2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
b'NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
4YAKB 2Z04A 5LYJF 1KJJA 3JZFA 1VBGA 2GQRA 4O86A 5IYZF 2R7NA 1M0TA 4C5BA 3Q2OA 3V4SA 3KAKA 3R5HA 1CE8A 2R6FA 3HBLA 3BFPA 5KKNB 5GONF 4O4IF 2YRXA 5D8DA 4EG0A 3Q1KA 1GSHA 5K2MA 4XX0B 1EYZA 1SCUB 3UFXB 2YZMA 1E4EA 1M6VA 1I7LA 1CQIB 4FFMA 2CZGA 1BNCA 4O81A 2NPOA 2WYOA 2YZGA 4J6EA 4MA0A 3TIGA 2X0SA 1CS0A 1OBGA 3NUAA 2P0AA 2XD4A 5LA6F 3TW6A 3JRXA 2IP4A 4YJ2F 4FU0A 4MV3A 2VHEA 1B6RA 5HBRB 4O7LA 4IWXA 3VPBA 3U55A 2QF7A 1WR2A 5KX5F 4HQ6A 2YS7A 3OUZA 3WNZA 1ULZA 1DV1A 2R82A 3GLKA 3R9RA 2NUAB 4O7NA 4MV1A 4YBZB 2NU8B 2DZDA 1EUCB 5C8YF 1AUVA 1DIKA 3TIIA 2R84A 3VPDA 5CAEB 4O7VA 2W6PA 4IHJF 4EA8A 3BSWA 1B6SA 4M99A 3WO0A 2GQSA 3RFCA 2R7KA 4EGQA 5BPFA 1W93A 2PN1A 2W6QA 4QSHA 4M98A 3G8DA 3AW8A 2ZDQA 1I7NA 4O2AF 4O82A 1KUTA 5DMXA 1PX2A 4IZOA 3BSSA 1OBDA 3MWEA 5EZYF 4EAAA 4O83A 3U9SA 1CQJB 3I12A 2GPSA 3GIDA 4IIJF 4O7YA 4MA5A 1VBHA 1Z2OX 4EABA 5JQWA 3AX6A 1Z2PX 4FFOA 2NU6B 1KJQA 1AUXA 3K5HA 2SCUB 4YAJB 4O7TA 5JVLA 4FFNA 4C5CA 4O4JF 2DWCA 3LWBA 5JQGF 2YS6A 3JRWA 3R23A 2W6NA 2DLNA 5J2UF 2XCLA 1C3OA 3ETHA 4ZQIA 1A9XA 3ORQA 2CNVA 4E4TA 3KAJA 1E4EB 4EA7A 5FNVF 1KBLA 3TQTA 2W6MA 2W6ZA 3G8CA 3KREA 3DF7A 3VOTA 3E5NA 1A48A 2YL2A 3WO1A 5LP6F 1IOVA 5JVDF 1T36A 2V59A 3U54A 5LXTF 1KJ9A 4YJ3F 2GPWA 2R7LA 3VMMA 4FFLA 2W71A 5C1OA 4MV4A 2VPQA 3ORRA 3K3PA 4O4LF 3HB9A 2R87A 4MV8A 2OLSA 1GLVA 3RV4A 4I55F 4O7ZA 2I80A 3N8DA 4FE2A 3ETJA 4TV8F 3K5IA 4WD3A 2CNUA 3HO8A 2CNQA 1JKJB 3LP8A 2YRWA 2YWVA 1KC7A 2YYAA 4ZI7F 4ME6A 2YZNA 2FPPB 1PK8A 1VKZA 4WBNF 3R5FA 5CA1F 1KEEA 1BXRA 4O2BF 5I47A 2V5AA 4RZQA 3SE7A 3N6RA 5H80A 4O4HF 3BSYA 4TV9F 1GGOA 4HR7A 4IWYA 2YZLA 2QK4A 4MV7A 1KJIA 4O7WA 3KALA 2PBZA 2V58A 4L1KA 4FFPA 2VR1A 5J2TF 3MJFA 2Z02A 2PVPA 2VQDA 4GGMX 4O7RA 1UC9A 5LOVF 2W6OA 1JLLB 2FP4B 2R7MA 2ZDGA 1JDBB 2W70A 1EHIA 2YW2A 2FB9A 1JDEA 4Y8VB 4HNUA 5CB4F 4M9CA 5JH7F 2J9GA 4MV6A 1DV2A 4FGRA 4XYLB 3OUUA 1M0WA 4I4TF 4MAMA 2HJWA 4MV9A 4I50F 2FPIB 4O84A 5BPHA 4HNVA 1UC8A 4O7SA 1EZ1A 1GSAA 3VA7A 1C30A 3V4ZA 2NU7B 4EA9A 1GSOA 3RUPA 2I87A 2CQYA 4ZOLF 3MWDA 4NYEA 4XYMB 1EUDB 3U9TA 2GLTA 4XZ3B 4FFRA 4HNTA 3JZIA 1IOWA 2FPGB 4YB8B 5HV6A 2R85A 4C5AA 3QFFA 2DIKA 2NU9B 3VPCA 2HGSA 5C1PA 3TINA 1Z2NX 3BG5A 2R86A 1KJ8A 1W96A 4M9UA 4DIMA 5BMVF 2I8CA 2C00A 3RV3A 5CA0F 4EGJA 4ZHQF 4TUYF 2ZDHA 3R5XA 4DLKA
chains in the Genus database with same CATH superfamily
1HXHA 5FL7A 3EGWA 4FI3F 4JUBA 1W4RA 5AJTA 1VSVA 4ZCLA 4YXFA 3DTVA 4M0PA 2ZU0C 3W8NA 2ATLA 5J5VA 2R6FA 4QIWE 3N2NA 1A9YA 5CPBA 1GSHA 3TM4A 4CGZA 2JANA 1C0IA 4PG8A 2WSYB 4RA6B 2Z9CA 1M76A 2WUEA 3IUPA 3NUAA 5AI9A 2O8EA 1A97A 2IE8A 2Q4RA 1RWPA 1C9DB 1MO6A 3E82A 1R5OA 4U0JA 2Z98A 4LVUA 2PSJA 4B40A 5EIOA 2ANCA 4KQWA 2ODWA 4J3FA 3WZMA 2WNSA 5DTIA 4MRPA 2O8BA 4JI5H 3PQCA 2G80A 4N9QA 2FW0A 10MHA 1UP7A 5C34B 1ZH2A 521PA 5ER9A 1S7CA 2VZEA 2OFFA 3UC5A 5F64A 2IUEA 5H68A 3PEEA 2ZRGA 3CONA 1YHYA 3HCAA 5F7JA 4NK4A 3KXDA 3U3XA 5H4GA 1MAUA 1JYEA 1GLNA 3G6YA 4S0XA 3OG9A 2LD4A 3GJZA 2Y2UA 4UTZA 1ELOA 3OHSX 2C54A 2P6RA 5J2UA 3K0CA 5KWVA 4O5AA 1JIHA 2F9LA 1F6WA 2HUPA 3BWBA 3CZPA 1KEKA 2QRQA 1AK9A 1TUBA 4WLUA 5ALVA 4LIPD 1XDDA 2IPAB 1Z4LA 1IBRA 1W49A 3RVKA 3WIDA 3CM0A 4RKRA 3E7XA 1ZJJA 4PTYA 3RJZA 1YBHA 5CDUA 2QYSA 6REQA 2XBLA 1U2ZA 1Z13A 2IZ7A 3T9FA 3PG5A 2PUVA 4FGKA 5LVAA 1VJTA 4RPHA 3T3OA 1S9HA 3CUUA 4PQRA 2ECQA 2WF8A 1GTSA 1X7HA 4UNPA 4L3WA 2OTCA 4RL4A 3ED5A 4L50A 1DWPA 4O2AB 4EITA 2GPTA 2B99A 4TT3D 1U7OA 5K0ZA 1BCRA 1Z68A 1YRHA 3DYBA 5AW9A 2A3RA 3H9QA 2GJAA 1V45E 3ZVNA 3VGPA 3G5LA 5ALQA 3AFOA 1L5NA 1NW5A 2V5AA 1JFLA 5T8KC 3C1UA 2E1RA 1B41A 4ED9A 1P3Y1 3AUFA 3K35A 2QPTA 4RORA 4O7WA 1I2KA 4KL8S 1Z36A 4YR3A 4JV2A 3L92A 3IAHA 4DLRA 3DKKA 1RAIA 4NAHA 3QY0A 2XQIA 4Z0PA 4ASUA 1BG6A 4K0RA 4CTMA 4JLDA 3A26A 1NQTA 1SQFA 1U6KA 4J16A 3H3FA 4L9WA 4TS3A 4AYBA 2H4YA 4BVKA 2HF2A 3SFZA 1P31A 2VNIA 4B4UA 3G68A 2IX3A 1F06A 1ZN8A 3CX7A 5JY1A 4IINA 1MVOA 1ZVJA 3V4ZA 1U0FA 2Y93A 1NR7A 1FVHA 2Y1LA 3LW7A 1GRCA 4RPIA 3MWDA 1FTQA 1U3GA 5B1SA 1WCV1 2E21A 1QHFA 1PF7E 4Y1RA 3PB3A 4FW9A 2XIJA 2YINC 3G0DA 3ZS8A 4C5AA 5FAKA 3VO2A 4RHFA 4BVJA 3WHPA 1FMJA 1CP2A 2XRZA 2HKIA 4JUAA 2B83A 3AP2A 2GMWA 2AKEA 4HLDA 4ZXFA 1ZGAA 2AK2A 2PPLA 4IJMA 2QVYX 4LMBA 3B36A 2QN3A 1O08A 1KKMA 3ETLA 1V96A 1QP8A 3AFGA 3C6BA 5A6SA 2AFHA 3ZHOA 3Q3HA 4PRKA 4BO1A 3V4SA 4FNOA 5KU7A 4YPFA 2GM5A 1G8AA 1IBKB 2HCJB 2GKSA 3FCOA 2EERA 1OU0A 1MRNA 2W0MA 2NADA 4J0KA 3D6VA 2EZTA 3H99A 1YGYA 2GNOA 4WLFA 3OX1A 2VHXA 2A5DA 1R4NA 3MSXA 3H17A 2B7LA 2NPOA 3L79A 1FXUA 5H81A 4WY8A 4EO7A 4AF7A 3KCNA 5BUCA 1Z8FA 4YJ3B 1OH7A 3SHTA 3CZ9A 1XQ6A 3SYNA 2EW2A 3IT1A 2RHHA 4Y1GA 3CRNA 2Z1MA 1M83A 3U60B 1GNVA 1XZQA 2ERYA 1EFDN 2YJ5A 1KWGA 1FRZA 1RZRA 1FUUA 3PW7A 2GEKA 4LYDA 2D5CA 2OY0A 4AURA 2AMJA 2G77B 2YNMC 2IUFA 1BKYA 5CLHA 4QASA 5BR8H 2L17A 3KWMA 4EZIA 5AK0A 1P44A 3RD5A 4DMLA 4N40A 1TRKA 1ZM4A 5J4HA 3VHLB 4WA7A 2GK3A 2X8JA 2O4UX 3T12A 4YHHH 4XB1A 4BB5A 2R6AA 1I3MA 2ZYAA 