2YRXA

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
420
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 420
sequence length 424
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yrxA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yrxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yrxA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2yrxA04
2DWCA 1VBGA 2V5AA 1KC7A 4WD3A 4HQ6A 3VA7A 4MV6A 1E4EA 4NYEA 3WNZA 1CQJB 3OUZA 4YAJB 4M98A 1DIKA 4O81A 5BPHA 1B6SA 1WR2A 2I80A 1Z2OX 2CNVA 1KJQA 1OBDA 2X0SA 2GQRA 5H80A 5C1OA 3Q2OA 4MA0A 2W6OA 1PX2A 2PBZA 3GIDA 5KKNB 4EGJA 3HO8A 4Y8VB 2GPSA 1T36A 1SCUB 4MV7A 2YZGA 2V58A 3TINA 3MJFA 4O7ZA 3RV3A 2CQYA 4FFMA 4HNUA 1KJIA 3KALA 2DIKA 2XCLA 1GGOA 2GQSA 3N6RA 4O7SA 2NPOA 4IIJF 5LXTF 2I8CA 2YZLA 3E5NA 1DV2A 5IYZF 3JZFA 3LWBA 3LP8A 5CB4F 3U9TA 4O7NA 4O7YA 4FFPA 2R7NA 4IWXA 1BXRA 4ZI7F 1JDBB 1KEEA 3U9SA 5HV6A 5C8YF 4MV1A 3VPDA 4FU0A 5J2TF 2QK4A 4O4IF 4HR7A 2NUAB 3I12A 4FE2A 5LOVF 2WYOA 2VQDA 2YS7A 1C3OA 5JQGF 4MA5A 1KJ9A 4TV9F 1OBGA 5JH7F 5J2UF 1DV1A 1KUTA 5BPFA 5K2MA 4M9UA 4O7TA 2R86A 1ULZA 3RV4A 1UC9A 5CA1F 4O2BF 2CNQA 2R84A 4MV4A 2ZDHA 1EUCB 4WBNF 1JDEA 2YWVA 5LP6F 3AW8A 2P0AA 1EHIA 5JVLA 1IOWA 4O86A 4EG0A 2R7KA 5I47A 4ZQIA 3JRWA 2VHEA 4J6EA 3Q1KA 4RZQA 5DMXA 4EAAA 1AUVA 3RFCA 4MAMA 4O83A 1CE8A 1EUDB 3HB9A 1KBLA 2W6ZA 4FGRA 4YBZB 2GPWA 2FP4B 2NU9B 5JVDF 1EZ1A 1Z2NX 2Z04A 2ZDGA 5C1PA 3VOTA 2R7MA 5CAEB 2R85A 1JKJB 4C5AA 3G8CA 4EA7A 2QF7A 3BSSA 2VR1A 3K3PA 2CNUA 2DLNA 4O82A 1UC8A 2PVPA 1IOVA 5LYJF 4YB8B 3ORRA 5BMVF 2CZGA 2YYAA 4EGQA 3R23A 2W6QA 4MV8A 1PK8A 5FNVF 3JRXA 4C5BA 4MV3A 4XYMB 1B6RA 3N8DA 4FFNA 1M6VA 2R82A 3UFXB 4YJ3F 1A48A 4QSHA 3TIGA 2I87A 3VPCA 3VPBA 4I55F 3BSYA 3KREA 5D8DA 2OLSA 2R7LA 1KJJA 3MWEA 5HBRB 1GSOA 2HGSA 1A9XA 1JLLB 3OUUA 3MWDA 3QFFA 3NUAA 2YS6A 2R6FA 3ETJA 2YRWA 3TIIA 4FFOA 2IP4A 1CS0A 2YZNA 4TUYF 2FB9A 4XYLB 3R5XA 3GLKA 2NU8B 2C00A 4FFRA 4DLKA 3TW6A 1GLVA 1W96A 2J9GA 4O7RA 2XD4A 1EYZA 3ETHA 2W70A 4O7WA 4L1KA 3WO0A 1E4EB 4XZ3B 4O4LF 4ME6A 2PN1A 2W6NA 5KX5F 2FPGB 2NU7B 5LA6F 1Z2PX 4IZOA 4ZHQF 3U54A 1I7NA 4MV9A 5CA0F 3R9RA 3BFPA 3HBLA 3KAKA 2FPPB 2W6PA 4IWYA 3AX6A 5GONF 1VBHA 2DZDA 2YRXA 1BNCA 4O84A 1GSHA 3JZIA 2FPIB 4EABA 2V59A 3KAJA 3R5HA 3K5HA 4I4TF 1W93A 3ORQA 1M0TA 4I50F 4O4HF 2R87A 4O2AF 3TQTA 2VPQA 2YW2A 4O7LA 4IHJF 4HNTA 5JQWA 4GGMX 2W6MA 3RUPA 3BSWA 2GLTA 4ZOLF 4E4TA 1C30A 1VKZA 4YAKB 2Z02A 3V4ZA 3VMMA 4O4JF 2NU6B 4EA8A 2YZMA 3R5FA 3U55A 2W71A 2YL2A 3K5IA 4XX0B 1I7LA 2HJWA 3G8DA 4HNVA 1M0WA 4DIMA 4M99A 3DF7A 4FFLA 3WO1A 1CQIB 4M9CA 1GSAA 1KJ8A 2ZDQA 4C5CA 4O7VA 5EZYF 3BG5A 1AUXA 4YJ2F 3V4SA 3SE7A 4EA9A 2SCUB 4TV8F
chains in the Genus database with same CATH superfamily
2OV4A 2PGLA 3M3DA 3ZWKA 1VB5A 5DI9A 1U8FO 3ND7A 4Q47A 1B00A 3QPVA 2ZJ4A 2X8WA 1W52X 3H5RA 1ICEA 2P5UA 4LXGA 1ZHHA 2VPXA 3MGCA 3PA8A 1R5NA 5A0TA 5AHWA 4HB3A 3WAKA 3OBBA 1P7WA 2QZ4A 2P1RA 2WG0A 3NBAA 5IPFA 3VGJA 4PC1A 2QGZA 1WU7A 3AUUA 4KKVA 2PZJA 2ZUSA 3TKAA 1PI3A 1JDNA 2GJ9A 2R62A 3QXJA 1H2YA 1TVKB 1N6RA 3DPUA 4DJAA 4Q12A 2IPMA 3P45A 1E9DA 1T4DA 4BMNA 1DV2A 5TB5A 4AL4A 4F3CA 1RLUA 1O94D 4CKWB 1X1DA 2CXSA 3ZE6A 1NLZA 3BMXA 5E6UB 3E7WA 1N9KA 1BMDA 1C3XA 1UFKA 2GLXA 4ESEA 4L74A 3OPNA 1W73A 4G0UA 3HI4A 3TZKA 7MDHA 3PSHA 5KT4A 2OGTA 1CRZA 5EXEA 4K0RA 4EKGA 3DWFA 3ODPA 3MTJA 2P69A 3ZNQA 2NADA 1T13A 1OVGA 2P65A 1Z5WA 4RELA 1K7XB 4J6EA 4GMDA 1GTG1 4F21A 4ZTZB 3FKIA 5KYXB 1T0IA 1T1EA 1CS4C 1U3VA 4HFRA 3ZJVA 3LOUA 2HU2A 1NF9A 3EAGA 1IQRA 2DR2A 4YT2A 3EGVA 1KQNA 5EIFA 1QG6A 2GCGA 3O8QB 2XHEA 4RAQA 1BU5A 1ETUA 1R0ZA 3KU1A 1E3DA 2GGSA 4MIOA 2AMFA 2Q8QA 3HCPA 3NMUF 1SUAA 2BEKA 4GKJH 2COIA 4ED0A 4PXAA 3HL4A 3EDMA 3KVRA 3SX2A 1I8TA 3AK4A 1YR6A 1GQOA 4OXQA 2VDOB 1BAPA 4C0HA 3BMQB 3MWYW 1IDOA 4DYDA 4CKZA 3LIIA 5THXA 1HEYA 5GV8A 3PNMA 1L7MA 2NW6A 1I7SB 3QA3E 5L4SA 4INZA 3MBIA 5JSHA 5KWJA 4X94A 4L85A 3VPCA 3KHTA 1JQAA 1RBMA 1UBCA 2B69A 3U4GA 1YT5A 2ZTHA 2VI5A 2VA2A 1CZHA 3K0CC 3GT4A 2PMZA 3IGFA 4QNRA 2AFVA 3C3DA 2BUCA 3DVAB 5JXIA 5EIHA 3QX8A 1BWQA 1QZXA 2HHFA 3EGXB 5K0SA 1NMQA 3RVOA 4AJPA 3GFBA 1H2ZA 3SNHA 4HTFB 3E5RA 