSA 1UMBA 1ZM7A 2WD7B 4GOOD 3HB1A 4RYLA 2NXCA 3L1KA 4QWDA 4AS2A 2VAPA 3FUCA 4C30A 1IJFA 3VYUB 4DXHA 4N6NA 1N1GA 4CQJA 3CVXA 2D1YA 4J1QA 5I6DA 2GEUA 1IBSA 1ZGGA 2IFTA 4RMGA 3JXEA 5IYDG 1K66A 1IOZA 1OKKA 1N5KA 4B81A 4W1QA 2HV8A 4CM9D 1WZIA 4YY3B 1Y4DE 4GBGA 5E4TA 3QVTA 3HLTA 3AKZA 3H0EA 1ZG3A 3EULA 2CDAA 3MFIA 4K3UA 4MCHA 3ZOKA 1UPCA 4PGAA 2D7DA 1ZIDA 4CMFA 3OEED 4NV0A 4OHWA 5C32A 2R1UA 3WWHA 2HF2A 3OZFA 4N82A 5EWJA 1WD7A 3ESBA 3IEMA 3UENA 5AJWA 4MYDA 4OHPA 3O3OB 3ZIUA 1F2VA 3Q8PB 4JV5B 4FBTA 1Z0IA 4UCOA 2VPYA 1ZJZA 2CZCA 4HXGA 5JNWA 5KTOA 4DUYH 2HF7A 4LMRA 3V00A 5I7SA 1HRKA 1N3IA 1FW6A 5F9LA 4PF1A 3I9V1 2QPLA 4R51A 2VBFA 1Y80A 2EATA 1JLMA 4RAYA 2UZAA 1VI2A 3WX0A 4LRQA 1Y8CA 1A50B 221PA 2P41A 4GQIA 1CFZA 3QE2A 1LDMA 1UT6A 2WOOA 1U9ZA 1USGA 2CVQA 2GZSA 4HYTA 4O8CA 3NOXA 3QQPA 3IOYA 5AQ1A 1GDTA 4HSEA 3EODA 1KIMA 3O3NB 2PZKA 2QN8A 1TI7A 3BCRA 3OHPA 2XUHA 2Y1LA 3OFSA 4ZOLB 3TGWA 3MF4A 1L5RA 4O08A 3VJLA 2HY7A 3SIPA 3ZN2A 1TD9A 1X7XA 4FGSA 3VO1A 5EJGA 4LC1A 1NYQA 1WB5A 2XUOA 1Y3BE 4QOFA 4DDHA 5EJ4A 3E5MA 3PR2B 3URKA 2PD6A 1XHFA 2D2FA 2DUWA 4LXQA 2ZJ3A 1RHMA 3WA7A 4WNAA 5BYAA 4Q1AA 5CYPA 4PQYA 2FLWA 3QSGA 5T6BA 1S8NA 2I4OA 1P6XA 1CUXA 3JQ7B 3I53A 2JLUA 4INOA 3GEIA 4DA8A 1DBSA 2Z04A 2XAUA 2KI5A 1QFMA 3GT3A 4A6DA 3PHIA 1U0RA 3GV0A 3JQ6A 3GGOA 2ECKA 4AS1A 4KIJA 4GDFA 1DC4A 4TTQA 3O1LA 3OZGA 4I4CA 3GUHA 1V26A 4O2RA 1EKPA 1SURA 4OUKX 5ALMA 4M0DA 3TTTA 5KTTA 1G41A 2OMKA 4CF3A 5T7BA 4U8HA 2QROA 1L7MA 1GAQA 4ENRA 5DX8A 5HTOA 1FS4A 4TWJA 3MB8A 1XKQA 3KQTA 4TYMA 2HCRA 1X7XB 3SIRA 4C08A 1R66A 1CZRA 2YZ7A 2C5HA 2C2KA 3PPXA 2TECE 4M88A 1J22A 1XJQA 3JD0A 2JANA 5AKGA 3RAQA 3PJFA 4IDNA 1XMOB 2I3BA 3GJ6A 3A04A 4GI2A 5JSUA 5AOBA 3W2FA 5BWRA 4B3SH 3AINA 3GRZA 1AA6A 3ZC3A 2W7TA 1PN3A 1YACA 2ECOA 2Q8PA 2EZ9A 2P0EA 4W7SA 4CV3A 4YRSA 4CQLA 2OHHA 1O0BA 3IIEA 2ZT5A 5ARDA 4D4KA 1HGXA 1UPUA 2J9FA 2YW2A 4QUKA 3DLBA 3FWHA 3SD7A 3GTPA 2WFZA 3ZUGA 4I2VA 3E23A 3TLYA 1NAIA 3ZV7A 2P7HA 2DVMA 