2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
2VPQA 1DIKA 2R7KA 4M99A 2V5AA 1A9XA 5LP6F 1UC9A 3VOTA 4ME6A 2QK4A 3BG5A 1PX2A 3TIGA 1C3OA 1DV1A 2W6PA 4RZQA 3QFFA 3V4SA 5I47A 1CS0A 2IP4A 5BPFA 5KX5F 2GPWA 4FE2A 3R5FA 4FFLA 4XZ3B 1KUTA 5C8YF 3NUAA 1CQIB 4YJ2F 2YZGA 2R86A 2R84A 2OLSA 5JH7F 4FGRA 4EA8A 4DLKA 1AUXA 4O7TA 4MV6A 4EAAA 4EABA 3Q1KA 2V58A 3LP8A 2FPPB 4M9CA 3VPBA 1JDBB 2NU8B 1W93A 3ETJA 4HQ6A 2R82A 5J2TF 4O4JF 4ZQIA 2FB9A 2DIKA 2W6NA 4O4LF 4MV4A 5GONF 2YWVA 3RUPA 3R5HA 1JDEA 3OUZA 2VR1A 4O4IF 3U9SA 2GQRA 5CA0F 2CNUA 2YYAA 3VA7A 5C1OA 2FP4B 4O7ZA 1T36A 2DZDA 5LOVF 2ZDHA 1SCUB 2FPGB 5LYJF 2DWCA 1EUCB 4O2AF 3MWDA 5CB4F 2W6ZA 1GSHA 5BPHA 3R23A 2VQDA 2YZLA 3TIIA 3BSSA 1OBGA 1EHIA 2GPSA 4IZOA 3RV3A 2WYOA 3AX6A 3GLKA 1BNCA 1M6VA 2P0AA 4O86A 2XCLA 2R6FA 2Z04A 1E4EB 1E4EA 1Z2PX 3BSYA 1VKZA 3VMMA 2FPIB 5J2UF 4MV3A 2DLNA 3U54A 2W6MA 4TV8F 5FNVF 3U55A 1VBHA 2YW2A 2NU7B 5CAEB 2NUAB 2YZNA 4YBZB 1M0TA 4MV8A 3V4ZA 5KKNB 5H80A 4XYLB 2YS7A 2HGSA 4NYEA 2I8CA 2CNVA 2XD4A 3WO0A 2GQSA 5JVDF 1B6SA 3K5IA 3KAJA 2NPOA 3N6RA 3WO1A 1IOVA 1DV2A 2X0SA 3E5NA 4FFMA 5LA6F 4FFOA 1I7LA 5HBRB 2NU6B 2YL2A 1B6RA 4O7LA 1CE8A 2Z02A 4ZI7F 4I4TF 1EUDB 5C1PA 3TW6A 4MA0A 3G8CA 4O82A 2R7NA 1IOWA 5HV6A 4O7YA 2CNQA 5DMXA 3GIDA 3N8DA 3BFPA 3HO8A 4O7SA 4M98A 4O7NA 4EGJA 4ZHQF 2ZDQA 1ULZA 1KJ9A 3TINA 2R85A 3AW8A 2J9GA 4EGQA 3UFXB 4QSHA 3K5HA 1EYZA 4MV1A 3SE7A 3DF7A 4MA5A 4HR7A 1UC8A 4M9UA 2R87A 4HNVA 4YB8B 1VBGA 4XYMB 4C5AA 4Y8VB 3MJFA 2PVPA 3VPDA 4IWXA 4J6EA 5EZYF 1Z2OX 5BMVF 3BSWA 3KREA 2QF7A 2I80A 5D8DA 1KC7A 5JQGF 4O7WA 4WBNF 4L1KA 2R7LA 2C00A 1KBLA 4IHJF 3RV4A 1EZ1A 2HJWA 3KAKA 1C30A 3TQTA 1GSOA 2GLTA 3ORRA 2NU9B 1KJ8A 4MV9A 5JQWA 3Q2OA 4O7RA 4TUYF 3I12A 4FFNA 1BXRA 3LWBA 1KEEA 1M0WA 3JRWA 2CQYA 4EG0A 2V59A 3K3PA 4XX0B 3ETHA 4EA7A 1CQJB 4FFRA 2CZGA 1JKJB 4GGMX 4FU0A 1GSAA 1KJQA 2PBZA 1PK8A 4IWYA 4MAMA 4DIMA 1AUVA 4O4HF 3KALA 4IIJF 3JRXA 3HB9A 2W6OA 2VHEA 2I87A 3R5XA 5IYZF 2YZMA 5JVLA 4ZOLF 4E4TA 4YJ3F 2R7MA 3R9RA 1KJIA 3RFCA 4O84A 2W6QA 5K2MA 4FFPA 3ORQA 1KJJA 3JZIA 5LXTF 1OBDA 3MWEA 2W70A 1JLLB 1Z2NX 4C5BA 4HNUA 4O2BF 4EA9A 4O7VA 1A48A 4O81A 4MV7A 3U9TA 4TV9F 2YS6A 3WNZA 3JZFA 2ZDGA 1GLVA 1W96A 3G8DA 2SCUB 4I55F 2YRWA 3HBLA 5CA1F 2W71A 4C5CA 4O83A 1I7NA 1WR2A 4HNTA 2YRXA 4YAJB 1GGOA 3OUUA 4I50F 4YAKB 3VPCA 2PN1A 4WD3A
chains in the Genus database with same CATH superfamily
4DDVA 2WWWA 2FFHA 3ZBQA 3B1FA 3KXYT 1QO7A 1KK2A 4AY5A 4FIZA 3RVOA 3F49S 2H54A 1ZONA 4BWFB 3NEYA 4RCNA 3QFFA 1OTXA 2J3HA 2Q41A 2OXRA 4K6FA 1ORWA 2W42A 4FWBA 1WHTA 4B3IA 2Z8YA 4C89A 1V4VA 2FZEA 3FH0A 3LMKA 4EFNA 3LECA 1VJRA 4XDHA 5AFSA 1CJSA 4EW2A 4RK6A 3I8XA 4G8CA 3B89A 2D2XA 1D0VA 4HMOA 4XD7A 1Z15A 4CV3A 3KFXA 1IBLH 1O9HA 1VP9A 3Q5DA 3NHFA 3FPLA 3ZXIA 1GFSA 3PC2A 5HA5A 4DIOA 2W6NA 3QOFA 3HNRA 4JI8B 4C4XA 3ZU2A 1AS3A 2XZOA 3UY4A 4CODB 3U6BA 3G1TA 4K9OA 3A2KA 1Y6GA 3LKZA 2RH4A 5JC1A 4MO2A 4QYMA 3ST7A 1DHRA 3AU8A 4U5QA 5JC8A 3I04A 3HL4A 2Z3ZA 3JD2A 4YCBA 2WJWA 2IZ1A 2GTPA 2IBSA 5CB4F 2JB9A 4RFVA 2PX0A 1PJZA 1I1MA 3R23A 2XECA 5LP6B 2APJA 4TTIA 3EVGA 1OYOA 5KG4A 3QFCA 1LWNA 3B60A 3T5HA 1OX4B 2FHPA 2JAQA 3FMGA 1WS6A 4YALA 2WM3A 1YVPA 1EP3B 5SZJA 1J06A 2NZ8A 3HZZA 2FAXA 9MHTA 3H5WA 2R8KA 5TQJA 1X9NA 3EQ6A 3CGWA 3DEAA 5F3WB 1WBJB 2P2YA 2C5AA 5AKJA 4QGAA 3Q7PA 2I54A 1AB6A 1O8BA 1MA0A 2NVXA 2H5IA 4LW8A 2JLUA 5T6MA 3KR0A 1P2FA 2PMZA 1N8SA 3M82A 1FUUA 3PR3A 5G0UA 4QOEA 4QXAA 4D4HA 5TR9A 5F7ZA 4YT5A 1QGDA 4EKIA 2OCLA 2AF4C 2H07A 4YY3H 1XJQA 5IS2A 4E2XA 1JSRA 2BGKA 1XQVA 3IRUA 5LQNA 3GQBB 2DLCX 2XMGA 4O2AA 4PZPA 3DBIA 1N48A 5FTJA 1Y37A 1KSFX 4EY6A 2NAFA 3D6HA 2OZVA 5B7QA 1AUOA 3ONVA 2YNMA 1QHNA 5BRJA 5FPPA 4WESA 4JQCA 4EATA 5DGHA 1Z6PA 5K8UA 2PZAA 4HWRA 3L0BA 4X6LA 4HNVA 3JD1A 4MLPA 3PNSA 4BNUA 2D8MA 1CETA 2GZAA 5IH7A 3RJ9A 1Z2OX 1Y4UA 4P82A 1HUQA 2NO5A 3L8DA 5JQGF 2P69A 1R0ZA 3BRSA 4LQLA 3PF9A 3P9NA 4JI6H 1TT7A 1JFSA 5JRZA 5TF4A 3GNQA 3I92A 3EHEA 4QWCA 5DGCA 5DIFA 1R9GA 4I0WB 1HE3A 3BZUA 2FWBA 3KS9A 4EYKA 4XX0B 1FSGA 2J30A 3R8CA 3E2PA 4TQ9A 2A5DA 3C39A 3LV8A 1Y33E 2ZWIA 5BVHB 4MO9A 3HS3A 2ZTHA 2B4RO 2H1IA 2QYSA 1XA0A 3H4TA 1MGPA 4NXNH 5BW5A 5BUZA 5KB3A 3FKIG 3KYDA 2VF4X 1G6KA 4DB4A 2FQQA 2GN2A 4C0AC 3CNLA 1UBEA 4BHTA 3W9SA 4BJ3A 4WHMA 2PSHA 2Z4TA 1FNDA 2DHQA 1NYRA 2P2CA 4BN4A 2GXQA 2HREA 2JHPA 1I3KA 1XEAA 1KZ1A 1YXMA 4QDKA 1U8AA 2JHGA 2ZUTA 4AJJA 4NXMH 4WBNB 1P4RA 4RIIA 4CU5A 1S0UA 3L6EA 1IDN1 1Z26A 4JXUA 3QEKA 5LBUA 1IHDA 3RC3A 4HOYA 1DQSA 4Q7LA 5JRJA 2NT4A 3DR3A 1VYTA 4D43A 5JBIA 1TM7E 1HDIA 4ZFNA 3WGHA 3LX4A 1E7YA 3HU5A 3AEQA 2EX0A 1B04A 4GLXA 4U8GA 3GMSA 5TXGA 4Z9FA 3USES 2VA8A 1BE1A 3EZ7A 1J99A 3PITA 2UV8A 2O3RA 2E4AA 4FOPA 4CKEA 2VP6A 5H82A 3KVNA 1OI2A 2CKZB 3DB2A 1XMSA 2VKTA 3LTNC 1EP2B 2PGDA 4E13A 9LDTA 3F9CA 1SOMA 4XIYA 4HGQA 1DKNA 3ONFA 2G5TA 2VK1A 3C85A 3HDGA 4ZCMA 1GZUA 4HY3A 2R8HA 3HA5A 1J20A 1VZ3A 3SEFA 3IEPA 1H9CA 4LY9A 2VBIA 4AQDA 2F4VB 1C3XA 4J1QA 3T9EA 3WLFA 5B6PA 4NFYA 1JMYA 3AP3A 3FMIA 3WLRA 4HDKB 5FAXA 1VJTA 