2XCIA 3B3GA 3D6VA 1QX4A 1XD2A 1K68A 4AUNA 5K3FB 1QFMA 4W63A 2XD4A 2C2GA 3P9RA 5K2OA 4HN9A 4CM3A 3NEYA 2ZT6A 1K27A 1JXOA 3INTA 5LA6F 1AGPA 5FAXA 4CMEA 5JDCA 5IYDG 3RHSA 3TZQA 2EFEB 1KR2A 2O1EA 2C88A 4LF8H 4EG6A 3DVSX 4MB2A 1F4LA 3O8DA 3U1TA 2AK3A 1GWNA 2E1RA 5KT5A 4ZAVA 5ALHA 3IC5A 5BUQA 3N86A 4OLJA 4EO9A 4APMA 2FMUA 1BS9A 3R5HA 2NQ8A 3X1YA 4PBTA 3I4NG 2EW1A 2VF5X 1VGVA 2QD3A 1FFEA 3E23A 4EHNA 2AYXA 2UXDB 5AOAA 4PG6A 4FGWA 2CNOA 3U1VA 3ROFA 4B31A 4GX1A 3WK8A 2WLSA 2IPLA 4ZEOA 3SDBA 1LBSA 4GD3Q 1MC1A 4NBSA 4FHGA 4HMPA 3K8YA 4FEGA 4ZAGA 4LX0A 4UPDA 1KVRA 4C0QC 5BV7A 3N2EA 2C4UA 3GDEA 4RIEA 2K4MA 4ECWA 4HQ6A 1QQTA 3R77A 3A1FA 5A9SA 4LK2A 3WL3A 3ZWOA 3NR2A 4FCCA 3L7BA 1C0LA 5GM2A 2I66A 1N33B 2XYGA 4UXHA 3W2HA 3ZDXB 4E15A 4V03A 2R751 3KTOA 4MGEA 3NIFB 4M60A 3I52A 3INNA 2FPSA 4JLAA 1DU4A 1DL5A 2YWEA 3ROTA 1ZG3A 1YNOA 3UZUA 4NVRA 3F97A 1JJIA 1FXWA 1VHLA 5DIZA 2HKIA 2AFHB 1RJEA 4O7NA 1K2WA 4EBCA 3EJ6A 1KFKB 5C8YF 4G5YA 4RNOA 3ME5A 4FLFA 1BYUA 2CUNA 4AI6A 3VKHA 2RHBA 2YY7A 2Y77A 1AN0A 3N53A 4BE7B 4YYEA 2PL9A 2OQ2A 2HCJB 1ZR2A 3HU5A 4L50A 2RKOA 4BNJA 1SBNE 3KJFA 3CPEA 3BYZA 1E1DA 4X1IB 5DX1A 3FHTA 5SZHB 4QU0A 3T7KA 1ENYA 4MV4A 1OWNA 4JI8B 2ODNA 2YCHA 2ZT5A 1Y1WA 1JR3E 3CEMA 1JT9A 1SKUA 5D1HA 2BF4A 4CUZA 4K6MA 4F8YA 1SBCA 3O4HA 5G3YA 3U3OA 2DWQA 2CJFA 1N9GA 2QUIA 3EXG2 4PR3A 1OFUA 1NFFA 1V7ZA 1R9NA 1FJGH 3L0YA 1W36C 4PRYA 1ZOIA 3FTPA 4FNGA 5JVDF 4G9EA 4YT8A 1DSSG 2IKSA 4IJQA 1WY5A 1E2EA 3VDXA 3K0AA 4PQRA 1P6UA 4GF5A 5CCXA 5CVVA 4DRFA 3IDSA 2Y0BA 4RVGA 4TL6A 1TJ4A 4RVNA 3DQQA 1M34B 3AR9A 3FTFA 1KZHA 5B3KA 3BT7A 5F3DA 4CMCA 1L4GA 1T29A 4RUCA 3GDWA 3Q41A 2J87A 3DSRA 1P0MA 1OLXA 4KJXA 5KSYA 3R3VA 1RQNA 4ZAYA 3WLRA 4K03A 3NT4A 2IZ7A 2H0QA 3LZ6A 2ZJTA 4LJAA 1WSCA 3NASA 3M8KA 1A8IA 1VCHA 4HLUC 2XTAA 3PDHA 1MIOA 2V4QA 4FZVA 3S99A 1Y98A 3EZGA 2ODWA 4RETA 4RY2A 4UCTA 5KHOC 1T15A 3HDTA 1KDYA 2ZSEA 4QYWA 4Y9SA 4X64H 2NU8B 4KW7A 5KVSA 2JEYA 3NGLA 3NHJA 3GFRA 2OM2A 3PR2B 2JI6A 3VU9A 2B8WA 2Y1FA 2W70A 1TRHA 3Q85A 5FBLB 2H2FA 2I7DA 4RLSA 2W6NA 5DLGA 1ESCA 4IMPA 3R5SA 1T9BA 1M0SA 4CMKA 5HJ5A 1RRKA 1NOIA 3W3AH 4YV7A 4A7PA 3K1AB 2ZE5A 4F8JA 3AT1A 3GP8A 1DTWA 3U3DA 1ZAKA 2BGRA 1Z07A 4I4NA 2A35A 4M0LA 2ZAIA 4RMGA 4A0QA 4D41A 3ASVA 1T9GR 3NO4A 1DEOA 2WR8A 5CTJA 4D8WA 4ZC8A 3WDSA 2BGNA 4GPD1 3VDRA 5FUXA 4C78A 4FYKA 1Y34E 2N42A 5D1OA 4FSXA 1LPPA 1KZ6A 1XQWA 1SA0B 3IEPA 2QD5A 1N2CA 4Z8XA 1TW2A 4CLHA 4KWCA 1B6TA 5E7IA 3WL4A 3ONWA 2YYYA 4AUMA 3TFOA 4H6PA 4GEKA 4OFWA 5BR1A 4NI5A 2NPFA 3IJRA 2TECE 1WV0A 4HAXA 3V1KA 3OWHA 1V1RB 1M2GA 2ID4A 4BXXG 1PT5A 2AZMA 3OQHA 5KKAA 1MFZA 3OX3A 5HJ2A 2X6QA 5H70A 4W1SA 4JB3A 1ACMA 1XZQA 4YVFA 3E4DA 2CQYA 3SMQA 4Z7QB 3L82B 3D3NA 2XPCA 2ENUA 4TVSA 1YOBA 5KFSA 4IIJF 1RU3A 3K9NA 4FWBA 4KIWA 4ONEA 5LA6B 1XZBA 1QWOA 2Y68A 3GJSA 4WN3A 1ZUNB 1QRTA 4JHXA 4KAFA 2OENG 4KRXA 4GE3A 2UYGA 1XPJA 4CDRA 4IHKA 2QE6A 5BWLA 1WHSB 3WGGA 2XODA 5DHFA 2OC4A 5MN5A 3AUXA 2ZYAA 1LI7A 3BMNB 2VSOA 3CZRA 1H0SA 3UMGA 2BFDB 1P4HA 1NIPA 3E9RA 4ED6A 3I23A 1TAGA 4DCUA 2NO5A 4CIBA 2W93A 3T12A 1AKNA 2LNDA 2Y05A 2IYQA 1EKPA 1E3TA 2V6JA 4WEOA 2O9JA 3OLZA 3UXYA 2BBSA 3UN1A 4JIMA 4FR5A 3MC1A 2WIGA 5AVTA 1Y7LA 4H1HA 3A4YA 1NNLA 4WCVA 2HPHA 4LGYA 4OL0A 1Z12A 1FDSA 1Y9JA 4JLWA 1QIHA 2AVNA 1R4MB 1PIWA 3RIXA 3LUHA 4TVKA 1E8MA 5FD6A 4P7KA 2D06A 1YVDA 2Q5IA 3BWVA 1AMUA 3R0VA 3AEZA 5H3LA 3L0DA 5DTIA 4G4GA 4DWOA 3Q8RB 4C5AA 4JUAA 4QDUA 4MJXA 3ZW8A 3JQAB 5BSHA 4UQOA 1KIFA 3HVJA 4P38A 1MX9A 3SC2A 3OM9A 3KB6A 1RT9A 2IEAA 2C3OA 4BTLA 2IYZA 4D9EA 3CE6A 1A4IA 4QGAA 4W5HA 1GGHA 4XOUA 3CVZA 3QVOA 5C9ZA 1WA5A 3I5YA 4TTTS 4BRZA 2C77A 2QAIA 1Z22A 4MV0A 2DX7A 4MV3A 1QGOA 3WYEA 1YB2A 2BFAA 5ARCA 1WY7A 1WB5A 3IP3A 3NTQA 1X6VA 1EGVB 4OI2A 4Y1EA 3JYOA 5F3RA 4Q6WA 2OCBA 2EJTA 1XYYA 3C3EA 1XN4A 5HJ7A 2JH3A 4YRJA 4OK6A 4M9XA 4ETNA 3ZZTA 1JG2A 3HY6A 4F4WA 3NXKA 1L4YA 3G7SA 4ITVA 4QJIA 2FB9A 3G6YA 3TDMA 4NCXA 3PI6A 4RHUA 2RE8A 2SKEA 2QUBA 2Z8YA 1GFSA 1WNFA 2HJHA 1CKNB 4EFLA 4MZDA 3T5DA 3OD1A 4KODA 2FGJA 3S2YA 4FJ1A 4JC5A 2B99A 5HXAA 4L4SA 2XUDA 3AKZA 1R50A 4ZK6A 2WPDD 4P34A 2EL9A 1SKYE 3QELA 3TTWA 4E22A 1CZLA 1C8LA 1BVUA 1VQ1A 1DX6A 