4A2PA 3BA9A 4DR5H 1X7DA 2KBEA 1VJ0A 4RD1A 3B85A 4P80A 2O2HA 2H11A 4Q02A 3KETA 3OQ1A 5BOVA 2I6QA 2DQKA 4JBYA 4WV3A 1DKMA 5T4FA 5IJ0A 2YZMA 1P29A 2DBRA 3LKZA 1TTTA 5JY1A 5JBIA 1KI7A 4KJXA 3Q72A 5B3KA 3GX1A 2GEJA 3RS0A 5AUPB 1U0FA 2XE6A 4J9RA 2EP5A 1ADYA 2BGKA 2P67A 2BTOA 4OGWA 4PR3A 4E5DA 1T8YA 4G37A 2XQIA 3R6LA 4RHXA 1WRVA 3L6UA 5FWXB 1GKKA 2FSUA 4PYLA 3I76A 5DP1A 1Y1WG 4LRYA 4QO7A 4D96A 2A9PA 2PCJA 4QXOA 2IDZA 3W9SA 4BMDA 1Q0HA 1RJEA 3U9LA 3WGOA 2XLCA 2JA2A 2LIPA 2PJZA 4OJKA 5DM1A 1Q7CA 3HN6A 1ZR2A 4M1QA 4MP3A 1UM9B 1V45E 2HSJA 4RZSA 5JAOA 5KVCA 3D2BA 4Q9DA 5CT9A 1FTYA 4ALJA 2WHPA 5A1JA 3OF3A 3NRJA 1FFWA 3SOPA 3ZUPA 4AKHA 1GGHA 5JEDA 4OIMA 4QSHA 5LU9A 1UZAA 3I61A 5FF9A 4C03A 1E1QD 1Q7BA 2EWMA 3IAEA 4IHJB 1S01A 1WXXA 2KSWA 1I30A 4GVLA 5E4JA 1HE2A 2CHEA 1QLWA 3BTSA 1T9ZA 1IXYA 4EPXA 2R0QC 4C5AA 3E0QA 1WSBA 3T41A 5JATA 4UBKA 1JDPA 2RAUA 3LI2A 4U9IS 1PS0A 3MZ0A 3QPAA 3G9ZA 4I4IA 4X71A 1GJRA 3FZGA 3CSWA 2J3QA 3IV6A 4OB7A 4P35A 1M10A 3QVWA 2Q3EA 3H5VA 3IESA 3P97A 4H60A 2W4MA 1V7CA 2D3TA 5KKNB 2QJRA 4BB9A 5CFOA 2BFOA 1GOTA 4DMMA 2QX9A 3DOHA 4YWHA 5REQA 3MWFA 4H3SA 2Q0XA 4ETWA 5KOHA 3AZQA 2A9RA 2GM5A 1ULUA 1QV9A 4DRXA 4ZGWA 3H2YA 4B6GA 1P0FA 4KR2A 1QIMA 4MEBA 4HO1X 4XJTA 2PUWA 5BWVA 1XCOA 2F4VH 1M2GA 3IIIA 3NDIA 4DV0B 5TV2A 3BIOA 5IASA 3MVEA 3K0AB 4EFBA 2A1UB 4O1HA 1O97D 2AG5A 4MTEA 3BGDA 1Q19A 4EY6A 4JI4B 4QM7A 4CF4A 3OKFA 3FOZA 2WA1A 4RANA 5KG5A 3UF0A 4O7RA 2JKVA 4UD2A 3ESZA 3O8RA 3L6DA 2UVRA 5JDCC 4PIPA 1Z0ZA 1G20B 4DXAA 1WMEA 1XOIA 4HB3A 2BWJA 3JZ6A 2F7SA 5HJEA 4HAVA 4CODB 5KEIA 5KWIA 3PEWA 1LPSA 2EEZA 4N0EA 2PLWA 5DMHA 4RZQA 4OUDA 1ZM4A 3AF2A 3H0CA 2QUJA 2R8YA 1W4AA 4IHJF 4ID3A 1P4GA 4FFWA 5HPYB 2OY0A 2OAGA 4GOXA 1A0IA 2J5XA 4NI5A 3FYTA 1LBEA 4KWTA 1VLZA 5CDFA 4O7VA 1VSVA 3TQOA 4F3KA 4KYUA 1A5BB 3H1GA 1GQYA 4GRAA 3ZXYA 1YQXA 2X5XA 2ZYSA 2WMOB 3PNMA 3M82A 2J46A 5FFFA 3HKZE 2B7BA 4HAIA 3STVA 4CIAA 1FUKA 3R75A 4DJFC 4IH4A 1ZJ4A 3C6YA 1UBJS 3SPXA 2AN1A 