5KNBA 4CF6A 1C2TA 4JLUA 1MZPA 1GFWA 3JQGA 1NSFA 1GPKA 1FQKA 2Q9CA 3TFOA 3SSAA 1KI7A 3QKTA 3SS9X 2EF1A 1YSCA 5G41A 4ZEVA 4BATA 2XTNA 4E5DA 4A0SA 1GCOA 3FR7A 1KC1A 2P90A 2PZMA 2FSPA 2QSZA 4A5OA 4HH0A 5G02A 3MD0A 5DNDA 3MUOA 1XF9A 3KQTA 4PYLA 2JEYA 2FMFA 5DCWA 2CN1A 2ONYA 2EARA 3AKZA 3OZBA 2R6R1 1X8KA 3NH9A 3H1FA 2R7LA 1TA0A 3ZWVA 1KU0A 4JDPA 1TCAA 1IHPA 1L1RA 4DR5H 3NEAA 3Q0EA 3EMVA 5IYBG 1G5HA 1KWKA 3QXSA 1WSDA 1B93A 1E6EA 1ZBQA 4Q05A 1ZAKA 4LGCA 2QTMA 5E9JA 1SG0A 4G07A 4HZIA 1F38A 4C7VA 2ZP1A 4TM7A 4MPPA 2JJYA 1P5ZB 4X84A 1VC2A 4A2BA 4DCCA 1BVYF 5JSYA 2G63A 3QF4A 5H70A 3S2SA 1U6JA 2PS0A 2C4HA 1XNJA 4Z9FA 1RRVA 4FGWA 2BBOA 1RZVA 5DW3A 1C81A 5KFQA 4EPTA 3M81A 1YHNA 1W88A 4U7CA 4IJVA 1R8XA 3OOEA 4I4NA 2WNHA 4HNUA 4GPTA 2E1PA 5CX1A 1FDVA 3HV0A 4L51A 3SD7A 1GNLA 1L5VA 2A2ZA 3OM1A 3K53A 2A9KA 5DI3A 3FOAA 5LUBA 4PGAA 5CITA 4MOWA 1E9SA 2DFVA 1Y8CA 4AM8A 1NLFA 2VJLA 4XCQA 5B4UA 2P69A 3MPOA 1PBTA 2JFYA 3NRCA 2VYND 1E9BA 3E1KA 1EUDB 2VZ8A 1KJWA 1W0JA 2WTUA 1TM3E 2HJRA 5H3HA 1NASA 1PWEA 2ZSUA 3FYUB 1MOSA 1T36B 5LZ7A 2BY4A 1RJFA 2IBMA 3MS7A 1JHQA 4FLFA 4DTIA 2IWRA 1P7VA 1F7UA 1KFBB 5AWFC 3VZCA 1Q84A 3AKCA 2G5TA 5AVJA 4UMFA 1MH1A 1NI3A 2ZRFA 4UHDA 2NP7A 3DPIA 2V9CA 3MAGA 1UBOS 3FI9A 1KYWA 4EGJA 2XODA 1ZY2A 1SH7A 2QAIA 1Y4UA 2VDRB 3ZLVA 5LYJF 3GRVA 4CQLA 4R01A 2UAGA 4O86A 1KZHA 4E22A 3GUZA 1P2UA 5LZ4A 3M3PA 1ETUA 2XMQA 2FMIA 3OY7A 2RCYA 5JASA 1S3SA 5BO5A 3WC4A 3CZRA 2YZKA 4MIYA 1RIFA 1QP4A 3LULA 2X1VA 5D8DA 4XDGA 3C8HA 5TIIA 2OSBA 2H1HA 4HAWA 3HXLA 4Q3OA 2ZUEA 1FX0A 2VK2A 1H4TA 1I1KA 1EZ4A 1NBMD 1GTG1 4DCMA 3BMNA 5KTYA 4BJ1A 2C4NA 3VPGA 3ZD7A 3AFHA 1VL5A 3EZNA 4LNUA 4ZGWA 3TE7A 5FUMA 5HBRB 2H0AA 4LE0A 4NEQA 1TGVA 4XWAA 1CQWA 3MERA 4ZYXA 3T0IA 2GSDA 5EP4A 1X1AA 3MHPA 2BEJA 5JLAA 1P2SA 4LN1A 2H0QA 1TEHA 2YV5A 1XNQB 1RXUA 3JQCA 1ZFNA 4PG6A 3GV0A 4G8JA 1CKOA 4QGFA 4QDUA 3LDFA 1EM8B 3P8ZA 4D8VA 4ND8B 1LDYA 2X0KA 5A06A 1OXKB 2XA9A 5TGDA 4GVLA 1P2DA 1YQXA 1YRYE 4UM8B 3BMQB 4KXYA 3SSOA 3TZQA 3EEOA 5L3SA 1OBDA 4U7GA 3H2IA 2MINA 3FIJA 1ZIXA 3KKKA 4DHWA 2D74A 3RUFA 1J5XA 1TWFA 3IAAA 3IBYA 1ODIA 4NOKA 1BDBA 4NI5A 4PXSA 1DJQA 4Q48A 3WGUA 1UFOA 1Q14A 2F4NA 4ZIRB 3N6VA 1QHHA 3VU8A 4D26A 2RGGA 3NDIA 4BIIA 2JLVA 2CL0X 1ZQ9A 1V8OA 4RS4A 1NMQA 2FUCA 5CM9C 4LDPA 3RVNA 3KPJA 3MUEA 4JAVC 2P27A 4DPLA 3SP1A 1XCBA 4Z99A 2JJMA 4I1VA 3DMNA 1SBNE 3FNBA 1TTQB 4KNWA 5FWXB 1A5AB 3HCRA 3MBIA 1MO4A 1WCYA 1JLHA 3M1LA 3WMFA 4YBZA 4XASA 1YK0A 4CL3A 1B1CA 1K2WA 5KVQA 3CCFA 4D6YA 1UEIA 2NT4A 3O93A 3SXJA 4IICA 4RJLA 2ZTLA 1NYRA 1SVNA 4P6VF 2DC1A 1O5OA 3D2AA 2VK1A 5G0TA 1JPVA 2AX3A 4YRZA 2ZFUA 3H6HA 4PONA 2XTJA 5EUMA 3OETA 1ZVVA 2DEUA 5EZYB 1CZHA 1E63A 2H1VA 4OQMA 2R92A 1NXQA 3ENKA 2HSZA 4DGQA 1XBTA 3CUKA 4CCWA 3GLIE 5IH3A 2P1ZA 3DZCA 2QL5A 3VO1A 1PW5A 4LFBH 2GKGA 1AHPA 1E1DA 5DWQA 4OUKX 1PGQA 2BCGY 4FZRA 1JQLB 1NHGA 2FMAA 3VNQA 3RO7A 1CKNB 3VPSA 4EUNA 3KJNA 1SPBS 2VHJA 1V48A 4B3FX 5CIQA 1JA0A 3QKUA 2G9RA 5CLFA 1GZ6A 4I4TF 3LOPA 1M2EA 1VCNA 1VYHA 4TMTA 5E0OA 3T5KA 3REOA 2EJ2A 4LBWA 3LTEA 1TNDA 5HR5A 4BFYA 1YJ8A 4DCUA 2NUAA 1GUBA 4HGQA 4I1IA 4J9RA 4O4LB 8LDHA 4PZEA 4CKEB 5CTAA 4KBYA 2H9IA 4ZAGA 1UZNA 1HDXA 5HBGA 4XUCA 4NPAA 2AV6A 1AK2A 4ZI7B 2JJ1D 3I9MA 4RGQA 2UZAA 2AZDA 1FYFA 2IEZA 4AQYB 5I7SA 1V7CA 1Z56C 4DLYA 5BUZA 1IZ0A 4OM8A 5A04A 2X0FA 1JJBA 1QTIA 2HJGA 1HNWB 4TVSA 2PJUA 2WIGA 4GO1A 4PZUA 5FPTA 3H8SA 5EC8A 1V9CA 1V7PC 4C3UA 2I7TA 2VF5X 1RYEA 1DTWA 1I30A 3DS8A 1X80A 4CLEA 1XL1A 3DO8A 3BGVA 4DIFA 4DGSA 4E46A 3M6IA 4O8CA 2H0RA 1TEVA 3K9QO 2VSQA 2QTHA 2VEDA 3V8RA 5IM4A 1QR2A 4PG4A 3DXXA 3O8RA 2QQGA 2O1EA 4AECA 4MA0A 4MKIA 2LDXA 1JZQA 4JH0A 3GQBB 1ULUA 4O63O 3VU9B 4RACA 1GPYA 2J0SA 2YS7A 5I3ZA 3Q8SB 5ERYA 3LBIA 3LLUA 4YRCA 4G0MA 1KZYC 3V6HA 1W2WB 3UUWA 4KHZA 4U2KA 3ZDEA 4J1TC 3N2YA 5B3LA 1UBSB 3FR8A 3I4NG 3ZXYA 4O4HB 1ZOOA 5FTLA 2XUGA 2CMKA 4BMYA 1JECA 4UDNA 1B26A 4NTZA 3ZHRA 1UMCA 1U65A 4ZVUA 1IOZA 1ILWA 1K4YA 3QXCA 2COGA 3N2KA 2J4FA 3DMPA 4UQPA 1RQXA 4ED8A 3JW8A 2FLVA 3LSYA 3BH7A 2HXSA 2EW8A 2OD9A 4QELA 3D8NA 4L5YA 5F77A 4ZAZA 3RI3A 3BULA 2PL5A 3PDCA 2WSBA 4UNSA 4D3XA 1I80A 4XYLA 4IYRA 5F1PA 2Q62A 2O0HA 3KS9A 4O4JF 4NU5A 1A82A 5KINB 1XMXA 4BNHA 3LWBA 4PAGA 4H18A 1SU7A 1XU9A 5HCNA 5EE0A 5BNZA 3WQHA 2GVNA 2RC5A 4ZO8A 4CQMA 5JRZA 3Q3EA 5HK9A 2WU0A 1CNFA 3TIXB 3GMIA 4Q7MB 3D4BA 3NX4A 1M33A 3BJYA 1GKUB 3R7LA 3A9SA 3KKQA 4HNSA 4FYHA 2OXRA 3ANYB 5H3LA 3G89A 3WKDA 2YMLA 3QXXA 4KSYA 3JQAD 3K5IA 1MTZA 1JKJB 1Z6GA 3LBHA 5K09A 5L45A 1CULC 3LYLA 3ACBA 1TT5A 3RBEA 3OWHA 2R4QA 2K7ZA 4YNBA 3R5FA 3DC7A 3F4BA 3AESA 1MP0A 2Q8PA 4L8LA 3PC8A 1PEAA 3SJCA 2YV2A 2DLCX 2K5UA 1E7WA 2VT2A 5I5YA 1OVGA 2GO1A 6ADHA 1QNLA 3SG0A 3WQSB 3AW9A 1U1GA 3LP6A 2REXB 1VG0B 1DQPA 1OAOA 2Y0SE 3SS8A 3BB4A 4ZK2A 3UPTA 1I6UA 4WAUA 5CBKA 2HBZA 2ZI9A 4HSGA 2CL5A 4ZU1X 1CZKA 4MV0A 1J5PA 1JBKA 4MEJA 2O2EA 2XMCA 3AM5A 4Z2YA 3PNBA 1P80A 1MO5A 4L22A 5KYWB 2C7RA 1G3RA 4AZ0B 3ICOA 3H5NA 3LYAA 2GHIA 2YXLA 1NPDA 4OGLA 4CF3A 2PTGA 1E9FA 1JFFA 4D41A 5LQAA 2OPHA 2WIFA 1VPTA 