5AKJA 1TQDA 4AQYB 2Z4RA 3IX7A 5EVJA 2WSSA 1GFIA 4AYXA 2CNWD 5CT6A 5GINE 2I7TA 4DWVA 3PS9A 4EIWA 1VSQA 1NBEA 2XF8A 2XVMA 3OMXA 4CI9A 2KM1A 4L73A 2F3QA 4G4JA 5JRDS 3D4BA 2ZKIA 1C1HA 3KOWA 4AUKA 1G21E 4B80A 4UBJA 1ZD3A 2V3CC 3P4UA 4PYOA 3TQCA 4RL6A 5E9JA 1FW6A 1C7FA 1CUVA 2G5TA 3QOYA 2QB5A 4O4JF 1G6KA 4QOEA 4BWSC 3R5FA 2BE7A 1V71A 2YY5A 3A6LA 1PZHA 1RVV1 2EJCA 2HGXA 3Q40A 3QHAA 2JFWA 1ZGBA 3VBCA 4NAVA 3UAVA 4EM6A 3OUTA 1OIVA 1CWUA 1QE3A 3RI3A 2GD2A 3HB1A 1W7AA 4LQCA 5HTOA 3NHPA 5EHZA 4MH0R 4K9QA 3QI7A 4RWEA 3OOWA 1DQZA 1E7WA 3AFHA 2EBWA 3F3YA 3Q0TA 3H3JA 1OPRA 1XZPA 3V1LA 3BHJA 1HT0A 2M1XA 3QKRA 4EZBA 3L92A 4OREX 2QJOA 3D2LA 2CNVA 4DV3H 1RBYA 5FO1A 1UFVA 1K3FA 2O07A 1JHQA 1TPYA 1FC0A 5D1NA 5KDDA 1CEXA 3FVRA 5MDHA 3WTBA 3E18A 4F2HA 1V11B 3YASA 3CWZA 3A9RA 1AUQA 2YYZA 1XTIA 2FN3A 2X40A 4H1WA 2D7CA 4F3YA 1V9PA 3LLVA 3F2IA 4FC6A 4CKBB 1W5TA 3F8SA 4MGKR 2YN2A 3TLYA 2O7NA 4C0XA 5B37A 3W9YA 2B4RO 3GCXA 3AB8A 3USZA 3UT0A 4PLGA 4PIVA 5COQA 2OZLB 3AWDA 2W4QA 3B1WA 3LF1A 3C24A 3SHVA 3U7EB 2NUAB 5FXMA 5KFWA 3GZ4A 1HYBA 3RYIA 4I8IA 4IIFA 2CV0A 2O2CA 2JFQA 1JA0A 1YTLA 1M74A 1N36B 4Y0VA 3OEHA 3D6UA 2DAAA 5EWFA 2BISA 1N6PA 2Q6TA 1EVLA 5L9XA 2V54A 3DE1X 2XOKD 1O8BA 4L16A 1A9XB 3WRVA 1VHTA 1CVLA 1M6WA 1QV6A 4F7WA 1M1ZA 3H19A 3GA0A 3N2YA 1RADA 1J5PA 1W94A 2ZM6H 2Q6IA 3NANA 2IHUA 5JXWA 4B9AA 1JIHA 2JRCA 5FH9A 3AIKA 1U90A 3K1ZA 4ML3A 4TMYA 1PT6A 4CLEA 2WC1A 3IKJA 1XKQA 4PYRA 2GPNA 5IDXA 2A9OA 3RJZA 3X2SA 4YO8A 1EVYA 1G7TA 1ADCA 1UEXC 1SXJD 2VJBA 4JV1A 4K1XA 4CODB 4P31A 3ABOB 3L4EA 1NYQA 4K40A 4MPDA 3WY9A 5ESDA 1D6MA 1FUEA 1IM2A 2X42A 2QL6A 1RC1A 2BKUA 3PWTA 3TPCA 3R4CA 1DDIA 4PC6A 3W8NA 4N7MA 5TQ2A 3C3BA 4J4TA 1UOOA 1G42A 3IDZA 4XW2A 5ALJA 1B16A 2Q4DA 2PYDA 1NR1A 3ZD9A 2MSKA 1ST2A 1M66A 3EXIA 4XGIA 5F4BA 1Q17A 1S3FA 1VLLA 1NTRA 1NRXA 1VMKA 3EFEA 1KI9A 3PD0A 4PPNA 5K0GA 3GNTA 2OV6A 4EUSA 4GX5A 2RCYA 4B09A 4EFDA 3VYWA 2GPTA 5C44G 3IP8A 1NASA 2H8GA 3V4VB 1DEXA 2ES4A 5EPEA 1U1GA 5ICFA 3CW8X 2YICA 4I9FA 4WWHA 2J3DA 1IBKB 3G0GA 3ET5A 4QZVA 1QDEA 4ZHQF 1VJDA 4REQA 3O8BA 4B6QA 5CA0F 4AX8A 4CCAA 3PXDA 1D6SA 4YN3A 4G1UC 2EZ8A 4CFZA 1NRIA 4BTEA 5HFJA 2H2DA 5DFAA 3BXEA 5CB0A 4TTJA 2KMLA 3GZNA 2C2MA 4NG4A 4BBZA 2GTHA 4ZICA 2J31A 4MWBA 3NAMA 2YHIB 6Q21A 4UM9B 4QQRA 3Q6MA 5SY4A 5EWGA 2FLVA 2J85A 4ACAA 4IP0A 2W6MA 4RUKA 2ZR9A 2YKGA 4JCOA 5DNYB 3NTUA 1WMEA 5FQOA 5HK9A 3AFNA 4J0KA 2GEBA 1Q21A 3I9OA 5FLKA 3VKGA 4M46A 4V3BA 3O9VA 2ZI5A 4B7XA 3HRHA 2ZVQX 3G8DA 1G20E 4CEHA 4D46A 3P5BA 5CEEA 5KFCA 3DUFA 1C7QA 2J9ZB 3AM3A 5KTPA 5DQHA 3W1VA 1G7CA 4I1UA 2WE7A 3O1IC 1NUTA 3B7WA 1RWXA 2R6ZA 3FD8A 1YJ8A 5PNTA 2OUIA 4HPWA 2PKEA 4TXHA 4HQ0A 2PCJA 1J56A 1DT3A 1XTBA 1UKBA 1OUMA 3LLUA 2WF8A 2GXSA 1M2OB 3CCBA 2I6SA 5DB4A 1QHXA 4K6GA 4WK2B 1OLSA 3D1JA 1F8GA 4S24A 2WJHA 1CY8A 4P9NA 4POAA 1CXZA 2W8ZA 3G5TA 2QENA 3RSSA 1ZITA 2JI7A 3FROA 1D1PA 1H1TA 2I22A 3RYHB 3SYKA 1YH3A 1PV4A 2DPHA 2C96A 3R4VA 3A6GA 1CC1S 4FMCF 4Q48A 1XEFA 1P60A 1QGAA 1YDGA 3E5NA 3HBJA 4PYQA 1MU0A 2XB6A 2R7NA 2IELA 2VH1A 3SLGA 3IQHX 2VHUA 1WOMA 7REQA 5IYBG 3QX3A 1D5CA 2J0QA 2W7PA 4K87A 3Q98A 2HMAA 4I66A 3UYLA 3QU2A 1TJNA 1RI4A 3UB2A 3HDVA 4DJJA 4BL5A 4L15A 3RAPR 3ZXYA 2GCIA 5IDYA 4Q43A 2FLWA 2ZI4A 1N1DA 1VSUA 3TFQA 2NIPA 3IRVA 5KNDA 4EJSB 3OJEA 2UZIR 4IFTA 2D7DA 5AI8A 3D7NA 3QPBA 2WQZA 3X0DA 4DRXA 2WDZA 4NLLA 4YA6A 4IR7A 4NH0A 5EJ9A 4JU8A 1RP1A 4US2R 5JAUA 2VWQA 5L1IA 2AI2A 4Q03A 5K8CA 3R9KA 3WXBA 4MGYR 2DFDA 5FA8A 3OIWA 3FPCA 1ISJA 3WNQA 3B3AA 1CUFA 5CFZA 3OTGA 3A32A 3OP4A 1MUUA 3CEJA 4C6TA 4U0KA 2Y1CA 2X8JA 3LQ4A 1NQWA 4KXXA 2QD1A 5JARA 5KFXA 1VIVA 2P4HX 3GEGA 1ZM3A 1IM8A 3HBAA 2NVUA 4KQ6A 5F9HA 2WHEA 1VL1A 1G8KA 4CYMA 4FSDA 2NV2B 3QVLA 2Q2QA 3JQBA 3DWIA 2IYTA 4A5SA 3RRMA 3KOZA 4LWPA 1WD7A 4IINA 4A3SA 3USCS 2EQ5A 1YGPA 4P54A 4AJEA 4R16A 4GRDA 2NSHA 1ZH8A 2PMFA 1D2MA 1TM3E 2X86A 4MYCA 1FA9A 4NYJR 3TNYA 1SR8A 3NUAA 3A0UA 2C1ZA 3WZ2A 1K89A 2ZQ5A 2PSSA 1A0GA 3WL7A 3ECAA 4EY4A 4QJBA 4U8HA 3K2QA 4EEKA 4MLZA 1PNTA 1NBAA 1SC1A 3PNSA 4EPWA 5CA1A 5HZHA 5IK2D 1JZQA 1K3TA 2Z2JA 1WZCA 2Z9BA 3LQRA 4C89A 1NVEA 4GKAA 4QXQA 3RIHA 1Z8HA 3GLSA 4B74A 3GA5A 1CJCA 