2I55A 1U2QA 4C78A 4E4RA 2BUAA 2FWJA 4D4IA 1VMEA 2ZYAA 1RP7A 3FFAA 1C8VB 2J7PA 3EVBA 3IG0A 1OV4A 3S8EA 3JQGA 5EWLA 3FRHA 3KEGA 4DDTA 3SVTA 1I1QB 1R5NA 1HQYE 2YJ3A 5I60A 2OENG 3FMPB 4I4NA 1EFCA 2GHTA 4J03A 5IJAA 3TPZA 3H5TA 1XVUA 3HXQA 1YDFA 4RKFA 5D1HA 3WQRA 1FVOA 1SY7A 1XWIA 1V6SA 4ZQGA 5E1OA 3L8GA 2AEMA 4OOFA 5DO9A 1DS6A 1I01A 4E31A 2CFOA 3WIDA 4PZ8A 2EHDA 5ERXA 1RR6A 3U39A 5EZYA 3O7WA 1PRYA 4BZPA 2I2BA 3BHNA 1YCDA 4CT0A 2QJOA 3V8BA 3OX2A 4F4YA 2G77B 2GHRA 5BW6B 1YZFA 3TM5A 1EUYA 3GOQA 3QUQA 3V4SA 3JQFC 2R7ZG 4K9MA 3ABZA 4BMVA 3DOEA 3RJ5A 2B21A 1HMPA 2I3GA 3OZAA 2ZJ8A 2GA9A 1D2AA 2PXHA 3AY0A 1EIWA 2WAAA 3GQCA 1NRWA 3AWDA 4YAWA 3OT5A 1PNQA 3QW2A 3BFVA 4BLSA 2IP4A 1N5LA 2GYUA 2CDRA 2W2PA 3MA0A 4LBZA 4A6PA 1VM6A 3THWA 3H4TA 5AW6A 1SR8A 3KWFA 3ETNA 1HSZA 1D0SA 2R93G 3ZTWA 3D4PA 3TKYA 1Z6YA 3UG6A 1QF7A 4FB5A 5BVHA 1VKJA 4TTPA 5FNVF 1ABFA 5DDIP 3RTGA 5DFAA 4JNCA 4ZGBA 4F4UA 1IOVA 1WCIB 2HF9A 5KOYA 4XM0A 4BO7A 5L40A 2CXNA 3ZHUA 3AJDA 4BBZA 5JH7A 5EN4A 3COJA 1TC1A 1CUJA 1E1DA 2IQ5A 4YCSA 1JH9A 3UANA 2C5BA 1Q7RA 1WVIA 2JA8G 1AB6A 1TQ6A 2ATCA 4PX9A 4WHXA 2R8GA 1XSEA 2XT6A 3TQ1A 1WWKA 3AR3A 1SOUA 2B1JA 3H5RA 1IPFA 3IBYA 3GFPA 3OZBA 4IKOA 4KQFA 1I7DA 5IEJA 1XFDA 1N3LA 1GZ7A 5ADUS 5ALQA 1I8TA 1NULA 4KDCA 4E4YA 1E66A 2Z02A 2RARA 3OOJA 4RIFA 3ZWAA 2HGXA 3DTVA 3QMWA 4HZIA 2OOKA 4PYIA 1NVVQ 2ORIA 3INNA 4RW0A 2DULA 3P52A 4U2GA 2XDAA 1AQ6A 1Q1AA 2GDJA 2FMIA 3B9QA 4NDZA 4O33A 4UCTA 2NVUB 3NT5A 2ARKA 1C9KA 5F73A 5DGDA 3ZTYA 3L0YA 4U3JB 2O4CA 4D5GA 4DLXA 1HI9A 4N3AA 2KSQA 1RLUA 1UK8A 2I6SA 3DO5A 2IL1A 4G0YA 4IV0A 5DYNA 5FA6A 4Q3EA 2ZJTA 4P83A 4BJ5A 4EARA 4KXVA 1RYMA 3S2SA 3TSZA 2VSNA 2ZS8A 4ED7A 2IW1A 4YRPA 5EESA 4E5MA 4BX8A 4PHGA 5JNUA 4RTOA 2IU0A 4J0CA 1JR3A 4EKEA 4Y2HA 3B20A 1DIGA 4GOKA 3UWOA 2WBLC 3V48A 3PJRA 4Z54A 1E6MA 1SUSA 2ZUFA 4XX0A 1NMSA 1KEEB 2JATA 5K99A 3VU8A 1KE1A 3TUIC 1EFPB 3EF0A 1TLFA 1UOEA 1SKAA 3M4NA 4U00A 1JH8A 1XMVA 2DC1A 3DKPA 3PHCA 4QWMA 3ZV3A 