2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
molecule keywords Phosphoribosylglycinamide synthetase
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
3LWBA 2R7NA 2W6OA 3BSWA 1GLVA 5C8YF 5FNVF 2XCLA 5KX5F 2VQDA 2I8CA 4YBZB 4MV6A 3R5XA 4EGQA 1AUXA 1M6VA 2XD4A 2R6FA 4YJ3F 1EUCB 4XX0B 4YB8B 4IZOA 2WYOA 1VBHA 5C1PA 1PX2A 3VOTA 4O4LF 3HBLA 3TIIA 4FFMA 2HGSA 4WBNF 4MV3A 2HJWA 2R7MA 4ZQIA 3KAKA 5BPHA 3N6RA 2DLNA 5LOVF 3R9RA 2YW2A 2DWCA 3ORRA 3Q2OA 3ETJA 2YZGA 5JQGF 3G8DA 4MV8A 2NU6B 4I4TF 1EZ1A 4ZOLF 4ZI7F 3SE7A 4FFOA 5H80A 4RZQA 2YRXA 4XYMB 4O7SA 2CNQA 2GPWA 2VR1A 3TQTA 3OUZA 2NUAB 4FU0A 2IP4A 1CE8A 3G8CA 1UC8A 3U9TA 4O7VA 5EZYF 3V4SA 4EGJA 3MWEA 4O4IF 1E4EA 2W70A 1GGOA 5LP6F 4HQ6A 5JQWA 1DIKA 4EA8A 1I7LA 2CZGA 4O7TA 3VA7A 4O7ZA 1KJJA 2V5AA 4FGRA 4O7RA 4J6EA 3NUAA 4MA0A 4C5AA 4FFLA 2YS6A 3K5IA 4FFPA 4O2BF 1A48A 4MV1A 2GPSA 3VPBA 4C5CA 2W6QA 5D8DA 1EHIA 3DF7A 3U55A 1KC7A 2GQSA 3E5NA 5KKNB 3K5HA 2FP4B 2C00A 5I47A 4O86A 2PBZA 4MA5A 3VPCA 2R7KA 3BFPA 5HV6A 1EYZA 2YZMA 1OBGA 2R87A 1AUVA 1C30A 4HNUA 2R82A 2W6ZA 2YWVA 2FB9A 2YZLA 2YS7A 4MV9A 4EA7A 3BSYA 4O83A 2Z04A 3RV4A 2VHEA 3MJFA 4O84A 1KJQA 3TINA 2W6MA 2R7LA 4TV9F 1IOWA 3GLKA 4O81A 5CB4F 5LXTF 4M9CA 2R86A 4O82A 5GONF 4MV7A 2SCUB 3WO1A 3QFFA 3K3PA 1IOVA 3JRXA 3RV3A 3I12A 3N8DA 2CQYA 3JRWA 1GSHA 3HB9A 3BSSA 4M99A 4O4JF 4XYLB 5J2UF 2NU9B 1M0TA 4O7YA 4ME6A 2ZDHA 3WO0A 2W6PA 1JKJB 1PK8A 3JZIA 2YZNA 5DMXA 2GQRA 3U54A 4O2AF 4FE2A 5C1OA 5CA1F 2PN1A 2W6NA 4TUYF 3U9SA 5K2MA 5HBRB 4O7WA 3HO8A 5JVDF 1I7NA 1KJIA 3V4ZA 3VPDA 2Z02A 4I55F 1KBLA 3R23A 1KEEA 3TIGA 2NU7B 4Y8VB 4NYEA 4L1KA 3KAJA 1VKZA 1GSAA 1T36A 5IYZF 1CQIB 1BNCA 5J2TF 2X0SA 1JDEA 4IHJF 4YJ2F 1CQJB 3ORQA 4DLKA 1Z2NX 2V59A 4HNVA 1W96A 2CNVA 2I80A 3RFCA 2FPPB 1KJ9A 5CAEB 1EUDB 2R85A 2ZDGA 5BMVF 4MV4A 1C3OA 1E4EB 4HNTA 4O7NA 1DV1A 2R84A 2P0AA 1DV2A 4C5BA 3Q1KA 4IWXA 3AW8A 4HR7A 1JDBB 1SCUB 4EA9A 1Z2OX 4EAAA 1Z2PX 3R5FA 2NU8B 4I50F 3UFXB 4YAKB 4TV8F 1W93A 2YYAA 1WR2A 4YAJB 1OBDA 3GIDA 1A9XA 4O7LA 3R5HA 2FPIB 1B6RA 2QF7A 1KUTA 4O4HF 4M9UA 1GSOA 2VPQA 2PVPA 3VMMA 3TW6A 5LYJF 4MAMA 2NPOA 2DIKA 2ZDQA 2W71A 1M0WA 3KREA 4FFRA 5LA6F 4ZHQF 3MWDA 4QSHA 2I87A 1KJ8A 1ULZA 1VBGA 2DZDA 2FPGB 3LP8A 4XZ3B 4EABA 5BPFA 1B6SA 3KALA 4FFNA 2GLTA 2YL2A 4WD3A 5CA0F 1BXRA 2J9GA 4IIJF 3BG5A 4EG0A 1UC9A 3WNZA 2V58A 3JZFA 3ETHA 4GGMX 2YRWA 1CS0A 3RUPA 4M98A 2QK4A 5JH7F 2OLSA 2CNUA 5JVLA 4IWYA 4DIMA 3OUUA 1JLLB 4E4TA 3AX6A
chains in the Genus database with same CATH superfamily
3MF4A 4QWDA 5FO0A 4B44A 2D8AA 2EV9A 5ADHA 3O4FA 4GPBA 4BECA 1SWWA 2QUZA 3BF8A 3DDSA 3GNTA 2W2KB 2VDNB 4P33A 4QFBA 3ZKAA 4YPVA 1X9NA 3W78A 1RWQA 1BJKA 1V4NA 4WAUA 2Q50A 4B82A 1E66A 2GZSA 3PYXA 5KFYA 1WCWA 2XPCA 4NYMQ 2PT9A 2R8IA 1OSNA 4GC6A 3K2QA 4LHYA 4QDTA 5G0VA 3G5TA 1KT8A 1QWOA 1YZNA 3I0NA 3JAKB 2AMFA 3VBEA 3QYJA 5EWLB 4B75A 1YZQA 1DIBA 1F9EA 5ESWA 3BTSA 4HJRA 1QU2A 5GV7A 3HHEA 1R00A 1UBFA 2QL6A 1EKXA 3HU3A 3QJGA 4MIOA 4W1RA 5DBEX 2OP1A 5JO9A 4D0LB 4EF5A 1GT6A 4ER6A 4UZEA 4E21A 3U37A 4W5OA 3N28A 2R92A 4BNZA 4RGQA 3BWVA 1QE3A 3TQCA 3S81A 1NSYA 3PHJA 1I2DA 5JYDA 1PV4A 2L18A 3SDZA 3UT5A 4U2CA 2GASA 1Z4QA 4BUZA 2QVYX 2JIRA 1NNLA 1AHNA 3HMKA 1Z17A 5BW8A 2HGSA 3D1JA 4MV3A 1WZ2A 1S3SA 5DHRA 5EC8A 1GYFA 4RHCA 2IFTA 2A0UA 3RSOA 3HCCA 5F98A 1WQ4A 2EZ8A 5CURA 2C2YA 3C6BA 2XY4A 2B78A 1FVXA 1NUUA 3AFIA 3DA8A 5I9TA 3WGVA 5I5XA 3AVYA 1US8A 4TMVA 3AHGA 1PU2A 3DNPA 2DWCA 4KRFA 3Q2OA 4V0NA 2HCTA 1VJCA 4PPYA 1CQZA 2P2YA 5F9NA 3REQA 2QN3A 3AWDA 2JI4A 3MGGA 5K3DA 2J7KA 5LPNA 3KM0A 3ZGZA 1TYZA 4HP8A 3ZV6A 1TCUA 1QAQA 4CLEA 1MXHA 1Z8NA 1CLUA 2HQSA 5JSKA 1E0KA 1G291 2QR3A 3F1KA 4I4TF 3WSWA 3MD9A 5JQGB 1YFLA 2FEOA 5BRAA 4Q4JA 1AOXA 2QPOA 2AC7A 3KCQA 2FEAA 2RC5A 1A5SB 3IIIA 4HX2A 4R81A 3S29A 4DAOA 1XPJA 4QG7A 4OAPA 5C4GB 1YC5A 3HEMA 3VZQA 5JATA 1KNXA 3IPXA 2WLTA 4OAQA 5A5FA 2E4ZA 5D1PA 3BPSA 3LV8A 1ZM3A 4DBVO 3RSHA 4X61A 3U7HB 2EGHA 4IG4A 1S2LA 1BU8A 3PW0A 2CVFA 4N3CA 1FXWF 2QVGA 3FDZB 4G1VA 2B4KA 3Q8LA 2L69A 2V6JA 3GGCA 1ZNQO 2GFQA 3FNHA 3HP1A 4H31A 1XNRH 4M9SA 4MULA 3ULKA 4F4JA 2ZJAA 4MUYA 5K0EA 3T1QA 1CUZA 4NJEB 4BJ6A 1E1CA 3PYMA 3DKPA 3THRA 5F1YA 5EOVA 4JENA 1E8NA 3OZVA 2FF7A 5J2UA 3H1TA 5B6JA 2FZKA 1PE0A 1NV9A 1VJGA 4FINA 1RQLA 3LQ2A 3PEVA 4O7VA 1NW7A 4DLLA 1WD7A 3N2LA 3MMPA 3VKGA 3D2LA 4NZNA 3KTMA 2R1UA 1E4EA 5G3ZA 4P0PB 3H8WA 4CM9D 3VR0A 5A9RA 3N2NA 4DDVA 2R48A 4AN1A 4Z54A 1AF4A 4I66A 3TTSA 4DDMA 1ZY2A 3AEQB 4F84A 1A1VA 1K7FB 2EQ5A 3HYTA 1USIA 4M1ZA 1DLIA 3KSAC 1YR2A 4EA8A 3DPUA 2PUCA 2EW8A 1Z3CA 2F1IA 3FVVA 3JVVA 3M1YA 2NVWA 2IEIA 2C31A 3MLAA 3NHJA 4YXFA 2R00C 4R2HA 3G23A 2Y3IA 3WGLA 1VE9A 2YV2A 2V5AA 4G0PA 4K9SA 5EZ6B 4LOLA 1EG7A 1H0RA 3ISJA 2PWYA 2ZB8A 3IRUA 3GEMA 3IDQA 2YHIA 1K8ZB 2Q5QA 1A97A 2VAXA 3DBHA 3G79A 4MSUA 4B6PA 1AKWA 4MJ3A 4PR3A 4CMGA 1JRLA 3EFOA 3GJXC 3L82B 1SVSA 3LJKA 4X8HA 4FFLA 3A25A 4KYIB 4EOGA 2UXBH 2DECA 3SC6A 4C6SA 3FDIA 4HATA 3CKMA 2MOKA 2R8PA 1OWPA 3IB3A 3OZDA 3QITA 2V4RA 2PSJA 2YWBA 1ZRMA 5IWAH 1UIMA 3FNBA 2JGJA 