2QRZA 2GHRA 3OECA 1O87A 2CBGA 3GLIE 1W2WB 4W9NA 5IUNC 3E3AA 4U5XA 2DTDA 3SM3A 2X1MA 3G6VA 3MW8A 5AIBA 2R6DA 1EWTA 2PH7A 5H59A 3ZWNA 3BTOA 2FSGA 1AV6A 4JQYA 1IPHA 3QE9Y 4I4TF 4HDRB 1T1RA 1M0TA 3WIEA 1YC2A 2PH5A 4MQ5A 4LZNA 1P3JA 4DSZA 3T1VA 2QX8A 4N9WA 1MAVA 3IPYA 4YAKB 1ODIA 1Y1LA 3ILVA 4YRTA 3T1YH 4DGSA 3H9EO 4EA8A 4K26A 4NICA 4WNIA 4QTUB 2HA5A 1B0ZA 2WTXA 1RK5A 3HCCA 4BFXA 1BJTA 3EPGA 1FQWA 3T1TA 2PSDA 3HB0A 1J0XO 1F3OA 1O6CA 4P0TA 4X3OA 3MLBA 1IFXA 2EW8A 1MAUA 1WUHS 2BVNA 3FW1A 1VBGA 4S0ZA 4TLDA 2Q41A 2UUBB 5KU7A 5H9VA 4NJMB 1B3BA 1KXZA 1HFKA 2P2NA 4GPTA 3CUTA 1EX7A 2DH5A 1TJPB 2ON6A 5I9BA 2PVCA 1HYHA 4BDTA 3RVKA 2K2WA 1JVSA 4KP7A 2Q5QA 1KDRA 2OPBA 3GGJA 2BFBA 3CUUA 1XTRA 4KO1S 2V1XA 3GGCA 4G1EB 4XWOA 5BSGA 1JDZA 4LRTB 2G76A 1ADFA 3RV3A 2XKJE 4OYYA 4DLRA 1CUXA 5ILQA 4W5RA 2F9LA 4O7SA 3AETA 2VRWA 5CP8A 4KE6A 5CB4F 4R9VA 2P2SA 3LGAA 3CMCO 2WJ6A 4KGDA 2G17A 3KJXA 3I6QA 4O8ZA 3SZ3A 3L05A 3IHTA 3N6VA 5HKOA 2FU5C 4RJIA 3E1SA 1BKDR 4CQMA 3HUFA 1SUWA 4M36A 2VJDA 4O4HA 3EXAA 4RVDA 2DQSA 1OZFA 3FYDA 1YS1X 1BE1A 1ZJWA 3Q8SB 2OCXA 5KFLA 3AFOA 4RFVA 1Q6YA 5IVDA 3AYHB 4WCFB 2PAAA 4MVJE 1BSVA 3PRJA 3BTUA 2GEKA 3DE5X 2FSHA 2VHEA 3BFJA 4OI0A 1UADA 1KO8A 4TKZA 3STUA 1IYZA 3PHLA 1EJ0A 2H4WA 4U9UA 3SQLA 2P2GA 5K0ZA 4MTLA 5DM4A 4XCQA 5ITZB 4E11A 1PJ3A 3AGQA 2ABJA 4CTNA 1Q7GA 2AGVA 4KE9A 1QOZA 3R41A 3ICPA 5LQAA 4O82A 1T6YA 5JJCA 3JPYA 3GVCA 5BV8A 2XGPA 2HUNA 4RTJA 2C0PA 2UVVA 4DV5B 2GA9A 2C5FA 4AUEA 4CL3A 1DDGA 4MCHA 1KDPA 4CLOA 4HG2A 2D2XA 1I0IA 3N8DA 1NVXQ 5A71A 4FMCB 5JD5A 1XNGA 2PX2A 3QWBA 4KFUA 2KB0A 4IRMA 4PAMA 3FPGA 5B4TA 3PWKA 3TPFA 3TD2A 3U13A 2XE7A 2IXTA 3GB8B 3DOUA 2JEZA 2IPOA 5JYDA 1D0SA 3C4QA 4Q9DA 4BLVA 3NHYA 1YDMA 2ZSIA 4I1PA 1OBCA 3VSEA 1TEHA 1SEIA 5G53C 3CSDA 1JHMA 1XALA 1GDDA 1CUGA 1E3JA 4Q3NA 4K5QA 3FVQA 3KLNA 1JF8A 3ZV6A 3T94A 4XYGA 4RA6A 1QAOA 3QVKA 2Z0MA 2WAAA 4F6RA 3MYRA 4TYMA 4YRIA 4UTPA 4MARA 4RU1A 2AR9A 2BUAA 5CFPA 1IU9A 1DJOA 3VV3A 3R1IA 3JZMA 4PINA 2B63G 1N34H 3KQWA 2OBLA 2CYCA 4Q82A 3CCCA 3OKCA 1JVNA 1XXHE 1MFPA 3H99A 1AO0A 4DBLE 1N1MA 5B1YA 1RDFA 3PQFA 2WPDA 5NULA 4FPXA 1PFYA 2XUJA 1QH1B 4YLGA 2XRYA 3IJ5A 3S8EA 3RW9A 2GCOB 2XA9A 2HT6A 2NO0A 3TLEA 1RM5A 1MABB 4JHLA 3WHKA 5HBRA 8LDHA 2QZPA 3EUEA 5KOJB 1XIVA 1PL8A 3UAOA 1Q19A 1V3VA 1KEWA 2GUGA 3DGFC 1VKNA 4BLWA 1IHYA 1YZHA 1ET0A 1JAIA 1FL9A 1QJ4A 4ZOAA 4YCMA 2MSWA 4OI4A 3WR5A 4FYJA 4YWJA 1BKSB 3VR0A 4X84A 4IVQA 3EG9B 3PRKE 2FMTA 4I8XA 3H0CA 2RGAA 3CUYA 2OA0A 4A8HA 1NAHA 2CVPA 3OCYA 3QNWA 1N25A 3ZD6A 5WRFA 3CQZA 3G82C 2IODA 1XKXA 3P27A 3I32A 2XZDA 2DPMA 4GP9A 4K1LA 1OAOA 2PMWB 3IUJA 2QPLA 5L53A 1KMMA 2FK3A 1LJLA 2ZT8A 3CLSC 4EPVA 1YDHA 4S35A 4IQ8A 2VPPA 3G79A 5C35A 2FPWA 2I8CA 1HNXB 1S5PA 4TQUS 3R5KA 4M0CA 3DMHA 2RGGA 1KNXA 2X7HA 2DLDA 1ZZGA 5K8TA 4BJ5A 4EMTA 3TRHA 1L3IA 4OH1A 2W6JD 4K6OA 1LJUA 3SFVA 3T9AA 3C15C 1BDHA 1MIHA 5LOVF 3X43A 1XMVA 1NVTA 1UDBA 3NLLA 1S2DA 2V0GA 1UNNC 5F7JA 1J25A 1IEWA 4YRRA 1DV1A 4IF4A 3SYNA 4BTVA 1WSBA 1JQDA 5LQNA 4YLEA 3CH5A 5DO9A 3W5SA 3J81W 4UM8B 1GT91 3K6JA 3OHBA 4EJSC 4YCDA 5J4KA 1QE5A 3FLMA 2VHXA 2H29A 4PGMA 2C31A 2O48X 1GCIA 3RVNA 4B82A 4KLCA 3VNBA 5DP1A 4AZTA 4NZNA 4TTAA 5KREA 3ERCA 5EC8A 4IR1A 5KG7A 1TEZA 1QIEA 5TVGA 4DIUA 2G07A 3GMTA 2A5YB 2WSSD 5YASA 2R79A 2GEFA 3PTLA 3NHAA 3REQB 4NU8X 1Q0RA 2DJ5A 4JR1A 4WY8A 1B6GA 1T4CA 4BS9A 1D9XA 1OV6A 4MW7A 4DXAA 2C2HA 3JQ8A 3RAQA 4PAOA 1G55A 3HDHA 5I4IA 2C9BA 1DXOA 1I4LD 4AG5A 4OH7A 3THSA 1SUSA 3O3OB 1EP9A 4DQNA 3PJGA 2WTEA 1N7JA 1GARA 2ETXA 3RB3A 3R3YA 3CEBA 1GN9A 4WKGA 1GYQA 2IPNA 2CW8A 4PSDA 4DCSA 4FI3C 1JMYA 2Q5OA 1SXJA 3RSLA 2R9VA 4PM4A 3SQDA 5JZVA 1FTGA 5DHTA 2C2ZA 3H18A 4DDVA 3BJMA 2O0KA 1WMDA 4QJ3A 1AK2A 2H5JA 2DTXA 2HNBA 2NTEA 3D3JA 4JJ7A 3L5OA 1N1EA 4C2AA 5CB4B 3IURA 2D2VA 1FP7A 4RPIA 4R2IA 3I4FA 3FDFA 4DREA 4QUIA 4NBTA 4C07A 4J0JA 3ETJA 2YOFA 2DY1A 3AVQA 1X7XB 3T3IA 4U2EA 4AF8A 2J3EA 4YUZA 3HOWG 4R8RA 3THYB 3QE0A 4ND3A 4DLKA 4MKZA 5AOCA 5EUMA 3OF2A 4UNRA 3OQVA 4KWIA 3WSTA 3CURA 1B2LA 2AWNA 2G9VA 2IHKA 5JNRA 3KM0A 3WQQA 4EGSA 2QLBA 4RNMA 3CE9A 2WU1A 2FZEA 3D3QA 3KAKA 4BX3A 4RF2A 2XITA 2W6PA 3OE4A 2E4UA 3VO1A 