4YPOA 5DNUA 1W48A 4QM6A 1TYBE 3WOVA 4XD7D 1HT1E 2FZKA 3TD2A 2H1OA 2ZSKA 3AP1A 3I8SA 5FNZA 2Q4RA 3JWGA 4LF9H 2Q1YA 1C8BA 4PVCA 1JIJA 4MRSA 5AXBA 2YNMD 1UAYA 3BFJA 2XDWA 3BE6A 4U3JA 3USCS 2QRVA 1JEQB 1QFSA 4MQLA 1HPLA 2MTBA 3VNAA 3IPAA 2IDJA 1Y8ZA 3HL0A 4NARA 2FZ4A 2H4WA 3VPHA 3OUZA 1P5RA 3IDOA 3W6OA 1II0A 2Z30A 4J90A 1Z2NX 2DUUA 4Q66C 3RFCA 1KSJA 1SM4A 3EPLA 3OI7A 1JQ5A 2XSZA 1JLLB 1JEYB 2P11A 4AYBE 3CZQA 1FFBA 3CINA 4KN9S 5HS4A 5I4KA 1S0OA 2IKQA 1GADO 3RUIA 4I08A 2B20A 4CLEA 1OGYA 5L3VA 4RLSA 4Z8YA 4ZMSA 1XN4A 2XZOA 4FDLA 2CXXA 3DWIA 4O2BB 4ZVLA 1Z39A 1FMCA 3BHMA 1PX0A 1Z2PX 1RYHA 3GC6A 2QSUA 4JVSB 1R8YA 2VUHB 4P5PA 1SIWA 2QK4A 3PFKA 3LCRA 4FLEA 2XRZA 3SC2A 5HOEA 1U0TA 5KJCA 1BHO1 1LQUA 3ZHZA 4ABYA 1BZYA 1G38A 3AXTA 1A77A 4WK2B 1JX6A 5FBRB 5TS2A 4DV5H 1PZFA 2O2JA 4L02A 4AICA 3G7NA 4JUIA 4CQNA 3TOXA 2Y1XA 4EI9A 1VIYA 4CL0A 4BZQA 3RS8A 3EN0A 1KDPA 4HLUC 1U7HA 3NC0B 1H2WA 2YH2A 1OAOC 5J1TB 4BX3A 3CY6A 3TD9A 3SS9X 3F5FA 4H3KB 3GI1A 2DBVO 3ECSA 3R7NA 1OB5A 5CDUA 4OI0A 5DYYA 4RV9A 4C5BA 3M33A 5C3MA 3PRYA 1KDTA 3ZVKA 2NWQA 1XZLA 4LMBA 1D9ZA 1TYEB 2VF7A 3NAQA 4HXEB 1EK0A 4NZNA 3GZNB 4FR5A 3ER6A 5IARA 1TMKA 2NACA 4WNYA 3LWZA 4CM8A 4ARIA 3H9QA 3REQA 5B2FA 3D0QA 1PS9A 4LZAA 3VNRA 4Y7DA 5E8JA 3WO0A 1U4OA 1U2RA 1YAHA 2AQHA 3GDHA 3WICA 3J80A 1JBKA 4NQRA 4P4SA 2CLLB 3SXPA 4HQ0A 4BNFA 2R7LA 1VLMA 1WV0A 2GO7A 2OKGA 1Q6ZA 2VK4A 2WYIA 4LN1A 4ZC8A 4A1FA 1LBTA 1FSFA 4UEJA 2WJWA 5A0TA 1VL8A 4O2BF 1VCNA 1VG8A 5KINB 4ED9A 4X8MA 1TQ8A 4EATA 1P4HA 4FMCB 1AN0A 1BA2A 4G0XA 5ARCA 1JDUA 1FOEB 2DF8A 4P31A 1EX7A 4JU9A 4EITA 1DC6A 4REMA 3ZJYA 5FOQA 1T5SA 1KEPA 1V6AA 1ORWA 4NOJA 2BFPA 2WSMA 4D9MA 1I5RA 1Q20A 2J07A 2VHJA 4BL5A 3K96A 4FC7A 4TQSA 4Y9SA 3OQIB 3ZJ5A 3HCFA 2WY2D 1QTRA 2Z58A 4PPGA 4PQFA 3UHJA 5HKKA 1C30B 2X41A 2X8BA 1P5FA 1DG9A 2HBYA 1NJ2A 3FX2A 3I73A 2Q7DA 3NFYA 2I9KA 5KTMA 4TTSA 1R8SA 4RU1A 1H6BA 4ZT6A 1VIAA 1N1EA 2IKSA 2J9ZB 4KXQA 4JR2A 5EEHA 3UB4A 3NO4A 3V8MA 2EJ0A 1PJBA 