4IJMA 1CXZA 4UULA 3EXIA 3AV3A 2DR3A 4M38A 4AWAA 4RXUA 3EJWA 3KKMA 1ECFA 1NUPA 2PL9A 4OGFA 4OXKA 4BX0A 4EX6A 2IYRA 3UPTA 4KR2A 6AT1A 4UJ5A 3G89A 1H4TA 1MEJA 3SZLA 4O33A 3UJHA 5J63A 1TM7E 1GLNA 1B6GA 3HFRA 2IOYA 4G1CA 3QF7A 3ZDYB 4K8OA 1V3QE 3Q0IA 3LPCA 1BH6A 1KBZA 3AETB 1XYYA 4RADA 4UHHA 2XYQA 5A5DA 5C7LO 1GGVA 1UPBA 4QGBA 1ZK1A 4PZ9A 4BLQA 3MN1A 2IU4A 3F90A 1I32A 4DYHA 4G0ZA 2CXSA 2FDXA 2XE4A 4RIEA 5AW5A 3PCXA 4KACA 3FGNA 3V6LA 1EFPB 1QG6A 4OB6A 2I3BA 2IBSA 3WRYA 4LY9A 1WUYA 2VJYA 4EI2A 4DLZA 3KHTA 1WXEA 2G77B 2M9MA 2QVLA 4GZ6A 1VG9B 5TGZA 1YWGO 1FBTA 3H40A 4PX3A 4K6KA 5KSZA 4KAAA 3K0CC 2AU0A 2OV1A 2VA9A 5FTKA 3SJ7A 2YS7A 2D5IA 3QMPA 4CG2A 5PNTA 4N0QA 3JQGB 1BE0A 4H7IA 4IRMA 3VNAA 1D2GA 1ODKA 4EGCB 2G76A 1FOEB 3GOHA 3IEPA 4RETA 4OXIA 4YMHA 2VPPA 4I5IA 4BKPA 1P72A 4Z4QA 2XRZA 1SKMA 1N8KA 2Y0CA 1VG1A 2D3WA 4R2LA 1ZRNA 5BV7A 1BXKA 1KI3A 1ODSA 4KJZA 4M0KA 1HF3A 1IOWA 2J8ZA 2A2ZA 1MOZA 4ZEOA 5YASA 1AF7A 2SCUA 1LWOA 4M9CA 1LBTA 2DUWA 1LW6E 3ZZNA 3QP9A 2VK2A 3WWCA 1UFOA 2BJWA 1SVUA 2BM0A 2FN9A 1TA0A 3HRKA 4U2FA 2FR8A 3F71A 3DMGA 3RREA 2BGIA 2PYZA 3BRCA 3E1SA 3MZ0A 2ONYA 1J23A 1UODA 3HPQA 5T4BA 3B1KA 1ILEA 2AQHA 2CDCA 1LPMA 1UBOS 2WFAA 2X0JA 2L42A 5CCDA 3IR6A 3MR6A 5CLLA 1KI8A 3NVMB 5IKOA 3DTTA 4ZVKA 3UWDA 4JLBA 2IX3A 3ZE1B 3HWSA 2WTUA 4JI8B 2A9PA 3H18A 5CNIA 1ICEA 3JRWA 5UKDA 1A8PA 3BQ0A 4M4SA 2JEOA 4WRRA 3SYTA 3KBOA 3ZU4A 4R8UB 3QXXA 2WP0A 2J09A 5KTOA 2ZJOA 1O6BA 1ZH4A 5HF5A 3L8YA 1XTKA 3WFZA 4RAOA 4J94A 3JAWB 1SC3A 4CG3A 2ZKIA 3W5JA 2HZ7A 2Y76A 1UXGA 2UYOA 3CE6A 1RBYA 3OZFA 4MUKA 5E6UA 1OQAA 3DT8A 4CN8A 4KR3A 3QJYA 4CMFA 5C1OA 5CA1F 3N9IA 3SS7X 4YJHB 1L2TA 1N4AA 4JR0A 4QLAA 2JLQA 2SKDA 1U63A 2Q1UA 2DPYA 4DR4B 1DARA 1G18A 1M2WA 1JWLA 3RSQA 3QI2A 4MVJH 3V46A 2PGAA 2IZ0A 1VGRA 2XHZA 3K09C 4HS4A 3KIPA 1KYTA 3TUJC 4R8SA 1A7KA 4BX3A 3M9OB 4S1NA 4FI3C 1HQDA 2CKZB 1P9NA 4IJUA 5DBGA 4BX9A 2Q5IA 5CT8A 1DAIA 4C7BA 1CDEA 3I6QA 4J9PA 5B7PA 2GZRA 4JP8A 3VYVA 2QQEA 4A3CG 1VL5A 2BKXA 3WRXC 4TKUA 1VAJA 1VHTA 3VPDA 3IPAA 3BXHA 3QK7A 3JARB 4BB0A 2W11A 3WGMA 3R23A 2FYTA 1MT0A 3FOWA 3NOVA 4URZR 2I1WA 5CTJA 4D5GA 2UYHA 1ONNA 1JNYA 3FWNA 4UKDA 3PNKA 2QUKA 5EXEA 2A9JA 1RYDA 3AR2A 2X5XA 5BSTA 3W7VA 1GITA 5L3SB 5EDWA 2K4MA 1UBRS 3OJCA 4LZJA 4PYIA 4WZAE 4YXWA 3VAAA 2ZAGA 1G8YA 1M7BA 2ZJ8A 3DOIA 5G41A 4KN5A 1XZKA 4BC0A 5BWMA 1QHNA 2QL5A 1CB0A 4JJ7A 4HOYA 3TOCA 1B33N 3FLEA 5AI9A 2IGTA 3R7DA 2OOSA 2G88A 1MLDA 4G3XA 3CLSC 4PZDA 1NXSA 3M9XA 4ND6A 3TIXB 1MTOA 1CZOA 1DQNA 3EX7C 3AVWA 3RFXA 1GQ2A 3T5GA 3WJ7A 5HM8A 2IODA 1XMQH 4MCHA 4XR4A 3ZDQA 1MX1A 1R9NA 4FJ1A 2NWQA 1R37A 2V7PA 1IXRC 1YB1A 2AXNA 2KS6A 4PRZA 1E9DA 4A3EG 1MGPA 2Y9MB 1SFOA 1H66A 1BMFA 1CNEA 1JIKA 2E4AA 4KI0A 5G4KA 4AECA 4QVGA 4Y7CA 2OXCA 4DV3B 2VHUA 4JI4H 1NVUQ 4R2IA 4J1TC 3RYIB 1M75A 3EIOA 3OLYA 3B51X 3RR2A 3U3ZA 4BVHA 2IZ6A 2ZQ5A 1QPZA 2J87A 5HQ3A 4KQWA 3CEHA 3ZHCA 5C51B 3FUVA 3FTFA 2GBGA 3Q8SB 3JU3A 2A0YA 3PJEA 4Q4AA 2FW7A 3D43A 4CLOA 2B34A 2E48A 2IOQA 3LQ4A 3F3KA 3SD7A 3GWZA 2NNLD 1XMJA 4A3MG 1QFSA 5A1TA 4GSKA 4MV4A 1FMTA 3K0HA 1E6MA 4DQXA 2JEFA 4AYTA 3IVAA 4KFRA 5K3FB 3T0GA 2JI6A 1Q0SA 3EUEA 5KFUA 2HHJA 3A9RA 3CLTD 4B6FA 4DR1H 3SGLA 4NCNA 4OU5A 4MZDA 1O95C 5KFMA 3DO5A 4KMOA 5JLAA 2NXJA 4UPVA 1MZVA 4HUJA 3RRBA 1JKXA 2UDPA 1L5MA 2EWWA 4HR7A 3L8MA 4P4TA 5D1OB 1SCUB 2J4FA 2X9GA 4TYMA 4FZ5A 3KE8A 5EWLA 2PLFA 2CUNA 2IIPA 1XO1A 4ERNA 1TLLA 3RJ0A 1UBKS 3AC0A 4ESHA 5JCJD 3SIXA 1AGYA 1SUAA 1Z0UA 5BSWA 2MSKA 3QX7A 2WSLA 1B6TA 3VSCA 1IN5A 1I6WA 1C1DA 1GPLA 1LQ2A 4MIKA 1ZOPA 2X4GA 1BS9A 1P19A 1PQYA 3ROZA 1E6EA 3BJZA 1GN9A 3QH4A 4I6GA 3HI4A 5AWFC 4M21A 5A4KA 5HM6A 4S05A 3MGKA 1OFUA 3RROA 3P1JA 3NQ41 4CLDA 1YHYA 2VK1A 4D8VA 1H94A 1LJLA 3L1UA 3RYFA 1QOZA 1DXHA 3LTEA 2G07A 4C3VA 4B3DA 1H22A 2BGKA 3WLQA 3IBTA 4EKYA 3F6YA 3BZBA 3WK9A 1ISIA 3M34A 3OWOA 2W4MA 3CLTC 1A9XA 1H2YA 3MTAA 5K20A 1W0JA 4XTRA 1GKKA 1JU9A 2H6EA 4LXYA 2WOJA 4EPXA 3CO5A 3JSAA 5CIYA 4PZ6A 4EQZA 3ODGA 4YQWA 4DZTA 1DWUA 1RM3A 4Q3AA 3TKYA 1H23A 4B45A 1YJCA 2XYHA 4U1RA 5ETJA 1GTZA 1KH3A 4IRUB 2WIAA 4YR9A 1UPCA 1U9YA 2Q3EA 1CNFA 3WBKA 2QT1A 3HVJA 4HZUA 3BERA 3LUDA 1MX3A 1T36B 2QR5A 4H1UA 4DMLA 2D54A 1RYSA 1FMLA 1QPGA 3G0DA 3T7KA 3ZDCA 4F85A 1Z0KA 3U7QA 1AN0A 2CUZA 3JYPA 3OOEA 1PDVA 1IAVA 3TW6A 3WGYA 4AKTA 1WLSA 2IVZA 3GCDA 4OLJA 1NIJA 3BK7A 4GQIA 2UUBH 1RBQA 1SC1A 2YJZA 2ZFUA 4F6RA 2ZB3A 3EXG1 4KFTA 4QE3A 2QSYA 4GP9A 2WU3A 4YRAA 2VH2A 3ZC3A 1OAAA 4A5OA 4BQIA 2IXTA 1GV1A 2JIOA 5ARBA 1C9DB 1PSDA 3UMJA 4ENUA 3VNNA 5TJ9A 2VHWA 1KDVA 3UMVA 1KO8A 1T6YA 1ULZA 1TA4A 2BQRA 1GUFA 1U0EA 1TFUA 3BH7A 3DMTC 3EIXA 3K72B 1DCKA 1NUAA 3NJRA 1EWRA 3QLTA 4WQMA 3REFA 1IYZA 2H7XA 5KYXB 3GRKA 4IYRA 4PR0A 1PR3A 3E53A 4M0PA 1MW9X 1NKTA 3FCOA 4WZBA 4QL3A 5FH9A 1TK3A 2QGFA 4HN4B 1OTYA 3OO1A 4MEBA 4R2JA 4OGGA 1IH8A 1TVKA 5CBKA 4WDQA 2WJZB 3T3IA 4D46A 2MR6A 4FFNA 1FP4A 1J9GA 2IHNA 4IMJB 4UHCA 2UVPB 3D54D 1Z0SA 1WSAA 1VJTA 5F5NA 1MRNA 5KFHA 5LNK6 4EMUA 1VLZA 3OCVA 4LH6A 4PQGA 1F2TB 3IEIA 1E2IA 1M6WA 2DAAA 4H6VA 5AI6A 4BNXA 