1Q1GA 5LQUA 2JRLA 1V4NA 1IOZA 5TC4A 2E9SA 2F3PA 1TJPB 3II6X 4PC2A 4Z8XA 3GRAA 3R3WA 4TL8A 5JJBA 4HGZA 4A3FG 1V9SA 3ZDCA 2F90A 3WYCA 4BLSA 4HATA 2IIPA 4NL4H 2W90A 3T35A 4DYDA 2TMYA 4HGPA 1EFAA 4ND5A 2JD1A 5AHRA 1T2DA 4GM0A 1XRNA 4TMTA 1W76A 5H80A 5BR1A 1EWYA 2CL6X 1DIRA 1K97A 4HZUA 1I14A 3O74A 3K5IA 3QY0A 3DDZX 4LF8B 2A9RA 3IDOA 3FCXA 3LAWA 4MPTA 3ZW7A 2PGAA 3OQIB 4OVKA 5C8DA 3GXBA 3AOGA 2PZLA 5E6SA 2K5UA 4JUDX 2VAMA 1PT8A 2H4HA 3S40A 4BQRA 1TOAA 3T0FA 3U44B 1PTJA 4ZT4A 2CNBA 2BM0A 4P0PB 2ZZKA 1MO4A 2DT8A 4RUAA 5CX1B 1UQRA 3H1PA 4RY9A 4EUNA 2ZJFA 3SR4A 3JQ7A 5T8KC 2PZFA 4ZYLA 3MWJA 5DG9A 5C7IO 4JGIA 4RTMA 2R87A 4Q1VA 4WLOA 2GA8A 5B5SA 4JI0H 4K6GA 2VYFA 2AZ4A 4IRUB 4ED7A 1TT5B 1N5KA 4E7OA 3ESXA 4L02A 3TX2A 3PSAA 3WWJA 5KFZA 1ECBA 3TAXA 1FS5A 4TQUS 4D9MA 3CWCA 4F92B 4KLRA 4LXTA 2AI1A 1B1CA 3MQ4A 4HX5A 2GUWA 4MLZA 4JJ4A 2GERA 3I12A 2Y76A 3KWLA 1Y6QA 4MTLA 2JKYA 3AM4A 3QMVA 4EJSC 1LY1A 1H0HA 3CHYA 5HYVA 5CLIA 4QOHA 2D00A 2RFLA 3UO8B 1UDXA 3EOZA 5HM8A 2R8YA 5CVDA 1JR2A 2P1ZA 1E4FT 3KOYA 3CLRD 3DAFA 4W99A 1G66A 3HA2A 2I55A 4PX2A 4MZDA 3RYTC 3AXTA 4XE5A 4TV9A 4CGZA 4A27A 2C2YA 4MPPA 5BWRA 2WI8A 1Y9DA 3HCAA 1I5RA 4BO9A 1XMIA 1QYXA 2EQBA 4ZC1A 1S3GA 1N5JA 2O8EA 2IHVA 1Y8CA 3RQSA 4W5TA 3RHTA 1GLVA 4CG1A 4KPFC 3DFZA 1NTRA 2PYIA 4UKDA 3TM4A 2VAVA 1WZEA 3JQQA 4X5OA 5AT1A 2D4AA 5L3VA 1Z7EA 1GCUA 1OTHA 4UCFA 2XJ4A 1CZHA 4LHXA 2FSHA 2BFDB 4IYJA 2I3AA 5HXAA 3QJYA 5T4HA 5AXDA 3SF8A 2D5AA 1ZFNA 3DBRB 3VDQA 2FPUA 1GRCA 3G0OA 3JQFA 4IJWA 2BFNA 3AO0B 3EZGA 2H8GA 5JMOA 1QS0A 4LSXA 3U1VA 1ZH6A 5DF1A 1W7AA 1NKVA 2OOSA 5BPFA 4EG8A 2VP3A 3UHJA 2CXQA 2YMLA 1Y1WG 1EWKA 4FHGA 4IIJB 4YJ2F 1HWYA 5FOUA 2GN0A 3UPUA 2W11A 2XA2A 2Z2JA 2XMZA 3OSPA 2P6RA 3IBGA 4DANA 4X8LA 3OZVA 5E8RA 1WXWA 4NMLA 2PLWA 3LXUX 1OLOA 1L4UA 3OLXA 1TM2A 3LK7A 4UNSA 4A3MG 1QF7A 5ED0A 2B3DA 3IVCA 2RH9B 2P4HX 4APMA 4TN1A 5B7PA 3VU9A 1R6VA 4CVNA 4HQ0A 1OB5A 1H1DA 1RYDA 3NLLA 3V46A 1M54A 4B33A 3EVFA 4MB2A 2RK6A 2G8LA 1QZXA 2FUEA 1JFFB 2UZAA 3PXCX 1JI0A 2Q6KA 2I7DA 1K7XB 4R2MA 2HVQA 4EPYA 1I4EB 4EB8A 5IDVA 5ALYA 3VO8A 4J3JA 1ORDA 4LYAA 4DM3A 4Q7KA 4DPMA 1OF1A 3TCNA 2JA6A 1M6VB 3U4QA 1KDOA 2QDXA 4EDFA 4F9FA 4LCJA 2QM3A 4AMVA 3F5SA 1XBTA 2C07A 2XKKA 4DR4B 1OE0A 4WDRA 2OFFA 1BJTA 4BNTA 5JVDA 5D3MA 3ADKA 4K40A 1GPH1 1RJPA 2BELA 4UFNA 4JVOA 1QIEA 1T6BY 2VZEA 4RK0A 1PDVA 3FPHA 1G0OA 3LYUA 3ME5A 1N1EA 3EIWA 3Q8RB 2D8AA 2Z0MA 1IDOA 4Z5XA 4PHTA 1E6CA 4M55A 1E32A 1O0CA 4PSAA 2NUBA 2NU6B 4WKCA 2BJWA 1KXZA 1OT3A 5ALLA 1FX0A 4LYDA 1E1RA 3LS2A 5FYQA 2COEA 4F56A 3HXOA 4JFRA 3RKRA 2B1IA 3AHJA 4C7BA 4REQB 4RJKA 3COSA 1QZ3A 4NYMR 5FFMA 2OLJA 3F98A 1RQLA 1GGKA 1KO7A 4KHZA 4CUZA 1KOGA 1KY4A 2LPMA 5LVAA 4ZYXA 2ZW9A 4DV6B 1N7IA 2ID7A 2FE1A 3OE7A 5LNK6 3QYJA 3KYIB 1ZN2A 4RHTA 1KT8A 3H3VH 1ZUWA 3IL2A 3PC7A 1ZD8A 3MCVA 1UADA 3DCYA 1Y6ZA 3EG9B 3EZNA 1DWOA 2VQEH 4IHJA 3FGNA 3D54D 5FLYA 4DVJA 5AW9A 1XRRA 3HYTA 1SBIA 3BA6A 4URHA 1A0IA 4DUZB 3L7IA 3MTAA 3OU7A 3WJ1A 2PSFA 4RK1A 2I4NA 1PWYE 3TEKA 2NVYA 3UWKA 3OTOB 3LHDA 5KTMA 1CW2B 1U0JA 4RDCA 4G0UA 2QTWB 4KI0A 2ZM6H 4WLVA 3D6MA 5JCJA 3L18A 3E7WA 4UNIA 3HRKA 4ZI7B 3IKMB 3I5XA 3KJFA 4C2MA 3BJMA 4DJ5X 5IKPA 1JKJB 4CCSA 2GEBA 1XL1A 1XJ0A 1U4OA 4DCCA 1SFOA 2ZAIA 4FI3C 4FBUA 3SGIA 1JILA 1ZGGA 4R68A 3T8YA 1Q3TA 4D2IA 3KQLA 2WIKA 4Z9BA 2ANBA 4ABTA 2IOHA 1XLUA 1DIGA 5BSGA 1QKIA 3TRJA 3L02A 4C7OA 2E82A 4OYLA 4MI1A 4KXWA 1U1IA 3NVKI 1D04A 1RRKA 1IHPA 4LNAA 3W2GA 1ECPA 3CKLA 3EASA 1HORA 1T0HB 3IIKA 4BVFA 1VCHA 3FNEA 1PDOA 5F1OA 3E3MA 4EY8A 1E1CA 2ZE7A 3DE6X 4Y6OA 4RY8A 1IM5A 5EHXA 4ZREA 4YCSA 3IJPA 4TKMA 5AI4A 3QSYA 1U9ZA 4ON9A 2XVZA 2W5UA 1EJ0A 2ZSHA 5FJJA 5I47A 1CVIA 1VBKA 1V2GA 4LCBA 4PZ8A 1A0OA 3NW9A 1XTJA 1CQIA 2IXFA 1A7UA 2ASLA 1U9IA 5JH7F 4FEYA 2MYUA 4LGVA 5SYAA 2GN1A 4HZIA 2J0UA 5AHKA 2Q07A 4BZWA 2WYWA 4JJFA 4Y67A 2AMFA 4C4AA 2ICAA 1PS0A 3EUFA 2KBFA 1IEXA 1Z38A 1IZ8A 2HMVA 4MW4A 4QODA 3LP6A 1QF6A 2BKLA 3DW1X 1YK1A 3A9WA 3F6EX 1ZHSA 3H9QA 4Q82A 4PHFA 1AT1A 2EKZA 4D6YA 3WZMA 2VF2A 1S0OA 4CEJA 4F96A 3LY7A 2WKWA 2GLXA 3OZBA 2B0JA 4DIKA 3TW7A 1JQKA 5BPHA 1OFTA 1PZMA 3E7XA 2DFNA 4TLBA 4K9MA 1CB7A 5IT4A 2KPOA 1RHMA 5G4LA 3AIOA 3UJPA 3WLLA 2PGOA 5E95A 3Q85A 2Q49A 3JYQA 1OFHA 2OKCA 2YIVX 1LQUA 2OO3A 4Q9JA 4MKGA 3CZAA 3U55A 5TMPA 2HU8A 4WFIA 3U4DA 5HQ3B 1KMQA 2REXB 2C77A 1BD4A 2QQGA 5A6VA 1AD2A 2F48A 4EF4A 3QVMA 1RAIA 2F55A 1ZICA 2J6IA 2OXFA 4M8KA 1L4BA 1IOVA 4Z4GA 1DBRA 5EP3A 5EUBA 3UT5A 3I9MA 8OHMA 4ZXPA 5IF9A 4EW3A 5JCOA 1P1CA 1YACA 1PFGA 2ORYA 5C1PA 1JT2A 4MA0A 3DL2A 3GEPA 3ZCSA 1EB9A 3AEXA 4X65B 3MMXA 1UCFA 4V39A 4X3PA 3N2ZB 4PG6A 4EHFA 1OV4A 2CDNA 4AJHA 4WY5A 5B1HA 2JA5G 5JTUA 4L5JA 1S9FA 4Q9NA 3PUIA 1FJHA 2B5OA 2B2XA 1NURA 1FVFA 2EWVA 2ID8A 1L4HA 2B4AA 3EC1A 4QWMA 2BP7A 2G9QA 4JJGA 4RNDB 4B48A 3WDLA 4EHIA 3L46A 3IAM1 4V1CB 3RTEA 2XMPA 2CLEB 4WNIA 2BISA 4FM9A 4URFA 5I3ZA 2IWRA 2Q4BA 2QVLA 1SUDA 1SG6A 1OH7A 4C2TA 2DBZA 3NOQA 2OT3B 2GD0A 4B9EA 2PUWA 3GGSA 2JCYA 5BR4A 1XMQH 5FL7A 4EBFA 3EA4A 2EIXA 2EFGA 4UU0A 5F33A 