1ANKA 1PJQA 4S1PA 3RK0A 3MRXA 3AONB 3L4BC 3PNOA 3RLIA 3WJ1A 2QL6A 1CD5A 1A0OA 3U48A 4AMZA 4DCVA 4OLBA 3F9RA 1H8ED 1Y5LA 3LWBA 2FN8A 3EMBA 5A2QW 4QOEA 4RPLA 3SEAA 3P2KA 4EI7A 5CDTA 4N65A 2PX6A 3KKZA 4D8YA 3NOQA 3TOCA 3BK2A 4C20A 1L4YA 1UDXA 5MN5A 2Q21A 1P60A 2Z6QA 3KUXA 4P7KA 2AFIB 4GXRA 4DA6A 1C9MA 1MB0A 1K7EB 5BSWA 1T6NA 3K9FC 2GBFA 3KTOA 3MUNA 3VV2A 1E79A 1NGSA 3KVNA 4F0JA 4F46A 4QG3A 2JDIA 3WV4A 3AG5A 4KL8S 4BVHA 3LVFO 2FR1A 4LXIA 1XJ5A 2VZEA 4MWGA 5HJ7A 3AHCA 1JRLA 1XLTA 3HVHA 3CF2A 3JATB 1QHSA 4JVMA 4OFBA 4XM2A 5F7JA 3RRNA 3JRNA 4EUEA 1RYYA 1R64A 1V7ZA 1SRQA 2PGDA 4ZRMA 4HNRA 4IYJA 3I72A 5DTRA 4S0XA 2XB6A 3ZK9A 4R71A 1RZRD 3DLAA 1PR3A 3OX4A 4BFLA 5ES4B 2HA2A 4IFTA 1M0TA 1P91A 1LDGA 1NVFA 2NVBA 4R9RA 2MMGA 3CHYA 4HNAA 3HI6A 4C88A 4LF8H 1BEZA 5ICMA 3U0BA 1AQIA 2KQUA 2BEWA 4QU9A 3RGGA 2WFMA 2ASVA 3FY4A 1RQGA 5EZYF 4KUHA 4DRYA 1ULZA 3THYB 5EYPB 3T3DA 3WBFA 3R3HA 1L4GA 1DKPA 5J2TF 3I83A 3QPDA 4NMLA 4NJEA 6LDHA 5IP9G 2GPNA 4NL4H 2AW5A 2DR2A 3B38A 4F9TA 3WWJA 4FZJA 2CJWB 4LK3A 3MJ4A 4DL4A 1Z8FA 1VHTA 3WGVA 4CCWA 1ZIYA 1KDRA 4TM7A 5LA6A 3EUWA 1LDNA 2ZUVA 4ZOCA 3EGEA 5EP3A 4ARAA 3LBYA 2P9GA 1X38A 4H2DA 4M3NA 1Z5NA 4FR0A 4KSBA 4EHIA 4ZTZB 4Z9FA 2P4HX 4A3LG 2ZKLA 2G1JA 1EDOA 5FBLB 5IEBA 5K0TA 3TI9A 1WTAA 4FBLA 2R5NA 4IUBS 4UUAA 2I7XA 3C24A 4FIDA 1ZCJA 2WMNB 5LLTA 3GGDA 3HKCA 5BUQA 4BTEA 2A5YB 5B1IA 2GQ0A 4Q8FA 4E03A 1G5HA 2GBLC 2HQSA 3CSUA 2XT9A 4EY7A 4BP1A 4Q7LA 2VUUA 5KOJA 4HNVA 1BX1A 5EPOA 3TZLA 4P0PB 3K9CA 1CNFA 2VJOA 4Q6BA 3QLUC 3SSOA 1BO6A 4OI2A 2R7AA 4LSMA 4JVNA 5CT8A 3FMIA 5TGTA 3ULKA 2HH9A 2POQX 1KMIY 2GTPA 3X2FA 3O9MA 1WB9A 5JYDA 4DKXA 2WJIA 2YCHA 1LFAA 4QBHA 2O8DA 2V5UA 3WOHA 2XGPA 4LHXA 1NF9A 1W88B 2JRCA 4KYIB 3SXJA 5LP1A 1A69A 2H4ZA 1XRLA 4QHSA 3WYDA 4V3BA 1PZXA 4LXHA 2WB4A 1FQWA 1XRRA 1HFKA 2PH3A 2M6KA 2QVXX 4U2KA 5CU7A 3P0RA 3RABA 3OCVA 4UU0A 1L5LA 4OU5A 1G3RA 5LBIA 1MHPA 5LYYA 3BH0A 4I4LA 3U44A 1Z75A 3TXYA 3UPUA 5IM4A 2OESA 3B3FA 3KQYA 