4EB6B 4M9ZA 1S8OA 3HYLA 3NR2A 3S1SA 1BXGA 2UYYA 1FU7A 1QVWA 2JBHA 2WAAA 4B6GA 1XJQA 4LQDA 1EVQA 3Q40A 3U7EB 2P65A 2OGZA 3F6BX 4EFBA 1NMYA 2QTHA 1T3SA 4K26A 3DSRA 3UK2A 3ETHA 1FRVA 2H1WA 2V74B 4ECYA 2K5UA 3ABRB 1V8FA 2NXEA 3OIVA 4OJQA 2IV2X 3SC4A 3VR6H 4DBLC 3BK1A 3R74A 4Z9XA 3I76A 3HJHA 4WNCA 4YRJA 1L9KA 4UZSA 4DIMA 4NPCA 1EBUA 3TMKA 1YI0A 2PH1A 3FMIA 2WUDA 3J80A 1M7GA 2PKYX 2XF8A 3C24A 2FDCA 2Z8ZA 4OHZA 1HEIA 3HH8A 3Q9LA 5C8YF 2FJ0A 2FSUA 1IMJA 3H1GA 1I1NA 1N77A 2DKOA 1PKEA 4BVJA 2WZBA 2COUA 4A92A 1CY8A 4CM3A 3KKNA 1B0ZA 3FRJA 2JNWA 2QVXX 3D31A 4J8PA 2ILTA 4L8GA 3S2UA 4B4VA 1K3UB 3W1BA 1NX9A 4QBKA 4WY2A 4BAUA 4CMIA 2EFCB 2QS9A 3KQHA 2CW8A 3W1GA 1M5UA 3RT9A 4E94A 3EG9B 4FKZA 4EG5A 5AXAA 1Z68A 2O3JA 4ZYYA 4KH0A 4CYMA 2IIVA 2NO0A 3HKDA 1DEOA 1S8AA 1ZI8A 5BR4A 4BFLA 3DWIA 2C3YA 3HYNA 5HK8A 3WICA 1DHRA 4M9QA 2XD4A 1EWVA 2OT3B 3EDOA 4F56A 1G3UA 2VP0A 1QFXA 3QV1A 3UXHA 5BVHA 1APBA 3QIAA 1BYUA 1LVGA 4M1SA 1RE0A 2EIXA 2I4TA 3I9LA 5FPYA 4D3FA 3C4QA 3O2JA 4WW0A 3NV7A 5DV9A 3H5AA 4JCCA 2PBRA 5BSRA 2PAAA 3RVBA 4AICA 4Z3KA 1E94E 2ATEA 2BBWA 3F5FA 1EP3B 5JZMA 2JJMA 2QSUA 4LPSA 1G4UR 2FW1A 1YONA 5K8TA 4RJ2A 3WNVA 4NXMB 5KMGA 1O7JA 1Y34E 4PFKA 3HRIA 3RIYA 3KB2A 1EVJA 2BFBB 1RJPA 1QO0D 4QRIA 5JJLA 1WQ1R 1WOYA 3EZYA 3NOQA 1K88A 1WW2A 3GRFA 4ECSA 4RCNA 1FP2A 1P7CA 2ZUTA 4ZTZB 1TO1E 2K2WA 4NXMH 1O96B 3H6HA 1K6MA 4WEOA 3AEYA 3W05A 1X7YA 1BX1A 2JAWA 5KVCA 2DLNA 1EFUA 4YIKA 3L2OB 5EZYB 1DZIA 2VQ6A 3X1MA 2DPJA 1CCWA 5D5PA 3K9FC 1JQ5A 2ZIFA 4IFTA 4DUZH 2NQ2C 1PJ4A 1V7QA 3R41A 4E32A 2O8DA 1DAHA 1OXTA 1TMKA 1XZ8A 2H0AA 3AFNA 5B37A 3VNUA 4B6QA 1VSQA 2RKWA 1H5NA 3P9PA 2PKXA 1EJ2A 3RRJA 3GJ7A 2PGIA 3CX3A 3GV7B 4GVXA 4FBUA 5ERYA 3Q8WA 3K2EA 4E5NA 4D9NA 3K4HA 1M7HA 4G5YA 3C3WA 5FA8A 3MR2A 4D8WA 3JQAA 2IXDA 3R0QA 3UIEA 1RS0A 4EEYA 1WULS 4HKTA 3D2AA 3VR6D 4F4DA 4MKFA 5C4IA 2F43B 4ZYXA 3MMZA 1UOOA 4GXRA 4CQNA 3MT9A 3I6IA 3NUGA 1QZTA 2H4FA 2X4DA 3ESZA 4G1UC 4B4DA 3LX4A 4RLFA 3WRXA 3FBTA 4RELA 3I52A 2DOKA 4IAOA 3DLCA 2GCOB 1VIAA 3B8HA 1RKXA 4B46A 1SIBE 3MUFA 4J2OA 1T6XA 1FDOA 1W44A 1EP9A 1TD9A 1XQVA 2X40A 2W2QA 5C37A 4TMKA 2BF4A 5LL6b 4L8FA 3I58A 5A06A 1KAGA 3PWZA 3K6KA 2DBVO 3MG9A 1L7EA 1O0SA 1VL2A 2QZSA 3QYAA 3EPLA 3GJYA 4CMHA 1FVHA 1CERA 1YDGA 1D07A 3C5CA 2VA3A 5FWXB 1YA4A 3N7UA 3L4JA 3BMXA 3THWA 4R8KA 4W5JA 3ZD9A 2QQ0A 3MHPA 1GGOA 3EE6A 1V1RB 1V47A 1Z45A 3GF4A 3O94A 1FE8A 3FIJA 3O8OB 4Y2XA 5CLQA 3ZI0A 3BCRA 1SB9A 5LXTA 1RJWA 3GLHE 5J4YA 1Y3HA 2I71A 1EK0A 1Q7EA 2I6QA 1FNDA 2VJQA 4G81A 4MUHA 5DNEA 4B3FX 1YDMA 8GPBA 1CUIA 2W58A 4G4SP 3ZEAA 3THYA 3DMYA 4O7ZA 1HM5A 4QHSA 2QORA 1B00A 1E4OA 3PUHA 1MQ8B 1UXIA 1TADA 4FGRA 2YQ5A 3M33A 1B1CA 4MPPA 1ZI9A 2J3HA 3LKZA 2PU5A 2VHVA 3RTCA 1PYDA 4CM1A 4DABA 1RC8A 3MWGA 2BKEA 3LBHA 4QW8A 1HWYA 5A7GA 4ZGGA 4O7RA 2R96A 5A0FA 3W5HA 1X1SA 3ZWPA 1C5KA 2CBZA 2CLIB 4J07A 2XUQA 3E18A 4O2BF 1S68A 1OLSA 2OHJA 2ATXA 2OZVA 3KEGA 2V97A 4EG6A 2O23A 2CXUA 3DGFC 3FRIA 1T0PA 4MV1A 4LDPA 2GLUA 4C1BA 3GLGE 1RXIA 1J8FA 3GQBA 4G2TA 1O96A 3TBFA 1XMXA 1BA3A 1P60A 1QC5A 2UXBB 1N92A 4RBNA 4U7PB 3PW4A 2LV8A 1ONSA 1NYRA 2QI9F 3ZOZA 1SU4A 1YA8A 2WWXA 4RH0A 5EZYA 4KNWA 4R6WA 5EXDA 2V5VA 5DTQA 1SOAA 3BF7A 4XIIA 2L19A 1Z7BA 3WK4A 4LBWA 3VO9A 2FMAA 2ZG6A 2CC2A 1T1RA 1ZBDA 2C5GA 1BCSA 2RGWA 2X8JB 3R3YA 4IH9A 1I3QA 1W1UA 4INOA 4K9NA 4N5LA 4Y18A 4B17A 4E4RA 5ALJA 2EJ2A 4PRYA 4DXHA 1V96A 1XYGA 4YRLA 4CDMA 5FLMG 1U7PA 3MS2A 4KQ2A 4NYJR 1EYZA 3AYXB 2Y1WA 3BA1A 3K09A 1XR3A 2HHLA 4S04A 5KG6A 1Y1VA 1V2GA 1FDVA 3QUTA 4PLCA 1OCEA 1WY7A 2JC3A 4B0OA 5IVHA 4LZOA 3PRKE 1YDWA 4OHUA 4TKVB 4HQOA 4N8SA 2QLNA 2B2CA 2R82A 3QFRA 2YZLA 3OEHD 3FHJA 2ASEA 2EHDA 1RYZA 3IALA 4XB6B 5EMNA 1VI6A 4AJ1A 2HL6A 1SK8A 2QRUA 3EVDA 2GO1A 3AIIA 1AN7A 2HLDD 4NMWA 1U1GA 4WERA 4YRDA 4MGYR 3SOPA 3DL0A 3MRSA 4TXNA 3MJFA 4MLPA 1LLUA 5FNZA 5BV2P 1IK4A 5KWJA 4JKOA 5JJKA 2Z4TA 4O3NA 3OQJA 3UZUA 2W6MA 1NBMA 4NVRA 5CGQB 3FTCA 5DLPA 4CQLB 2D5AA 2BW0A 2R6GA 2VA8A 4QWWA 2C2RA 2PL5A 4LX0A 3TRHA 3WLHA 4NEQA 5DRTA 1SZCA 4HRAA 4AJ9A 4W9NA 2FPGA 4KPYA 2ZUUA 3IOCA 3U3DA 2DH6A 2OKCA 4MW5A 2X58A 5AHRA 2DBZA 4LJ7A 5GONF 1IN8A 3MJRA 4MV7A 3RYHB 1C0EA 1LD3A 1X8XA 4AL4A 2Y1EA 1KP9A 2AQ8A 1P9OA 3JYNA 1OPRA 2Q45A 2G9UA 5CLHA 4OOFA 1ACMA 2ECFA 1E6UA 2ZUBA 3KXYT 3PO3G 2ZE5A 3UAZA 3M6WA 4RORA 5EUBA 4G4SO 3IJRA 4UCTA 1UOEA 1UKAA 2O8VA 2RAPA 2WSBA 3RV3A 1F12A 1K8RA 2YMLA 3AUUA 3HVHA 4LBVA 4KE8A 3Q10A 1CB7A 4AZ3B 4Q9DA 2XOKD 3Q5EA 1N0IA 3SNHA 4TZ0A 3EPRA 3UQ8A 1TCBA 1CC1S 4NP6A 1IM2A 3UQYS 4GPEA 4IUDS 2JA6G 4OK3A 1QRDA 2WQ7A 4AMUA 3PNSA 4BZZA 1YB5A 3STTA 3BQ9A 2BZ1A 2M98A 1XROA 2OBBA 1KPGA 3GUHA 4OG2A 2F4VH 5DWVA 3SG0A 3NC0C 1JHXA 1R15A 2R1TB 1JMKC 2F4NA 1VKJA 2QN8A 2ZXFA 4KXYA 3VBCA 1MO4A 2FPSA 4C4TA 4ZYWA 4TWBA 3Q0TA 2PN1A 4H6PA 3M5DA 2W6NA 2HF8A 1V11B 2UKDA 2PUEA 4QECA 3WLNA 4IOKA 1K3TA 2Y71A 4V03A 1RZRD 3LX5A 3AVOA 3N6VA 2O2EA 3C3AA 3NBUA 3HO8A 3QU9A 4PO1A 2QA5A 5I7OA 1TU4A 1PZEA 5JMTA 2AD5A 4PHTA 4ID9A 4PZYA 4DIFA 1W5EA 5JRZA 3EBOA 2WF9A 4IJ5A 4QPJC 4ECEA 1GTMA 3EULA 3I9NA 