2BHLA 4MRPA 2V3CC 3WNBA 2EX1A 1YZYA 3GB8B 1E2MA 1DG9A 3TBFA 1LX6A 2G4CA 3CW2A 4AZ0A 1RRPA 1R0RE 3WDKA 2IGTA 3TSCA 3NM5A 5LQMA 3AUSA 3W5DA 3VPAA 4UQPA 4AAYA 3IOEA 2VK2A 1VPWA 1MIOA 1GU1A 1SVMA 4O2BA 1PGJA 4QELA 1XD2A 2YU9A 4NOLA 3BK7A 5KT5A 3ZE1B 4IAJA 1KWKA 1AGPA 3LDFA 5JJKA 3EVAA 2C5EA 2CLKB 1SPBS 2B1GA 3STTA 2OCDA 2GJSA 1VLZA 1ADYA 2Z5GA 3K9FC 1FDTA 4MGIR 4I6GA 3HBLA 2HIVA 2ZS9A 3AF3A 4BEBA 2C4VA 1PVVA 3I39X 4PNHA 4YMTA 2WT4A 4H6WA 2MOKA 2UZ1B 4N3AA 3D31A 4KYUA 5A3SA 4E4YA 4WD3A 2D4HA 2H8KA 3BE5A 5KX5B 4ZZ1A 1IQ0A 1VI2A 3KSAC 2GHQA 4JLAA 5BN3A 4ME6A 3QGMA 1Z0ZA 3AJDA 1A9TA 3IAUA 1TAQA 3ILHA 1NOJA 4CMEC 3UNXA 2OGZA 2GXAA 4C4OA 4B3RB 2FZGA 1TUBB 3MUNA 4U6QA 4KZKA 2BQRA 3BCUA 4WHXA 1R7RA 1LQ2A 3B9QA 3PVXA 1AKWA 3TNDA 3RAFC 2NZ2A 1RZRD 4RA9B 2BFMA 1KRWA 4JGBA 2XNHA 1B0PA 2C4WA 4G9EA 4LHYA 1FYVA 1T34A 4O4LF 4MHOA 4EHAA 2DQKA 3NCHA 4EFKA 1WVGA 4HN4B 1V16B 3PQEA 5ECDA 4JIMA 3FPEA 3RYFB 4XQ0A 3U4HA 3C3AA 4D92A 3EH1A 3LCRA 5CVTA 5A06A 1XP5A 5HFNA 5HF5A 2CLLB 4XQEA 3T41A 3WE7A 3VHXB 4RD6A 1JAIA 4B76A 1FFXA 2PU5A 3GZNA 4YHBA 1UJBA 3IE0A 2V55B 5AH0A 2W6ZA 1ULSA 1T35A 3VR3D 2AC2A 1NMXA 4I2NA 3W3AD 5DNDA 2XWBF 3GCDA 1L7QA 1DKMA 4RPIA 3W6ZA 5FA8A 2MINB 1K2WA 3PNKA 3DBVO 3CEPB 4EQ5A 2X3UA 2Z58A 4DA7A 1SXJD 4J07A 1UQUA 5AOCA 2YJZA 3SS7X 1ZHQA 4K6CA 5EWLA 1GEEA 3V1KA 4R1SA 4XYLB 1I7SB 3VU8A 4DREA 3LGXA 1NXPA 4ARZA 3L8CA 3GRPA 3I28A 2XTMA 5EC8A 2QW1A 1UDCA 4FLMA 5EQJB 4A8JA 4A26A 1Z25A 3K73O 3MSXA 3O8DA 2XCTB 1B00A 1WSCA 2RB5A 4M0CA 3FWZA 4FB4A 4YMSA 2YXNA 3KE8A 4DGSA 3ZCQA 1CJTC 3TZKA 1NBHA 2WZBA 3ORSA 4H7FA 1IHYA 5EDWA 1OX5A 5I7VA 2V7BA 1JG3A 1H94A 4WJLA 1BDBA 4RX1A 5EQFA 7MHTA 1Y5IA 5EZYA 3LY8A 6REQB 5K4GA 3G6YA 3C3KA 4TV8A 4IIGA 4YAWA 3ILVA 2JIQA 3RC8A 1QYDA 2O7SA 2XB2A 1MVNA 4KE8A 2ZCUA 2O1EA 2C0QA 4HNSA 4HFJA 2XPCA 4IH4A 4KBFA 2JJ1A 4UULA 1QBGA 4N6GA 1NMSA 2NVBA 3EXG2 2QJWA 5HRAA 1AQJA 4LJ8A 4OOEA 4ZVVA 4XARA 1RBQA 1Y4AE 3O73A 1MB2A 2VK4A 3BMQA 4EA6A 4UFOA 3A4IA 2OD9A 4DL2A 3K3PA 4RZSA 4Z0NA 4YAGA 4O33A 2X22A 4BVLA 3G79A 1OX6A 3DBLA 4R3UC 4O4HF 4R16A 2GZ1A 1UL1X 4HXYA 2PD4A 3UYYA 4JX9A 4X8OA 4LZAA 2ZP1A 3DV0B 2I5PO 3PW2A 1AH2A 1LSSA 1WDLA 1DEAA 2GXSA 1CNFA 4PAMA 1K3FA 4AD8A 4JJ6A 2DUJA 3ZDYB 4OMUA 5LQCA 4DZZA 3CH6A 3A3NA 4MQEA 4B4UA 4LJ6A 2R93G 3F5DA 4XASA 2R00A 1H3EA 2AJCA 1I50A 3H6KA 3BDVA 3OOEA 1NI5A 5CK4A 3C5VA 5BMVB 2C9MA 4NC9A 2VIIA 4OJYA 4NCNA 2DQ4A 4YAJB 3NGDA 1BIFA 1Y63A 1FFBA 2O2DA 2VS1A 4BFSA 2JFWA 3MJHA 1T0PA 2ZB2A 3J7AK 3SC6A 1Z17A 5IWAH 1YS7A 2A0KA 3PX7A 2ORVA 1LBIA 2HIAA 4I6JA 1EG7A 1SG9A 4G67A 2DE0X 4KXXA 4MV0A 1QK5A 1F1BA 3COYA 3RJZA 1ZOSA 2YOHA 4XUCA 1XKTA 4C0BA 3PJEA 1R6TA 2A30A 4M9RA 5FA6A 1I2KA 1AK2A 1EWVA 3W4JA 1GAJA 4HQ6A 2XCPA 2F8SA 1QE0A 3WMWA 5LXTB 2CHEA 2J31A 1QQTA 3FVTA 2W6IA 1QCZA 4JUZA 3D5EA 3CR8A 1CSEE 3QE3A 2VA3A 3MLAA 4IH1A 3O95A 1S10A 4UUAA 1FPQA 3MPOA 2FSVC 1G9SA 1EKPA 3D4BA 4IQFA 3AHDA 2Y4NA 4RIGA 5DBEX 2D0DA 3BAFA 2YHIB 4HAIA 3DEHA 2ZUWA 1EUCB 2WSIA 4AICA 5FYDA 4MCHA 3F1LA 3LA8A 1MOPA 5KUTA 1O95C 4R8RA 4IQ4A 3HH8A 2Z3WA 1I2LA 3HB5X 3L8HA 4QGFA 2ZBFA 2TRSB 2VHQA 1T8WA 1VE3A 1RM0A 5LQSA 1KPGA 4FEGA 2X58A 1C8VB 3WLPA 5I01A 8MHTA 1XFAA 3FLMA 1J1ZA 5BWTA 3LQ4A 1EESA 2PX5A 3ELBA 3N0VA 2J5QA 3I32A 3EAQA 3HYSA 4CM7A 4PXYA 3GLFE 2OCPA 5D7NA 2XX3A 2NP7A 2CMGA 3IAXA 1DC8A 3IVMA 4IMIB 4TLMB 5DVZA 1TVKB 5AWFC 3O8OB 4B44A 4I99A 1O9BA 3CB2A 3ZLUA 3ELYA 4JC8A 1N2CB 1WMBA 1FVIA 1GDHA 2CB9A 2NX2A 2ZAOA 4ILEA 3AUAA 2YV1A 1ECCA 4Y2UA 1HQKA 2QN7A 4JP3A 1TM1E 4RM2A 1M2GA 4PRKA 5TQ2A 1C50A 2N1BA 4ZODA 2OXTA 2CLOB 1W9MA 1FJXA 1GPNA 1JH9A 4ZHQF 2ASVA 1KJ9A 3IR6A 3K6JA 2W2XA 3EPJA 4IXTA 3Q87B 5L1JA 2X4IA 4YMIA 1PUJA 1IAQA 4PYNA 2ZIXB 2E2IA 2H7YA 1YUBA 3O8QB 3EC2A 4HHEA 4GSLA 5IDWA 4Y9RA 3OD1A 2JC3A 4LWZA 4NX2A 2HXGA 1WY7A 4K9LA 5BR8B 1ISRA 1RAEA 3MJTA 4CR6A 1WPRA 4ARAA 1C1HA 4NAUA 5KMGB 2PSJA 3W8EA 2AMLA 2RK4A 3WWZA 4DV0B 2VYNA 4CFSA 3WYFA 4XTRA 3T5DA 1QRTA 1SAYA 4EI8A 3IB3A 4R1QA 1PNQA 3I61A 2Z8XA 2HNKA 1ZM9A 5DNAA 2YWBA 3QKSB 5KNDH 1HURA 3LPMA 1E2PA 2W6JA 4HLNA 1JB9A 4Y2XA 1B8PA 1E5XA 2HK7A 1CZRA 1JRLA 5BN4A 4QO8A 5EINA 2ZGVA 1X2BA 2IKQA 5BSFA 3KSDO 3ROPA 4C5BA 2RJOA 2HAEA 3SICE 3BM5A 3JZFA 3O83A 3M6WA 4UDNA 4B17A 2ZRAA 1DB3A 5JOQA 2YWXA 1G8FA 4JYAH 1CUUA 5M7EA 3KHHA 5KHLB 4OP1A 5IZCC 3PJRA 1A98A 4HX2A 4TRMA 3UF0A 2WVHA 1FNSA 5EUMA 1ZI6A 1LBHA 4YPFA 2QAGC 2PTGA 3CX6A 4RTJA 1DTEA 1CLEA 2F1IA 3W06A 2P6UA 3LG2A 1IVYA 4TUYB 4R83A 3AFNA 1ML3A 4OMFG 4BBAA 3STUA 5IBCA 5KFTA 3SDZA 3OHPA 1R8JA 2NZUG 3CVJA 2AH5A 2GKGA 2JCBA 1QLJA 3ISJA 4RZQA 5E7MA 5F9LA 3UYKA 3AT1A 4AWXA 1YIOA 2F8MA 3CEJA 4QUEA 4WKPA 3UMRA 3W5VA 4KVFA 3SZGA 1HRDA 3WBFA 2OCYC 1QLHA 2XCOA 3AEUB 2R1VA 2QD5A 4N12A 4IQGA 1T8TA 1O58A 4B3FX 2XQFA 4RNCA 2QLFA 2OBNA 1DQZA 2XTZA 4I5DA 4K1LA 3EIQA 5B7NA 2B37A 2CNWA 1DJQA 1V43A 3MCTA 4RLFA 1P73A 2H4YA 3ZHTA 3S8MA 4QYXA 4RA6B 5B58T 5CW1A 3GTKA 5LLDA 4WGGA 2FG6C 4HYQA 2WLTA 3WLJA 4F72A 4BNDB 3QEJA 4U2CA 1QYIA 1HV8A 5A3QA 1AJEA 2X2PA 1YAJA 4LF7H 5KOHB 3QX7A 2NQTA 