3T7DA 4TWIA 3V8QA 3SI8A 2ZBPA 3I0NA 3ZNQA 1Q77A 2VP3A 1SU8A 5LVAA 4MVJI 1OWMA 5KMGB 2F4VB 1WCMG 4RK4A 1NXWA 3KYCB 4S1VA 5IMBA 1R15A 1VE6A 3DE6X 4BVGA 3C8MA 3WLAA 4OMCA 4PBSA 5DTQA 3R3WA 3F49S 1TECE 4TTTS 2OQIA 1OX4B 4NYIQ 1N6OA 3I8XA 2X0RA 4ZZ0A 1OHHD 3R0ZA 4RCNA 5DGCA 1R4AA 3HABA 1IOLA 5K6TA 2WIDA 1UQTA 1NA5A 4KZKA 4X7MA 2FSSA 4QYMA 3DTFA 2HQBA 3NEYA 2BH9A 1YIDA 2RK6A 1V43A 3BKXA 2DUNA 5DG7A 1JU3A 4HEA6 3I1YA 3CZMA 2FK8A 1B8PA 3NWOA 4X3OA 5FA8A 4GIBA 2I3ZA 2PEYA 4UVGA 4E5VA 3LA8A 1H0KA 1VCOA 4WNCA 5HJ2A 3LY9A 5LD2B 1W46A 4RORA 5JZOA 4F21A 1YTUA 3LL4A 6Q21A 4CZ2A 1A8SA 1LPOA 1M2FA 2F4NA 1GQFA 1PT6A 5K0LA 3ZU3A 1FE8A 2AYYA 3IRVA 5JAIA 1A76A 1QKKA 2D1FA 4Y1RA 5A6VA 1LSSA 4YT5A 4JU8A 2BFFB 4JJ4A 3G0IA 3ZV6A 4IRXA 4EEKA 4NABA 4UOEA 1OU4A 1XLWA 3CQZA 4YEDA 1Y0BA 3W5VA 1I4DD 3CTPA 3EUAA 1S0NA 4YJ3B 1AKWA 1RYFA 2JGEA 2XVZA 3NBXX 4TLCA 3R7WA 4BQFA 3SJUA 2PZAA 1D1QA 2ZWOA 1Z0DA 5ITVA 1WY5A 2YZKA 1EWQA 1JKFA 3IXQA 1U2GC 1WHSA 3PL5A 5IW8A 5TPWB 2XJ4A 3VSAA 3CH7A 2Y4OA 3CZRA 3OD1A 1PJAA 4JCCA 3W79A 3Q8SB 5DMXA 4DAAA 4ED6A 1YL7A 1Q0RA 2GBGA 2F8LA 5JALA 1QGDA 4L0CA 4U7TB 2JCGA 5H16A 4AM8A 2VYCA 5JR3A 3FG9A 1LF5A 2XNDA 4EG5A 1K5HA 9LDTA 1RZUA 2J09A 2JRLA 4YUYA 2HHFB 1QWOA 4GC9A 2G08A 2HSDA 4R8MA 3CEHA 3LCJA 4F86A 3NDBB 3A6KA 3SIWA 2NXJA 4TS9A 1J1ZA 3RSZA 3VUFA 3W1WA 4ENTA 5M34A 4MV4A 1JDBB 4CT4B 2REXB 1QHHB 4QBGB 3SF0A 1GZ4A 1FNSA 2P5SA 3PW5A 4EFLA 4HDCA 3UAZA 3N2KB 3D7LA 3RANA 2W6MA 1DO2A 3AEZA 4DV3H 5KFLA 4IRDA 1Z5VA 5ALYA 4EKGA 5LOVA 3DTGA 3T5PA 4OHRA 5DISC 5CB4B 3MWDB 2Z95A 1MOSA 3UG7A 1MORA 5LOVF 1W96A 4QGHA 3WLQA 3VPBA 2PKRA 2K5UA 3FMAA 1ZKDA 1J42A 1SK9A 2EZ4A 3UV7A 1BFDA 1P0PA 3T5JA 3PHHA 4G65A 2PK3A 3K6JA 3QLVA 1BVHA 3I6YA 4LFCH 3VSBA 2XVYA 4CI0B 1DBVO 5FV4A 3K9LA 4UBMA 4U2FA 1PLJA 4P4NA 2IK8A 1YC2A 1HUQA 4HTFA 3UK6A 4Q4HB 2YYAA 5B64A 3H75A 1XU7A 4WKPA 2QGFA 5T14A 4H59A 3MW8A 2YINC 3N70A 1A9PA 4FTWA 5ALOA 3ZY2A 4IR9A 2HMUA 2RHJA 2C5LA 4G0OA 3DVQX 4LBVA 