3AETA 3EEBA 1HL7A 2Q4BA 5IBPA 2JLCA 3H97A 3T7EA 5L1KA 3ORYA 4LNHA 5D5QA 4UHBA 1U0RA 3G9XA 2G0TA 4TV9B 4PO8A 1CEYA 5DF1A 4IX9A 1JQ5A 3OSUA 2XNDA 4EECA 4P86A 4M38A 2HYDA 2DKOA 4EUHA 1XDZA 4AJIA 3IOEA 3T1YB 2E48A 5E7MA 4KNVA 2X0RA 1JG6A 2C57A 3FXAA 1KORA 4OL0A 3TLMA 3DQPA 1GZ7A 5JCJA 2EFGA 2SKEA 5EXXA 2FP4A 5JH7B 3RJ0A 3L6BA 2PMCA 1R18A 3TRJA 5IASA 4U2DA 3R5HA 3D6JA 4TSFD 3I01A 3HB0A 4ARIA 1VCMA 3IDSA 4HDNB 3WGHA 4R6WA 2GESA 4CPDA 3EPIA 5AP9A 2VLBA 3UHFA 5HRCA 4KLZA 3CT6A 1M6VA 5CH8A 3QSYA 3AR2A 4Q43A 4J9NA 1YRLA 4D43A 3BCUA 2Q5QA 4HQOA 4E12A 4BJ6A 4C01A 5EE5B 1AKWA 1R2QA 4NONA 1MOZA 4LMYA 3UMJA 2I62A 3OFSA 3ONFA 3H2GA 3RF7A 3A4NA 3OUZA 2UXDH 3HXPA 5CVEA 4F4CA 3H42B 1PNVA 2CB9A 3EGVA 1HO3A 3FFBA 3N5CA 2XMSA 5E6SB 4Z0HO 1C0PA 4NCXA 1T9KA 3STUA 1N2IA 2I65A 2IVFA 3PF8A 2OMEA 4ZHQB 1TWHA 3BRQA 5H02A 4F50A 1XR3A 3CUEF 1XZKA 4DZTA 3NOXA 5BPFA 4U1RA 1JR3E 5AM0A 1YKGA 4N76A 4YJDA 2I91A 1RBZA 3CX3A 1ZIDA 2H48A 2P9JA 3T41A 3PDUA 2V7BA 2YDXA 4UUMA 3ZCPA 1S0MA 5LL6b 3DE5X 1IULA 1MU0A 1RAHA 1HEIA 2XUKA 1C1DA 4JI3H 4GPD1 4M9XA 4Z51A 1EAMA 1JHZA 2UKDA 4M1OA 1OGJA 1S9DA 4QTZA 2WQZA 1IJFA 5DO9A 3O26A 1UBFA 3TKYA 4HDKB 5ER6A 5JQGF 4ED1A 1NXVA 3F2IA 3DDOA 3M1IA 2AG8A 3QPWA 2EBHX 2W2QA 2OECA 4JA2A 3TLAA 2GJ8A 2WIJA 5JANA 4QJFA 1A9XA 4UCWA 4LDRA 3RT1A 2QD2A 3LLVA 4IG9A 3OLYA 3HL4A 5T6BA 2ZLBA 1BJRE 1KSHA 3EGXA 2I7DA 2QAGA 2F1JA 1LF0A 1EGQA 1PQUA 3MF4A 1C1HA 1CCWA 4QJ5A 4JK3A 4MB0A 3ADDA 2J30A 1K9SA 4DLUA 4CI9A 2R6HA 4Q1DA 3HB7A 3PHBE 2GM3A 4NQRA 1CR4A 1KDYA 2BE9A 2IU6A 3DDNA 4B2YA 2RH4A 4BEVA 3T5CA 2X77A 4ECYA 3G6VA 1CQZA 2B21A 1Y1VA 3C7TA 2OHOA 4YV2A 2WVGA 2RGVA 3RFUA 2B8WA 4ABTA 5A9SA 1HE4A 4D0SA 2VRBA 4FDLA 5ALXA 4JYCA 3FPFA 2O5CA 1V35A 4C1BA 2QENA 3L0BA 1NZJA 2IHYA 3U4GA 1XJWA 2ZBVA 1TQ8A 3MMPA 3O8LA 2IW3A 3BREA 1E3TA 3GN2A 2AOUB 1JEYB 5A02A 1OKKD 2Q2TA 2BUBA 4QA9A 1SUSA 3OLCX 4G1CA 1JDJA 4DW8A 1LZLA 1QP0A 2AGOA 2WPDA 5KDOA 5B7PA 1X94A 3IQDB 2BQRA 4CMBA 1QAMA 2XMRA 1M2NA 4AKEA 3RPEA 5I45A 3H40A 2RHRA 4Q4HA 3ZEAA 1A0IA 3QELA 5EMMA 1TMGE 3BGDA 5EMLA 1REQA 2GZ1A 3CT4A 1P2BA 5DULA 3C3AA 3E0QA 2L0XA 4BB6A 4WFKA 2J5KA 5T4EA 2G7MC 2VKTA 4EHBA 1OILA 5J43A 4PQFA 3MK31 3V8PA 4YAIA 1JTFA 4XSHA 5KWEA 4JELA 1CJUC 3GRAA 5HIMA 1GGFA 5BVGB 1CUVA 4BLPA 4I4IA 4UCVA 1EFLA 4MR9A 4G1VA 1YCGA 1M10A 3N9IA 1GV1A 5KFJA 3IVRA 2WT9A 221PA 3LLSA 1LFAA 4FD2A 4Y18A 4YX9A 3OTIA 2ZBFA 5JEEA 4UNQA 5KMGB 4IZIA 1H2YA 3HKZE 4O3RA 1QVZA 5AJWA 2J0UA 2I55A 1GPJA 3PGJA 1GLGA 4ZI3A 2W48A 4B34A 1RLOA 2OFWA 4P4SA 3LA8A 4ER7A 4JC8A 1JMYA 2NAPA 4JI6B 2JFFA 2R8HA 2QUZA 2J46A 1XZHA 4P80A 1XMPA 3SBXA 2XX3A 4ZYYA 2C9YA 3DJYA 4RV5A 5DLYA 3EXEB 3IPAA 3ZZNA 1Z5GA 2YWDA 4ZOLB 4CM5A 4RC9A 5HTOA 1JVSA 2VTEA 3N2LA 2NWQA 3UAXA 3KSAC 3GYBA 2EBWA 2QRVA 4UUPA 4GMDA 4OQLA 2X9GA 4XCVA 1NT4A 1SU6A 2PJZA 3K9HA 4EEKA 3LECA 2AVNA 4HS4A 3SZUA 4ND4A 5SY9A 2WMDA 3AY3A 2GAJA 1Y9JA 3I61A 2E55A 3EDYA 1KO5A 3KXKA 1DXYA 4FOLA 3V7WA 1GG2A 2P2YA 4YP0A 2W22A 3HY3A 1JXAA 1UDWA 2WU3A 4NYJQ 5TX7A 2YWEA 2HY7A 2RHWA 5DMXA 2FF7A 2D5LA 2PH7A 4B1FA 2CMGA 4RTNA 3VNBA 4JLOA 1H4VB 3KD2A 2X40A 4JKYA 4DSZA 5J4LA 4W9MC 3IUMA 1SXJB 5BWTA 4O3QA 4LFCB 2BTQB 4DSNA 1GL3A 1VJ1A 1EK0A 3FBGA 3STTA 3G2QA 3V33A 4OOEA 2CMFA 2QL9A 3IKTA 4UU1A 3T1OA 4CN9A 5CHYA 1X87A 1ST2A 3SZRA 2ORVA 2ATIA 4X62B 4F21A 4QT0A 3I52A 4I55A 5F7OA 2F55A 3R7BA 2DETA 4HEHA 5EOYA 2OORA 3Q8RB 2ODPA 1JE0A 9ABPA 3FWZA 4HUQB 3MA0A 4QXQA 2X86A 4HGNA 4EWLA 4KV9A 4N5IX 1WB4A 2C04A 1T4CA 4QDJA 5HCUA 2RC6A 3L7NA 3GP3A 2GCNA 3FCAA 5AOAA 4YAKA 1FDOA 2QRNA 1R6BX 4X64H 4OHFA 2IV2X 4RWZA 4MR7B 2BFEA 3ROXA 3IFSA 3CPSA 3H7AA 4H16A 2X0IA 3CWCA 3T7KA 2QHXA 2VK8A 4S1PA 5BSEA 3JWGA 3I1FA 2QK4A 4D97A 4PZZA 2BGRA 1NYTA 2JGDA 1P19A 1SCUA 4B3IA 3F6SA 4WJKB 3H5AA 2BGWA 3MR6A 2W4IA 3IR6A 1MFZA 3FW1A 3NR2A 3ZQJA 3M4YA 1M2KA 3K30A 1TT7A 3WWOA 5D3KA 1IEXA 4OIMA 2Q07A 1QV7A 2PMBA 2GFHA 2ZUWA 1F8FA 4TVKA 3LHKA 3U39A 3NASA 3T35A 2AI2A 3GJ3A 2P35A 1GZHB 1JHVA 4W5NA 1JTEA 2B20A 1V8ZA 2P11A 3RUEA 5JMPA 3W9BA 4FTWA 2V4MA 3WKEA 3L02A 2ZB3A 4JI4H 2NN3C 4X71A 4BGIA 2ACEA 3DVAA 1H2EA 2DUJA 2BHTA 3N2ZB 2G9NA 2PXXA 2EJTA 2PSHA 3AL3A 1QO9A 2QGFA 2J07A 5B6IA 1D2AA 1T2FA 2E85A 1XYYA 3KETA 3T34A 3WJ2A 4GMFA 2GN0A 1NBEA 1E5QA 2UUAB 3FGOA 3LY9A 5HPYB 1LNSA 2WU8A 4GI7A 1M34A 4XDHA 3HH8A 3AV3A 4BUZA 2Z95A 1M1ZA 4XSVA 1Z4KA 1W59A 1E1QA 3MJTA 3DJFA 3FKSD 5GONF 1FRVA 1LI7A 5D85A 2DOKA 1R9GA 4G5GA 4Z7OB 2NZWA 3PSAA 1ZAYA 1D2MA 1C8LA 2FEMA 2NVOA 3NHAA 3OJFA 1BFKA 2ZREA 4H3VA 4H6XA 1SUIA 3BC1A 4YT5A 3COSA 4M7WA 3D64A 2R66A 2AJBA 1YR6A 2VHZA 3PNOA 5EWMB 3K8QA 3ODPA 1JSZA 2QDKA 3KZVA 1G42A 1XB2A 2J33A 4BE7B 3M6MD 2WKSA 3OEEA 1BW9A 5AFSA 2A94A 2CXUA 3WYCA 2ZYSA 3P1JA 1H65A 3F6RA 3G6WA 3PCXA 4LKOA 4I4CA 3OU7A 2UZ3A 3L4BC 4GRDA 2ETXA 4W5JA 4Q18A 1SUAA 2M32A 1OU4A 2GRJA 3OOYA 3AG5A 3HP7A 4GXNA 3OQBA 5C8DA 1QDLB 1DC3A 2ROQA 4OHXA 4R1NA 1T2CA 2JA5G 3ONNA 2IY7A 2FTKE 1GGNA 5LDGA 2D1FA 5TB5A 3LQFA 2JPDA 3IR5A 4B6PA 3OPQA 2C96A 3R77A 4K8RB 4ONEA 4Y6PA 5IKEA 1W87A 4ZT6A 3ZHZA 