2IDKA 3ACCA 2ZU0C 1XP5A 3GGPA 1QVRA 4A73A 1VKJA 1NXWA 3LCMA 4LUCA 4YI3A 2OOSA 4DMLA 4M7WA 1NSTA 1ST3A 5EVCA 3W8EA 1E1MA 4I50F 5K0TA 1P7PA 3O3CA 3UAWA 3OEHD 4B4VA 1G5HA 5EL0A 1E3LA 3L1IA 2IS4A 5BOSA 1QIDA 3FOEC 1OYYA 1H6BA 3R3UA 4NV0A 2GD6A 3RVMA 4B6JA 1U3UA 1Z5VA 4RADA 4DQXA 4XVQA 2R1ZA 5LPNA 4NOLA 3E5MA 2QSYA 3RARA 3FUUA 1JFVA 2PV0A 5KG3A 3TW8A 4ICIA 2FQXA 3SGIA 1XZAA 4CKXA 5LD2B 4ZOLB 3PGMA 4M76B 2RH8A 821PA 4Z7JA 1L7AA 4U7DA 3GWGA 1QPGA 5IJ9A 5J40A 3SR4A 2FPPA 1C1YA 4BXOA 4ESHA 5HCNA 4N01A 3J7AK 1SELA 5B4UA 1FNCA 1SCUA 3TDNA 3LVFO 1GXSB 4LVCA 4JDPA 4MX8A 2OO7A 1E9SA 4NBNA 2W22A 3PKIA 4DMUB 1RVDA 2ZYDA 1NWCA 3SXJA 5KX5A 4W7IA 1SFOA 1UK7A 2GQSA 2Y27A 1TMKA 4LJ7A 1F4PA 2H2WA 3K4QA 3ORFA 4QXRA 2EKLA 3U02A 4BC0A 1OAAA 3U4DA 2R68A 5TMEA 4X3CA 3IVMA 4PG4A 1KEEB 4Q1AA 1O58A 1XL0A 1SMKA 3FPFA 1ZL0A 1NLYA 4XM2A 5FWNA 3AHCA 4K28A 1AJEA 1IN8A 4AY6A 4O2LA 2WV9A 1ZM4A 5LXTB 5LZ4A 4ER3A 1MORA 4WCFC 4KC0A 5EJIA 4LOJA 3QX7A 3ZCXA 4Q1DA 2YWVA 4IGFA 5KQSA 4OD0A 5BRNA 3N2GA 1G21A 1HKUA 2CL7X 2EWVA 4G6ZA 3E9NA 1CE8A 2Q9AA 5DW3A 3ABSB 2WMNB 4N7BA 4DA9A 13PKA 1Y3FE 1NE7A 1N7IA 3B9PA 4ZVOA 4J4BA 3V2UA 4JI2B 4AZ3B 4EMBA 4MMXB 1A76A 1KI4A 3AF4A 4GBED 3PR4A 4C7OB 1GVNB 3FIJA 4BNXA 1A4RA 3PE3A 4HSGA 3I76A 4HGZA 3LDUA 1UKVY 5AXDA 4Q1BA 4W9RA 2YXNA 1U2EA 1E79A 5EUBA 1ZCJA 1KP9A 3NATA 2H17A 3DLPX 2WTNA 1DKNA 3WQRA 1EDDA 4Y2SA 3CGGA 5D5HA 3ZY6A 3ZLJA 3IPXA 5JS6A 3EULA 3F3SA 2IZOA 3ZV5A 2ZYTX 4URVR 1ETHA 1LK0A 2QORA 1MJHA 1S2IA 1WM1A 3LE8A 3WTCA 4ZI7A 3N41B 3Q88A 5EA2A 4P3NA 1GG8A 3RTCA 4I5IA 1JDPA 2YWFA 4BRSA 1ZH0A 1Z16A 3IPLA 4RPLA 3IALA 3BAZA 5B4VA 1M7BA 1CY1A 4U2GA 2IA5A 2PO7A 4G0PA 2FX3A 3KYDA 2PR2A 2QZSA 2O2JA 2QN3A 2J9GA 3KS9A 2ZWMA 4RD1A 4O08A 2TSYB 3DXFA 5DNCA 4B1FA 1XC7A 4TTVA 3A28A 5BWWA 3A36A 4MV9A 1OREA 2AG0A 2DG2A 2Y1OA 1YVRA 2YRXA 4ZTUB 2JVJA 3A37A 5IK2A 4DV6H 3A9WA 4YCBA 4XUCA 1JYEA 4UPEA 1A8PA 4LFAH 2UVPB 4HYEA 4JZKA 3T0FA 3PDIB 3COVA 3B6KA 3SEAA 3L7LA 4CNQA 4JI4B 4RSHA 3C6QA 3DFFA 4GI3A 4I19A 4UVIA 3RIMA 1E3WB 2G06A 4HPJB 2DECA 2W9BA 4LYEA 1XUOA 5CFMA 3L2OB 3F0TA 2FPUA 5TMPA 2QNIA 4JJGA 1V96A 1GNPA 3RSZA 5IBRA 3D7SA 2WF9A 4RQBA 3MGBA 1HZZC 4FYMA 2UUCB 1ODSA 1X80B 3KU4A 1D4OA 5KNDD 4C05A 4KYVA 1DC7A 2IK8A 3MILA 4IIGA 1RSZA 3AUKA 4YR7A 5FCDA 3G9TA 3VKVA 3LL4A 1NQXA 3KKOA 1B74A 3E6AA 1ESMA 4XOIA 2JBHA 1O2DA 4A3JG 3TQIA 4JKYA 4YRDA 4NOKA 5HX7A 4YEDA 4YCJA 2HWYA 2YHBA 4RCVA 1J9EA 4DLPA 1MR3F 4HGPA 3LDHA 1E9EA 4X5OA 3DTVA 4Z2YA 3TZ6A 1JA9A 3P20A 3RASA 2Y1LA 5CNMA 4RTKA 4DGQA 4OKIA 3AY6A 1BHJA 4F2WA 5A6SB 3WLFA 3O9ZA 2C59A 3Q7IA 2I29A 3P0EA 2VT7A 3KZOA 5THKA 2R1VA 2J41A 2NPOA 3M4NA 2ZANA 1XJWA 5J47A 4KUHA 4IDFA 3U2QA 2G8LA 4G63A 2ZOSA 1XNRB 1C3JA 2LP4Y 1O6GA 1CF9A 5B3JA 1R3DA 5I9NA 1OBFO 1IBMB 1PFUA 1QUEA 2NZUG 4ZMRA 4RZ2A 4FE2A 2VF4X 4UBNA 5BN5A 3HJNA 2F43B 2BBTA 4QYIB 2YVKA 1KVSA 4OCZA 4BCBA 2VP2A 2CXOA 4RNNA 1ZYUA 4IMJB 4FYVA 3MQ2A 1M5UA 4BNDA 1OH7A 3G2IA 1SC6A 2BMVA 2FN9A 2NXEA 4LE0A 1MQ8B 1JR2A 4LVUA 4EPXA 5A1JA 3BILA 5C18A 2Q1XA 2XDAA 5LMNB 4O83A 4IEEA 1JWBB 5EJAA 1N2IA 3O4RA 5HOQA 5K3WA 1V5EA 5AVYA 1T9ZA 4FMPA 1GQYA 3WMEA 4G5GA 2FW1A 5C34B 2BJHA 4JLNA 2NU9B 5KWVA 1NYLA 1BN6A 5FYQA 4QWCA 1JI3A 4EYIB 3IVXA 3PW0A 5B30A 2QTWB 2VP9A 2VR1A 1NVWQ 5B6IA 2I4NA 5GM1A 2AYYA 4B6EA 1BEEA 5AK6A 2O5EA 1U6JA 4F9TA 1EFVB 3TUJC 3TSYA 2JASA 3MPUA 1U7TA 621PA 2PXAA 4RKFA 4YT4A 1EP1B 3IV9A 1T5HX 1GV1A 1D2NA 1RJRA 4JEMA 1IBSA 4J90A 1GAWA 2X8BA 3BQ9A 1U2ZA 1DAMA 4JEIA 4EY8A 3OQNA 5D6OA 3RJMA 2Z98A 4DM4A 4LOKA 3JZAA 3V00A 3IA7A 4FT4A 3SI7A 2D59A 4K8RB 1B0PA 4RXUA 4JV5B 1XKTA 4DEYA 3PQEA 1VMAA 4HP8A 1GSOA 3EOZA 3IT3A 4RY0A 5KQMA 1WXWA 4UBOA 2VKQA 1UP4A 4M6WB 1T2UA 1X92A 4I4CA 2QL5A 4HTAA 4YJGA 3T15A 1SUDA 2ZTLA 4DA7A 4BFWA 3OZXA 3EIOA 4MO9A 1LEHA 4MP8A 3GG2A 4OUDB 3MCZA 1YBMA 3KLBA 4JJ4A 3B3QA 3U17A 4UCOA 8ABPA 5D5QA 1AKQA 5FBQB 4EEYA 4RVOA 4IO0A 2A1HA 1QTQA 4B2LA 5JY6A 4Y1FA 2GMWA 2Y0PA 1OWOA 5HK8A 3V32A 5AJWA 3BDIA 2DCMA 1XDNA 4ABTA 4CQMD 2C54A 3R9XB 1RWKA 2HDNB 2RHHA 2ONYA 4B81A 1W0KD 2VOBA 1ULTA 3LNCA 2OP1A 4NCNA 5AI0A 2JAXA 4KTTE 2HVQA 5JECA 2OILA 4QFDA 4WLFA 3OFJA 5FNVA 1P62B 2VQ6A 