2ZPTX 1M2HA 1SKUA 2XDQA 1WMAA 2R8ZA 2ZBDA 2OD2A 2J87A 4EMTA 3AXSA 1GNQA 1BH2A 3S5UA 3NDJA 3VYUB 1FLVA 3K4QA 2RB4A 3MAGA 5K3AA 3GHHA 4MV3A 3W6OA 2OC4A 4KIJA 3BD9A 2W2LA 3GR6A 6ABPA 5AKZA 4ZZ3A 4J75A 4V02A 5JJLA 4CTJA 1CR0A 3IUJA 4UVHA 2O8CA 1U8EA 2KMLA 3UB3A 2RGWA 1WQ3A 1E58A 5CIQA 2XQIA 3FPAA 3PRHA 2HQBA 3IJRA 2Q8PA 3EC7A 4WZAB 4IOLA 3V4VB 4TRNA 4NIMA 1S89A 3P9RA 3H05A 4WGFA 3OT1B 5DDIP 1FVXA 2VUIB 5K3CA 2VPPA 1W6UA 5F77A 4JL5A 3DKRA 1CX9B 3DF9A 1OVGA 3LM8A 1QVZA 1RM4A 1CG6A 4DS3A 1YJQA 4OV6B 2OZEA 2IYXA 3O4IA 4G4IA 3AKEA 2J9GA 1NE7A 4NOMA 1Y42X 2SNIE 5ELLA 1GTSA 2B20A 4JWKA 2ZB7A 5JAMA 1SCKA 3HWWA 4BLTA 2PUVA 5EJEA 4JJZA 1UMBB 2G83A 3F47A 2C8VA 3KREA 4FQ5A 2ZFUA 3R09A 2YOFA 4L1KA 3BORA 2CUTA 4RZIA 2OEPA 4XCXA 1GCAA 2UXCH 3QSGA 4NDAA 1FMLA 2H4JA 4G5XA 4RAYA 4J7XA 2QTVB 4NH0A 4CIBA 2Z2ZA 3PX2A 4AKIA 4HSEA 2X42A 3AYZB 3NTVA 4A3GG 4NCHA 5IN5A 2IY8A 2XUDA 2ZUCA 4P93A 3OEYA 1J07A 2QT0A 1UOOA 2FPPA 1C80A 1XZDA 2VDOB 3RADC 2O7QA 4XWGA 2K2WA 4RETA 4YDQA 4PSKA 2IS2A 4G6ZA 3N58A 1TDJA 4MP6A 4EKNB 2JVKA 4ZVSA 4B7ZA 4BUZA 4MVJH 1OBFO 3PEFA 1LI5A 5IZ4A 2MSNA 1RLIA 1J9ZA 3NPMA 4CHIA 5KDDA 2W2VA 5K3OA 2YRWA 3KEMA 5JZSA 4MLCA 3QEMA 2VP4A 3FJOA 4GC5A 1BS2A 2KM1A 1TZBA 3DE4X 3B7GA 2PRKA 3N2GA 1BMTA 3H2GA 3ILYA 3R9KA 1X8LA 1EPUA 5ENVA 4BZXA 3E82A 1HOTA 3WK4A 3AHFA 3ZHXA 4KR6A 2HHHB 1NSYA 5ADHA 2HLHA 4HKTA 2W8BA 3KLNA 1EFRD 2XEDA 4F3YA 4R0MA 4HT3B 1GGHA 1OWTA 5FH9A 1W36B 5KJ1A 4L50A 5FNZA 4HDCA 1GKYA 3LQKA 3ECSA 3KCQA 2EF0A 4XWKA 4P1ZA 2J0QA 3VR2D 4Z4IA 2E6UX 1LV7A 3N70A 1SG0A 3ETJA 3KP1A 5GM2A 3PLRA 4XUDA 3IAEA 5HGXA 1GPWB 1J5XA 1GYFA 2JI7A 4YFVA 4MEBA 3FMPB 5C5EA 2Z43A 3TQQA 2WQ6A 2DFPA 3LW7A 5T64A 3F3YA 3JWIA 3GP8A 1OWLA 4QIHA 1RYBA 1YQ9A 3LBAA 3L40A 3DQQA 4Z3OA 3MJ4A 4OUDB 3BS4A 2EJUA 3RFUA 3QQ5A 4HGRA 5FBHA 2FVYA 4B3CA 1SHTX 1N7HA 4ES6A 2AJBA 4OL0A 4C6HA 4UNPA 5HIKA 1D5WA 2O59A 3GLKA 1BNCA 3GV0A 1JAYA 4P8RA 2BE7A 1WCXA 2UVQA 3L8GA 4IFTA 2OFXA 1WP9A 4R2WA 3BRWA 3FUCA 1EDEA 4Q44A 1HDZA 1BFKA 1ZD1A 4G56A 1LLCA 4V0QA 4M8IA 1UKVY 4YMGA 3GNTA 4KGXA 3IHLA 1RR6A 4ZVRA 3H4VA 1XYGA 2HF7A 5FHQA 2Y99A 3FG9A 2JHFA 2UAGA 1GIAA 1IJEA 4HN9A 4S05A 2VUMA 4QM7A 4XWOA 2QLMA 4YMWA 1VSVA 3LZCA 1EXMA 1UXIA 3FPJA 2YV3A 2B82A 5G0WA 3Q9UA 1L7OA 4KREA 2O6HA 1YL7A 2CXPA 4RMIA 3F6BX 2J6SA 1OU4A 3BFPA 4MXDA 4DDWA 2L0XA 4DLBA 1SBQA 1H6CA 4OFXA 4RDIA 4IG4A 2DG2A 1WTAA 4IP0A 4DE5A 2CVQA 2VXYA 4MS4A 1XTIA 3V1MA 2VSFA 1ZKDA 2JIZA 2C2KA 1G2PA 1JV2B 4H7HA 3PQ2A 2YRFA 1N2BA 1JKXA 1ECFA 3MJFA 4QNRA 4RV9A 4XQ9A 2FYTA 3PE3A 1LD3A 1WJGA 3DMRA 4DILA 3QTBA 4FGZA 4E2FA 2QGNA 3BD8A 2NZWA 3CO5A 4GKKH 4PWYA 3CJQA 4BFLA 1IFXA 2DPXA 4OGLA 3HP7A 5DE3A 4AJEA 2CK3D 4EHDA 1Q12A 2BTOA 3BA8A 1U1DA 3C48A 3B52X 2OV8A 4U7HA 2L19A 1AF4A 3IAS6 3QPBA 4F2GA 2W8LA 2YWGA 1ZS9A 3Q7QA 3C8ZA 4Z6KA 5K0GA 4G4SO 4Y18A 1BU8A 3IQFA 3UBMA 3C0FB 5F3DA 3FPGA 4AVYA 3IJ5A 2BBWA 2PZEA 3CRMA 5AK4A 3KQNA 3S29A 1FNBA 3FKSD 2UUCB 3W6PA 3LPDA 3FETA 5H0IA 2BDEA 5L53A 2WB2A 5K2MA 5BWMA 4CLOB 3P32A 3GT3A 3A7DA 1B4DA 1GUYA 1DEHA 1Z9BA 1I5EA 4E6PA 4YAUA 2UDPA 4UQLA 4KN5A 5KI6A 4MQFA 1OXXK 3ROFA 2O3UA 4MPDA 3I3OA 2HRZA 4WX2B 3IT2A 1WV0A 4TOIA 4LH7A 5TT0A 4PXSA 5IVDA 4DUPA 4Y1RA 4YK7A 2Z30A 3L0ZA 1WDWB 5AIAA 5A3RA 4FBMA 4Q4JA 4IOJA 3MSCA 3GHYA 1JXLA 2Q21A 4ZJPA 1MD9A 1ISJA 1QBKC 3P96A 1TM3E 1E3TA 4I14A 1CS0B 3ZU4A 1GL9B 1X7ZB 3UPDA 1PJ8A 5DX1A 1VXRA 1P8LA 2BTQB 3CT4A 5C8YF 4XZ3A 4QFBA 2ZG6A 5GZ6A 2R5WA 1N34H 3HJGA 3GLFA 1UBUS 1P75A 2YC2C 2QG6A 3UCEA 2XCUA 1MBZA 4XM2A 1M8PA 1S2DA 2C9YA 5KFMA 1SUWA 1TEHA 1T91A 1GJRA 3HO6A 4CLXA 1ZXLA 3EPRA 4ZC8A 4ZQFA 3C3JA 1ZA1A 4HDAA 1GA1A 3F90A 2A4MA 1BDJA 4O63O 1JQAA 3V2GA 1XZGA 3GUUA 4ZGWA 2XB8A 1ULUA 4DPKA 1MH1A 3BGVA 4HPJB 1ONSA 4PPFA 2P9QA 4FMBB 3HYLA 4X1YA 3D43A 2C2EA 4L4SA 2NIPA 5HJEA 4FYWA 1UKCA 3NIFB 2E49A 1HYEA 1ZJZA 2EG5A 1FTWA 3S8YA 3ZH2A 2OYRA 1ESDA 3LA6A 3FFTA 2P62A 4YONB 5LKAA 1C7IA 2XDYA 2G67A 3OEEA 3FOFC 3UYLA 3N53A 5H68A 3OHMA 4RIEA 1ISGA 2QDKA 4CHTA 4C4TA 5KAPA 1PSDA 5FI1B 2VP2A 2AG0A 2C54A 1PT7A 3O2NA 2DKFA 5K6AC 1FNMA 4L8FA 1RRFA 1D9ZA 4CM9D 2FR1A 2CHGA 4YBZB 1W4AA 3C3BA 4HEJA 4YJDA 3OE4A 3PKIA 1L5RA 1KYIA 4N18A 3QTTA 5BW8A 3JW8A 4PRZA 3LYAA 1N0UA 1V7CA 4NQZA 3IVGA 1TTTA 4QFMA 4I3HA 1KNXA 4QVIA 2PNJA 3I05A 2H1WA 4ED8A 2QTCA 3LCVB 2C1EA 3FF1A 2WHXA 3FGZA 3KEFA 1EDBA 1SIBE 2REQB 3GCWA 1EQ2A 3BL5A 2Q45A 2Z6QA 3FY4A 5KJFA 1HZZC 2O7VA 5CJJA 3CKKA 3HMKA 3WIUA 4Y6SA 1F7UA 3ER9A 1OXTA 1P0MA 3TJZA 4TLDA 4OXYA 4D96A 3OF3A 5AW8A 3MFYA 1VKJA 1VFPA 1T9KA 3BXHA 2OWOA 3OLYA 2BDTA 3DOJA 1V9LA 2G72A 2BRUC 1X38A 2J5KA 3Q3VA 1PQ4A 4RYDA 1LVGA 2O8DB 1ZETA 3UGKA 5EJ2A 1Q83A 4YJGA 2O7RA 1EUYA 4GU5A 1BE6A 1OJLA 4KVZA 1A96A 3HXPA 3Q72A 4NJEA 5GV7A 4FNGA 3IIMA 3RTAA 3OMWA 5E3HA 1JTEA 2R65A 2QMYA 3LDGA 4J4HA 4AX8A 5SZIA 1L5QA 5CTAA 4A3CG 1BA3A 4ZCIA 5CEJA 2Q6IA 5IXSA 4QM6A 4BVHA 3TLZA 3FCSB 5CM0A 4W7SA 4N0PA 5AW2A 3FIJA 3K0EA 4A0FA 2DPMA 1FYFA 1RJFA 3VPGA 2GJ9A 3CF2A 2ISSD 4PR3A 5FOSA 3PBKA 1I2CA 3IIIA 2G63A 5ALDA 2WJAA 3HWRA 3A6HA 