3HCAA 4NC9A 3UHAA 5GOZA 1GZ3A 5C4MA 2C4KA 2XGMA 4G1VA 4LTDA 2B2NA 3BXPA 2FN3A 1OH5A 4LV8B 4Y1GA 4J43A 4GR9A 1UIMA 3DC7A 1CQJB 3A9WA 3U2QA 4AY5A 2X6RA 5B2EA 3LXXA 3H87A 4B2IA 2A9VA 2A5DA 1LSOA 1GGJA 1MX3A 3NRBA 1Z4LA 3H6GA 3W8EA 3KTFA 3I9FA 3AUAA 4HPWA 2OBYA 4I50A 4JQCA 2PJDA 4NG5A 2HDOA 1GUDA 1QM5A 2VEOA 3AFIA 3OOSA 1BKDR 3E4DA 3SXUB 4C29A 4EHAA 1DG3A 4ALKA 2XNJA 4NMMA 2ZDGA 2QX6A 3BE8A 4N3NA 2R44A 3R4CA 5KFDA 2ZKIA 3MQ4A 2A4MA 1MHTA 1N2CB 4EFDA 6AT1A 3K0AA 1Y42X 2OGSA 3SGLA 2P40A 3PUHA 1F0YA 2XRMA 3ID6C 1EB9A 2ALZA 1R8QA 3S99A 1BQEA 5IDQA 3AOEA 3E8SA 2EX1A 4IVRA 2C2OA 3BCHA 1PNRA 3GG2A 3GUCA 4UTXA 3VZCA 2EBHX 4ZZ1A 3GB8B 1M3SA 2IOYA 1ACMA 5LIPA 4KQJA 1Q84A 4EVQA 5PNTA 1J0EA 4B3GA 2FFHA 2IHUA 2D54A 1UKZA 1JLRA 1V9SA 3KWLA 1G21B 4IV5A 2OCKA 3NIBA 4UBNA 2Y9MB 4IGEA 1MNQA 3DOFA 3NTVA 3P0HA 4IZ6A 2Q2WA 3OOWA 3EIQA 4QQKA 3VR5D 1MJFA 1Y5IA 1EVZA 1WZNA 3R40A 1VLHA 2C9OA 2DKOA 4D46A 3FNHA 4FKBA 5EE9A 3H1BA 2FWIA 4AFNA 5B6JA 3UK0A 4ZO7A 3DT6A 1DV1A 1CNMA 3VNSA 1XDSA 2VG8A 3WY9A 5HZGA 5IRCD 1M34A 3LD9A 1JHPA 1Q16A 2G06A 1SAYA 3IPYA 5LXTA 4IIYA 3CZ4A 3C6MA 3DZJA 3IQWA 4W7IA 3V8PA 4BJHB 3BICA 4CMDA 2QE7A 5I7WA 4DT1B 1TKBA 5D85A 3Q9UA 2HQOA 2GTIA 3GFVA 4JLBA 3TEMA 2QZPA 3EPHA 4WCFC 2ZRGA 4MA0A 4J1TC 4I81A 4QC2A 4XIFA 1ZMOA 2C7VA 2R9VA 1K92A 4J0JA 5DNCA 4UDXX 1XLUA 2PMBA 2RHGB 3KB8A 5KNBH 1NHGA 4DV1B 1RRCA 3DBLB 3LXRA 3RSSA 4JI3B 3PXGA 3DLPX 3KDAA 3IEVA 2X2PA 4NCNA 2P4UA 5BXYA 5I8WA 1UOPA 5C52B 4ENVA 5HWSA 3AR4A 1S2GA 4S2EA 3EQ8A 1Z56C 1OH7A 2FJ0A 2JJQA 1IDOA 1CR1A 3VSDA 4J3JA 1GTSA 3JASA 2W9CA 1S4QA 5HJ5A 1ISJA 1QH1B 2D0OB 5LD2C 2P27A 3Q3GE 4KSCA 2OO5A 1VJGA 2IZ5A 3DAPA 3QFRA 3WHLA 1FYFA 4XYLB 4HLQB 4UDNA 1JHOA 1O6ZA 5DLDA 1RXEA 3ZR4B 1M54A 2FP3A 3HS3A 3NOVA 2CJFA 2QU8A 3KQPA 4U1RA 5LC1A 3UC5A 2OCDA 3KZKA 1Z47A 3GRAA 5HKAA 5FTKA 1NR7A 3B1JA 2YHAA 3RIXA 2LNDA 3QBVA 3VVLA 3HO1A 4MRMA 1AJEA 2PGJA 3QKSB 1JSRA 2NU8A 3WP0A 1QHXA 2HZBA 1W9HA 3Q8LA 1CP3A 1KRHA 2VPIA 1A8HA 