1SM4A 3IA2A 2GR9A 1PSWA 5E3IA 4I55F 1D4AA 3DZHA 2YXDA 3E3AA 4MRMB 4ZDJA 3W5BA 2V0GA 2QV7A 3T5PA 1GGFA 3EEIA 3C3EA 4BUJA 3TIGA 4JASB 4JQCA 4HB4A 1GZ5A 1IEWA 3MRXA 4HXFB 4LCJA 4LDRA 4QEZA 4ZRNA 1TJYA 3FVWA 3E48A 4LQCA 1C41A 3ZDXB 4D4GA 5A62A 5CA0A 2C77A 2IWRA 5H02A 3JQ8A 1WF6A 1A76A 5CM0A 1DOZA 3NM5A 1L0BA 5IH3A 1L4YA 2WSYB 2FW6A 1E8DA 2ZWPA 3D0KA 3KXDA 1UK9A 4H4EA 4ALLA 2F3SA 1O0BA 4QJ5A 1GZ6A 1NXVA 1T26A 1WVGA 4KITB 3ZWVA 3TY9A 3QTTA 2IMWP 1Q7TA 2F1OA 2DQZA 4ILKA 4H9GA 4QJ3A 1I4OA 5BYKA 1T36A 3SS8A 4UDNA 1M3SA 2P0EA 4PLHA 1ONPA 1AK2A 1RJ9A 2MINA 3K9BA 4RFSB 5JSYA 2ATIA 4ENWA 3JZMA 5JXIA 2XODA 3COPA 2ZBGA 2JDID 4OUDB 1PNOA 4BTEA 2O6HA 2RKBA 2XADA 3KU4A 4JBYA 2GPJA 4S24A 1AU9A 1FNMA 4RH3A 3BDVA 1YMVA 4LFAB 1REQB 2FY8A 1IULA 3WJ2A 5MGBA 4UVDA 4ZANA 3QKSB 5CDTA 1H1LB 3AR6A 3JQ9A 1B74A 3RQIA 3F2VA 1N2XA 2R6ZA 3QXCA 1I3KA 4QFMA 2AR7A 4QTZA 4ZOCA 5DASA 1J8QA 3S1AA 4OLBA 5CVTA 4BGVA 3FF1A 4CF3A 4WOJA 1P0QA 2VP6A 3LW8A 3U4AA 2GVZC 1PHRA 5EMHA 1FNCA 1D1TA 3PK0A 5FR2A 3MT7A 3WNQA 1D4FA 1UMDA 3EC2A 4R2KA 4IQ0A 2LCFA 5GTDA 1Y3FE 2DFDA 1W5BA 4JQYA 4J0HA 2V3WA 4EJFA 3RCBA 3EXHA 4LA4A 1ZW6A 2OG2A 4FHGA 2Z6VA 4RS3A 1GG5A 3Q7PA 5KSYA 1YR7A 3WGZA 1U1IA 4J9MA 2QJWA 5I5YA 2P0AA 3IGFA 3IKVA 3ODPA 4JVOA 4EITA 2XA9A 2R97A 4FNGA 3Q15C 2R4QA 1HDEA 4E6NA 3Q1KA 1II8B 1PJAA 4XQ0A 3T61A 4BGIA 5IULC 1I14A 1JE0A 4RD2A 4DC1A 1M5TA 1TECE 1YR8A 5AKKA 5KHOC 1NBOA 3DDHA 4PIVA 3OZTA 3DR5A 2YVQA 2IPAB 5IAKA 1KK2A 3CGWA 3U4HA 4EB6A 4J3FA 4OP3A 2WWVD 1W0JD 1WZIA 3EPKA 3TCKA 1BA2A 3I5XA 1POXA 3RLFA 4AG5A 4F5YA 1YDEA 2K2QB 2C29D 1DSSG 3GZ4A 3HXTA 4F1JA 2R1VA 1IWPB 4L85A 3ZW8A 2VQ3A 4WLOA 2NSDA 4GKBA 1O8BA 1T9DA 2B7BA 2R8RA 2HDNB 2BV3A 3HCAA 5CM2Z 3K31A 4GX2A 1IUOA 1VA5A 1VIMA 5G53C 2VXBA 3E1GA 2VP3A 2LDBA 2H0QA 3LG2A 1AKUA 1OZ0A 1WXFA 1AO0A 4YACA 4YK7A 1IBMB 5AJXA 1WR2A 1DBWA 1YD7A 4QUBA 5EMJA 2QLMA 3KJGA 2ZGVA 1CHNA 3IBGA 3ZY4A 4E2ZA 3OKAA 5F4BA 2XWPA 5L4NA 3LVFO 2CMKA 1QLWA 3MB5A 4TPKA 3RYCA 4LGCA 4KDRA 3KHSA 3RIXA 1C7ZA 1OFVA 5B1DA 4DB2A 3HOYG 2QF7A 2DJIA 2WV9A 3HB0A 1PFVA 3VKVA 3KJQA 3ZBQA 5JV5A 2EQBA 1XOIA 2QP3A 2NX2A 4ZI7A 2J6CA 4D1YA 1L5HB 1DRKA 3D3KA 2YC2C 3M6XA 4B3XA 1I3NA 1RWPA 2PMKA 5FOQA 1N6OA 2BSAA 4TKUB 4G09A 4J0DA 3AWIA 5E6SA 4ED7A 3WG9A 2XLCA 4W7IA 5BNFA 1AGNA 1M8GA 1RHRA 1HZJA 1BXZA 3BH0A 4IDCA 4FP9A 4AZTA 1ZITA 4FGSA 5ER9A 5HXAA 1ZD8A 4AWXA 3AHDA 1OGYA 1AY0A 2O4UX 5LYJF 1COZA 2ZYVX 3C5WP 3O38A 4LN1A 4FUTA 1V16A 2CYBA 4GI2A 4E1VA 5CITA 1JAIA 2QMUA 2EFGA 3NANA 3BT7A 1CRWG 3Q8XB 4Q44A 4GVPA 2O7RA 3V7UA 2A57A 3VISA 2FGJA 4N82A 4J7CA 4DNFA 1SG6A 3AEUA 4MPDA 5EUCA 1Q19A 5JCZA 2V7TA 1YIOA 5KFQA 2I4IA 2XLBA 2ZAOA 1PD0A 3IYLW 1QZUA 3LHSA 5K3CA 3I1FA 3NHZA 3URKA 3G2HA 1ZYUA 1Z07A 4H1WA 1FS6A 3O4VA 1E5LA 3IAS1 3U7GA 5BW4A 1VMIA 2C4NA 2WUFA 3RSZA 4ZYUA 1RJFA 4LYAA 3STWA 4D3ZA 3E1KA 4FLMA 3TL6A 5IHXA 4XIGS 3LXMA 2C59A 4J4TA 1IQRA 4U0KA 3A6HA 1EPUA 5FUVA 9LDTA 2B5WA 1U31A 1BOFA 1EK5A 3D6AA 3CH5A 2CGEA 4R7ZA 4LJAA 4OK6A 1W75A 2YCLA 4ND8A 3A2MA 4OKIA 4V0KA 1HSZA 1D2EA 3TJZA 1UFQA 1P5ZB 3R2JA 4PE5B 2FDRA 1Q95A 4BQSA 4V1CB 3T1YH 1I3CA 3PLAE 3CF4A 2P5UA 3BRSA 2ZTUA 4Q7EA 1Y82A 4TXLA 2BI8A 4CM8B 3HJGA 4BVEA 2OAQ1 2XQGA 3RSSA 2NYUA 4URHA 4FGUA 4UASA 3PGJA 1W4LA 3WRWA 4OB7A 2NQ8A 1KL7A 3ZTTA 1CS0A 5IN4A 3NPAA 2R7ZG 2GX6A 3HB5X 2QB5A 3QLEA 3GLIE 1S8FA 4WE3A 5JVLA 3BMCB 1DJPA 1IBRA 3T5MA 4OJKA 1JG2A 5DT9A 3O8NA 4JI5H 3TCNA 5JSQA 2WW8A 1UJNA 3BM5A 5CXUA 4HDCA 5DF1A 4CMAA 4BEVA 1FSPA 2QZ4A 4JLDA 4BLPA 4Q93A 4ZT6A 4GRDA 1S3GA 2W6OA 3Q8MA 4X66B 4KC0A 2BKLA 2JGDB 3VU8A 3HOZG 5DX0A 3UWMA 4B85A 1FVOA 3H5IA 3UFXA 3KZXA 3ZE9A 4TQSA 1YQDA 2W98A 4DDKA 1TO2E 3FE2A 4MR9A 4QYTA 1N32B 4QX6A 2CEAA 4N0EA 5IS2A 3PFKA 3EIHA 4M8LA 4KK4A 1WMSA 3T9AA 1A9YA 5H68A 3KVOA 4XGRA 1FFBA 1NVXQ 1NG1A 1PJSA 3GVCA 3R3VA 2ZTLA 3Q72A 1S03G 2HF7A 2BFMA 5DHQA 5DSXA 3T38A 5HX7A 2COKA 2ZJYA 3DL2A 2CBXA 1SYXB 1N7IA 1K5HA 1OAOC 3BRWA 4C4PA 3LCRA 2DM6A 4F3RA 1GPJA 4K05A 1SCAA 1KE2A 3QKIA 4NLLA 1MH9A 4P1ZA 2H1CA 1A5TA 3B89A 3HABA 1QJCA 2F3PA 3VPGA 2VJOA 4KIUA 3OM9A 1BJRE 3I2HA 2GDZA 3V5NA 1G20B 2BGTA 3I09A 4BFXA 2HEGA 3A37A 1IBLH 5BT9A 2RKOA 1HZZA 4FUQA 3HBLA 5DGAA 1C8VB 3T5JA 1DC7A 3CHYA 4MK4A 3EBLA 3TIIA 4QOEA 3WGHA 2HJWA 5LMNH 2WA1A 5FHRA 2VJBA 1YZFA 1U4OA 2QX7A 3ETDA 3AETA 1EINA 4IOMA 1IXYA 4PLFA 1ZHSA 4HWKA 2GN9A 1MF7A 1T5HX 1M2FA 1EE1A 1N48A 3VOBA 2OXTA 1GR1A 5E9QA 2XEXA 1M1NB 4KQMA 5ALFA 4F60A 4F50A 2XXAA 1N2CE 3V2UA 4C7OB 4J9OA 2PQ0A 4X1IB 1YOVA 3N0XA 1AB5A 4MQEA 5KWIA 4CUZA 4WFKA 1VPVA 2XCAA 1X2BA 4JLVA 2VBGA 3CRMA 1ULUA 1WAMA 2PUHA 3L0YA 3H2SA 4G5GA 2YWXA 3OF3A 4WXMA 1KYIA 5DCYA 5I7RA 2WINI 3TGLA 3OM1A 3KJNA 2NZWA 4HAYA 2JHCA 1UNNC 1NJ8A 2C0CA 2G4CA 4GPZA 4Q3CA 3BD9A 3GB9A 4HXEB 4EEZA 5JTTA 2X6TA 3I64A 1ORDA 1C8LA 3H2HA 4EBEA 4LF6B 3HYCA 2PX0A 3HGQA 2JHFA 4UFZA 1ULAA 1VIYA 4KWHA 5I8WA 3G17A 1XT6A 3NKLA 2ALJA 1VLVA 1PYGA 1W9HA 4RY8A 3VC1A 3ZU6A 4ZYTA 1DBPA 4N6OA 3OFVA 4REQB 1CBUA 2EWMA 4PWZA 5G0SA 5D00A 1T9BA 2GPWA 3PFIA 2P4SA 3AVXA 5IRCD 2Q99A 1CZNA 