1IC6A 4P5PA 4QSMA 4YJ3F 3NHUA 3VR5H 1LDEA 5C31A 1VFNA 2AKEA 4I46A 3TRDA 2ASEA 4BO0A 4MR8B 4F38A 2A1UB 2OCKA 4D41A 1EAYA 3O5AA 5TQ0B 1I6MA 1R4MA 1GVHA 1OWNA 4YRBA 3WOVA 2ZXUA 5AXCA 1ADCA 1J23A 5I5VA 4C4YA 3T3MB 4TXLA 2EYQA 5DQHA 3W2FA 1M72A 4I1IA 3UENA 1Z74A 4K81B 4XXHA 2WF6A 4AZVA 4J94A 5DHTA 3L8YA 3H5IA 3TCKA 1U2QA 2HDWA 1G8PA 1CR1A 5EIWA 5JT1A 7REQA 4K6NA 3DGEC 2XAAA 4JIGA 3EPPA 5KEIA 2KE5A 2A9QA 2G25A 4GPIB 4EZBA 2KX7A 3M2PA 2GPWA 2PLNA 2D7DA 4V0SA 2HC9A 4CMHA 2VUSA 1L3IA 2HCFA 2BZ1A 1P9LA 3IQGX 3IV9A 2ZETA 4W63A 1WXXA 4A5SA 3KXIA 3MR5A 2ZUEA 2MSKA 2LR0A 4WQMA 4UD2A 5J2TF 5EZ6B 4NBKA 2QPTA 4D3FA 3ACCA 2ANCA 3M6FA 4AFNA 4Y6GB 3DXFA 2HK9A 2H2AA 3PUXA 4HD8A 5I7SA 3R5HA 4C08A 2VUUA 4X1IB 4RZHA 3MWEB 1NF2A 4ESHA 1FXSA 3WL7A 4ADSG 3OPYI 4C2UA 4KLCA 2O2CA 2DHEA 4D74A 1Z7WA 3BH7A 4UAJA 4CV2A 3C8HA 2J48A 2DWCA 4Y2VA 4M8LA 3AI2A 5L9XA 4I36A 4NZZA 2IYYA 2CMDA 5EHZA 2XBLA 1P1KA 4NXMB 4QWWA 1OBHA 3L7NA 2AC7A 4XYMA 3O1IC 4X94A 1OX4A 3IA2A 3LLMA 3O3CA 4TROA 4I5EA 1IRIA 3WRXA 2UXDB 4X66H 2H0RA 3S2ZA 1W4BA 4LC9A 1OW3B 1TYZA 1ZUIA 1OAOA 3FMFA 1EE2A 4OB6A 2P41A 4B43A 2BFFB 3VTAA 1BMDA 4FHZA 5DLPA 1N5IA 2VPTA 1U1CA 4JLJA 1DAEA 2WP8J 4QAJA 5F1KA 4LFBB 4FFMA 1S8FA 3FVWA 3HZRA 3LQQA 4M38A 1NQWA 2GD6A 4AJLA 2BGLA 4MZXA 1W4ZA 3NB0A 3PR1A 3UCXA 2D1QA 3I23A 1YZTA 3PW5A 4YRCA 1N5RA 3AUJB 3BTSA 5T57A 1AQNA 5KFHA 3GQBA 4PS1A 4EJSB 4LE0A 1KY2A 4EHBA 3E81A 2ERCA 1JG1A 1BDMA 5IDXA 3FAKA 2BT4A 3ZVKA 2ABWA 4OMDA 3KZXA 1XLTC 3GTJA 2O06A 5IM5A 4QXOA 4UTZA 4KAXA 1JEDA 2IPNA 2DERA 3ZHOA 1QAOA 1VIMA 4U7FA 4OATA 1IMJA 3HQ4O 2PX8A 5G1PA 4BKPA 2WKSA 4IWXA 2BI4A 3R8FA 4BCDA 2QPAA 2QV0A 2P9YA 2HLPA 1JIVA 2CXSA 1EZ1A 3Q2IA 1C4KA 5G53C 3GUCA 5LZ9A 3L8EA 4I19A 1UM8A 5F98A 1TU3A 2FFBA 3W9YA 4PY2A 4UAVA 4ALKA 2IH4A 4DDHA 5A3VA 5IRCD 1KZ9A 1N6HA 3SXUA 3WJ7A 3PDIB 3HXMA 3DXXA 1PHRA 4JR1A 3QWFA 5CGQB 3QHPA 1U2SA 4Y2RA 2FEKA 2J7KA 2IOQA 1OI4A 4RMJA 4IG9A 4BBJA 2ZWVA 1N92A 3C4QA 3JZDA 2A5LA 1JAHA 3E8XA 4DDKA 3JU3A 1EQAA 3E9CA 3HNPA 4OQEA 4RESA 8AT1A 5KT7A 2Q1WA 3ORFA 1MJGA 5BQFA 5JXHA 1SBNE 1PCXA 4EA9A 3NM4A 2QZSA 3ZX4A 1KI4A 1B6GA 1H8EA 2PL3A 2PWYA 2WTNA 4U0JA 1X74A 4F12A 2FTKE 1DJNA 3RHFA 4WBNA 1P16A 3PPXA 3IBFA 5I4KA 1V1RA 4RY0A 4CQLB 3T06B 1GQSA 3OA0A 4EL0A 2GFIA 1NW3A 5DHUA 3VJRA 2ZI4A 2IV3A 4ACAA 2P7IA 1E4YA 5AJXA 1AC5A 2VPSA 5B37A 2Q2TA 4GC6A 4Q9HA 3MWLA 3BPSA 4QUBA 1V25A 3RGWS 1E6KA 1XVVA 1M7GA 5GINE 1XZKA 4ML3A 2K2QB 4RPLA 3SS9X 1V5FA 3MHTA 3GI1A 1Q1NA 2GYYA 2DOKA 1VE7A 2Q3MA 5AKXA 3PHIA 2J9ZB 4L57A 5DEOA 4F1KA 1L5VA 5BO5A 1A2KC 1EX7A 3LVQE 3SJUA 2VSNA 4RGBA 3K2IA 2X0KA 4FS2A 1RC8A 3N39C 1KWGA 2QL6A 1X7WB 2MSEB 4IZIA 5IPFA 4FDMA 5CA0F 1VMAA 4NS1A 3AJEA 4TTTS 3F1KA 2ODTX 5KG5A 4Q00A 5IF3A 1P33A 3LD9A 5FR2A 4IJUA 3I01M 1IYZA 4H59A 4E08A 2ZDHA 1IAVA 2XGPA 1U1EA 3EPLA 5JO0A 1CQZA 4HDKA 3L41A 4RH0A 3R6WA 1GAEO 4WZ6A 3WK7A 4OO3A 3TIIA 2CUKA 1XLWA 3RM3A 1GZ3A 1VPDA 4X92A 4KXQA 1QRDA 3WI7A 3KL2A 3RUEA 3OVMA 1TTQB 2HQ1A 1CZLA 5EGNA 1U3TA 3T5KA 3QX3A 2GAOA 3JQ9C 3Q0IA 1VBHA 5FTKA 5H3HA 2VJKA 2JA2A 1IQUA 4WIAA 3T3IA 3T5AA 5KFYA 2OZLA 4R1LA 2YFQA 2JH9A 3DTVB 5L8VA 1D1PA 1UBJS 2HXSA 3HJNA 3DG9A 1B7GO 4UMDA 2A8YA 1UPBA 3M5WA 3CLKA 2IW1A 4EVSA 3O8CA 1W52X 1EVIA 5ALKA 5I5EA 2C7RA 3K72B 3EJWA 4LC0A 2XV1A 1EUDB 4JBWA 3CPSA 3TW6A 2VQSA 2IIVA 1KBOA 4X91A 4R7ZA 2NO1A 3L7YA 3U44A 3RVQA 1QAMA 5DTMA 4FYKA 1DVRA 3VO2A 1FYDA 5CX1A 2A0FA 1LB1B 3GOHA 3SHQA 3OOHA 2XGSA 3Q0TA 4IKOA 1SEIA 4RZXA 1ADJA 1TQ6A 1Z2EA 1Q6ZA 5KKCA 5EZ5A 2QYOA 5AYVA 4WEOA 3G2PA 5FPSA 1SXPA 4XOUA 5G1NA 3OC0A 2JI6A 4EB3A 4CQMB 5F5NA 3KQKA 1SEVA 5BYJA 1XTVA 3MTJA 4C14A 1XEXA 4HS4A 4JVLA 4ZYUA 2AJTA 3KEGA 5DOVA 1BG6A 3GAFA 4RQBA 4W5WA 1WA5A 3SF0A 4P7BA 1FMJA 3MQ2A 3H84A 3KAKA 2D5CA 1Q1ZA 1UBFA 3H2ZA 3ML1A 5EG5A 4B6SA 3UC9A 4WNYA 4ER0A 3LSTA 4G1CA 3UAOA 3L7LA 1H2ZA 1M0EA 1FE8A 1HM5A 5D00A 5DNVA 4LY3A 4JUBA 1XO1A 2QX4A 2FEXA 1T6XA 1R6AA 4CTNA 5EPEA 4DR5H 4FS8A 1VCIA 4Y2JA 1KQOA 4M6WA 2ZRMA 4FOOA 3EUEA 5ICEA 4M1QA 1R5JA 2CZCA 4AMBA 3RIZA 4ZO4A 4KFUA 2R97A 3DHWC 5JVLA 4MR7B 4HBGA 3AV3A 3TOCA 4ARVA 2PX4A 5KYNA 1K0FA 1D4ZA 3TTXA 5EWFA 3JZIA 4JSYA 2W70A 1OH8A 2J0EA 1RE1A 3OQ6A 1F2UB 4GOJA 1VG8A 3A6ZA 5ALIA 2HNBA 2KW5A 3N43B 4H7IA 4I3FA 4K5QA 1CHDA 1M66A 4HDRB 2C22A 1NE2A 4P9NA 2GD2A 1EEXB 4PIPA 3SHVA 1NU6A 3O92A 2I3GA 3U0GA 2OHHA 4PQYA 2ZBVA 3DWFA 3G0GA 5KWIA 4OKSA 5GP1A 3DBRA 3C1UA 5EIAA 3ZPXA 1P44A 3DMFA 3THYB 3CLUC 3RLIA 1HEUA 4X7MA 1BDIA 3T3EA 3F7MA 3DP7A 4HB4A 5HKBA 2I76A 4ESVA 4P84A 4HADA 3OX1A 2HY7A 4PZLA 2R3SA 3ZWNA 3GFPA 4CMIA 5D6OA 3DMHA 2O3SA 2OMEA 4H7KA 4D79A 1BCSB 2Z57A 1CKOA 4AO7A 4MV6A 1T3TA 2WIDA 3ND7A 3GA0A 3ZJVA 3MRSA 4XLTA 1I7QB 2O54A 2XMCA 3N2EA 1CC1S 2MU1A 1OXVA 4F1WA 1QC5A 3WLKX 2IUFA 3QJGA 2ZI3A 4MVJI 3HBNA 3UAVA 1DAAA 4M8SA 4BLQA 3WKCA 4DXDA 4HN2A 1CB0A 4X63A 4UATA 4IS2A 3OQVA 4NOJA 4RNMA 1YQXA 2WAYA 4D81A 1JFFA 2C96A 4OQZA 1E2EA 1KIMA 5KSZA 1OV6A 5AK5A 5J23A 2FCRA 2BGIA 2FEWB 3B2NA 3RSQA 3NTLA 1M6VA 5HCIA 4MUEA 2VRWA 2HQOA 4RL6A 3QVXA 