4FYHA 1PNOA 4LYJA 4KIGA 3R8XA 3EFHA 3DV9A 3EEBA 1R6VA 3S2ZA 5K3DA 4Y2HA 1IAQA 1E2DA 1RZVA 5DASA 1TEXA 1DO8A 4BQRA 5LD2C 2FPRA 2Q3DA 2GN6A 1J9ZA 2V5AA 4R0MA 1T9AA 2AC2A 2RI6A 1XQ6A 4G24A 4L2IB 4A6PA 2GM4A 3V6KA 1Q7BA 2OCYC 1R7RA 2Y1XA 4JV2A 2IQ5A 3WWJA 4DVJA 5IRCD 1M1YE 2NZXA 3BGOS 3V1UA 4JXZA 1KAMA 4FEYA 2BFFA 1K88A 5DIFA 1Z88A 3LO8A 2DPIA 3AF5A 1ECCA 4HVAA 2B35A 3NRCA 1YRYE 1EHYA 1PJCA 1TFUA 4FCVA 3ROXA 1QLHA 3R76A 2EGHA 4UD2A 4QWDA 3GPIA 3VPXA 2P79A 1EGMB 3GIJA 1JDSA 4PIPA 4ARIA 3GMIA 1J7JA 1TVMA 4Q44A 1VDMA 3E9QA 3GLIA 1EIWA 4MVWA 4W8HA 2OBNA 3ZS8A 1V6AA 1AKUA 1W1UA 1JQ5A 1VE7A 1UFQA 1KVTA 4NDZA 3A0RB 5AXCA 3OTOB 3T9FA 3ZGVA 2XCAA 4DXHA 2W6JA 2R84A 2QLJA 5C8YB 3DTNA 4ZIRA 3AM4A 1NYRA 4DCNA 2PRKA 3A2MA 3EQ7A 3W4KA 4EAAA 4FE3A 1TB4A 4FR0A 4WXEA 1RRVA 4OQNA 1L5HA 2RJNA 3HB9A 1BCRB 3RABA 2OZKA 1OFUX 1Q1BA 2VA3A 4LYYA 1JR3D 4HS4A 3DNPA 3TGWA 2FSUA 5T64A 2VL7A 2A5LA 2HHJA 3CF6R 1A98A 4CI0B 1RQPA 3KR0A 2EJBA 2P0YA 3GJ4A 3RYTC 3GRCA 4PO8A 2CNBA 1VLMA 2OAQ1 1UPXA 1GAXA 1UK6A 2FEPA 1EUZA 1XXLA 6ADHA 4AJKA 4IICA 5CNJA 1DOAA 2MHCA 3EWIA 3WSWA 4JCCA 1G9XA 3L7OA 4JT8A 5G4KA 1R4ZA 5JVDB 5DP2A 3TG2A 3EODA 1GPUA 5E95A 4BIIA 3ZDQA 1TA9A 2JEJA 4DL2A 4TLBA 5FWYA 2FZ4A 4ZYXA 4BDSA 3KUUA 2OFOA 4JC4A 1XMJA 3IUSA 3T35A 1HR0H 1MKYA 4L95C 5F78A 3SS9X 1MAWA 4FQ7A 1HLPA 4EBEA 2XEXA 4UBMA 3BMOB 5C5JA 2OO5C 3D2CA 1T8SA 3HKCA 2OV2A 2WEKA 3Q1LA 3UBTA 2WJYA 1Z83A 1X38A 5J1TB 2NO7A 4TV9A 4J1TC 1J9GA 2LE0A 2Y71A 3PW5A 5JMWA 2JAQA 3C1UA 2P6MA 5AI6A 1EDBA 2VNJA 3HSYA 4I6JA 2E87A 4G5FA 5HQJA 3ZE2B 3R3SA 2CZCA 3KFLA 2V03A 3RBEA 2ADMA 2LTAA 4V1CB 4RPJA 4D74A 5J23A 4QBTA 4J0FA 7AT1A 2C2KA 4TMZA 4ENUA 1M1NA 3PGJA 2X9NA 2M6SA 1LSSA 3CS3A 4MVJA 1RAGA 1JQEA 3RTXA 3CW2A 1LI4A 4GH5A 3LPNA 1B2RA 3PD1A 3BWYA 2AQ4A 4BEVA 1GZ7A 4WN9B 2HA7A 5C1DA 5E9AA 1N0UA 3H1AA 4MW6A 5DCWA 4IHJF 4HHEA 4E7PA 1ID8A 4TWZA 2Q50A 5JOQA 4B7AA 3T5AA 4MA4A 1WIWA 3EYWA 2OAGA 1ZM9A 2R7AA 2VP4A 2GB4A 2GA8A 1ZOSA 3C6BA 3OWOA 3CVWA 1MB3A 1OB5A 4D42A 4D1YA 2HV9A 3SCZA 1RNLA 3GH3A 3AZOA 1I33A 1DX9A 3E9ZA 2J6BA 3FIUA 3O8OA 2XOEA 2BFCB 1CY4A 3QWHA 4HEJA 4G0MA 4OQYA 4GI2A 1K06A 3IULA 3UXMA 3IT2A 1X8KA 4F12A 3H4VA 3SQMA 4U9HS 4B5KA 5KO2A 5AMXA 3DE6X 4C0WA 1U7OA 4WVFA 5DI3A 2PD4A 4AU1A 4MJ7A 4EFNA 3EW9A 4G36A 4KR2A 3IPCA 5DGDA 4LDRA 1JIQA 2FKAA 2I6TA 2FPIA 2XMRA 3CEAA 1P2FA 2C28A 2OYSA 3S2IA 4ZCRA 4Q02A 3TCXB 1ZQ7A 1Y8QA 1EH5A 1SCKA 2OAP1 1L7QA 4IJMA 5F2OA 1EAMA 3HY4A 1KZ1A 2CVOA 2IMWP 1JKIA 1V47A 5KQLA 5GQSA 1NATA 3W5JA 3O8RA 4BMPB 2CWWA 2JKZA 2RFLA 3TR5A 3V80A 5AW7A 3J7AC 4KHZA 1AOXA 2QNBA 4QEZA 4IIJB 2E4VA 1XXHA 3ONNA 4FYIA 1IUOA 1R9GA 5TT0A 2ZXFA 2B1IA 3C7TA 1BX0A 1HFEL 2K7ZA 3AR7A 3UJNA 2O03A 4IX1A 1B8NA 4N54A 4J7CA 3DQZA 5FL7D 1Z0ZA 2JFBA 3IPAA 4MQLA 1X7WA 3FVVA 5KAPA 2WD7A 1W581 3ZQUA 3WBFA 3BJEA 1NZFA 3P97A 5FUBA 3BGSA 3IQEA 3A05A 4FUQA 2XXAA 3SSOA 1SQSA 5ERGB 3FMGA 1L1QA 4BO3A 1RPJA 3H2ZA 4HX9A 4E14A 3SDSA 4L51A 3EISA 3O8NA 3W2FA 1S8AA 3HNRA 1SXGA 4N3GA 3PC4A 1XZJA 4F4UA 4MKXA 1NP3A 1KZYC 4TT8A 1G5RA 1QIFA 2C94A 3HVIA 4EENA 4C9BA 2WFLB 4PTLA 3U0BA 1NXSA 2G9ZA 4PRKA 2QRVB 1DHTA 1MJGM 3V46A 1LVUA 1IONA 2KSWA 3UF0A 1CQWA 3D6AA 3GFTA 2GYYA 5AJYA 4JX8A 1XQ9A 3QNMA 3KSAC 4JJ6A 4EI7A 3H0EA 5IAKA 2ZK7A 2H0AA 1T0JB 3AHFA 1QRAA 2IE0A 1U7DA 5GIOE 1XLTC 3DT8A 1OGJA 3UZBA 3RT7A 5I9MA 4ARZB 2JJMA 3GEDA 3E9MA 3QEMB 5KNDH 2GM5A 2XUGA 5A0FA 3WB0A 1P0QA 4F5EA 4JGGA 5IWAB 4I1OA 2RARA 4EB6B 4DIOA 1NBWB 3TLCA 2E4AA 1MNAA 2DUMA 1TGVA 4INAA 5CBPB 1PJBA 2QM3A 1OFTA 1M6YA 4KRYA 1EXVA 3OC6A 3EVZA 5LP6A 1AQIA 5DMHA 4F0JA 4GXQA 3IS3A 2BFEB 3KTAB 4P86A 3L7KA 4EYHB 2QMHA 1G63A 4LOLA 1CZUA 3HZZA 2HK9A 4EG4A 3GFVA 3WOVA 2PJRA 5DBHX 2FSPA 1HK7A 4V0NA 4EATA 2ZSBA 1ZN2A 3EFOB 4IR9A 2YFQA 4YPOA 3RVQA 2C2YA 3UJ6A 4CN8A 4OXXA 3I6MA 5I8PA 2GHIA 1T6NA 1HLGA 4KGZA 1RWNA 3WIBA 4P32A 1WQ1R 1AB6A 4H2DA 4OK5A 5C32A 4BN4A 1CPYA 3NGXA 3N43B 5AUQA 4GWKA 2C2XA 2WNHA 4D9IA 5D87A 1KI8A 1EFCA 1H42A 4WERA 4DTCA 1KBOA 4X8MA 1JA1A 5KYVA 2GUWA 2Z1DA 1RCTE 3TE7A 3BB1A 1Y8CA 4QBFA 1SEVA 3THXA 3PPXA 2GX6A 1RHQA 4URFA 6ABPA 3UWOA 5AKLA 1WPXA 4GC7A 1S1MA 4O4JB 4N82A 3M9XA 2J3LA 1D1QA 