2D1YA 3ABSB 1W5AA 4KIFA 5H81A 2B0JA 1GTSA 3LH5A 3EWSA 4W6ZA 4YP7A 3BEOA 4DJEC 4RD3A 1QQ7A 2O59A 4BV8A 4QXRA 3NIBA 3CN7A 1ZK3A 2VHCA 3SYLA 2G17A 1T3HA 3ZX5A 3MT0A 2WK1A 2HA6A 1YE3A 3RU7A 5EJ8A 1ZN8A 1A8UA 3DKVA 4JNCA 3K4PA 4IICA 4LNAA 5FOTA 4WECA 4JDPA 2X5KO 1Z7YA 5KKAA 5DK6A 1PDWA 1OH5A 3BQNB 4XKJA 2G7ZA 3HG7A 3RODA 4DIBA 2HF2A 3KEQA 1J0XO 1WB9A 2DR2A 4W1SA 1NJ2A 2BEKA 4UDYX 1P7WA 4EPYA 3RRZA 3GEEA 1O6FA 3T5DA 3BIWA 1XTTA 1R16A 2RGNC 2VBCA 3NWJA 4KCGA 4L72A 3TAHA 4D4HA 1MP0A 2FEMA 3LYUA 5FNVA 2LGJA 1BVRA 2OGSA 2XUZA 2YV5A 4B79A 2P79A 4UREA 1PG0A 3OQPA 4PFSA 1T1IA 3OZUA 4XSVA 1KVQA 3ZWMA 3R0XA 3AJAA 3PI6A 3WA6A 3FTQA 2O7SA 3OSUA 3UZOA 4BNKA 4HB0A 2Z1NA 4D56A 3ABQB 1EVKA 3NZEA 1TW3A 1FFGA 3P96A 3OT5A 3JALB 4R1TA 4DPLA 1N8SA 4F97A 5CDFE 3BMQB 3GP5A 4Z2YA 3LY5A 1ESZA 4C5CA 1ZICA 2NZXA 2BLNA 3HACA 1OIVA 1ZIPA 1LPSA 2GO7A 2HCBA 3K1JA 3NH9A 1P8JA 5D8DA 2ID7A 3KWJA 3QVVA 3UAYA 4EKDA 2EEPA 4QWAA 5DHTA 1E1QA 1E6CA 1VCHA 2GQSA 3NHWA 4MR8B 4QODA 4B7UA 4C07A 5DISB 4E03A 4RPHA 3SR3A 3R6WA 3NVAA 3WIOA 4XD7D 1DKPA 2C3MA 3GRRA 2HSWA 1UP4A 2ECOA 1Y1RA 1MT3A 3OSZA 3HDQA 3O4GA 2PBZA 1G9XA 4LXGA 4KQJA 5JNSA 4P35A 5DN6D 1DQRA 2CJWA 2O2XA 2P4EA 4DCVA 1N2CA 1WEKA 5JS7A 2ANBA 1WCV1 1QGZA 2A9QA 4ZDIA 1MJGM 1QUFA 1MX9A 2ID8A 1DIGA 3QW2A 2IYAA 3OKPA 2CCKA 3GNLA 5E4JA 3WTBA 1J2RA 1QFJA 2GPBA 2CV2A 4H16A 1TC2A 2AS0A 2JASA 5EHZA 5AOBA 2VHTA 2D62A 2I2DA 3WMXA 3I4NG 1IDOA 2HJGA 1HDCA 3D0RA 3OD1A 4MKGA 4QNNA 5H83A 1NVTA 2NO1A 3W5CA 4Y9UA 4YB8A 3PVCA 4RZRA 3NAZA 1AA9A 2OEPA 3BAFA 3GCGA 3B1YA 3NJ8A 4FNOA 3WSVA 1NMZA 1VZ2A 3DBIA 2OFFA 3S5JA 3O74A 5DTRA 4IX9A 2Q7OE 1IMOA 1N5DA 3E3NA 2Z6AA 1Y6GA 3ELDA 3C70A 4Y6PA 5AT1A 3UMGA 3KZKA 1D2CA 2EW1A 2FTKE 4F9TA 4MUEA 1NOKA 2YXPX 3VHQA 4DV3H 1KI2A 5J4VA 5JRDS 1G8KA 2RCYA 3GLKA 3L49A 2WVAA 1Z13A 2OC9A 4TT8A 5AXBA 2Q1WA 4GGPA 1M6NA 1WSDA 3IB6A 2PZEA 4LNUB 1OLUB 2HA5A 5A9SA 3R3WA 4ZJUA 3WWIA 2EG5A 4D99A 4UTZA 4UZFA 4A1OA 4N76A 5FT9A 4N47A 1W85A 3WO1A 1VYVA 2PSHA 2KLHA 5AW8A 4COOA 3QEBZ 1YFKA 4IHJB 4YHBA 2BRUA 2IYOA 5DHUA 3ZWAA 4GLBA 2IU0A 2H9YA 3ITKA 3HCOA 4B8ZA 3CC8A 3DR3A 4BP8A 4POOA 2IY9A 3I6BA 1OU0A 2B8NA 2BCJQ 3KC2A 3OCJA 3RIMA 3TD2A 1D2RA 4V1CA 5JSZA 1S3FA 3OE4A 3ELWA 4R40A 3ZN2A 4B40A 2FK3A 1UC5B 1ORVA 3DXXA 4JBGA 4M99A 4F4ZA 3QWUA 4YR2A 3DDUA 4BP3A 1KH2A 2D1FA 3TS1A 2PXXA 5EXPA 2YWJA 3ZX4A 3KQOA 1E6LA 1OX4B 1QV6A 1Z6YA 3B20A 3GJ6A 3LDUA 2OYRA 3WRVA 2O2IA 2RC6A 3ZWNA 3MWMA 3I9JA 2FPOA 1NT2A 3LT1A 2ZI3A 5K01A 1F7UA 2RE8A 2JGAA 3CIOA 4PQFA 2C1ZA 5FPKA 1Y5NA 4QYMA 5DGCA 4QGAA 3N5CA 4TTVA 2YMMA 4Q39A 3FPBA 1XTUA 2QAJA 4C0BA 3KWLA 5CDFA 1VHJA 3HN2A 4B32A 4TN5A 4B3TB 2BZGA 1EB9A 3IUJA 3GYBA 2ST1A 5FB3A 2QUIA 5AIAA 2VSFA 3EGWA 3UPDA 3VR3A 3IKJA 4Z7OB 4EJSA 4JDUA 3SGIA 3DS8A 4R05A 521PA 4OD0A 4PG8A 4HS9A 2AE1A 2QKYA 2QPAA 1E9BA 3OJLA 3LMKA 2IBTA 4DQNA 4BFVA 2YY5A 2Q2OA 4JI6B 2EARA 3HKCB 3KCNA 4ONEA 3ANNA 3DDOA 2VKQA 1R12A 3PUIA 2YICA 2XKAA 2XUAA 3H86A 1HT1E 4IHAA 1DP4A 1RRVA 3R8XA 2R6CA 4LWOA 4NDZA 3PHIA 3R5KA 1OF1A 1QCYA 4F1WA 4RIHA 5BSUA 2A1UA 5DEIA 1K6JA 2R4UA 2NVOA 4NBVA 3VR4A 1LI4A 5HW0A 4D25A 3QPBA 3HLTA 4BO4A 1C8KA 2B7LA 1X8KA 3NTOA 3P9NA 4QVKA 3PJDA 5FYQA 2B30A 4NNJA 3TXXA 3UMMA 2B9VA 3D02A 1J5XA 3P9ZA 4FGWA 3ZCXA 3BIOA 1NUSA 5EHGA 4DLVA 1ZINA 4AJNA 3AY6A 5KQSA 5M34A 1UK7A 2VF5X 5KJCA 1T29A 3H5TA 1MHTA 1RSZA 1ZRHA 3A70A 1GTVA 1Q20A 1LBQA 5KHAA 4WKNA 5CB8A 1WPGA 1L5QA 5IZCA 2Y1XA 2BTEA 3GCWA 1EBBA 4UARA 3SYKA 1E0SA 1X1QA 1Z0IA 3FNFA 3A9VA 2YCHA 2OKGA 3BJEA 5DVZA 2H2FA 3LOUA 3ZHTA 1S97A 1DEHA 2I80A 3R6DA 1EXDA 1Z38A 4NCIA 4RD1A 1XDGA 1KE1A 4GR9A 4PPGA 4ETIA 2UXCB 5A7FA 2JDIA 1ABFA 2QU7A 4AN0A 4C0JA 2BR3A 4W5WA 5KYXA 3PFFA 1D0VA 1T4BA 2RMKA 2G0AA 3H0CA 1HFKA 4HD8A 5JD3A 4M1TA 2XQJA 4UTVA 5KINB 2RG1A 3EDMA 4YLGA 5CB6A 4JWTA 3ZKWA 3I3OA 5FORA 3H5NA 5AUPB 3PE3A 4OHKA 2BGRA 1K2VN 3N44B 4J0FA 4WCDA 1KI7A 2EKQA 2FZ4A 1WS6A 2NYAA 2WSSD 3M9WA 3I2GA 4KYVA 5NULA 2QPTA 2WFLA 1HC7A 4AX4A 2PLNA 2RK6A 3OM8A 3FPAA 3GFVA 4MQUA 5E3JA 1TYCA 3V6HA 3DZDA 4LDNA 2RI6A 3CRQA 3UB2A 4ND8B 4L2IB 1M1YE 1VIVA 1TYEB 3PPYA 4TLDA 4GLOA 2IY8A 4NU8X 3INTA 2NQTA 4M87A 3TRDA 1WU7A 3W4IA 1J0CA 1FRZA 2XWQA 3EVBA 2YTZA 3A2KA 1PGNA 2GN4A 2V7QD 3LY9A 2E55A 5B2FA 2JGRA 5TXGA 4DUGA 3CG4A 1F0KA 1L3CA 4O4IA 4RA6A 1SA0A 3WLKX 5JE8A 1LFAA 4JXXA 1DKNA 2GZHA 1VHLA 4CKBA 2DSNA 4EVRA 2OZLB 3HKCA 2NVXA 1Q1GA 3UW3A 2TMKA 4BMOB 1JZQA 3M4ZA 3ZW9A 5I7EA 5JJCA 4LJ8A 5CD9A 1F5SA 4FWBA 1TCVA 2BFFB 1NY5A 2GLXA 2QE6A 2WM8A 4IFEA 1R0CA 5JASA 4EYOA 5FPSA 5HIAA 4W9MC 2H2DA 3TPZA 3SJBA 2QIPA 3EFHA 4BNJA 2LTAA 5DLDA 4F04A 1SUFA 2EF1A 3R5HA 3FUWA 3LFUA 3KHKA 4K1XA 1R6TA 4R9VA 3STHA 5ANRB 3ZHZA 4AJEA 2SNIE 2JD2A 2XXAB 1DWPA 1CRLA 4BMNA 4FB4A 1EFAA 3D8TA 2JHPA 1JIJA 2C4UA 3TQHA 3C3YA 3T1HH 2I6GA 4HVTA 3EWIA 4RPLA 5KSWB 4M9UA 2DFPA 1UAAA 1V26A 1FFSA 3LYHA 2AR9A 1W8IA 2X2OA 3FFAA 4AXXA 3NYIA 4Z5XA 4AZVA 1DMRA 4ZCPA 2AK2A 1DUVG 1JB1A 3E9DA 2PIDA 1LV8A 9ATCA 2M05A 2FP4A 2OVBA 3LCMA 3QYFA 3A6ZA 4HWTA 4PONA 4DGQA 2QUJA 4K6FA 2VT2A 3H4IA 