1TKBA 2PUDA 1DINA 5LCXA 1ZOIA 5FEMA 2O20A 3LUBA 2CCJA 2TYSB 4Y1GA 3RASA 1GFIA 3RB0A 2HDHA 1M2NA 4HRAA 1EFTA 3QE0A 5G3YA 2PRYA 1RXWA 1ONOA 2NTVA 5CFQA 4ECRA 1NF3A 4YCNA 5SZHB 4E11A 3LOPA 3RBAA 3QUSA 1MF7A 5HZKA 2X1HA 2ZUDA 2W2KA 3B5IA 2EJ2A 4R3NA 4X64B 4IUYA 1BMFD 1Z8DA 4UPDA 1X8KA 5F12A 2Y9PB 3ZHZA 5K0NA 5JY6A 2HUPA 1C0IA 2IYNA 4NMMA 2VK8A 2CWDA 5CVVA 3AKYA 2CNQA 4REQA 4BV9A 5M2QA 2QNRA 3QE2A 3I1IA 3NWPA 3W0LB 3R3JA 4QEDA 1ZNYA 4PF1A 4ZI5A 1XTRA 2YICA 1Z4PX 3NASA 1PWEA 3DB1A 4JV5B 5DNCA 4G84A 1E60A 1GU7A 4PSUA 4OGGA 1UFKA 4ND7A 2Z5LA 1SHLA 1C4XA 1ZM4A 2EP5A 1N7GA 1XB2A 3G6VA 4JEIA 2DUNA 3ADPA 2ASDA 5FBRB 3GWZA 5E9QA 3ZVMA 2QRKA 1KEWA 1YIAA 3IX7A 2X9QA 2IYAA 3DZJA 1GG5A 3QEOA 2FKNA 3L7JA 1G8KA 1YS9A 3BDAA 1TCBA 2P2GA 1N3YA 1L8XA 4LBZA 3B7WA 2YDXA 4EKYA 2V7TA 3C1TA 4IGEA 1BXGB 1IXRC 4MJLA 2WHQA 4DG5A 5JAPA 1O5TA 4KFSA 1Z36A 1JKJA 4HAVA 5JE8A 4DLUA 5FULA 1ECJA 3C0KA 4JYMA 4AKSA 4IX9A 4Y9SA 2PH5A 5F2NA 4FPXA 3KALA 2D1TA 2VH2A 3DW3X 1QIDA 3VR4H 1YA4A 3AH8A 1LDMA 3BXZA 2WU0A 5D1HA 4B6OA 4UARA 1AZSC 3NDIA 1SC1A 4HNAB 2JGLA 3TE6A 3JQBC 2RDMA 3BJEA 4TQGA 2LKDA 2GJ8A 4ABYA 2QJOA 3BBPA 3BBLA 4PC3A 1XIVA 1Z7YA 1P2BA 1XE3A 5A0TA 4EO9A 1W96A 4O83A 3W9BA 3GPDG 3CWZA 3DZBA 1OKKD 4JNKA 3L82B 4F6LA 1Q11A 4P4SB 5FORA 4BLVA 3QLVA 1IQRA 3S70A 2H5LA 2LCFA 4AY3A 1JIKA 2JLVA 2P27A 3C98A 4N7BA 2QK4A 1NP6A 1VB5A 5IKMA 1JDBC 3PZRA 4EGFA 1ZMOA 4K2HA 3EBLA 4L7VA 1EGAA 1GKIA 1MJFA 2R2AA 4BEWA 5K5EA 3DEJA 3QHQA 2HX1A 3OO1A 2O2ZA 4NU8X 1DXQA 1L7BA 3JQAD 2P6MA 2YCLA 3BWXA 3TRKA 2FW8A 3Q1KA 3BMCB 4DCUA 1JXMA 1MT0A 1Z12A 1G2WA 3N2KB 3D4LA 1LK0A 3VYVA 5KTTA 2DIKA 4UNRA 2DULA 3H0GG 4MV4A 3A6PC 4DMUB 1CY7A 3QLTA 2F3TA 1UBGA 1RPJA 4WFQA 2IK8A 2PNFA 2VDUE 5EYPB 5JDIC 1XU7A 3OH8A 2YXBA 1CD5A 1RM3A 1BX3A 4Q1AA 1GTG1 1ZIXA 1NHGA 1UNNC 2RBKA 4YRJA 3VYSB 1ZXXA 5I5YA 1ONBA 1SZCA 1F0KA 2O3QA 2JL1A 2R8XA 2ZBUA 2CKDA 4D4GA 3PHCA 1ZSNA 3D3WB 4KIGA 3DOOA 2EZ9A 4MVJG 4F4ZA 3ANXA 5HVNA 2WD8A 4QYWA 1PEDA 3JYHA 1E9FA 2AW3A 1EGVB 4AWAA 4L74A 1JQLB 3MW8A 2EYUA 4N8DA 2HGSA 3I64A 1YR3A 4M60A 3H40A 1JIHA 3NXSA 1K8YB 1DEOA 4H4DA 4ZPXA 1CQJA 1YCDA 3MK31 3NWJA 1Y3BE 2H52A 3ZOKA 4UM9B 5DEIA 2VRBA 1E3QA 1JIJA 4DMFA 4JI5H 5T4FA 1WZ2A 3HUTA 1JVSA 3ESRA 1URPA 2AXPA 3KOUA 3JZ6A 3FKJA 4PYOA 4XQGA 5GJCA 2NZVG 3N0XA 3NHZA 3K7EA 1QFYA 3CNQS 2NMVA 3B82A 1QYWA 5TPWA 3SHOA 5K09A 5AICA 4RLQA 2M32A 2C28A 1FTNA 1BW9B 4QW8A 1CJVC 2P68A 2P67A 2ZBPA 4X62B 2JFQA 3F6SA 2VXBA 3E53A 2XMSA 5AHXA 4DV1H 3UAZA 1YZQA 2ISQA 2V9CA 4Q47A 1Q74A 3KJHA 4WBSA 3L79A 5DP2A 3G5MA 4V1CA 4QYSA 1NQAO 1ZH0A 3KIPA 1G3IA 2WLSA 5LMNB 4LJ9A 3CV3A 1EFDN 3ND8A 3GAZA 1HDCA 3PS9A 2QUJA 3D8TA 3ZNOA 4DN6A 5BW4A 4GYKA 3PPVA 3CBQA 3F6CA 1VBFA 3AR3A 1J2TA 4BP3A 4JLMA 3TO5A 1SIWA 3K71B 1RQPA 1YRQA 2NQ2C 3UJ3X 2ODAA 2EATA 1W0KD 3ILXA 3ZZUA 4ND3A 4FVTA 2IWHA 3IPRA 3D8SA 4F84A 3ZUPA 2R8IA 1YNSA 2YN4A 5LWHA 3GLIE 2DWQA 2YVLA 2W6OA 1Z45A 2YY6A 3OLCX 4HL6A 3AINA 2HMTA 3BYZA 4RD4A 3E22B 4RSHA 1DTWB 5E2BA 4ICIA 5M04A 3K05A 5B6JA 3RSLA 2CJXA 2E18A 4DBVO 2EG9A 1Q0QA 3UOAB 4TV9F 4BECA 5KNBH 3HJHA 2VJYA 3PG5A 5JS8A 2VT3A 4W6QA 1Y7HA 1IXKA 4FS3A 1G7RA 1SCAA 3T1HH 4BNIA 2Q3EA 2YY7A 2UZ1A 2BMEA 4GXTA 2XB6A 2CD9A 1IRXA 3MPUA 1LSJA 3D1VA 4UVEA 4CMFA 4AG5A 4P22A 5KX5A 4P2GA 1PZHA 3ZI4A 2R6ZA 1C8LA 2BMVA 4BDSA 1T9AA 5FBWB 1V3VA 2RGXA 4XWAA 4R1OA 4DLYA 4EJ6A 4XKJA 2JGIA 1U63A 3U40A 1Z4KA 3IUQA 3SNKA 1MAAA 3KHTA 4R9RA 2DMRA 3VC2A 1TUBA 2B7BA 2AC4A 3M1YA 4BO4A 3R41A 3SQXA 1ZU5A 2R4QA 1YBFA 4RA9A 1JDBB 1GDDA 2OBMA 3ZEAA 5ALXA 4BNZA 2H9YA 5AR1A 1UXGA 1IZYA 2PEZA 1S1CA 2WYIA 5EP2A 2C97A 3WKDA 4RHXA 4C4ZA 2X3FA 3ZZ1A 1HKUA 2X5XA 3KQSA 3RYFA 3OCVA 5EGSA 5C3UA 2AVDA 3BRQA 3KUDA 3MBKA 3E4DA 2XHZA 4DRYA 1K6XA 1K83A 3VHXA 1RQRA 5UKDA 4QASA 5EESA 5D51S 1WHSB 1AU9A 2B1QA 4QDUA 4ITUA 1Q16A 1DJPA 1YQWA 4DLNA 4LX8A 3QEBZ 4OHXA 1P6UA 1XNQH 1SU6A 4K3VA 3EXFB 5P8WA 1G17A 2XCLA 3ZJ5A 2UZ3A 3A9SA 1JMKC 1ML4A 2MINA 1UDWA 2L42A 2C2HA 1K8QA 3LRXA 3X1XA 2OSBA 4MVJM 2FXVA 3HPRA 3TTVA 3ZCUA 4TYMA 4CI9A 2P9GA 2XUOA 5KVVA 3URMA 1W0JD 3PEWA 2HIMA 4JB2A 4D8UA 1B8NA 4GGOA 5JVDF 2VYCA 3UUWA 2O2JA 2FP3A 5TX7A 4JJ7A 4P4UA 2AA3A 1A5TA 2H1SA 1F2DA 1M2OA 4O7LA 2EZ8A 1QJ4A 1QHGA 4BWSC 1U9CA 4FQ8A 4BPBA 2BWJA 1L4YA 2Z1MA 1KRXA 2Q4EA 3FMVA 4HDMB 2GBFA 2H7VA 3INNA 3W5CA 3K9QO 4JLVA 5CLFA 3U7FB 3UN1A 3WFJA 4CM3A 1NOIA 1M1UA 1DFIA 1JLLA 3RVJA 5J4KA 4DMHA 3UFXB 3EXHC 3NBFA 5MFZA 3O0DA 5EWEA 3WWHA 3FUWA 3BCHA 4MKIA 2PVPA 3OZGA 2HQSA 3OAAA 3FCYA 2G06A 5EE3A 3GLHB 2ZVPX 1P1FA 5AKGA 1CT9A 3A9RA 4K28A 4CEIB 4DV5B 4N6OA 5HWSA 1WDKA 2VQFH 1Z5PA 1FUIA 3FOBA 2QI9C 2BJHA 4IHJF 2ZSBA 2HJWA 1Q7CA 1V6AA 3AYXB 4NWIA 4PYLA 3MUOA 1T4MA 3G7UA 2J5BA 3EF0A 3LWNA 3ER6A 4MDEA 1ZCBA 1EVJA 2DBQA 4F5WA 2VYVA 1NLYA 1XI2A 4BMOB 2FZKA 2QAGB 3BAAA 1NNLA 5AHOA 3U3DA 2QU7A 2ZWMA 3EQ2A 3H1TA 4G5QA 4ZOLA 1H2BA 1TJYA 5DM1A 4QOFA 2HJRA 3TEFA 2I78A 3B8EA 5LM3A 2ZWPA 4XLLA 5TB5A 1C8BA 3HB9A 5IAEA 5GQSA 1AMNA 1XQYA 3OWOA 4G9BA 1A8SA 2ZQ5A 3DV0A 4N54A 4PYIA 5K3DA 3A3KA 1KY5A 