2V45A 1YE5A 2VAPA 1EWVA 1G9TA 3RSSA 1Z6XA 4BRWA 2C4MA 2O3QA 2WQ6A 2HBYA 1BGWA 2IYFA 4BCDA 5JC1A 1ZHQA 4JVNA 4NEGA 4WGFA 2ZM6B 2QRZA 3ANTA 1SCBA 2WWXA 3FG9A 2YASA 2Z56A 3OFNA 3B3JA 4REOA 3GJRA 4N0DA 2ZSHA 2IYYA 2EP7A 2JAHA 2REBA 3DLTA 4IKOA 1QTNA 4AW9A 4KVGA 1JAXA 4OI1A 3RCBA 4F38A 3UKDA 1A9QA 5AVWA 1TCUA 1AN0A 1QM5A 1QG4A 5ALFA 4FMCF 3W1VA 3GRYA 4ALIA 2WD7B 1PJSA 3UAVA 4FILA 4FM9A 3HDJA 2GILA 3VR2A 2HNKA 3A9VA 3QKIA 3JQEA 1SG6A 4PYJA 1YH3A 1QCCA 4B3MH 4ED0A 4OHVA 3K9WA 1UT5A 3IJRA 5DCUA 4D4HA 4PV7A 4R9SA 5KJCA 4R05A 1X42A 2VP4A 2CHEA 4AXBA 1YASA 1K7SN 2HCFA 5L1JA 1TO1E 4GBGA 1HR0B 3OHMA 4M7EA 1FYEA 1WG8A 4IDNA 3ITDA 3ZWDA 3G02A 3VA7A 1VLVA 1A8PA 3EWIA 3AL0C 4EVQA 3AKDA 3IOMA 4EQZA 5FR1A 4BC0A 1M7HA 2JBAB 3BN3A 2I87A 3RUIA 1YS1X 4O29A 4B71A 5DLEA 2WFZA 2VCEA 2WUGA 4QU9A 3FVRA 1GG5A 1HRDA 1U1CA 4EG3A 3KKPA 3KVRA 4GXRA 5T5QA 4CTOA 1EFRA 4UC0A 5IARA 4OJTA 5FEUA 2ASDA 3ZH9B 1QYDA 4XLZA 4CDGA 1FF9A 2WSLA 3LA6A 4TUYF 3A9WA 5GQSA 3WJ1A 4OYYA 5KG0A 3U4QB 4E94A 1YI8A 3OJWA 1KJJA 1QRTA 4HB0A 1VBGA 3OBBA 5LJLA 4URUR 1ETHA 3IMFA 4OMCA 1MABB 3HI4A 2HTFA 4UEJA 2IP1A 2RI0A 1GEGA 3UJHA 3DBHA 3RBXA 4XYBA 4J7CA 5CG2A 2YR0A 2C4TA 1Q7GA 1E4EA 3RC2A 3MS4A 1GJRA 3SI8A 1EX6A 2UZIR 4US0R 4O5OA 4KQKA 1BKSB 3ACCA 3FVWA 4UPVA 5JAHA 4URVR 1N6RA 3TW6A 2PR2A 5HTKA 5IZ4A 2WINI 1N1DA 4FU0A 4BVGA 1XA4A 4J16C 2ERXA 4XIIA 5E8RA 4RK0A 1EUYA 2HMAA 1JXQA 2IPOA 1OI3A 1K68A 4A26A 3KBBA 4O3NA 3KSDO 4MV1A 1PP4A 4JB3A 1FP4A 2VC2B 1Q3TA 3PQ4A 2QZPA 3THRA 1T1IA 4PNPA 2H29A 4MQEB 5AKHA 2JLAA 3K70C 4GOOD 4HVAA 5C35A 1ZN2A 3IJ5A 3GNTA 3A3NA 3TUZC 4CVNA 5B2EA 3Q4GA 5FOWA 2O0KA 5G3ZA 3X1KA 5LLSA 4O83A 3RYIB 3FDZB 4DLWA 5EP1A 4CFYA 3EASA 3OQJA 5CFZA 3GH1A 1MHTA 4HGPA 2VAVA 1Y4AE 5TVKA 2D2FA 2RGDA 1NMYA 1PL0A 1PCXA 1YZNA 1XDBA 1RCUA 4DV6H 1ZK0A 2WIKA 5KFHA 5C44G 4E5KA 5THXA 2H4XA 4AD8A 1G4UR 3L6RA 3PLRA 3ROZA 1FP6A 2EIXA 4RULA 4XJVA 1VYVA 4RTKA 4E32A 1LPPA 2UZ0A 2VSYA 1AXGA 3LDAA 1YVRA 1EKPA 3AHDA 3PNYA 4DCNA 2NV2B 1GO2A 3VR6D 1OFGA 2P2CA 5BN4B 5KREA 3EA0A 5AKGA 2ZRDA 1GVNB 2FJUA 5KTSA 4MZXA 4TWZA 2UVPA 1GKIA 4M0MA 4L15A 4WK6A 4DR6H 4P83A 3COWA 5FWDA 3HJHA 2QXYA 2DFKB 4BEWA 4V0KA 1MX3A 3IJEB 3GOHA 5I4CA 3AF2A 5CURA 5KFPA 1DEAA 5REQB 4YAGA 3SE7A 1P9RA 5JYDA 5DQIA 2PT9A 3GHYA 2IEBA 1GN8A 2PBZA 2R44A 3IPCA 1T8WA 4MV5A 3H65A 5IAEA 3UYKA 4II3A 3RSQA 4ECQA 5MHTA 4R5HA 4L0MA 5IJAA 3O2QB 4PIPA 4CMKA 1EEXB 1KS9A 3KAPA 2WWVD 2QNRA 3URKA 3QBEA 1DV2A 3A2KA 3FLAA 3ENNA 3V7FA 3R2JA 2XUPA 4W5OA 3GP8A 5LZ9A 3WB9A 4CG1A 1O7JA 4AJOA 4UTNA 5JUWA 3SLGA 1Z06A 3ZCQA 4CKCA 2QVCA 1KI4A 3KT6A 1V5FA 2ZIVB 2RMKA 3I01M 1TJYA 4YACA 3WNVA 3ZDYB 1X1QA 4NC9A 2JLZA 3DEKA 1GTL1 2VHWA 1QC5B 1XT6A 2CLHB 4TLLB 3NC0C 2WE7A 3EA5A 5J59A 4XAQA 2F3RA 1LVUA 4HATA 3QVUA 3KQHA 3MTDA 5EWJA 3FPKA 4FCVA 2XKKA 3IAXA 4JJ6A 5EKTA 4F96A 2XVXA 1AE1A 3VMFA 5CB4A 5E1BA 6NULA 2MHCA 1VKNA 3AMVA 3EIOA 4QDOA 2DKNA 1HM5A 2HA7A 2PBLA 4F2DA 4BN5A 1IDOA 5JBIA 3TSAA 3R7FA 5FBHA 1QPBA 3BF7A 2K6GA 1LRKA 5AXAA 3VR5A 4Z86A 4W7HA 5FFMA 4D0RA 3GW8A 1BS2A 1E0KA 2R6CA 1KYQA 2SKCA 1E79A 5IK2D 5GINE 2EZ4A 2WK1A 4ZCTA 3U2QA 4FFMA 1I6WA 3U4IA 1U3UA 3OKCA 2C8KA 2EKPA 4DAAA 1TXGA 3FE2A 1SXJE 1LW7A 4GU5A 4N0PA 4D82A 2WG1A 3DCJA 4Y2TA 3WNBA 4QG7A 3TCNA 4OXRA 2NYRA 1Q0ZA 2UUCH 3HA3A 1L5OA 1DB3A 4GC5A 3EIHA 3FETA 2Z83A 1DIGA 1JNYA 2PCJA 1EDBA 4A93G 1W48A 4NJEB 4LF5H 5CNMA 3USCS 1QHYA 4CU2A 3NV7A 5CMLA 2YJ4A 3CQ9A 4OQYA 2LCQA 4CGYA 1K3UB 2KB0A 2OV2A 2VDVE 1YZLA 5GPBA 1YC5A 4QSHA 1W35A 5AT1A 3STHA 4JBHA 3TGPA 1QIGA 3JYQA 4F06A 1IVYA 4HD8A 1XMVA 4PO1A 1E94E 1JLSA 4M87A 2QE6A 3NOOA 4QUBA 1VZ2A 4XUGB 4BVLA 1L7XA 3ONDA 3EYAA 2H3HA 3ITKA 4QRIA 5K0TA 1SVMA 1XTJA 3DZIA 3H1AA 1C8VB 5A5GA 1X1DA 4KDEA 3L7YA 1FKAH 1CIJA 1MB9A 4B9EA 4D9NA 1RWXA 3SEFA 4DSOA 5G0SA 1PFQA 2JFVA 2PL3A 3L8HA 2PVCA 5DVZA 4Z9XA 1H0SA 1TIBA 1RYRA 4F3CA 2EJ0A 1A2KC 3P9KA 3NPAA 3N59A 1WMDA 1U28C 1H4QA 1IOVA 2V59A 1NF9A 1IN7A 2AH5A 4RENA 3UJAA 3QUCA 4TL6A 1AKNA 2YYYA 2ZPUA 2DH6A 2ZJYA 4Y9TA 3RJTA 3PDJA 3U4HA 4CKYA 1ABEA 3PITA 4JB0A 3QJ5A 3LCRA 4KGVA 3OJLA 4HAZA 4J2HA 2JLQA 4K81B 2FX2A 3HFSA 3MINB 3QWIA 5ENVA 2B2NA 3BSYA 3NAZA 4FGLA 2W83A 1VGRA 1JZTA 4TKVB 5CFRA 3RDPA 4RU1A 3IVXA 3G2NA 5CNJA 5ALPA 3TBHA 4Z8XA 3E3AA 3OZSA 1WV0A 3AUTA 4C4AA 5I7WA 5EIBD 4N5DA 5KFAA 1JVBA 4RGYA 4EGSA 3HDYA 2X6TA 3PJRA 4TKUB 3LQ1A 3CY6A 4WZBB 1L5SA 3NHSA 2OGTA 1X14A 3IBGA 1BMTA 2H2DA 5C0OE 1FRNA 4KE9A 1UAGA 1CUAA 4YR7A 2JA6G 5JO0A 5DN9A 1C30A 1NW8A 3WRVA 5CXQA 3AOEA 5B6JA 1NW4A 3SF0A 3DA8A 3OTQA 3ZWPA 3RTGA 2C95A 3COVA 3BTVA 5FUVA 4RA9A 1WW3A 1VZ3A 3R0XA 2XJ4A 4M1YA 5D5HA 3RU7A 3FLEA 1PFKA 3CRMA 1CQJA 2QTBA 3NONA 3NT5A 3DOIA 3MMZA 3D4IA 4KTVE 1I4LD 3Q6NA 2ZXEA 2ZM5A 2GQRA 3CC8A 4KIGA 5DOZA 1IEVA 4E11A 3WLIA 2XCSB 4OGWA 3VC1A 1M5RA 2D1SA 4XD2A 4JT2A 1R0YA 2QT9A 3BX1A 7GPBA 3L8FA 3P0RA 1VI6A 3P9YA 4TVIA 4GC6A 1ISMA 1E77A 3I8XA 5DHTA 1YQ9A 1R16A 4XVHA 2NLOA 1X1SA 1E9RA 2QM0A 4BWGA 3RGXA 2BM8A 3HJRA 1RKBA 3HI6A 1BH2A 5GTDA 2BR5A 2G6BA 4AJNA 3M9OB 2XDQA 1P9WA 1M0SA 