5B2ZA 1P4AA 4AYWA 2AL7A 5L3QA 1G8GA 3AUFA 4NZYA 1BWRA 5ILGA 1F9AA 3OT4A 4G0XA 3G9ZA 3JQFC 4DLXA 4EVSA 4O2LA 2QENA 1TAUA 2C03A 3M8KA 4FE3A 4BNTA 1XA0A 4IXTA 5LD2B 1T8WA 4BJ3A 5B7GA 1SQ6A 5CJPA 3UVEA 2DU8A 4BMZA 1U7DA 4PV7A 3DLAA 5CB0A 4QJIA 3RD5A 1JHPA 1CF9A 3KR1A 3ZK8A 3N75A 1DQZA 1UPAA 2JGEA 1RPNA 4H0CA 1EVEA 4OI2A 4MVXA 3KUXA 4Y1RB 1FMFA 2NIPA 3AM4A 4L22A 5KVQA 3WK7A 1CY1A 4IM7A 3WJ1A 4ACBA 1M34E 3R0IA 2VO1A 2AGOA 2J4DA 4M6WB 3B1JA 2P6NA 5DKFA 1PJZA 2C5BA 4HSGA 1RACA 2CXOA 4MOWA 1Z82A 2QD2A 4U6SA 4LF4H 3OJEA 1LZLA 4F3KA 4F2DA 1A1SA 3WGKA 4EB8A 4N41A 5DTJA 4GQBA 3RANA 3KRTA 4D92A 3SICE 4BWYA 5JBQA 2A14A 3OMLA 2QY6A 3D1VA 4NIMA 2ZIXA 4L9SA 1VYUA 4YDQA 2GAAA 1BDJA 1NONA 4F4IA 3BG5A 3D5TA 5IJ9B 3GPCA 3W8FA 4BWFB 3RJMA 5IDYA 1UDBA 4UUOA 1AO3A 2D74A 4G07A 3SSOA 1G8PA 1PT9A 3OE7A 3EXIB 3F78A 1LNZA 5DW0A 9ABPA 2C42A 1N9GA 4M76B 8OHMA 1SD1A 4HI0E 1K75A 1L5WA 2PLAA 3NTUA 3WZ2A 1ZIYA 1LH0A 3RUPA 1X7WA 3GH1A 3RHZA 4X9XA 4BVFA 1GPBA 4IGIA 4DT1B 1I50A 3B60A 2MU1A 4LYFA 4AY4A 4ZOLB 2CLMB 4DLRA 1W59A 1ZG3A 2UXCH 1JECA 5JMOA 1ZVJA 3T9BA 1JLLB 1D1QA 2QR2A 3GFQA 4HWOA 2AZMA 1YCDA 4JX8A 1UP6A 4CE6A 1GD1O 1RRKA 2PK3A 5GZ1A 4GM4A 1C0IA 2VQSA 2UUCB 1V6AA 2GBFA 1GLVA 1HDIA 1Q77A 3FWKA 4JKYA 4Q48A 2C92A 1TF5A 4EYHB 1YFJA 4BO8A 2AJBA 3NIGB 2XWBF 3AI1A 3IAHA 4QQFA 4CF7A 5IFKA 2DRIA 1QGUA 2XT0A 5E6UB 1IZ7A 1O8CA 2H59A 5FUQA 1Z0JA 2JFYA 2XIQA 4X85A 4F0JA 1ZCZA 2V7QA 3EEQA 1T2CA 3SHVA 2CV1A 2JZNA 4I3FA 1EIZA 1N2CB 1TNDA 1NLUA 4KQEA 3K1ZA 4HDQB 3ME5A 4MVCA 4CHTA 3HP7A 2C2BA 2OFXA 3BZWA 4BWGA 3BA9A 4Q21A 5JD6A 4BY7G 1NN0A 3TOZA 1PK9A 3FKJA 1SY7A 1C1XA 3CUTA 3TFOA 3M3PA 1EUCB 1DTEA 4YB8B 1X7ZA 3N74A 3MT8A 2H4JA 2WWTA 2OORC 4X8OA 3LZ6A 3TQRA 5AQ1A 1MC1A 5KFNA 2J6HA 2PSFA 2Z43A 3LL4A 1Z6QA 4JIGA 1I4DD 1SKBA 4ZI7B 3EZXA 2CMGA 1IFXA 4JMLA 2EL9A 2QLFA 4IDQA 1XZDA 2JGLA 3DE2X 4KXFB 4ENPA 4QXPA 4YFVA 2Y6VA 3OO0A 4BBRG 3Q9UA 4D9BA 1R18A 4PCUA 5ESXA 4GL4A 1YR6A 4KEAA 3ETEA 3KHUA 4JYAH 4L5YA 4C6RA 3BFVA 5BQFA 1Z26A 3GUCA 1SGWA 1F3LA 1DAEA 1TRHA 2E6UX 2YVUA 4RU1A 3FLMA 3UICA 3SHWA 2YFQA 2OWOA 1OKKA 3KT3A 1KXZA 2DWPA 2NT4A 4P36A 3M3DA 2Z5FA 4J0IA 1MW8X 2IZOA 2PXAA 4D8TA 1N34H 4HLUA 1CWUA 2VDUE 4I2VA 1FSFA 1WXIA 2HGWA 1Z2EA 1UOPA 3BWCA 1MV5A 3ANLA 4KXLA 5J1SB 2AMYA 2YV3A 2BPOA 3A27A 3PQ7A 5DU2A 5EZ5A 4Z53A 2R5NA 5GV8A 3H0EA 2NU6B 1HR0H 2CFTA 2IEYA 4C7XA 1MO5A 4C03A 5LUAA 5E8RA 4DYVA 1XQ6A 4GO1A 2C8LA 4Q1EA 4DCPA 4EEKA 4UNPA 1H3NA 1WDMA 4LSZA 5D6OA 1S0OA 2JGIA 1U80A 3DOOA 2BH2A 5H3CA 2ZI7A 4NR0A 3LOQA 3EDQA 4D41A 3LHKA 4RJKA 2SKEA 3HCDA 2NYRA 4DJFC 3E6AA 4RV5A 1U9ZA 1X3SA 3O9ZA 3VNQA 3PSAA 1KARA 2F1HA 2X3UA 1J0EA 3K6SB 1SU7A 1FYXA 3NTVA 1YDFA 4QTTB 3GPIA 3C87A 5LCXA 3R0ZA 4G2NA 2CNQA 2Z2XA 3CVZA 1XCJA 3ZJVA 2Q49A 4K28A 2O52A 4O59O 4YREA 5DP2A 4Y0VA 2V4UA 2NUAB 5KFXA 5KG3A 1HG1A 4DQKA 3ND7A 3PVXA 3CUKA 2ZTVA 1QONA 2YOHA 4IIJA 2I22A 4L15A 2RAFA 4G3IA 4G8CA 4XWOA 5EHIA 3CQZA 2ENUA 3OEED 4OGKA 3ASYA 3QVTA 1DGQA 3ZXIA 1JHDA 1NW8A 2GZMA 1JIUA 3QHQA 2Z4RA 4CM6A 3RAEC 2P9JA 2B1RA 1JYFA 1I80A 2VJDA 1WCYA 3Q7SA 4F5DA 1BROA 3IUEA 3NDIA 3HOWG 1KI6A 4GR4A 2WLSA 5AICA 1TPZA 3F5MA 3C8UA 2ZE6A 1LC3A 2XCOA 3KQMA 3L8EA 1JEQB 2OTCA 2XMZA 1N9KA 1WUJS 3KP1A 1RZRA 1K5GA 3PBKA 3AB3A 3M4JA 1YI1A 3E5RA 3A1NA 3DAGA 3LXXA 4HEA1 5B53A 4PLGA 2QRNA 3GB8B 3H3FA 4KYUA 4KE9A 3V34A 1B0PA 5TSDA 2BFEA 3H8SA 2C5HA 4A0GA 4UMEA 4RTQA 5ALKA 4BU1A 1LDYA 5DM70 2LIVA 1X7HA 1M7JA 2ZYUX 1AC5A 1G4HA 2JCBA 2W9XA 2BEVB 4QUJA 3RLIA 2WWFA 5GJBA 2DHDA 2I6TA 4DJ5X 3JZ6A 4PZ7A 2BGMA 3AV0B 3AY3A 4Y9TA 4CKXA 4YPOA 1IATA 2HQOA 4KXNA 1L8AA 3JVDA 2FPRA 2ORVA 3PQ3A 5EYPA 3R7WA 1JHOA 4QDZA 1ZSYA 2EBWA 1JQKA 4L4RA 3FZGA 1CUWA 2E87A 4V38A 2GPSA 1B43A 4F4UA 1QCCA 3HO6A 4JJAA 4JZKA 3BS4A 2ZYAA 4YQEA 3UWSA 4HUTA 1VGVA 2TMDA 5DX8A 4IIGA 1DMSA 1XELA 3ZU5A 3DF7A 1MBZA 2Z8YM 1YVUA 4OQQA 5SY4A 1FDSA 1KI1A 2AG1A 2VPIA 2B4QA 3PG5A 4BNHA 4ES6A 3V1TC 3UAVA 1HNZB 3GDFA 1ODFA 2UUAB 2JAOA 4R01A 3NXSA 1FQKA 1LWNA 2BUAA 2GEUA 5AHKA 4FT2A 3I0ZA 1GFSA 3K32A 1D6JA 2R7KA 1I24A 1GG2A 2JAXA 4X7BA 1Y4UA 4HH4A 1YQQA 1F3OA 4B7CA 5AVYA 4G0VA 1T8TA 3OOWA 4YAWA 2OBLA 4MRSA 1OZAA 2P75A 1WBJB 2B98A 3NG1A 4HEHA 3T1NA 2ZU0C 4HRXA 4KXMA 2BOVA 4LGMA 3O93A 3QA9A 3KWFA 1DTWA 1JW9B 3CG0A 4UC0A 5L53A 2W6ZA 2PMFA 3OUTA 1J90A 1HQYE 1J0DA 1YK0A 2A5FA 4UTXA 5EJFA 1GVHA 3R1IA 2ONCA 2C0QA 4N18A 4J9QA 3P5SA 5EE0A 3GC6A 4O83A 4WFIA 4NV3A 1RIIA 3D8UA 5AK3A 1JQEA 2NVBA 1I4EB 5HFJA 5C5JA 1RXCA 3PC8A 4X6UA 3SEFA 1A9SA 1V95A 1E2UA 3TLBA 5I3ZA 5CT5A 5ALQA 3FAZA 4QBIA 3BWDD 1E7YA 4UM9D 3HCBA 1AD2A 4NZMA 2IH2A 2GJ8A 4US0R 2E89A 3FHOA 4EO4A 3H9UA 3KR2A 3VO2A 5L7WA 3LUAA 2OAP1 4MWGA 4P0QB 3EF0A 4BZWA 1V4YA 4AY6A 1YS4A 4V2IA 5EJ9A 5HUHA 4FKMA 1QF7A 4O3QA 4OO3A 2J07A 2WTEA 3IOBA 2EJ0A 2FSIA 4ARZB 4RGYA 3RTGA 2FCAA 1ST2A 4QM6A 5AKHA 3OTIA 3QIVA 1POWA 3UKJA 3N53A 4Y6OA 2YNMC 4FXPA 1BHQ1 2Y8EA 3T1TA 4GI5A 2OC4A 4LOKA 4LNHA 3NGMA 1O94D 4WLVA 3GIMA 1G2QA 3LQRA 1L5LA 1U0LA 1EWYA 5DYWA 3ESDA 3MYRA 5EKDA 4GMHA 3FNRA 1FYWA 1ZXXA 4EDHA 2CQYA 