2F9FA 4IO0A 1GHTA 3KYHC 3M6MD 5IHPA 5IXYA 1FF9A 5JZ9A 4A23A 4Y30A 1E0JA 3G6YA 4TQGA 3ST7A 3WXBA 4FOLA 3QXJA 4AJ4A 3IDSA 4ZCPA 1DKLA 4FILA 3KDPA 2E18A 5JRJA 3SYTA 2WUGA 2RGEA 4RA9A 4BVBA 1XF9A 1XRMA 1UPXA 3A9CA 3ROPA 5IDYA 3NBMA 2E55A 3AGPA 3LSTA 3Q7SA 5CBPB 1XCGB 2EF0A 4EG8A 1AKQA 2JJ1D 1J5EH 1I9CA 1NUTA 3UHFA 2Y1WA 1GL9B 4PYKA 3RSQA 1D8AA 4YAFA 4L3OA 5AM5A 2P9EA 5DI9A 2FRXA 5FNVB 2UUBB 5G41A 2Z9CA 3Q98A 2I54A 2QDXA 1R50A 1YFLA 1REQB 2V4UA 1GG5A 2FFBA 4PAMA 1YE5A 2A30A 2B4KA 1NRIA 2A9OA 2J4FA 4N12A 4DLRA 1P1IA 4ZKEA 4JSYA 1DINA 1VSQA 1PEAA 3VPFA 2XGOA 4ZYVA 2P0YA 2JZOA 1E2JA 1DJNA 3ILHA 4UAUA 1JX4A 2IJGX 2ZWVA 2ZEJA 1WTCA 5DBHX 1JSZA 5DTEA 4MGYR 5IANA 3RRFA 3HU2A 3RU7A 2XWQA 4E5YA 4YCJA 3GMDA 4HLUA 4HNAB 3COWA 2GXSA 5JJ5A 2NU9B 1XEWX 2H59A 2ECFA 3PEUA 5IWAB 2DPJA 4RDXA 2ZRFA 1J2EA 2I0FA 3LVQE 4CKZA 9LDBA 1AKYA 2IY8A 2FQQA 2Q45A 3DP7A 3PC7A 4AW9A 4LPKA 1K3FA 2PYIA 3A27A 3EFOB 3K30A 4D4GA 1CQXA 4CLOB 2H31A 2VSOA 1OYYA 5A04A 3OY7A 4JD5A 1XR3A 1OXBB 4AMVA 3AEUB 4KIWA 4ERXA 5KNBD 2NMVA 3MS7A 3GVCA 1C7IA 3T35A 3VO2A 4AX4A 1ZMTA 1PE0A 2Q6VA 2VA9A 4GPD1 3QUAA 3H65A 3I42A 2JASA 2WWXA 4RSHA 2GFIA 1QCCA 3ANLA 2PKQO 2R92A 3EXHB 3PIRA 5AJHA 5DGXA 5IJ9B 4OXRA 5EINA 4RVFA 2HMWA 3I9LA 4OGFA 3SMVA 3PVXA 2JAQA 1K97A 4L6AA 1G5IA 1VFNA 1UK9A 1RQLA 2WTAA 2VHXA 1U2ZA 3NYIA 2YHSA 2OG2A 4MP6A 4A3JG 2FOIA 1Y1LA 3QVVA 1NVKA 1SPXA 5F1PA 3K32A 4CM1A 3A4MA 4L76A 5E7JA 2MJLA 3S0JA 2FW9A 4KQMA 2ASJA 4MRRA 1MT3A 3PHGA 2YR0A 3LBIA 4QVGA 3BB3A 4W5HA 1U9IC 4IIBA 1F2TB 1QYRA 4JNKA 4RF5A 1JIVA 1LI5A 2CYBA 3VH3A 3OAAA 4DPMA 3OHAA 2NZUG 1NI3A 1P18A 2RAPA 4LX8A 1PDOA 2H51A 4QYXA 1UKYA 3U3JA 1I2DA 3O21A 4LHZA 5DZSA 4YONB 5IJZA 1EXVA 5AI8A 1YS7A 2DUJA 4I55B 4JOSA 1Q0TA 3I3OA 3ZWMA 5AM2A 2EFJA 2HLPA 2ZM6B 1QGUB 1ZBQA 4F1KA 1F9AA 4QXQA 2J6IA 1W2GA 2O8EA 2W2KA 3U56A 1E2GA 1RI5A 3FOBA 4QU0A 4KUGA 1TL7C 3L07A 3PFBA 5AHRA 1K0FA 2ZJ0A 4ZV7A 1UXJA 3U31A 5CG2A 1XVTA 5KT2A 1D2RA 2YL2A 1FTQA 5I4CA