3SOPA 1WCMA 2IYTA 3FUTA 2BELA 2BR4A 1Q50A 4HNHA 4BAZA 3VR6H 4HVCA 3UMVA 4DARA 4IRMA 3N28A 3GJQA 1NAHA 4DV4H 4ND2A 4Q7JB 2GHRA 3UWDA 3THYB 5DYNA 5F9FA 1K08A 3GA7A 5BVHB 2IKQA 1DX4A 4Q4DA 3QUSA 5LD2B 2AN4A 4H1WA 1UH5A 2DHCA 5BN3A 5IDWA 3AINA 3CVJA 4N3CA 1MDBA 5DNVA 3EFOB 4BXXG 3FHTA 5K03A 1M8GA 5CHEA 1EG2A 2PX2A 4Q19A 1Y4SA 1TAEA 2C2OA 3ZXUB 3T3IA 1GPDG 3GJSA 1HT0A 4ABYA 1D4AA 1AKRA 4I4TB 3E4DA 4EYEA 3ND6A 3QZ7A 2NYUA 4A92A 2IYSA 4QBGB 3AWIA 1BJKA 5FNVA 1GDDA 2AG0A 3K32A 3QXJA 4PHHA 4BTEA 2QRLA 2BFCB 3H0GG 2D54A 1ZGGA 4DDHA 3S3TA 1PDWA 2IVZA 3PR4A 5JCOA 5D7NA 1ZUWA 4JB2A 3NFRA 2UVRA 1GO3E 1OLXB 5HZKA 4WN9A 1OXSC 3R6LA 2NO4A 3ICQB 4MWOA 2FFRA 3BPSA 3M8KA 5C32A 3IP3A 3C8MA 1F2UA 1NYQA 1UXOA 4HEJA 4G0OA 2R68A 4JA0A 3RS4A 5KC8A 1YBAA 2XH8A 1ZNQO 5FI3A 2A92A 1XTBA 4NNJA 5A7FA 2VQFH 3Q3JB 4I9NA 4U7HA 4L5AA 1PJ8A 1RLMA 4JYPA 1IM5A 5KOJB 1QS0A 4DADA 1WVMA 2YHBA 3KB8A 4AROA 1SCAA 4M54A 3JD4A 3UPDA 2Q1UA 2OHHA 4NCHA 2H5LA 4HVLA 3TUJC 3OCCA 4DT1B 1NP3A 4S1OA 3TL6A 3W1GA 4LZOA 1GEEA 2ASJA 3O9MA 3U5TA 1X8LA 3OJOA 3A3PA 2OV6A 4IPTA 1H9CA 4YRRA 2HL6A 2OB1A 3TF5A 1DUIA 4RMJA 5I7EA 3GL9A 4RV9A 1ZN9A 1ZOIA 4AY5A 4ZQGA 2YWCA 2X4DA 1V71A 3C15C 1NQXA 2QYHA 1D1SA 4O84A 4PSUA 1E6LA 2V4UA 2G5GX 3VTZA 5IVPA 2QVZX 3AHGA 2P2LA 2VLIA 2ZPTX 3ASVA 3CZAA 3QRWA 2PWZA 5IN4A 4XPIA 4GT1A 4BZQA 4RYLA 4EPXA 3Q0TA 2DABA 1F2TB 3PWKA 1S01A 1AU9A 1ZH6A 4J9OA 1MB4A 1A8UA 1YONA 4B45A 4K6GA 4YXWA 2GLTA 2UZ1B 4XZ3B 4R4JA 5JNSA 1Z6TA 2CNLA 4OSEA 2B3TA 1B14A 1LNQA 1JSLA 2J3EA 3PNMA 4FFSA 5FXMA 3FMVA 1V1MA 4P0QB 4P3YA 4NAVA 2PU5A 4QLBA 3QTTA 2R1UA 3EAGA 1FSSA 4EY3A 1FTYA 3I39X 4PZ7A 3N87A 3OZWA 1Y8RA 1J2UA 5ALDA 3LPLA 3AIOA 5KCZA 4BVBA 2ID4A 5FB3A 3HGMA 4FJ2A 2Y1EA 4ESOA 5FLXA 3C70A 1VXOA 1SUFA 4YP6A 2Q6OA 2QRUA 4BFTA 3HBMA 1X7ZB 2XI4A 3L84A 1X0VA 2XXBA 4A0QA 2VDWB 3IP1A 1ODKA 1H8HD 3PC8C 4UHFA 1J21A 3HY4A 5B36A 3VI4B 3UB2A 3RVSA 2O05A 2V3VA 3D5EA 2X2FA 1UFVA 1YGPA 4U9IS 4ESHA 1GDTA 5KO2A 4L07A 1DLJA 1G8MA 3U1BA 3IS3A 4H27A 2ARKA 1QZZA 2QN1A 2O3SA 1HNZH 1MDFA 5KYKA 1U1EA 2VJMA 1TQDA 3JAWA 3LUKA 5EHQA 4X91A 1PGOA 2BFWA 2JEZA 4XYMA 4C0BA 1JAYA 4GKJH 3CLTC 1UMBB 3TB4A 2FR8A 1N9GB 2IDKA 5CM8B 4YUXA 1HT2E 1II0A 4Q24A 1KEUA 3PUYA 3DKIA 3V8EA 2VHQA 3AFIA 4XR4A 2W2OA 4DKJA 1VL6A 3TIIA 3NBYC 4CMGA 1WOYA 1Q6ZA 4EBDA 1E8DA 3HA7A 4FZ5A 4ZN6A 2VPYA 1YS9A 1J0CA 3TTXA 1W93A 1FFEA 2X4LA 1G2IA 2QOEA 5DEOA 3A7DA 4J94A 4BNLA 1JKFA 3AYHB 1WXQA 2QW8A 3UM9A 1AQ6A 1MJFA 3KKMA 3MCWA 2BBTA 2HHCA 2FVXA 4TZTA 1JIJA 1QWOA 2AN5A 1RM4A 3MFQA 3HPQA 1ZKMA 1DIAA 1L5HB 3WYEA 5AOCA 2F64A 5AVQA 4QTUB 4XVRA 1LTHR 2WSSD 1ESNA 2DHRA 1CUZA 5BSFA 5K8LA 3R1IA 5KTNA 5J2UF 2DLNA 3K9NA 1O4WA 3CQZA 4M6WB 1HOXA 2WOOA 1M2VA 4PSAA 1F4PA 4H0CA 1NOIA 5E2IA 4NXNH 4LDZA 2YKGA 4BNTA 2JFWA 2B63A 2BMEA 2WWYA 4S2EA 3DHEA 2CJFA 3VOSA 1TCCA 5AESA 2J41A 1DRVA 3BJMA 1H69A 4OMUA 4CEJA 4Q3BA 5F3RA 4R2LA 2V7UA 4FINA 3S2FA 3GUHA 3MOIA 1Z47A 2OCXA 4FMPA 2UDPA 4B7XA 1IG3A 4R7ZA 3ICCA 5JS1A 3FOEC 3MR5A 1U5BB 1XLUA 3UKJA 5J5CA 3WNCA 4N3BA 4LF7B 3ZWWA 4KG7A 6Q21A 3IB6A 1Z3CA 1DQNA 2EEZA 3T8YA 4UE6A 3MWEB 2BF7A 1OBOA 5LYYA 4KFSA 4X20B 4NWIA 2O57A 5CD9A 4D0LB 1L6IA 3PVXA 2QJRA 1DJOA 3TLGA 4F5WA 4JGGA 4WUTA 2I33A 3W5DA 1O96B 4JC4A 5K3WA 4U39A 2WSIA 3NYWA 1N32H 1AB6A 3A04A 2OKCA 5EY5B 2AVDA 1P4GA 4I08A 4OVKA 4E5UA 1I5OA 2HMUA 1Y34E 2EATA 2OHJA 4ZT3A 2VUIB 2R93A 3ZWOA 2ZTSA 1A5TA 3BA9A 4MCAA 4BMOB 1U7XA 1A9PA 4NZPA 1PQYA 2CHVA 2GLUA 3TBFA 2ZT5A 2QRHA 1YL5A 3K0FA 4Q37A 2EJUA 1UWCA 2XBUA 2C2YA 2VSNA 4A2AA 2IYXA 1P17A 4DV1H 5L3ZA 3PFBA 2R85A 2FA9A 2F43A 4HDMB 3O9VA 2COEA 1YJCA 1EP2B 2J59A 1O9GA 4TLEA 3UAZA 4ZGGA 1XZCA 2Z8ZA 3V1YA 1PEDA 1TE2A 3DCYA 3Q5EA 4KQ2A 5IMSA 1VA4A 3N8GA 2H00A 5FBVB 3O7MA 3NNNA 5J23A 4CN8A 3KSRA 3QI2A 4X66H 1M0TA 4OXNA 1T2UA 4DYHA 5JQGB 2PFSA 2IFTA 2NOAA 1FPQA 4D0NA 1NJGA 3T3GA 2EKDA 2YRXA 3HJGA 3EC7A 4X45A 3QYAA 4OHPA 2Q2QA 4H7IA 2B37A 4XH9B 3E8MA 3LKBA 4BX8A 1W581 1HZJA 1SBQA 4M3NA 2O03A 5IZCA 3TRHA 4DB2A 2CXXA 3MTAA 4YS6A 4X5OA 2IELA 4FYIA 4PWYA 4JYBA 4RNOA 2W6IA 3LJKA 1D0SA 1QQ6A 2NTNA 1GRQA 4JBWA 1DKQA 2V1XA 1XJ5A 1NP7A 1V2GA 3A36A 1EMDA 1EWYA 1ATZA 2VWHA 1TUEA 4OCZA 4HEA6 4A3LG 5CA0A 4JFAA 5I9BA 4J0DA 3S8EA 3WNZA 1RTKA 1H3NA 1T1EA 1WDLA 5AQ1A 2HDHA 2VUTA 1K8ZB 4P1ZA 4FD3A 1UKEA 2QZJA 1T43A 3UXMA 1YQGA 3WK9A 2RGEA 4BZXA 3E27A 1QLJA 3T5MA 5F2EA 2X13A 3PWTA 1TK2A 1VIDA 5JOQA 1Y7IA 4LWPA 2WQ7A 4HFRA 1PZEA 3LQYA 1N3BA 1JRLA 4LF8H 2IYEA 2RDIA 3B82A 4CM8B 5F9HA 4CKWB 3S81A 1RZ3A 1Z26A 2YWRA 3V8QA 4UBJA 5KNDA 1VE6A 4QUJA 3L0IB 5JCPA 2GPSA 2FK3A 3GIDA 4H7HA 4O7YA 5CR9A 4CLDA 4QRHA 4E3WA 1LBSA 4FFNA 2FSVC 1OWMA 5C37A 5EKDA 3UJ3X 5A4DA 3JTEA 3SVTA 2AKAB 2D2XA 5LA6B 4TZ6A 1CNMA 1NTRA 4KGZA 1ZK3A 2H06A 3L82B 3PFKA 3OPYA 2GHTA 2WB1A 2ZIAA 1DBSA 1DUVG 4ODIA 4M0JA 3D6HA 2XOKA 1M5UA 3GTOA 1P9NA 4D57A 1ZJWA 3TEFA 3PFHA 1V16B 3EQ7A 3C24A 2H2WA 4KO2S 5EE9A 4TQRA 2SBTA 3BQ1A 2JGMA 3VYWA 5JR3A 1HLGA 4RD4A 5DM2A 2E4ZA 1UAAA 1DFIA 3GA5A 2P40A 4TXNA 5AVUA 4WZBE 1LC0A 5CB8A 3MR3A 1UPFA 