4AY3A 2A88A 3L7YA 3OSNA 1M6VB 1QYDA 4EEQA 1U2DA 1YAHA 4RK6A 4FOOA 2YMPA 2HHFA 3FSRA 2BZSA 3KOUA 4YJFB 1M0TA 3IC5A 5EYPB 4ZHQB 1WMAA 4LYYA 3KYJB 5LYJA 4TVOA 1VSVA 2WNSA 5HF6A 3I5UA 3I9FA 3IT0A 5DMXA 2BBSA 2H8KA 5BWUA 2CJFA 2HMVA 4R7TA 2CJYA 4Y6LA 1J25A 4Y6SA 5FUWA 2OPBA 4QBHA 4DA9A 3U5TA 1E7RA 2WTBA 1Z12A 4X1KB 1WVMA 1PJCA 2OGUA 5L3QB 3A0RB 4NAVA 4UE2A 4K6OA 3D3NA 4OJYA 2G70A 2OHXA 4QO7A 1WP9A 1W25A 1UKVY 5FTJA 3BTVA 1JYEA 4A8HA 2FSPA 2QMQA 3CNLA 5JCJA 1IEVA 1P80A 1VMAA 3GDEA 1XEXA 3B2EA 5C9ZA 5JNWA 4RO0A 5LP6C 1KKUA 3ACDA 3WHKA 4EYIB 1G5PA 1K1QA 1WOMA 1V39A 2SHKA 4EHHA 1H4SA 1VJ1A 3A05A 1H65A 3JQBC 1V35A 4BNNA 4LJSA 2Z83A 1IONA 4YR0A 1DTWB 3NC4A 4IKEA 2EJUA 4KO1S 4UXHA 1RPZA 3RB3A 3HA2A 3CX8A 4FHDA 4JOQA 4NBNA 1U3WA 4J1QA 1GA4A 1LBEA 1E9SA 4EJ2A 4G9GA 4GYYA 1YKGA 1I6LA 4QU8A 2I2CA 2PVSA 4M7RA 3U3MA 2R62A 2JJ2D 2WFMA 2FZVA 2HUPA 2ZEJA 4HAWA 2MSLA 1P0IA 4OKNA 2IXBA 3V8RA 2G25A 4Y0AA 1TA8A 3P97A 1GSAA 2BTOA 3WL6A 3WGOA 4XLTA 4B76A 5DNAA 5GY7A 3NM4A 4A2BA 2FW0A 3ESRA 1JKFA 4WGGA 3SVLA 1CYEA 1J0BA 4BV3A 3M7IA 5IT4A 3GTJA 1MCZA 3JQ6A 3S8EA 3JWPA 1GL3A 5TT1A 1P1RA 1PZMA 1H8HA 2HJSA 2QM3A 5CK5A 3WIEA 1ZJ6A 4KBGA 1QE0A 4BQOA 4HMOA 4O3FA 4CRWB 3ESXA 3KNZA 4ECUA 4FZ3A 2ASJA 5AXDA 4MTLA 4PZ0A 2AX4A 1IPEA 4J4BA 2X9QA 5IAOA 3RFCA 3OCUA 4G0OA 5MGNA 4AXBA 4FFBB 1VP9A 1ZIXA 4UHFA 4JI5B 5EG5A 4IAJA 3G5LA 3GXBA 3OLWA 3U4IA 4EFEA 2ZSKA 3N05A 1KORA 4FFWA 3BL8A 2DHQA 5CEJA 1R88A 1LJUA 1CUXA 2P2CA 5D01A 5F51A 3WS7A 1T43A 3DNFA 4HG2A 5F2EA 5MFZA 2ZM6B 1RXVA 4L0DA 2PXHA 1YB7A 3HCPA 4P92A 4UAGA 1JDJA 4FYJA 1T3NA 4IZ6A 4RM2A 4NCHA 5ALIA 3TW4A 4L4SA 3KQKA 3D9QX 1SD2A 1USWA 3PGXA 1BS1A 1IJEA 3EH1A 4W9NC 4ZQEA 2FWIA 3W5IA 5CYPA 2OD7A 2CFMA 2C96A 2J9XB 3DZFA 1U7UA 3A31A 5ALMA 4D8UA 4LKRA 2I4NA 1E3TA 3KG2A 4P58A 4IDFA 1Z4OA 4LZWA 3HEBA 4WX2B 3LQYA 4C30A 3Q7EA 3TL3A 3MELA 3T9DA 1KFBB 4RNCA 2G82A 1P1KA 4N9QA 2G0NA 3DUWA 5FAKA 3IAUA 4RPJA 5D3KA 1L1FA 1GG8A 1TMOA 4LOJA 4CUKA 4QTUB 2GYYA 4PX9A 1E3IA 1XD2A 2XUHA 4XIFA 4AUEA 1C9KA 3GILA 3KZOA 3H1AA 4TL7A 3SEAA 5JIBA 1H3EA 4D4LA 4HV4A 4II3A 2JFXA 5JO0A 1DIRA 4JVNA 3RAJA 3T3GA 4HCJA 2JBAB 1E2KA 2DBYA 5TPZD 4URVR 2ZUWA 1Z5OA 3KJZA 2QZ9A 1AB6A 2YCBA 3AEXA 1AUOA 1BCRB 1V8OA 2J0EA 4DUYH 1R0XA 2HKIA 3OCXA 3VPXA 1K3FA 2X6RA 4L8WB 1MJHA 1RAGA 4W1PA 4XJVA 3C7AA 5FYDA 5B3AA 1BSVA 1JF8A 2QMOA 1WY5A 2O8DB 3L7DA 1YJAA 4NBUA 1PFQA 4OUKX 5B30A 4X8MA 5J5CA 4B8WA 1QGYA 4DA6A 2VQEH 3W7BA 4CIDA 1V8ZA 4ED9A 4MVJA 5B12A 4YJ3A 2Q2NA 1KUTA 4Q9LA 2BFPA 3NCTA 5LMCA 1RHQA 1O4WA 1CUEA 4WNIA 3H6GA 3WLEA 3IVGA 2JRLA 3OZBA 3SVZA 4A4DA 4QGGA 3GFPA 4HJXA 5AW6A 3KT8A 5JUMA 1KZ4A 2X0RA 2IOFA 4UM5A 4BYGA 3AERA 4O8ZA 3ZQJA 1P31A 3INYA 1PGQA 1F7VA 4EIWA 3P4UA 1HURA 4Y2QA 1SKYE 2HHHB 3EMBA 5E1BA 3Q1LA 4JD5A 4DV0B 1U0NA 5T3YA 3GVHA 2DIKA 5KYKA 4CJXA 5CD1A 3I39X 5HKBA 1LUAA 5CM8B 2JATA 1Z83A 3CPSA 1UPUA 3GA5A 3X0DA 4K81B 3ZHRA 2XVZA 2HLPA 3K8ZA 1L1RA 4X65H 1PFYA 1IZYA 3NRCA 3R7FA 4CLOB 3FB1A 1XZAA 4PSUA 4Z2AA 1KJ8A 2FK8A 4D9JA 2IV3A 3N2KA 5KU7A 4MZXA 1J7JA 5KTMA 1HA3A 2DSTA 2HGZA 2PX8A 3RYIA 1UZUA 4XX1A 5KYGA 4LZZA 1I7SB 4UCRA 3QUAA 4LF8H 1A9ZA 2XTAA 1WB6A 1AZLA 3OIYA 1KWGA 2P41A 4J90A 2Z56A 2OSVA 1HRDA 4P5DA 3KALA 1QZ3A 3IP5A 2YV4A 1FVFA 4JL8A 2UXDB 1FFDA 3S40A 1XNQB 1YJ8A 2YXNA 1G8HA 3IQGX 3OAAA 3KPYA 4GX0A 4IDPA 4DEXA 2HMTA 1T0UA 3QZUA 2E18A 3LLCA 4DWOA 1N2JA 4UOZA 4IIJF 4HNHA 1B8NA 3Q7TA 4KN9S 4L2IA 3AK4A 3EVAA 3OC6A 5THKA 1HDGO 5TARA 1MRZA 2NTNA 3NBFA 3TEMA 1CV2A 1LB1B 2BTQB 4FW8A 2Q5LA 3P32A 4JB3A 4LV6A 4IVQA 3D5QA 3VZRA 3ZCSA 4NC9A 5HF8A 1B3RA 2XMDA 2W9BA 2PRSA 1YRBA 3GFGA 2CDRA 3VZBA 3WNBA 2IBMA 1QRUA 4DR5H 1T9KA 1EESA 1WSWA 2VT7A 3T1HB 3VPAA 5AVTA 2HLNA 1S2MA 3DL7A 4QU5A 3H3JA 4JVMA 1T5LA 1G16A 3L6DA 3PXAA 1CD5A 2Q3HA 1HORA 3NHMA 3UUFA 2F7SA 4RDHA 1CIPA 1ZNXA 4EW1A 3RSFA 1MB4A 4CV1A 3ABIA 4R2WA 2CMDA 3IKTA 4GW3A 2X5RA 1UBEA 2AQKA 3RO7A 3V55A 1VKOA 3A10A 3RM3A 4LVNA 5IF9A 2RGGA 1SBZA 3QWFA 1P2BA 4P4LA 4BLUA 2AFVA 4TVIA 1V11A 1JEQA 1JKMA 4BWSC 2WVHA 3QXJA 4UU7A 1P4RA 4BV9A 5KDOA 1KH1A 4HDRB 4Y2SA 1EFVA 2XZDA 3CR8A 5AM1A 1IVYA 1NXQA 2Z5LA 2CNBA 3PKJA 1DS6A 1HNWB 1XRLA 4BCBA 1Z4KA 1KJYA 1KEZA 4WJLA 4FBMA 3KS9A 3W3AA 2AN9A 1RMQA 1LI5A 1YQ9A 2PRZA 3BBPA 3ILYA 1HY3A 4ZQBA 3SF8B 3VSDA 3WL8A 2WR8A 2WYIA 1H6DA 1ZGBA 2Y99A 3QM1A 2F6RA 4B4UA 1RJEA 3OBBA 4GRAA 3X2FA 2AG6A 3GIWA 1DE0A 1OKKD 3BB4A 3GPBA 1ZK4A 4IS3A 3VOTA 3TSCA 4YRQA 1G21E 2WWHA 2H5JA 4CU5A 5KREA 221PA 2H92A 2V6GA 4ZVMA 3RT7A 3NHYA 5CPBA 5GMOA 4UPEA 1RHKA 3AT1A 3JARA 4RHXA 4WLUA 4AMBA 1ZGCA 2WM2A 3B3JA 4IDHA 3E0XA 1HLPA 1YXMA 4ZQIA 1R8YA 3DMDA 4YJ2B 1D1SA 2QZPA 4LXIA 3VX4A 1DJQA 1QTNA 5C7IO 5BPHA 4HZIA 3L4KA 4ZVUA 1DO0A 3DVAA 5C8VA 5KOYA 3RUCA 2RGXA 4OK5A 1OX6A 4TWJA 2WE7A 3KQSA 2PFKA 1UPTA 4JSTA 1AJEA 3WYBA 3D6HA 5IMBA 2HWUA 3N0TA 2ZJ6A 1L6IA 5ALNA 2WC1A 3KFXA 4ILEA 4JVSB 5DGXA 1A7UA 2HA0A 3ECCA 1FK8A 3O8DA 4L08A 4XR9A 3FCYA 4LG1A 7REQA 4YUXA 5BWBA 2UZ1A 3H0GG 4HDNB 3NWOA 4YFYA 3VI4B 5KYUB 2XYVA 4POAA 4UMVA 4A7PA 4BPRA 3EUWA 1V8DA 4KMMA 