1N0VC 4KDCA 3QVGA 1TYDE 4UASA 3VJKA 3H2SA 3E9NA 1C2YA 4QJ5A 3KOOA 3I4FA 4DMMA 4O7VA 5CFOA 1C1DB 1DL5A 2V7UA 5K3SA 4M0LA 5EP4A 1UBNA 4KOEC 3BACA 3GF4A 4YAJA 3HDHA 3HDQA 3PZPA 5BRNA 1N2SA 1NONA 4E6EA 4OH1A 4B09A 4GSYA 3EEOA 4P98A 5BSVA 5F51A 1ZD5A 3KPVA 1Q95A 2JH8A 1GTMA 3R24A 5DSZA 1DIKA 5I7UA 4BRUA 3WAKA 2LV8A 2WD9A 4PAWA 2C2OA 4FYVA 3HI4A 4N5IX 2BOVA 1E3MA 3FBTA 3SYTA 4F91B 1XK5A 2PFKA 3G59A 3ENKA 3ZGOA 4XVRA 4O3SA 1A5ZA 3UT0A 3AY0A 1BWSA 2ZREA 2J6BA 3NANA 4CMAA 1RHUA 3I5AA 3ZXUB 2FSUA 1DWUA 3PV0A 5E9AA 4DGQA 4RSMA 3KOZA 3KFVA 3GYGA 3NGMA 2ROQA 3WGGA 4KR7A 3JSLA 1PJCA 4GRIA 1R8SA 5DYYA 3B2EA 2PX6A 1ZD2P 5LXTA 3OJEA 2AE2A 3VR6A 1DZIA 1HYHA 4L8YA 1YDWA 4ZAZA 3S2IA 3MTBA 5CH5A 2WTFA 1KETA 4N5HX 4RKQA 5CNKA 3L6OO 3AI3A 1RXSA 1HDGO 2P78A 1T36B 3RSGA 1HNZB 3NJ4A 2JZOA 2X1LA 2YHIA 4YI3A 4MWBA 4RUKA 1EUCA 1LFDB 1NRJB 2GZ3A 4R41A 2R25B 4WSOA 4OHPA 3TLGB 4RTOA 4KG7A 4KNYA 1Y4SA 4U7PB 5AW7A 1HYQA 4OAOA 3UHOA 1FK8A 3E3AA 2CVHA 2VOEA 1E1QA 3EVEA 4EYSA 5I7FA 2Y0DA 4J9KA 5KFUA 5FNVF 4XFJA 1Z4OA 4BZPA 2QVBA 3NKFA 4HVTA 4LGYA 5DHRA 2YW2A 2QM8A 4QHTA 1E99A 3EFBA 4YRFA 1KSGA 4RTQA 4J4TA 5MF6A 1VM6A 3NBZC 3TW4A 1CHNA 3RTCA 4EEZA 4COKA 1TVKA 3O8OA 1Z82A 4OOFA 2EW1A 2Q0XA 2A1TS 2WTXA 1EI9A 3SCZA 4TLLB 1UBMS 2ZIWB 2Y4RA 4JDUA 3MLEA 4DRXB 2Q7DA 1D1SA 4P4NA 3LFTA 3K3VA 5JUMA 4PAQA 2QXTA 4YRRA 4I8DA 4C3VA 4P7KA 4GOND 1DIBA 2AHOA 1A71A 2EXXA 1G9XA 4EZIA 1WXEA 4IUDS 3C7DB 5JSUA 4UVIA 4DQUA 1YS4A 3WGQA 3TFWA 3FI9A 1C9JA 3SOPA 3H9EO 1P45A 4J9RA 1QCDA 4QPNA 4GX1A 2AFIB 2HLDD 4CKBB 5IFLA 2QG9A 4F60A 3RVDA 2FPWA 1TA4A 1M1XB 4Q12A 2ZIXA 4XD7D 1WF3A 3O8QA 3M89A 1L9KA 2HPAA 4MWSA 3PICA 4G8DA 3A9VA 1RAFA 1ZC3A 4R40A 4M0MA 4FGKA 3PNBA 4OUKX 2VAWA 3EIUA 4WAUA 3NV7A 1XTKA 1YQGA 2GLTA 4S04A 5KFWA 1CUAA 3PF8A 2V45A 1N9GA 4K0RA 4U0KA 2J08A 2RKOA 3WWIA 1PVOA 3IP6A 3LWDA 3Q3JB 4PV7A 4IDBA 4I4TB 1J9EA 1Y1QA 4LZZA 1E4GT 2W9CA 1YONA 5FFFA 4IRDA 4FZ3A 3OPMA 1CE8B 2BJVA 2H16A 5C35A 1L0BA 3QKSA 4QOIA 4BMVA 4MICA 3W3ZB 2X0DA 1U3VA 3EE6A 1BMQA 2WZQA 1BYUA 1XAGA 5LMUH 3D3NA 4OFBA 1ARZA 3PC8C 1Y8ZA 3T95A 5IHPA 4MW9A 1Y7PA 3B6MA 5DBOA 1DKLA 2EFYA 4B3TH 4HNUA 2GEDA 4O2BF 1MRSA 4YIHA 4ZRNA 5JS2A 1QDLB 3DLCA 4BY9E 5F4ZA 1A1SA 1R9MA 4D0NA 5ARCA 1NIPA 1EH5A 3B5EA 4GBMA 1G41A 2E21A 3E23A 4Q7QA 5HP4A 4RD0A 2CBGA 4LC1A 3F8SA 4NHEA 5H9VA 1J0XO 3A6GA 1S7CA 3AFMA 4DJEC 2QW8A 4TUYA 4EJ2A 3OKPA 5C4IA 4EM6A 4O29A 2GARA 3EQ7A 3H20A 4R6XA 1TO2E 3D6AA 3VOAA 1JB1A 4JV0A 1N6LA 3V8PA 3ZDZB 3I0MA 4ZT2A 2LKCA 4DCOA 1N0HA 3RT1A 3B38A 1EFVA 1V8PA 4JX8A 2LCIA 1R0LA 2R84A 1XZMA 1I4LD 5DI9A 4B47A 4NONA 5TARA 4ERNA 2X9GA 2CJPA 5EXTA 3IMFA 1NF9A 2YNMD 4RF5A 3HU1A 1E5VA 3S0JA 3AEUA 3SHWA 4O5AA 2IS6A 2GN8A 4OYYA 1TA0A 3E2IA 5ETJA 3ICVA 1IBLB 5A6SA 3F9IA 5L3ZA 2JPDA 3QX8A 2D59A 4IL5A 4JROA 3CN9A 4UHEA 1FA9A 3NUGA 4KXLA 4RA6A 4DCVA 1QPBA 1ZL0A 1N1DA 4EFEA 5KU7A 3FB4A 2O2GA 4ZT3A 1ONPA 1PYDA 5CB8A 5K0EA 4R3WA 4XJXA 3K0AB 2O3TA 1YE5A 1RI1A 4BNDA 3Q5GA 1NVBA 2I2FA 3REQB 2QTHA 4L7QA 5ECYA 3MF4A 4YQZA 1YZVA 1VCOA 3TK1A 3MS4A 4Q05A 1V7ZA 3V55A 2AD1A 4CM6A 4F86A 5JD6A 3HP4A 5E6RB 5I8WA 1C7JA 1CULC 1AXEA 2EARA 1ZN8A 4H77A 3K0CC 1U0HC 5CAEB 3NDPA 1MHPA 1Y14B 1SRQA 4NYEA 1G55A 3SJAA 5K0SA 2FZVA 4Q01A 3DHVA 5KAMA 1KQ3A 3WO1A 2ODEA 1LLDA 1N1GA 1M75A 1J33A 4B6RA 4U2BA 5AVUA 1T94A 3RUFA 3ASUA 2CBZA 2JGJA 1H85A 1QZTA 1ZNQO 3BMXA 3OT1A 4GP9A 1BS9A 2OM6A 3GLIA 3S27A 4LQCA 1Z0KA 3U4CA 4GP6A 1GLGA 4YY3B 2V97A 2MYNA 4Z9AA 3I6BA 1HI9A 2AK3A 3RSFA 1KXJA 4Q43A 1N77A 4ZMBA 1I13A 1GPYA 4DXAA 3BZWA 3ZS9A 1P29A 2GMWA 4E2WA 1CY2A 3IURA 4BQQA 4ODIA 3GLRA 1JFRA 1TPZA 3P0RA 4R0VA 2BKVA 4LF9H 3QUAA 3R3ZA 1NOKA 3VSEA 2G82A 3PYMA 4MSUA 2HRQA 4R9UC 3PUKA 4CN8A 4A0SA 5EZYF 1L4LA 4P3PA 1UMBA 1C3EA 4G36A 4IIVA 3AJ8A 4UM5A 2BF7A 1R8XA 3PCXA 4EHHA 2R4TA 2NZJA 3QBTA 4R5HA 1RJDA 1JVBA 2NP6A 1PLLA 4X24A 5I9BA 1T4CB 5FB3A 2PDAA 5A4MS 5D5PA 3L01A 1LTHR 4JI6B 2CNLA 4ANFA 4MRMB 4EG0A 5BWVA 3KAQA 2QQFA 5FBKA 1NNSA 2JZNA 2R751 4FZRA 3F78A 4P5DA 1SVSA 5FCDA 4MAMA 1JQ3A 1FLDA 1GQYA 3PW0A 5LZ8A 1SK9A 3M4YA 1W2HA 3UJ6A 1V1JA 2I87A 4Q4AB 5EIBC 3K9WA 1TK3A 4CLRB 3G8BA 3R9RA 1ZVVA 2C5HA 1X19A 4NXNB 5FI3A 3NAGA 2QJFA 1HFJA 3JQ8B 3EWAA 1MRZA 4WK4B 1QGAA 2OENG 5KG1A 3EVCA 1U7WA 7AT1A 2NW6A 4CDGA 5KFCA 1F14A 3IUBA 3PHJA 5SICE 1UMDB 4ROTA 5KVCA 2ZJOA 5LP6A 2NXCA 5IJ0B 3ZJ4A 1W30A 5HFAA 4TWAA 2YWEA 3RAGA 1DC5A 5K8TA 1UDBA 3GTPA 2GLUA 4UBMA 2Q50A 5FTWA 4AF8A 3ZLJA 1G6OA 2R8GA 5I5TA 3R5JA 2RDIA 2HSJA 5E7QA 3DYIA 1OPRA 4Z54A 3KQYA 3A3YA 1GT6A 2X0JA 5LFAA 4DBZA 5HF8A 1QIGA 3L06A 1TE2A 3LLSA 4LYYA 2PUCA 1A7AA 4S1OA 2YUIA 2C4NA 4EAAA 3CLSD 4QZVA 2X8BA 3BT7A 1P7ZA 3IXQA 3DFUA 1ZN9A 3J80A 2VZ9A 4UMEA 1EM8B 1Z5GA 5DLQC 1XDWA 1VMIA 4L8GA 5JWHA 4I8XA 4QPCA 4LF4H 3VH1A 4KQ6A 3Q3EA 4KBGA 3LO8A 1JECA 2L18A 2PGIA 4BRWA 4RK7A 1WU8A 4RZUA 4PM4A 4OUDA 4IDGA 1IH8A 3HYNA 5EJIA 1HYGA 2PMKA 4B3DA 3VUEA 2BIFA 2M6RA 1ZR4A 4A3SA 3QLUC 4LV6A 5KREA 3WNVA 3WMEA 1RZ3A 2KBEA 1TW2A 5JAHA 5J5VA 3AERB 2C2MA 4L85A 3F97A 3H3JA 2B3TA 4TM5A 