2V7EA 1O94A 1W7AA 3V2IA 2OG2A 1G1AA 3IRUA 3AY6A 3TW8B 4DWOA 4JLBA 2FVYA 4WIAA 2P77A 2DBVO 1NUUA 1K7FB 3CZQA 4I46A 1XK5A 5AHOA 2Q0HA 1OX6A 5I5XA 3KYCA 1TJ4A 2ZBPA 2AF3C 1P2VA 2AT1A 4PZ9A 3BFVA 5FFNA 1V5WA 1D1QA 3QVSA 1F48A 4WJZA 2AI3A 1JR3D 3PVCA 1PGPA 3EUEA 1GUZA 5E1MA 3GAFA 4YBRA 7YASA 3RRYA 3WR5A 4YV7A 3L5OA 3IPLA 2D4AA 2NUTB 3AJDA 4MRAA 1W34A 2QX6A 2C29D 3DBRA 1TKCA 4LZLA 1CS4C 2C2EA 3MB8A 1Y82A 5B3JA 2CDAA 2D0DA 4LMAA 1WMFA 3TMYA 4FBLA 1A2QA 2RGAA 2OORC 2J3QA 4LX0A 1K3FA 3A70A 1U0JA 1USVA 1O4VA 3HYRA 1SCIA 2OP0A 3ISTA 3LVQE 3B51X 4DIMA 1SO8A 2R0QC 3WWCA 4DEYA 3QK7A 2XPCA 2NU6A 3PFWO 3M3DA 4B7CA 1DBQA 2OZLB 4WKGA 2BH2A 2ZIEA 4BC1A 5K4GA 2RHBA 1I2MA 2Z08A 5AK5A 1QHEA 3ZVMA 3CLRD 3K3VA 3C87A 1YMVA 4RB0A 4TKMA 1IM2A 2VA3A 4GZLA 5D1PA 3B78A 1NVAA 2NO5A 4KGXA 3T7IA 4P7KA 1KQNA 1UZLA 1GV0A 1XZEA 3GQCA 5I5EA 3STYA 4E4RA 4R68A 4GOKA 4UCRA 2FPRA 2NT3A 3P26A 5KFBA 2OCPA 4G65A 1JU3A 2C3OA 4EHAA 3ORHA 2JHFA 3O4FA 4AF8A 2OQVA 3B6EA 1GL6A 2P9GA 2ERCA 3CO5A 4OLFA 1WXFA 2JCBA 1PT6A 4KE6A 2ECOA 4NU0A 1ODLA 3PDIA 3BWDD 1EFPA 1UM9B 2RDMA 4RGVA 4GZ3A 4PQYA 4WOBA 1I7SB 4PRLA 4CLRA 3Q3IA 3BSWA 2REQA 4A8HA 2R7KA 1U7PA 4KIWA 4UUBA 1TUGA 2J7PA 2QD4A 3KEGA 2CNKA 3CJTA 3R7WB 2JIMA 2ENWA 2PZBA 3OWXA 4K9NA 5BSGA 5I01A 1D8TA 5KJ6A 2I6SA 4Q21A 5G4KA 1RM0A 4K1XA 4NY1A 1TB4A 2VDNB 4X8LA 4GPBA 4FR5A 1UBKS 3HVJA 4XKJA 1A7AA 4O7TA 1TU0A 3QVVA 1KNQA 4EZBA 4G5OA 3UMGA 4FQ8A 1EKFA 4XQEA 3E9NA 5FUBA 5LP6A 4JYAB 1FNSA 3QG5A 4RKEA 3SBEA 1N7IA 2PYDA 4PFSA 5DG9A 2PMKA 5F1OA 1NWHA 2XVMA 3ZQKA 4IV8A 2HD4A 2ZSBA 5C7IO 5TMEA 3RASA 2JARA 1RI4A 5C8YB 5DX0A 3RFFA 4TTVA 4BQNA 2VUSA 3FAKA 4YB8A 3IEXA 4J75A 1PR3A 4MH0R 1KZ7B 2WV7A 4DSUA 5DBFA 1G8SA 1IBCA 3GTQA 1M7BA 3IA7A 3H5TA 4A8JA 3W34A 3EXFB 2I71A 2Z9BA 3SYTA 3VR0A 3KXYT 4LXGA 3C5VA 4F60A 1X7GA 4ME6A 1N2GA 5LDHA 1NF3A 4OX9Y 4ISCA 4BMVA 4K40A 3MLEA 1RABA 3HCEA 1W9HA 3EODA 1QYCA 4HRVA 4P4LA 1B1AA 4WKCA 2G88A 4GSKA 1BN7A 3GZNA 1SJ9A 4ZFNA 3CBGA 4FOSA 1WCXA 1VFNA 2WMYA 4IG4A 3LUGA 2X5KO 1QB8A 2PH3A 5EWLB 4AG3A 1CY2A 4M1KA 5EGNA 3TRKA 4EVSA 1OJLA 3OEHA 4EA6A 4G0YA 3DL7A 5E7QA 5AXDA 4DCVA 3WLJA 1K83A 1INLA 2WAYA 2C5BA 4U9HS 4QJBA 5IYCG 1PV2A 3P4YA 1IQUA 1NJ2A 1JXOA 3B6ZA 1MKYA 3FHLA 3DDSA 1SPXA 4JSYA 5DX1A 3G0IA 4FFVA 7ADHA 2JK1A 2BONA 2UUPA 3ZHXA 3B5EA 4F2PA 1ZGBA 3U9TA 4WADA 4FMDB 4FFRA 2OVFA 5IYZA 4AY3A 1FQWA 3NLLA 1T91A 3A11A 4GF5A 1Q74A 2PIDA 3NRBA 4U2GA 2P6OA 2JA7G 3Q7PA 5NLLA 1IBKH 3K8YA 2FY8A 2R86A 1NF8A 5CFOA 1SEIA 5T4HA 4GYJA 2DWOA 5YASA 3UQZA 1ODSA 3I5MA 3TRFA 2FMKA 4HG2A 4C4OA 2GQ0A 3GPIA 1KMIY 4KYVA 1QBKC 2B1JA 1ORVA 3GUYA 2GPAA 4JJEA 2QGNA 3L0YA 4H1UA 3OQPA 4KMSA 2I2XB 4UDOA 2X5OA 4LHYA 1PWYE 3B1XA 4GKAA 3N70A 1MC1A 2PLWA 2ZSDA 3GLGB 2FHPA 3O8BA 3JQ6A 2HWYA 1BEUB 3P45A 4MMXB 2Z1DA 1O54A 5KQRA 4HK4A 5BOVA 1G8GA 2G4LA 5TS2A 3JRXA 2YN2A 3WIUA 3HB1A 2R751 3Q12A 1LTKA 5C5EA 2EV9A 2YVLA 3NGLA 5IM4F 3FY4A 2J9RA 1VJDA 3KSBC 4TWIA 2KBFA 4A3MG 1J6UA 5JJKA 5ALSA 2A4KA 5LL6P 4ZZ2A 3QOYA 4RLSA 1PJZA 1FDIA 1C41A 4Q15A 3RW9A 1NLUA 2V74B 1YIAA 5K3OA 1P3JA 4FXOA 4TRRA 5FPYA 1SOMA 5FBZA 7ABPA 3NZEA 5F1KA 3P9RA 1TA8A 4QYTA 1U5CA 3LC0A 1WWKA 4RNDB 4LMPA 3F74A 3KZXA 5CEJA 2WYIA 4LRWA 2OBLA 4BZZA 1YJ5A 4M55A 2ZRLA 4LC1A 3WAKA 4TROA 2I9KA 1BZYA 2SKDA 1CT9A 3VDRA 1EA7A 2WAQA 3KX2A 2RDJA 3HP4A 4UE3S 5K8CA 1TC2A 5A2QA 1B76A 3IUYA 3PW5A 4L4ZA 2AUNA 1SIOA 1V9LA 4CODB 3IBTA 1NLYA 5I9MA 3VJKA 2OK8A 3RVOA 2Y77A 3PEUA 1RC0A 3IP6A 5BNWA 1ISIA 4JC5A 3K0CC 4IQ4A 4RESA 1J0AA 4IH4A 3DE4X 3QKSA 2JVIA 4A2WA 2IS1A 4K6CA 5I8WA 1GRVA 2UYCA 4HDRB 1Z25A 3NWPA 1Q57A 2D2IA 3WL4A 3KUXA 1P16A 1NXXA 3LUDA 1U0BB 4XQ0A 1BXGA 5HE9A 4WKBA 2HHFA 1A48A 2Z9DA 1JAIA 4WBNA 5CDSA 3A32A 4QU5A 2OH2A 1DC8A 3RVDA 1SHLA 3DVQX 4Y2UA 4IAJA 4MR8A 3F3MA 2YJ3A 4DUPA 1WXHA 1H1LB 2EHJA 3T06B 3EEFA 3KD3A 4EKIA 4H08A 3G9QA 4DXDA 1XC7A 1QVVA 1JALA 4ARZB 2R9VA 4GPIB 4GQIA 4XGRA 3KZKA 3N74A 1NI4B 4UEWA 1EEHA 5FBQB 2WF5A 2YC2C 2BDUA 4MV7A 4DZZA 1QF9A 3ELBA 2C2BA 3JPYA 1RQNA 3NTRA 3AFNA 4FFPA 2W43A 3ZGOA 3PI6A 3WP0A 1YS4A 4DA7A 1HDCA 4N0QA 4M9CA 1RQ7A 2NZXA 2GF9A 1JU9A 1TX4B 3OUUA 4QUDA 4II7A 1PAUA 2C4KA 4Y2SA 1KTAA 3IKJA 3TO5A 5IP7G 3WDKA 3IIEA 3SMQA 4YC7A 2C0QA 4NBKA 3O2SB 3ZWMA 3PS9A 1GG9A 4CV3A 2BFFB 3KKOA 1CZLA 2RONA 4EO4A 4B79A 2R8ZA 1C1XA 3FAZA 4B6EA 2ZJ5A 4RJJA 1N33B 2NXJA 3FX2A 1Z45A 1NMEA 5FOXA 2PGLA 4DCGA 2AOXA 4BVHA 3HHPA 4KWHA 3KHRA 1AUOA 4X0EA 3U7IA 2CW5A 3G7NA 2AIRA 1G0NA 5IM5A 1LLFA 2O2SA 4KBFA 1ACMA 3LL4A 5TQ2A 1AKUA 4C7OB 1NDUA 4YUYA 3AJ8A 3GVXA 3SBDA 3VH4A 3U7RA 3BABA 1ZPDA 4OJYA 1VJCA 4KMRA 3H1PA 4WCDA 4F3RA 3UOAB 5IJXA 3G2KA 3REQA 1VE1A 5G53C 3GJ7A 3IMKA 5E3IA 4ENPA 5LQSA 2WMNB 1N8SA 4QXAA 4UEQA 1W19A 4HGYA 3FDFA 4GNRA 2BZ1A 3AUUA 4BWVA 4OQ4A 4GPEA 3W5HA 5FTWA 4YMLA 4P92A 2WYOA 4LOAA 1OPRA 4ETWA 3MJVA 1H2WA 1AMOA 2C4WA 3JYPA 3UB4A 4TYWA 4Y6LA 5CK4A 421PA 2TECE 3TECE 4Q1FA 3C3KA 4LVOA 3FZEA 3U48A 1Z0UA 5BW8A 5AI6A 3OLWA 2A78A 4BV8A 3P2MA 3IP7A 2BQUA 3ZX5A 1HDIA 3P9SA 1WUTA 2XE6A 3ZDFA 4B7AA 2FEXA 3ICVA 3LPDA 