3V8PA 5C2JB 1P6QA 2ZIAA 3LW8A 1E6KA 5HTKA 4LWZA 3JATA 2J9RA 1FYEA 3AZPA 1KFCB 4WA8A 2IZ0A 1AX9A 4PZDA 3U3JA 4H3VA 5BN3B 3FTCA 2Z3ZA 2FMHA 4DCJA 1L7VC 3PENA 5JC1A 1E79D 4JI1B 3WYFA 3RAFC 2GPSA 3BX1A 5AKEA 5ETJA 3H2BA 4LFBH 3NHMA 2JLZA 3KHRA 1A50B 5C5IA 4XWWA 5KTMA 5IJ0B 4GFDA 4F56A 5CITA 1E1CA 4Y67A 3TJMA 5EJ4A 1DLJA 4QO7A 5EXDA 1XVUA 4UZFA 1DAPA 4H3HB 4BFLA 4YRMA 3T7JA 4O2AA 2OVBA 3HYNA 4P7FA 5I9SA 2YWCA 4V24A 3U44B 3IQWA 4MR7A 4QREA 4IHJB 2H2IA 4V0OA 1F7VA 4TVOA 2PUFA 1OI7A 1JHUA 1LC0A 1LTQA 4RMHA 4RGQA 1Q2XA 1NSFA 2O4CA 3LPLA 4LTMA 4OU4A 1BEZA 4B6GA 2DQKA 4HJXA 3A4TA 4JV0A 3TJZA 2NMVA 2VHZA 4MW5A 1JHZA 1D0VA 1FFXA 1NXPA 3MRXA 3NYRA 3E3OA 1YMVA 4TV8A 3SZGA 1T43A 5KWIA 4Q1FA 5B36A 4JP2A 4B7UA 3JU3A 3QHPA 3NTVA 4D7AA 4RMNA 2ARKA 3QXSA 4MB6A 1ZICA 2IBSA 4ZQCB 3N5CA 2H7XA 5AP9A 1OXVA 3QBEA 3SJAA 5JCJA 4RIHA 3F6RA 3SAJA 4EGQA 2W6QA 4ZYZA 3OOSA 1QU3A 1ZVKA 5F1KA 4W1QA 3GIQA 4KWEA 1JHRA 1FLNA 3L6BA 3NUGA 4JFRA 4PFQA 1XCOA 3O82A 4DV2B 5IW8A 4J9LA 4LE1A 3P9PA 3E70C 4HF7A 4LDPA 3R6DA 2APJA 2BTQA 4WZZA 3ZWVA 1N2GA 3BWXA 4KE8A 1KYTA 1FFDA 3LHSA 5ED0A 2DPYA 3QFFA 4GR5A 5EHNA 4UE3S 5H68A 2FZ5A 4B33A 2HMUA 4HL6A 3GLKA 3TL6A 3L6UA 1DQYA 1CQPA 4TLMB 3DTVD 3ZIUA 1HNNA 5CH8A 1VJRA 2VQFH 2E4XA 3QOFA 3PC7A 3EMKA 4UNQA 2PN1A 2Q4RA 2GCEA 4XA8A 1E1YA 2OFFA 2WYVA 3KO8A 4A92A 4N40A 1KYIA 1J2EA 2PRZA 2VDNB 1HYQA 2RDIA 1QHIA 4MPJA 2ZZNA 3I3OA 3PNVA 3H4BA 3VYUB 1CRLA 2CT8A 1X8LA 2HW8A 2BIFA 2YQ5A 3MIZA 2GK4A 1NN0A 1XCGB 2PUJA 5HKKA 1LV7A 3THWB 1RWPA 4LF7H 3AR3A 1NW3A 4GC5A 4E3ZA 4ZRDA 2R87A 2Q7XA 1YB7A 4ZHQB 3BB3A 3CQ9A 2A9PA 2UV8A 4IDPA 5CA0B 4WZBB 4GGMX 3H3XA 3WLPA 4H59A 1Z8DA 5C1IA 1FQKA 1OLUA 1DUSA 4RSRA 1V6SA 2HCTA 1C41A 4YMTA 2X58A 2DT5A 2W90A 2FW7A 2IS2A 2PQ2A 2UYHA 3LH5A 2JLVA 4ZJZA 1G5QA 3R7WA 3K0HA 1JJVA 4NPHA 1W0KA 4AKSA 1BO6A 4FOLA 1HT1E 3AVWA 3KXPA 2XR1A 1G18A 1K0FA 3C8MA 2IUTA 4B3TB 1KO4A 1H23A 4CM6A 4PQYA 3UJDA 1QORA 4EI8A 3A9UA 4BCDA 1R6DA 3C8ZA 2G1AA 3BAFA 2WU3A 4UFZA 4PYNA 2AX4A 5DG9A 1ARZA 5LR6A 4J0EA 3OX4A 1L5KA 3H42B 2I3ZA 1ISGA 3HJGA 2IYAA 3DO8A 1NUUA 4K9LA 5I7HA 5CVCA 1XA0A 1N6KA 4JEUA 1R5OA 2I4LA 3IAM6 2GK6A 1CEYA 2BGUA 1YZYA 3R7NA 3E2MA 5B53A 1X2EA 3HFRA 1CB0A 4LBZA 4YP1A 3EAFA 1BXRA 1H65A 4BNKA 4XB2A 1RRCA 2XWQA 4RYLA 4HADA 4HXGA 2OORA 4I08A 4R31A 3C3KA 3VTFA 5DU2A 1T2DA 1GPAA 2IYFA 1YOVA 5AVZA 4MWZA 3D3WA 1XZ8A 2CLFB 1WX1A 4M86A 4JT4A 2PSHA 1V7QA 5C31A 2XIGA 3PFWO 1WD5A 5D3QA 5L1JA 3SKYA 1OC2A 3HEMA 3RB8A 1MPXA 2P0AA 3MTBA 1LFDB 5LMUB 2PT7A 2JGAA 4ECZA 4IJVA 1ODKA 1ZISA 4RH0A 1MRSA 5J2UA 2NVYA 4UVGA 3ZNNA 3FUVA 4BWVA 1SCQA 4PY2A 5BWTA 2XECA 2BBWA 3U7QA 1L8AA 1T5IA 2ZIWB 4IV8A 2C2BA 4YIKA 1VXRA 4KB5A 3E61A 5JSQA 1HMPA 4OBBA 2IHTA 4JFAA 4AM8A 4DADA 4MVXA 5T67A 3UGQA 2H4XA 4WESA 2EYQA 2HFKA 3KJQA 4F1JA 2H1LA 2NP7A 1JR3A 4QHTA 3O93A 4DNOA 2ZROA 2QV0A 4ZPXA 4R69A 5AW2A 3IBTA 5HOEA 2LDBA 3R0QA 2XT9A 2G3YA 3L6CA 2PSFA 5DNAA 3EC1A 5LL6b 5KFEA 4OJYA 1Z5GA 4QG3A 3H20A 2JIPA 4EMUA 2NAPA 4K9SA 5CD9A 3MRTA 2XGOA 3HYCA 5DHPA 2BH2A 1WXEA 3STWA 2R44A 3N7AA 4Y6GB 2J5XA 4C88A 2VT2A 4N6OA 2HRZA 4OK3A 3X1JA 1GL6A 2ASEA 5TSDA 2YWXA 2P9YA 3Q8XB 1U2DA 2CLHB 4X8OA 2XUHA 2V74B 3PFIA 1E4EB 4LE2A 5KYTA 4N5IX 2BF7A 4HWTA 4PPYA 2O8BA 3BA6A 5TJHA 3MUFA 4UJ5A 1O6ZA 3DQPA 3I92A 1WDKA 5HYVA 1SWWA 3B3FA 1QYRA 2YIVX 3D0OA 5JV5A 3PC8C 3WRXC 1MVOA 1GR1A 5AHRA 3VJRA 4FD2A 4ZGBA 2OTCA 4U7CA 2H3EA 4G8DA 4MUHA 2C5AA 2N75A 3CHYA 2C7BA 5DF1A 3OT1A 3GBSA 4XUDA 4LQ4A 1N5MA 3WDMA 2FMXA 4R98A 5FTLA 2C98A 2GBFA 4LI3X 1XZGA 1FCJA 4WCDA 1BDIA 4ECAA 2QRNA 4BFCA 1IBLB 4KHPH 1E0JA 4I4TB 3B6MA 3ZHRA 3NHFA 1XWFA 3VV2A 4PTYA 4WKOA 2NNWB 3RM3A 1SD1A 1IVNA 1W4BA 4CQJA 1U1FA 2OQRA 1XRLA 4C03A 2PO5A 4AB1A 4QYXA 5L4LA 1T2VA 4E2YA 3RKUA 5ERYA 4BBJA 1GTZA 4GOOD 1NC1A 2V96A 4DF3A 4A27A 5IFLA 1P81A 1Q77A 3ZV3A 1VKRA 1D3AA 4TKUB 3L4BA 3CLRD 3VBEA 2VDKB 1J8VA 2HA4A 2CB0A 4AJ4A 2AJDA 2PGIA 2WF7A 1M8PA 2GN9A 4HN4B 2GVZC 3JD4A 5G41A 1MLDA 2FE4A 4OIMA 2FH5B 2YTZA 2F00A 3ZG6A 5AUNB 4UXJA 3C1OA 1OX6A 4PZLA 2JARA 4TZ6A 2QMOA 5DVZA 4FFBA 3C6ZA 3C3YA 2LCFA 2A5GA 3GVPA 5IMSA 1EG7A 4X62H 3VSBA 2WHRA 1UIRA 5AI9A 3T5HA 1XVAA 1TQ6A 