4KPEC 5JJIA 3UJNA 3LFHA 1PUIA 3MWFA 2C2HA 2G28A 4LQLA 5FFNA 4GKKB 4P31A 2O03A 1DT3A 3IPLA 2OUIA 1AQJA 3N2IA 1PP4A 3HBAA 2NTVA 1ZLXA 3EQZA 5KMGB 4XWAA 3KYIB 1G5HA 4I7EA 4GMKA 3WMEA 2ZSEA 3O2QB 4E5UA 4JJGA 1JHYA 3UUEA 3EQ7A 3KE9A 3OTQA 1NE7A 1P2SA 2VJCA 3V8NA 2PD3A 3TLXA 1OI2A 1QMGA 2PUBA 3CNOA 4WCVA 2IP4A 2JJ8A 2VJKA 3QPDA 3O95A 3UTCA 3G8CA 4HFRA 1UC4B 4L3VA 2Z5GA 2ET6A 1ENYA 1ADFA 1JUDA 5LBUA 4DXDA 3W04A 1U0TA 4WCFA 4KO4S 2IPOA 5I7UA 3ADDA 2QTNA 1VIDA 2FOLA 4IPTA 5IJ0B 1T35A 4C78A 4F92B 1JAZA 5HQ3B 2QD3A 2HWKA 1EFTA 1RTKA 4MGHA 1O95D 2HBZA 4AO8A 1AIPA 4DARA 9MHTA 1T4DA 5AJHA 3Q3HA 1RAAA 1YU6A 2HO5A 3DJFA 3PUVA 1NG9A 1JLSA 1EFVB 2KJQA 5CHYA 1EDBA 2NTJA 3IMKA 4RK7A 2PFGA 2YY7A 3UN1A 2JFFA 4WBSA 2H1LA 4J3NA 1VFNA 2E4YA 4MR7B 4XXHA 3USCS 4H6WA 2XVXA 5JZ9A 1Z16A 1GJRA 4GEGA 3RVMA 5BQ3A 4IF6A 4IQ4A 4B47A 3T1YB 3LBAA 5B2EA 3DCIA 1XCLA 3PW5A 2ZI6A 4MTDA 2NUBA 1A3CA 1C1DB 2WD9A 2ZCVA 4DWVA 4GOLD 1WCMA 4Q3NA 3S68A 3HR4A 1J1IA 1E2JA 3L41A 1KS2A 3GMTA 1NT4A 1WXHA 1X8JA 2WQ6A 4UBKA 3KDPA 4FNMA 4V2UA 2ILVA 5KAPA 2QE7D 4ESEA 2ZU6A 2VUUA 4AP9A 1JG7A 4KHPH 3GBSA 3KEFA 4IV5A 5BYBA 1BHO1 2VT3A 1NF9A 2G1AA 1PWXA 2KHZA 5A4MS 5AUNB 3NHKA 3SFZA 1U5CA 3B53X 4YJDA 4D4JA 1WHTA 3AONB 3KVNA 3OBIA 4CKEB 4JJ4A 9LDBA 3IXQA 3S2IA 4LV8B 1WLYA 4PS1A 3F7TA 3R20A 3P8ZA 3NETA 2J6BA 3ESYA 3OY2A 1KPIA 1E32A 4OYLA 4ZYLA 1GR0A 4ZIRA 2NU7A 5EQJB 3C3JA 4UCWA 1DBSA 4F2GA 4ID3A 3ICEA 2QLBA 1OT3A 3EAQA 1H2ZA 3NBMA 1W76A 2L17A 1GARA 1ZC4A 2DQKA 2EXXA 4UD2A 1KOLA 3KKPA 3HBNA 2ZJ0A 1QDUA 2IEBA 3F5DA 4K6MA 4X91A 2PSDA 3IV7A 5F64A 5E7JA 4A93G 5EI5A 4A73A 4RJTA 1RK6A 2CNWA 721PA 5LZ4A 5MN6A 2XRMA 3LM8A 5GIOE 4BXOA 1PR6A 2PPVA 4KHPB 4JR1A 3RPEA 4M37A 4NCKA 4P9NA 5JFOA 3GLHA 1YMQA 3WLPA 2QZZA 2ZWAA 3QFHA 1N0HA 4NE7A 2AFIB 1T13A 4TRJA 3QOXA 2ENWA 1W29A 3AF6A 4JBXA 3HV2A 2JJ1A 4IDBA 3X1XA 1BAPA 1KIAA 3BRQA 6REQB 2LRHA 3V4LA 2ZVJA 4Q3LA 1KJQA 2XEDA 4M9RA 5DNWA 4AKIA 3PRJA 5D3MB 3WSTA 2B9EA 1R6BX 3T54A 2AFHB 1XD2B 2GHRA 3ONNA 1O95A 3OZCA 3VDNB 5DE3A 2GJ9A 5JSHA 5BR7A 4M0EA 4TZTA 1CS4C 2FAXA 4EUKA 4LXHA 2B1GA 1F2UA 3OZ7A 4IS2A 1MVOA 3PHGA 3PQFA 3BH6A 4MIYA 1OHHA 4YT4A 2FG7C 3JD2A 1Z36A 2GYWA 4NWIA 1N8NA 3ZWDA 5L6MB 1LI7A 4C3ZA 4QDUA 4YLEA 4R1PA 2FQQA 4OFBA 1MC5A 4KGVA 1CZKA 2F1RA 4PO3X 3B38A 1ODTC 4NJEA 4Q3BA 1T4CB 4JS0A 1M2EA 2P91A 1ESNA 5L9XA 3EASA 4A6DA 1Z63A 1W0KA 4HNSA 1I5EA 5A2QW 1MAHA 2O3TA 1ZD9A 4MVJM 4RMIA 1NM5C 1Y8CA 4UATA 5CA1A 1EBFA 1GSHA 2WWRA 2IZZA 3EH2A 4KUHA 1KP2A 5EJGA 5CBPA 5CG1A 3AJ8A 1OVGA 3FPKA 2X0NA 1F8YA 1FP1D 1J22A 3W7AA 1RJQA 1IG0A 1NNEA 3D3EA 2VUIB 2JAUA 1JE1A 3M6FA 2QNRA 4FQ5A 4L5BA 3F2IA 3FNEA 4EI7A 1SXPA 2FEPA 3LYAA 1QTQA 1P9WA 4KHZA 2QYSA 3QTLA 1K4YA 2A1TR 3CPJB 2ODPA 3SQWA 2CFCA 4JYCA 3FKSA 4HVAA 4KI7A 1T4MA 3P45A 3OLXA 2AW3A 2Y0SA 2O2GA 3CUEF 4WKOA 3UWKA 1PWHA 5LOVA 2QD1A 2VN8A 1XTVA 3P9XA 4NCJA 4DN6A 2Q2UA 1U3DA 2R7AA 3L07A 4I4TA 4NESA 4R69A 1HMYA 1U3CA 3FXAA 4Y6GB 1JNXX 3CBGA 1CZLA 2XGMA 2VS1A 3LBNA 2NZ8A 1JZTA 3MGBA 3MINA 4FT4A 4Q66C 5ALGA 4DAEA 3DFFA 4A2WA 1SXJA 2FW9A 5FWYA 1FJXA 1RR6A 3BDIA 1HG0A 4LQ4A 3WXMA 1IRXA 2V9CA 3PIIA 5KNCA 2PGJA 5IXSA 1I8TA 3LT0A 1A4RA 2CJPA 1R6UA 3GAAA 5CU7A 3TL2A 4FJ2A 1CYDA 4X41A 3R7BA 4I9UA 3UH0A 2GOYA 3JD4A 5KPJA 1TVKB 1USKA 2WIKA 5DIFA 3RK1A 1JR3E 1U9CA 2I62A 4BX8A 4NYEA 1FEZA 4KVFA 4GOMD 3SF8A 2XE8A 4DUYB 3LHDA 2JI7A 1WTAA 1O6CA 2CXTA 4YCMA 3I8SA 4OQDA 1EFKA 3R9XA 2Z58A 3UJCA 1Z0ZA 3PDJA 1BDBA 4DNXA 1PS8A 4UCOA 4ECRA 2FLPA 2WABA 5KPDA 4A6XA 1WBDA 4ECZA 4F9FA 2IPMA 2A35A 3KOMA 4MW6A 4MS3B 2JPDA 4WNAB 4RVCA 3V80A 1X74A 5C8DA 2JLRA 5F35A 3AP2A 5K1ZA 3DXYA 4YJ2F 4G9EA 1TQ6A 3FG9A 3OX1A 4ZAWA 3MTEA 4ZEWA 5HRCA 3ORQA 1TFRA 4BFCA 1PJLA 3GEPA 4EY5A 4FIZA 2HA4A 2OFPA 4NDNE 3AR8A 1Z4MA 2Q62A 4ZZ1A 1PAUA 2WD7A 5J4LA 5KWEA 5JW6A 5L40A 5DG7A 2RJNA 3GHHA 3BWEA 2WHRA 4F2PA 3UA3A 2Y4RA 5CAEB 4NK5A 3HDYA 2H3EA 2M2IA 3JVUA 4XYEA 3TDKA 3UOAB 2COJA 3RBEA 1NW5A 4P22A 4RKRA 3ZDZB 1P3JA 3GTPA 3S3TA 1ZZGA 1G3MA 1JDVA 5IUJC 3ZDAA 4NULA 2XYPA 2UYCA 4XLZA 4NBWA 1BMFD 2Y77A 2CB0A 3IP7A 2HRQA 4XVUA 3UMBA 1KHHA 1ZQ9A 3PTLA 2JB9A 3PFHA 1L1EA 4E14A 5BUQA 3GLIB 1K9VF 2VCHA 4FEAA 4JV1A 4KV9A 4YMGA 6Q21A 4GDMA 2UVDA 3KOWA 2R11A 3ABZA 1HYHA 3BYZA 3ZWBA 3WL3A 2QVBA 1HNNA 4ZCQA 3IUYA 2XCTB 4EA9A 4NQZA 2EL7A 4I1YA 3CFYA 3T94A 4RIFA 4EY8A 3K2BA 3FOEC 1H2FA 4ZZ2A 4YRIA 2BVNA 3PT9A 5IC5A 3LVRE 3BKXA 5ECDA 3UJBA 3MAAC 1MJGA 4WESA 5I8PA 2WD8A 2MTBA 5LOVB 1T0JB 1HMPA 4OQZA 2VOJA 2FRDA 1NR7A 3LQKA 3OCYA 3KEMA 4WBNA 4A27A 2C7PA 2WKQA 2VKTA 4CGZA 1C9EA 1MG5A 3WQRA 3HWX1 3INGA 4J0QA 4YAJA 1U8XX 5HDBB 4OXQA 2UUAH 3MINB 1CHDA 3RFTA 4RSHA 1UMDB 2NO4A 1BVHA 2D3TA 3BXZA 5BRJA 3QHAA 2DAPA 4TXJA 3WWOA 1M1NA 1SXGA 2F17A 4PIPA 1DAFA 1NV8A 3DH0A 4CE5A 3B5JA 4UBLA 3H84A 4X1IA 2BFDB 1Y37A 3QFTA 5AIBA 3TSYA 5IVDA 3EOBI 3FCCA 2FPIB 1TAGA 1GUBA 5DRYA 1ZGGA 4OVKA 4ATNA 4X65B 1DU4A 3G0BA 1E9EA 4GI1A 5CUQA 2F90A 2CKDA 3HU1A 3MA0A 1L5NA 3VU1A 1E9FA 4DCTA 4OYHA 4DV6B 1G5FA 2AMLA 2D7CA 3DTYA 3IUSA 1Q0PA 1Q12A 4QAQA 5AW0A 5LWHA