2E9SA 3CKKA 3C1OA 1XMSA 3SDZA 1M8PA 3AERA 2W6PA 3A3YA 1ZRSA 3D1LA 4ZQEA 2L2QA 1NVMB 4QO8A 4AZVA 3T5TA 1ZAUA 1D2CA 1UMDB 5ALNA 3RE1A 2VF8A 4GICA 3R40A 4P7BA 2QTFA 2HIAA 2IHUA 4DL6A 3HQ4O 3EGEA 1U3VA 4OREX 3M2PA 3LRTA 2GAFA 4DIEA 4WK2B 3LNCA 1EIWA 5EPEA 1PJRA 4QPZA 3DT9A 5DW0A 4ZMSA 1UKCA 1MG0A 1FFBA 3U49A 2J8ZA 1RXVA 1G2OA 1E4YA 3NG1A 4RK7A 3DYIA 2W2XA 1DZIA 1JDBC 1NMSA 2YVKA 3RIXA 3QYFA 2QTVB 4F7WA 2IL1A 3N07A 4Q5IA 4PYKA 4TQGA 1AV6A 4B6RA 1VKHA 1YZFA 2EFDB 2XF2A 2ZBDA 3H0KA 4BLWA 3B38A 1KVTA 3WWHA 4ZCRA 2YYSA 3MWLA 3MQ2A 4FEGA 3RIEA 1XMOH 1GZSA 2GYUA 2JDID 1GPMA 1A9TA 1X9IA 4E08A 2XHEA 2NGRA 4LQCA 5CAEA 3KK0A 3BAAA 4Q45A 1ENOA 5DHQA 3CNQS 3NHMA 4RIFA 2BD0A 5L7YA 4BGUA 1BOOA 1NR1A 1ZS9A 4TQ9A 3BIOA 3LZDA 2P3LA 4F6LA 4LBZA 2YHAA 1JBQA 3SFVA 4QOHA 4IMIB 2VG8A 2O52A 5JYEA 1JDVA 2JVKA 4FK8A 1VBFA 2NVUB 4B5LA 4MW6A 2IP2A 1TA4A 2YRFA 4I5GA 1WEHA 5L9AA 1BEZA 3LY7A 3PNLA 2WR8A 4RYDA 4YPOA 1E1RA 4PX9A 3GWZA 3GGSA 1PG5A 2JA2A 1UBCA 4D9MA 1NTOA 1SCDA 1GQFA 4AY2A 4DQLA 5CG1A 2A14A 4TV8A 5I5TA 1DNPA 2QVXX 5DGBA 1E2UA 1AT1A 3GO4A 3QSGA 4C9BA 4BV3A 3U7QB 1JEJA 4ITRC 5JXIA 4FS8A 1Y6QA 1HNWH 1VE7A 4R81A 3MG9A 4WXRA 2X3UA 4GMGA 2WM8A 5D1HA 2Y0EA 2J0VA 1NE2A 1UBHS 4B17A 2DG2A 5P8WA 2FPGB 4R84A 1ITZA 1V95A 5HJ5A 1RHQA 5HOEA 3Q8PB 4YEDA 1VJGA 4RFSB 2ATVA 4GXQA 3L8GA 3LK7A 2Q7DA 3ADBA 1XKQA 3FN4A 3I1JA 5ALRA 4W1RA 3UH1A 3NOVA 3F49S 1EI9A 3ETDA 5ALTA 4W82A 4UUAA 2HOQA 2OMKA 3E6AA 4PCVA 4LGYA 2RAUA 1C1YA 1JHDA 2KPOA 1SKQA 3CCBA 3TM5A 1HE2A 4LH6A 5B37A 1GL9B 4MUKA 1NLZA 1XCGB 3DFIA 1OMOA 5ITZB 4EEYA 4ZD6A 4RSHA 3THXA 4L9SA 5HF8A 4EDHA 1HNXH 3DP7A 3FYDA 4OQPA 4B8YA 3O03A 2LIVA 3B6MA 3T5JA 4HDSA 1XX6A 2O07A 3LO8A 2CZGA 3C4VA 1VI2A 4FVTA 4QOSA 5KYYA 3DEJA 2C5EA 3Q8MA 3PIRA 2O59A 1AGPA 3GLUA 4OI2A 4F0JA 1VECA 1S4MA 5BMVA 5KFNA 1G7SA 1QE5A 5ALUA 4LYJA 3PFFA 1EVKA 4EOGA 3DL2A 1N6HA 4ZI5A 4CM6A 1MVNA 1U63A 3GA0A 3V4OA 3OICA 5ALOA 2JEFA 4O8ZA 3AEUB 4G67A 3AR5A 4NH0A 4FWBA 3AU9A 2P6UA 4FPXA 3OU2A 1OTXA 3BTUA 5LYJB 3QEBZ 3WLRA 5FA5A 1U2EA 1T3GA 2CCGA 4CF5A 2X5XA 1QOPB 2Y1GA 2QZ9A 4KH1A 3N58A 2RGBA 5CNKA 4EHJA 5CT5A 1AV7A 1IPEA 3LG2A 4BY1G 3L1JA 4GQAA 2J32A 4CM1A 4MXDA 2HDNB 1VJ5A 1CJBA 4K8OA 1TYCA 1S96A 1UP6A 4ZREA 1XELA 2CCKA 2C35B 3QQ5A 3KZOA 5ESRA 1OZFA 2AGQA 2CWWA 4MUXA 2WTEA 1KO8A 4W6QA 1M2HA 5F4BA 1CQPA 4OBEA 1JLRA 1MC5A 3K9LA 4RB3C 1IAQA 3S8MA 1F8GA 1O6BA 3NNSA 4Z9BA 2ISSD 2QL6A 4Q6WA 4H7JA 1GQOA 4B7UA 2FPXA 4B3XA 4O3FA 3HCFA 3ZKWA 4GLWA 5IXSA 4I55F 2ZIFA 1NAIA 2IYQA 2VJCA 2PKEA 1R6XA 2CNUA 2ZAOA 4GVXA 4EI2A 1SZDA 1SXJD 4WCVA 1TFUA 3FPEA 3WDSA 4G0QA 4AP5A 3U16A 1X2BA 2IQ5A 1R9JA 3ZXXA 2AI1A 2YZNA 4NPHA 4JQOA 1G2WA 1KSGA 2CW8A 4QYWA 4ALNA 2VDPB 3DL4A 1KYZA 2BQ3A 2PZJA 2W8LA 2WEKA 1WDMA 2J4CA 2XHZA 5I7OA 5DGTA 3L93A 1QH0A 3ETNA 2XXAA 5KNCD 4IXWA 4UTPA 2DMRA 2OG1A 4WXEA 2WHEA 4HV4A 4OB7A 1XAIA 1ZNYA 3LCUA 3EEIA 2F3SA 1O75A 2Q1TA 2OK7A 3B1KA 1XAHA 4PIMA 4RNNA 4H3KB 1B8UA 3DG9A 4DZRA 2WKQA 2DM6A 2VUUA 2VPXA 2QI9F 2W4MA 1ZDMA 3B7PA 4GC7A 5HKBA 3BH6A 1QVAA 2EIYA 3RS8A 2O48X 2JC3A 1E92A 4NF2A 5CH3A 5JCOC 2BJWA 2PRKA 2GNPA 3RHFA 3X3HA 3GLGE 4BFWA 3QNUA 3ONWA 3PPVA 5KBYA 3IUNA 2DECA 3QZUA 4ZVLA 4YROA 2FR0A 1SU8A 2W8KA 2NU9B 3P27A 3RRMA 1TVMA 4HMPA 3KTAB 2YYZA 2DBQA 1KJ8A 4JJKA 4PFKA 1DARA 1SNYA 1JWLA 2C00A 4PSDA 2XUOA 5IT9W 4IFEA 4DDUA 1L2TA 3TMKA 2ZDHA 3SJUA 4Y0VA 1KO1A 2VTVA 2DLDA 1RLUA 4CQNA 2C98A 1BXRB 1H93A 1DKPA 3IBFA 4OAOA 3IUSA 1FFXA 5K8JB 2LKCA 4YY3H 5DSTA 1NQWA 3KCQA 4DF3A 1H6AA 4P5PA 5JRDS 1YR3A 3OIUA 3DAGA 4XFKA 3SZ3A 1IC6A 1P1CA 4L78A 2VO1A 1L4MA 1FTSA 4AWBA 2DCUA 1K5DA 3L07A 1S6YA 3WX0A 1C4KA 2BN4A 2ZB8A 1JJVA 1E3MA 1EDZA 1DKUA 1PE0A 3Q6MA 1KMHB 4LQDA 1XEFA 2CHFA 4AP9A 4COKA 3AIIA 4IRDA 2DCMA 3Q7SA 3M6UA 1GGHA 1J8FA 1IMJA 2KMLA 1TIPA 5H16A 1E99A 4D45A 4BO3A 4MHSA 2X14A 2GN8A 2BFNA 1JUDA 1E7YA 4BNYA 2OQRA 1T9BA 2VA9A 4B8WA 3FKIA 2H92A 2VDOB 1SUCA 4AT1A 4A3JG 4TLMB 1N0IA 4F4YA 3FF1A 4NDZA 2PLRA 3KYDB 3F3YA 2EJVA 4Z3DA 2XCOA 1G291 3W06A 1GAEO 3PK0A 3HCPA 2WAOA 2Z2YA 2FGJA 4XQCA 3UC9A 2PAAA 3ROKA 1DC6A 5IJZA 5CXSA 4YK7A 4E1BA 1OTYA 1LB1B 4BNDA 1VQ1A 5H59A 3DEAA 1T9ZA 3K0BA 5B1DA 4A23A 4C0WA 2D62A 4ENTA 1PQPA 3DW3X 4NRDA 4IIEA 4J9SA 4AKIA 4B4VA 2FQXA 1Q6YA 4QXMA 2OXEA 5JE8A 5DBHX 1Y5LA 2ZUBA 1FW8A 1KMCA 3OZRA 5JT1A 2Z2XA 2R7ZA 1JLKA 1PYGA 2GZRA 2IUTA 3K1AA 2H4FA 4HZUB 3I09A 1KZGB 2HWUA 1WXGA 3TTTA 3WYBA 2MOKA 4HWSA 2FN8A 2HVQA 2VRWA 2X7XA 4NABA 3G8AA 2ZKIA 5FT9A 3RG8A 3NCTA 1LSSA 1VJ0A 3B12A 4UU8A 2DPLA 3C1AA 1K4KA 4D3FA 2XCUA 3M5CA 2PSSA 3NVDA 1ZD8A 1XALA 5K0LA 2ZYWX 3I30X 4IS3A 5A4FS 3V8MA 4EW1A 2N1MA 2ZB4A 4K9SA 5AW3A 2ZKLA 2E6UX 2WJHA 5E2AA 2YYAA 2GCOB 2VNHA 5DNCA 4OY3A 2GZSA 2XRMA 3L0CA 3NYRA 5AK3A 5JSUA 1U94A 1B00A 4AC9A 1O8BA 1XZNA 5BQOA 2QTLA 3UYYA 3DZ8A 3IHLA 4EY6A 4J76A 4RTRA 4N0EA 1KVSA 5EAIA 1ZGCA 3H20A 4O4JB 1XD2B 1FFGA 1G5IA 4L3VA 1NW6A 1OB2A 1XZIA 3G88A 5JZVA 3Q7RA 3DTVB 1N0UA 3LS2A 3DZDA 1D2HA 2RE8A 4IAOA 5BNTA 2W6JA 3QLEA 2Y0DA 2O2CA 3GEBA 1Y3DE 2R8KA 1SHKA 3IUBA 1P5JA 3X43A 