1W8DA 1N5MA 2JFOA 2VZ0A 5E3IA 2BEVB 4BTVA 2JCSA 4J0CA 3DVSX 1L2ZA 3K32A 1J9GA 4LE1A 4CCYB 4AKTA 3GUYA 2H65A 2ZYTX 2ONJA 4P0QB 1P1IA 2W48A 5IP5A 3ZWMA 4KOAA 2QTAA 1FDVA 3BD7A 1QFXA 3W1BA 3R75A 4N4AA 4F06A 4ZQGA 1LS6A 2B4TO 4E5SA 1LW7A 3E35A 4XX0A 3UQYS 5JFOA 3MT0A 2O2IA 3UMFA 4W8GA 3BA9A 3PTZA 1K68A 1DCFA 1PR3A 1XTPA 5F23A 4CDMA 5BVHA 4KQIA 2JFGA 3GP3A 3AV0B 2O0HA 4D82A 1ZKMA 4HYYA 1A0GA 2R7NA 3IH5A 3QI2A 1QHYA 4JOCA 5HDQA 4K9PA 1E2JA 4MPRA 2AN3A 1IZ7A 3CX3A 5ANRB 5AKEA 4FGWA 2AJDA 4ARSA 1L5FA 1R5NA 2GESA 4JC5A 3SSMA 4M0FA 2ZAGA 3THWB 3GTQA 3CZ9A 5DW3A 5I3CA 1YB1A 4WZBB 1TK2A 4L0CA 2WMOB 3EDCA 3TDKA 3KQVA 2FR8A 2UYOA 2ZE5A 3DMTC 1N36H 4JI0B 3LQFA 3OESA 1KYTA 3DDNA 2BKUA 1WZCA 4PANA 2XBUA 3ADBA 1Z56C 5DASA 1TWGA 3TF5A 3U4GA 2XE7A 4AJ1A 1N6NA 3D7KA 3QUQA 2E55A 1NVXQ 2XUPA 4DCPA 3GEDA 2W2OA 4XGKA 3CX8A 2XVYA 3IG0A 5T67A 3ZCXA 3UWSA 2OY0A 1A8PA 1PJLA 3HA7A 4B6EA 4MGZR 2HCBA 3JARB 2A5GA 4A3EG 1ORIA 3NHBA 3BFXA 3WGUA 5AVKA 3FVRA 1MOZA 1H6DA 4G37A 3V8MA 3V6MA 3ORHA 4V0LA 2ZJZA 2ZJ0A 2Y27A 4FDLA 3FX2A 2OGSA 3GTGA 5ARBA 3EZXA 4G0XA 3P0EA 4CLOA 2JEFA 3ZHCA 4FMDF 4B71A 1K6IA 1A48A 4MV7A 3V6HA 2PA0A 1OFGA 1IZZA 3N87A 1TW3A 1EUZA 3P9YA 3TZBA 2F8LA 4ZT7A 3I72A 2H1RA 1SVUA 4HNTA 1FW6A 4L95C 2HBRA 1NXTA 4KE9A 2XADA 4J9UE 3RFFA 2Y6UA 5A5FA 4WERA 5AXAA 2HJGA 4H3KB 1UUFA 3NIBA 1H6AA 4WI1A 1UODA 2A1TR 1BN7A 4P3XA 1P6XA 3ETDA 4CG0A 1E1RD 4HMPA 2OBBA 3QPDA 4FGLA 3PTLA 4H4EA 3B20A 3IDFA 1AGXA 3DH0A 1CS0A 5LDDC 1X7ZA 2WYHA 2V5VA 3I73A 3CF4A 5I45A 2PGJA 1NDUA 4QL3A 4WL0A 2P65A 4TWIA 4RAOA 2YZGA 4DVGA 2C3UA 2ZJ2A 1NF8A 2K87A 1NWCA 5JZ9A 2AKAB 5IYZB 4HTAA 2FWRA 4IAOA 2C2ZA 2Q6VA 3OE7D 4N41A 4R1TA 1XYYA 5DN6A 5DG7A 1V0JA 4I5FA 1GZ4A 2IYFA 3KKZA 3M7IA 4BQPA 3BICA 4JLPA 4GLWA 3OQIA 2RHCA 2W37A 2TSYB 1IUPA 3KNZA 4R2JA 4JI4H 1DZ3A 3X44A 2GZRA 4LJ4A 4I50B 2DQYA 4CR7A 1BVUA 5KTKA 4KVAA 5JCJD 5IT5A 1RQGA 4AIRA 1U7DA 2GPAA 1V5EA 4QFDA 1E79A 2QLJA 1VI5A 3KD2A 4ND6A 2VF7A 3K9HA 3W6UA 1TT5A 2XUJA 4HH0A 3IUNA 2R2GA 4ND2A 4JB0A 2ZI7A 2WC1A 5B3KA 3OJCA 2JIDA 3A32A 2GPYA 2VVTA 1JEEA 4HLQB 3RANA 5DYTA 1L5HB 3UV3A 5CR5A 2YWFA 4FSXA 4MQUA 4YLYA 2GQSA 4FD2A 5ITWA 1G2OA 1Y9ZA 3KXPA 4NESA 1I5OA 1ZY2A 4D4LA 1RKXA 4YA6A 5JS7A 2PRZA 5JAOA 4ZOCA 1Z22A 4HYKA 5JXWA 1GTL1 4RVGA 2C20A 2F3SA 2MCFA 3ZG6A 2WWVD 4L4UA 2GX6A 4HQLA 4X20B 1X94A 5D2CA 2F6RA 3L3BA 4IJMA 5CR9A 2OAQ1 3ZHSA 2OHFA 4E2ZA 4C22A 2ZIVB 3U37A 1XDGA 4HGNA 1SVWA 2VHTA 3PW7A 1HFKA 1MLDA 4IH9A 4CKWB 2O8DA 1Z7BA 2EOAA 1CDDA 2WKQA 5EE5B 5BP7A 3NFRA 1G5TA 1FP6A 3Q40A 2BFDA 2X8JB 4KDEA 2CMFA 1RWXA 2VQEB 4WN3A 1KK1A 1XQ9A 2ZJAA 3UC5A 4MWTA 4PO1A 3G85A 5K3BA 4PG8A 4KUHA 4DYVA 4NICA 3A05A 3NQ41 1MC5A 2W00A 5C52B 1EVEA 2CVOA 2G6TA 1RJEA 4WCVA 3TLCA 3AC0A 2ZM6B 3FSEA 5IVHA 1N2HA 1XRQA 2QD4A 4GECA 1L8AA 3N3BC 3DTGA 4XJVA 4IIJA 2N42A 3K8YA 1SKMA 2HIXA 2DQSA 1T29A 1A04A 1VDZA 4ECVA 2OBYA 1L4NA 2VYQA 1X42A 1AV7A 4RKRA 2IU6A 2XODA 3QTLA 1GFWA 3X1ZA 3O3NB 4QTYA 4NS4A 2MJLA 3P0FA 4GEGA 1U3WA 3K30A 1OZGA 2EL7A 3OURA 1KHTA 3LT5A 3VKGA 4JHLA 3VDNB 3U7GA 2RGEA 4KXMA 4A2QA 4FFSA 3TGPA 4M1KA 5CVCA 4JI7H 3V97A 3A06A 1TAGA 1GNTA 1Y9AA 5IBPA 4DSNA 2NLOA 2W4QA 3A1DA 1KAHA 3TQRA 1BAPA 2BHNA 2ZRFA 4RNNA 1XL0A 4IQ0A 1QJCA 3P9PA 1ZW6A 2ZB8A 1P2TA 2Z83A 2OILA 3KTFA 4LX0A 1ZRNA 3QPUA 2JASA 2LBPA 2V74B 4L5IA 2FN9A 3E3LA 3FA2A 1TM5E 3GRUA 1RADA 4TWJA 2XGOA 5K20A 3TQCA 4JLBA 5TE9A 1RLTA 4DR1H 4DWWA 4KLZA 2BBSA 2NXWA 4OP2A 1C29B 1P74A 3RAJA 3Q6NA 3IHTA 2IYWA 3FSGA 3PT9A 2QD3A 3IEUA 4R7GA 5EFZA 1NVMB 1DIAA 2CLCX 2IEGA 2AWOA 3VDXA 4CGYA 1DAFA 3MCZA 4EQZA 1UF9A 1WB6A 2NU6A 3KB2A 2HB6A 2WHYA 4J7AA 1PRYA 2G08A 3BCRA 4YYZA 3MOGA 3OX3A 4L08A 1R8YA 3EJ6A 3D6FA 3GUHA 2PV0A 3M1LA 4CKCB 1RBMA 3VVLA 2ZOSA 4FXPA 3P4XA 4V0OA 4XPIB 2OK8A 3AR6A 1MVLA 3ZKWB 2J1LA 1SCUB 1JXAA 4E09A 5FL7D 4O2AF 1JALA 2YV4A 4KLNA 4XVQA 2EC5A 3O26A 3BKXA 1UXOA 4Z7QB 1ZH8A 1PJQA 3INYA 3LBNA 3K16A 3THOA 1MQAA 4E1BA 3GRVA 3FNIA 4RQUA 3EG9A 5FPHA 5CXQA 3RTXA 3OQJA 3IQHX 3W7AA 1ZJYA 3HUEA 1DADA 2VPZA 3P2YA 1BVRA 2VJOA 1CJBA 5T8KA 2XYPA 4ZRMA 2X2FA 1VKOA 4BYMA 2F7SA 2NUAB 2GZHA 4PG5A 2J3MA 5ESWA 4AWBA 3PKZA 1FVHA 3KKEA 1F7VA 3ZCTA 4G5GA 1TLFA 4JYZA 1CEEA 4OKIA 1L4EA 1GM5A 2IYVA 4EMBA 1N2CE 4ZI7A 5EERA 5F5XA 3ACDA 3LBHA 2IEIA 3BTUA 4H17A 3N5KA 3O2JA 2Y1DA 2HSGA 3GFTA 4ZKDA 3F4LA 3UZOA 4MYTA 4YWJA 5BVGB 1KOFA 5H70A 2OH2A 5T5QA 1J2JA 2IYTA 3U80A 4QUDA 4Z7NB 5INTA 4ZRDA 4J76A 1HSZA 3QY9A 3DPUA 5WRFA 4EJSA 1BWQA 4DR7H 3N8HA 1X7GA 3OQHA 3PCRB 2P4SA 2C58A 4LYGA 3BXGA 5DI3B 1FDOA 4L4ZA 3H2HA 3R3UA 3QH4A 4PZ0A 2CC2A 2BAGA 3CIFA 2H9AA 3L4JA 3ZLBA 3FTNA 2M6LA 4A6DA 2AOTB 2XYGA 1RP1A 1M6WA 4KKVA 5I9TA 1FW8A 1YVRA 3T4EA 1I6UA 5FTLA 1YR1A 2PJDA 4QD3A 4CKYA 5MFPA 4PZDA 1AIPA 5FD6A 4PLZA 1EFPB 3EXG1 3OFKA 4U2EA 2ZJ6A 3MYRA 3UXHA 1F20A 1CUIA 2BFBB 5EMHA 4XVCA 3HCWA 3DAHA 4KW7A 4KO4S 3PO3G 2YN0A 4DCNA 1ZD4A 4RKFA 3C2QA 2H4FA 5L40A 1XMQB 3E1KA 3O4JA 3ETHA 4P4GA 2XB4A 3R3SA 1V51A 3F7NA 3MOSA 2K4MA 2ERXA 1FFWA 1DRJA 5B57C 1HLDA 2Z1NA 3AJ9A 1I3QA 2QRUA