2PJRA 3QZ8A 4OI4A 3AL2A 4G5XA 3OURA 3X1MA 1RRMA 3RVJA 4GX0A 5B2FA 1OAOC 2YHUA 2C88A 2HV9A 3WLOA 4LF6H 4O2RA 1JX4A 2ZULA 1K63A 5B1EA 4CIVA 2H65A 3DAHA 3O0TA 1DRWA 1DKOA 4MPRA 1DJPA 4ZOAA 4IH9A 4BB0A 3QFFA 2O8BB 3JQPA 5HM6A 2CVHA 2WIBA 1E9VA 3BA6A 4UAVA 1L7VC 2Q1WA 4OHRA 4MRMA 4GOJA 3ET4A 3GZTB 3RK0A 3PGKA 2NW6A 4RV4A 2JEIA 3ZDBA 1H2ZA 4MUJA 3T38A 4Z49A 3A1DA 4L6AA 4A1OA 1WUHS 4J9LA 2XJ9A 5JD5A 3ZGVA 1GXSA 2IHTA 3D7LA 3HXQA 3LQQA 1KBQA 3M5PA 3GELA 4MS4A 1G38A 3CF4G 5HUQA 3NWEA 1KY2A 5EXDA 5J2UB 4HTFB 2ZJ3A 2E37A 3PRJA 2IOHA 4DNFA 1QJ4A 2AEEA 4TWAA 4KI0A 2OYSA 5BUSA 4QLAA 3RU2A 2CF5A 2Q3BA 4JCOA 1TUBB 4QREA 2FE1A 4I19A 1I2LA 1QRSA 4EPRA 3JY6A 3GPDG 1AKQA 1MIOA 5BT8A 4PS1A 3LO5A 4CEHB 2FLKA 2O8NA 4D9BA 2I1VB 5ESWA 4UHCA 5EVJA 5IDYA 5AUQA 2CNOA 1YRWA 1GFZA 1ZNXA 1ULZA 4PX2A 4YQFA 5L6LB 4S1NA 1GSIA 4I4LA 1W5TA 5IKOA 3SZGA 3IE1A 2AFIA 4K6HA 3B13B 4NVRA 2XDAA 5CIWA 3LCCA 2K7FA 3CSUA 3G1WA 4LFCH 2PZGA 4CF4A 5C80A 4DSAA 5B30A 3M9WA 2GQSA 4G24A 2FFHA 4M98A 5THKA 3PEVA 3VKVA 3BDVA 4YMUA 3PGMA 2Z8YA 4KHPH 2XB8A 1BCRB 1T9CA 1QTRA 2JCYA 4XIYA 1NSYA 2WZDA 4X62H 5CD1A 3ZDAA 4RS3A 5DLGA 3UATA 5KNCH 4LUCA 1GN9A 1K66A 3F90A 3EGDA 2QV7A 3ZU6A 4A6EA 4FBMA 4K46A 5GJWC 1LX7A 4KACA 1MJNA 4A0GA 3RB8A 1RXYA 3FVVA 2QSJA 4BVAA 2YW9A 3MXOA 2Y1KA 3GX1A 1K6XA 3NANA 3K4PA 5INTA 1VS0A 2ANBA 1YKSA 1NJ5A 2AWOA 4Z1MA 2KHZA 1OLSB 4P4UA 3BXHA 3PENA 5DYTA 2DH5A 3C3WA 3A1SA 5IAKA 3U54A 2MSEB 5CA1A 4DLVA 4DLNA 4GKVA 3UBMA 2A0YA 2J7KA 3K70B 3H9EO 1HG0A 4ZKEA 3MWDB 5FLEX 4GKBA 4WOCA 3A2LA 3SM3A 3PR5B 4GPZA 3SC6A 2Q4EA 4OHYA 5A1TA 2QAGC 2FPPB 4N6OA 1ZHFA 1VBKA 1O03A 4CIWA 2XB4A 1FNMA 4JWTA 1QAQA 2UUBB 1AKTA 3IQFA 3L6UA 2C31A 1E7MA 1T0IA 1KJIA 4H3SA 3KALA 4MUYA 2V58A 4BPBA 3M9LA 4LMRA 1EX1A 2XWJI 2C3YA 2GFQA 2XVYA 2Z58A 3BMOA 3Q8QB 1J06A 4G1UC 1MT3A 2WV9A 4IXNA 3B48A 1O77A 3OT1A 1ZCFA 1A9OA 1T0UA 2A58A 4D02A 2JLXA 5J1TB 3G5TA 4FLMA 2WHPB 2GPBA 1ZCJA 2R48A 5JI3E 1Y1QA 1KL7A 5EJFA 1NJ1A 1ORHA 3KHHA 3VZBA 2BFOA 5KJ1A 4KR2A 2PXHA 3PFIA 2BGIA 1AD2A 2B78A 4JXUA 1BXKA 3ZYZA 1IBMB 1V51A 3T5DA 2GK7A 2HMSA 5CUQA 3T3DA 4DUGD 4Y3UA 3JALA 2R65A 3D54D 3TXAA 4LQLA 5AMXA 3NXSA 3IHKA 2Q4TA 4CL0A 1G6OA 2EG5A 4UFNA 5C1DA 2FDXA 4I2NA 1JHXA 3AKYA 2C9CA 1UBJS 1XL0A 4QGHA 4MTDA 5JJIA 4C4PA 3EVNA 3GLHB 2WTMA 1Y1KE 1OQAA 1OT3A 2X8JB 4PNEA 3TSOA 4AJJA 2GBIA 3K4HA 1NC3A 4NMHA 3ND8A 3JQGB 2X9NA 2J9ZB 5FAXA 3F5DA 2FPLA 3VR4A 5IFLA 4OA8A 1DU4A 2IXDA 1R8YA 1TYAE 2QN6A 2FN9A 4YV0A 5B3AA 3N75A 3EVBA 3EVCA 4YJHB 3I3SR 4X9XA 4C6HA 3GEEA 1BE1A 2CXHA 2Y05A 4ECAA 4LOIA 1UXHA 2A59A 1BO6A 3CNBA 1SZJG 2R92G 3KLPX 4CT5A 1RVDA 5EKUA 3C45A 3EF0A 3ABIA 2LP4Y 1CUXA 3MMSA 3OE7A 3NC0B 2BJHA 4URXR 1CERA 1KVRA 1ESDA 2RGUA 1YAHA 4PG7A 1KI6B 4DRXB 4EYIB 4RETA 3I8OA 1KQ3A 1XWIA 5TJHA 3LK6A 5DASA 1IG0A 2F8MA 4LY3A 1W0CA 3PYMA 3C98A 1PS0A 4F1JA 4Y7CA 5KFMA 2AW5A 1KI2A 3X1XA 1ZITA 2ECKA 5JNRA 1X1TA 1N2HA 4ZAWA 1D2NA 2C7GA 3ZDXB 3HKBA 4B3HA 1GCIA 2Y0CA 4BOYA 2UZ4A 1Q1QA 3VKHA 4FOTA 4DV0B 2FWIA 4QZVA 4OXIA 1LF5A 3BHNA 3DFUA 2ZM6H 1KYXA 5JQWA 4Q39A 1EESA 3A9TA 1NRXA 4MUEA 1G5RA 4TSRA 5JTUA 5KT7A 5KVVA 5L3VA 4YJKA 4WESA 2NO9A 3PXAA 1L7OA 3VR3D 2XKJE 3PTAA 4XQ9A 1M1UA 3GFFA 5ED0A 1GQ2A 2D59A 1RXWA 3ZLTA 2NSJA 4BQPA 3RC3A 2YMMA 4IIUA 1XJ0A 5KOHA 4KN6A 4LXHA 3MIZA 3ED1A 4QEKA 3DWGA 2DSNA 1SD5A 4GFDA 3HWX1 2Y1DA 4EATA 2RHCA 5CW2A 3SNKA 1ZEMA 2R1VA 3DHYA 5AH0A 2XB6A 4MDYA 1IUNA 1RR6A 2AC4A 4XM2A 4DAOA 3RG2A 3OIFA 2DPHA 1A8HA 3ZI7A 2VSOA 2PRIA 1RXEA 3L7BA 2FH5B 1QYWA 4FZ3A 3A1VA 3MFIA 3H11B 5DN6A 1F20A 4BQQA 4EPWA 4BV9A 1X74A 3PPXA 1QH8A 3F8TA 2QYTA 1DXQA 1P5RA 1QRAA 1SQGA 4F9GA 2PUFA 1XRNA 2H4WA 1FNBA 3I2KA 4FGSA 3U4CA 1N5JA 4BXOB 5KG4A 5AW8A 2FLLA 1HR0H 2V54A 2WF7A 2IZ0A 4OFZA 3C3PA 3IEVA 1MCZA 3C3EA 4JXJA 1PLJA 1Z0IA 3A0UA 3FGZA 1T3NA 1UPUA 3TTSA 3D3EA 5AUNB 1E7RA 1E61A 3DDUA 5BSTA 4XM0A 1WVIA 3F46A 3SGLA 4J9PA 3IP5A 1PW7A 1HRKA 3BBPA 4PNZA 4I3FA 4RVFA 3QITA 4M8IA 2OHXA 3KFVA 1NFRA 2QI9C 2YOFA 4Y2VA 1Q7BA 2BR0A 3LKZA 2HO4A 4C2MA 2XYQA 1Z7EA 3ER9A 3UJPA 4K86A 3TOSA 5J40A 4O3MA 3WLPA 4BZWA 3HHEA 1KFKB 1AO3A 4UJ3A 1LK7A 1RPAA 1YULA 4ZZ3A 4BBPA 1UK8A 3TWOA 3P4XA 4EO9A 1YE8A 4EIWA 3ZVKA 4MS3A 1GD1O 1RHRA 1O6GA 2GVDC 2YJGA 5HS6A 2D1RA 2GOYA 4YIKA 4XPZA 3LD9A 4F9EA 2WD8A 2HLPA 1QGUA 2GN6A 3DE0X 4U8GA 5FBWB 4CR6A 3ZWYA 1TKBA 1R88A 1JQKA 2HCBA 4A8JC 2VEOA 4R6XA 2VOEA 1KZ4A 2BI8A 4U9UA 4HEA1 2BE7A 4DYVA 2YY7A 4WBSA 4X97A 2Q45A 3EOZA 5M29A 2C5FA 3LPAA 4HLUA 4QC2A 1SKMA 1YQEA 4DLTA 1U2PA 3GXOA 3CVXA 4ZYUA 2SNIE 2B6NA 4KV7A 1E4OA 4Q00A 5HGXA 1OXBB 1L3CA 3CF6R 4A3SA 1FQJA 1QZTA 3VI3B 6YASA 4XE5A 4X8MA 1I2BA 2XGPA 3UJ9A 4N4AA 2GRAA 1Z8NA 4JV0A 1P0IA 3R3WA 3P20A 4KUGA 2KI5A 2P0AA 3E9CA 2ISQA 3AG6A 1RQLA 1WRBA 2UUOA 4IHJA 4U7WA 2L18A 2IX9A 2Z2IA 2BSQA 4BP9A 1T6YA 2HFKA 1ISPA 2GXQA 3GU3A 1MOQA 1MRZA 1NATA 2FSIA 1IL0A 1QGYA 2CDNA 4YBZB 4QAJA 4ARCA 5HKAA 1PJBA 1NQAO 5GGXA 3RSLA 2H2FA 2H1IA 4EGQA 3V4RA 3AT1A 3ZDDA 1SKAA 1GFIA 1QANA 2FFQA 1PK7A 1L5GB 2P1RA 4LOLA 1E1CA 4R2MA 3B53X 2H1CA 1CHNA