1J20A 1KH3A 2GCPA 1XVIA 2WF5A 4MCAA 5HRAA 2WVGA 5DM60 3B3JA 3K6SA 1N3IA 2Z30A 4S05A 2QTAA 2VOJA 2X0DA 5EUCA 4WQMA 3ZH9B 2JGFA 2ODQA 5T4FA 4GRIA 1KPIA 1TA0A 4MVJD 2GPWA 1F38A 2GETA 3ETDA 4DMHA 3A6JA 4A1FA 3RUEA 3ILYA 3QUBA 3ZWBA 3R2JA 2IYNA 3LYAA 4MVJI 2NAFA 4KXMA 5FL7A 5CYFA 3AH8A 1E2FA 4DMGA 2XZPA 4GLJA 1Q0TA 5L3RA 3UC5A 2MCFA 1A0OA 4Z3OA 4CEIB 4XPIB 4BU0A 1JP7A 2VT6A 2C1XA 3AV0B 2VH2A 5KYWA 2AJTA 4G5XA 1E18A 1G0NA 4IL5A 3VI3B 3F6CA 2CFCA 4ESVA 5K9ZA 3GRYA 4BZWA 4PC7A 1M6HA 4KCGA 2C04A 3GTOA 1FJXA 1P16A 5K0LA 1H5NA 1M1YA 3TLKA 1PR0A 1A69A 2VJMB 1FTYA 1GPMA 5JMTA 2JFXA 2C9OA 4KXLA 1N8TA 3OJCA 3VI4B 4X65H 4N6GA 1T24A 5HS6A 4JI5B 1G8GA 1Z38A 2HO5A 1JLLA 1ZXXA 4KO3S 4C4AA 1WSDA 3BQNB 1X1EA 3KQSA 5J2TA 4EGAA 1M8FA 1N5JA 4QRDA 4Z4HA 3LHIA 1CT9A 4FFRA 4UXIA 3N58A 1VCNA 1FS5A 2CFRA 1NVBA 1YA6A 1V1MB 5KB3A 4IRCA 5KFFA 4MR8B 1YBVA 2LD4A 4UFNA 5FOSA 3DGEC 1NTOA 1M1XB 1EMDA 4RKRA 4JNCA 1UZAA 1YI1A 2P40A 1Z2PX 1LNZA 1Z2DA 5FOTA 1J8QA 1QGDA 2A57A 2WABA 3FZNA 4TX1A 1R9TA 2QMQA 3KTMA 2FLLA 4RVHA 5LLTA 1ZQ9A 3BKXA 2O8EB 1T36B 2QUHA 3ESZA 1UAAA 3HGQA 4CF3A 3OZUA 4S1NA 1BYIA 2R1UA 3T5CA 3TSWA 3BHIA 2HMWA 3CFYA 2H1HA 2XRMA 5FEUA 3W5UA 3B52X 1VBFA 4UUGA 4UU0A 3UHPA 2F1KA 3SBXA 5IEJA 5I5WA 1ADJA 4XX0A 5A9RA 4GPIB 4IDGA 1LDYA 3ZX4A 5B1IA 1GUDA 1N32B 3KXLA 3L7IA 4CF7A 4EA9A 1F2TA 1Y63A 3DOCA 4X44A 2NX2A 4CF4A 2IYEA 2ORVA 3PUZA 2GNAA 3ICCA 4CTKA 1EWRA 3AUYA 1X0XA 4D8XA 4QT4A 1GCOA 1Y8RA 1PX2A 3NC1C 3I1IA 2QT0A 3D64A 1D6NA 1JX4A 1XMQB 1ZNYA 4KL8S 2WFZA 2XIJA 1ZH4A 5E0OA 4N5MA 4AURA 5IKPA 2FSVA 3H0GA 4U5QA 3V2GA 1GGOA 3N76A 1Y3HA 4ARAA 1FF9A 2W7OA 2UXCB 3V42A 2F4VB 4G4SO 4B3RB 4IRXA 1T5LA 2VF8A 2W2OA 3DE0X 4G09A 4GI5A 2HD4A 2B9EA 2IWHA 2W2KA 3FDZB 4P35A 4IH4A 3DMDA 2REQA 3FBWA 1XV5A 3H5AA 4R1UA 4K0KH 1Q7CA 1TT5A 4OPMA 3R7AA 2HRCA 2ZIUB 3JR7A 2Y4RA 2OLKA 3ROZA 5JH7F 1EQ2A 3DZBA 2PXCA 5FTKA 1GEEA 2A1UB 2CNQA 2UDPA 3SE0A 1I32A 4ZCTA 2Q7DA 2HB6A 4PXSA 1A9TA 2ISCA 4G23A 2XADA 3T1OA 2O2ZA 4NZOA 5AIAA 5LOVB 3A04A 4LC0A 4XGKA 1THTA 2QTVA 2P9ZA 3GJYA 4XAQA 4C4SA 3V4RA 1LPAB 1CNMA 3SU8A 1RFLA 2QG6A 1UUFA 2P41A 4V39A 3V7FA 2HIMA 5LUBA 1NUPA 4M0DA 4OQ4A 3BVPA 1EA5A 4MHOA 2PXXA 1MF7A 3QK7A 3NB0A 4O3NA 2J3HA 1AMOA 1CUJA 4BP8A 4UTNA 3H1TA 4ZPJA 3VVBA 5AXAA 1KMQA 5TQ0A 1Q2UA 1TIKA 4LNAA 2HU7A 2B4TO 3G02A 1XHEA 4OMCA 2QSZA 3DVRX 1POXA 1E8NA 1NW6A 3OJOA 3K72B 4RJLA 4P36A 4NY1A 3BB4A 1EVZA 1P91A 1TZJA 5L8VA 1WPQA 1E5XA 2IOQA 3PGLA 1XWWA 3NCTA 3OCWA 1QC5A 5JYEA 5DE3A 2AUTA 3SYRA 3O6VA 4U0JA 3ZCTA 1P2DA 4X61A 1J39A 2IWRA 4U8GA 5B5SA 2V7EA 1WCWA 1Z15A 3UG7A 4MIKA 4GKVA 3BQMB 4NU5A 2JEGA 4LC1A 1EBBA 2IA6A 2E89A 2H1FA 2QR5A 5GVRA 4WZ6A 1W34A 2WJAA 4JLVA 2DXIA 3GBPA 1M2KA 2QY6A 3HP1A 4OQPA 3MT8A 2EEZA 3CWQA 3LKBA 4XCVA 4D9FA 3MGKA 2AC7A 1PJZA 5KTTA 1N2BA 3A11A 2QQ0A 4NK5A 1V9CA 6REQB 4J9OA 4TL9A 4ID3A 4Y6LA 5F9MA 2HZBA 4J03A 2TYSB 4O4LF 5DWVA 4CMDA 4MTEA 5FOVA 2IHVA 5F5NA 2P4SA 1FLAA 1YHYA 5JJKA 1MBZA 4YRFA 5JG7A 2FX5A 4MUYA 2WIKA 3HQ4O 1O97D 2NXNA 4N12A 2ZETA 2N47A 3L7MA 4H7DA 4UNNA 4LSGA 4XTRA 2GO7A 1B42A 4D0LB 3TB4A 3N8IA 4CETA 4OAOA 2ZRQA 4J29A 3WYAA 4IEIA 4YK7A 3ZDCA 4R2KA 2FWIA 4EPYA 1QHHB 1UXGA 3CLTD 1DKPA 3UH1A 4DV1H 4P80A 3EH2A 3DB1A 4F96A 2QOEA 1V2HE 4RFSB 4DDTA 3IQDB 1VI6A 2JA8G 3GEIA 2VEDA 1Z08A 2HMTA 5BMVA 4KQJA 2GERA 3NM4A 1OWPA 1OHHA 4ZDJA 2PCLA 1GTMA 3I39X 2ZRJA 2YL2A 2J9FA 4DMMA 1JFSA 2JA7G 5K01A 1OKKA 5DLQC 1PL7A 4M99A 4I50B 4FOOA 3EY9A 4ZXPA 3GD7A 3A1VA 4R8SA 2LCIA 3QG1A 3MFHA 1JFFB 4R81A 1T25A 2CDRA 3HLYA 4IJKA 1Z2CA 4BQQA 5IVKA 1SU7A 3ZE9A 1QG4A 4FDAA 1GZVA 4YIHA 2UVRA 3NDRA 1BW9A 3RRNA 4R2HA 3WLSA 2Q1UA 3GLHB 3D4IA 1OYOA 3IAEA 5JCJD 4DHWA 3RU3A 3QNUA 1ZOLA 2PBZA 4C3OB 3AR8A 4N3NA 1KXJA 3MUOA 4KFTA 1G20A 2PYZA 2D00A 3S29A 4C7BA 1P2UA 4R68A 4JR2A 4GM4A 1II9A 3L7CA 1S1CA 1N4AA 4EI2A 5TJ9A 3T0IA 5DHQA 4NJOA 2GF0A 4N3AA 1RZRA 1AQYA 1RAAA 4BMCA 3B89A 3FCUB 4YV1A 1XU9A 1PZMA 3I9KA 3I9FA 4RTLA 4IGIA 3RD5A 3U4QB 3IR5A 3G7NA 2V0CA 1FNMA 3DV0A 1UM8A 3T1HH 5D6NA 1KC3A 1PSZA 3KQMA 1FJHA 2ZYWX 1IVYA 1HT2E 2OLJA 4E5SA 5A4KA 2Z08A 4KQWA 2FUKA 2WUEA 3C48A 4WE3A 3V5NA 2AG6A 2GD0A 3T7EA 3NKLA 3UWPA 2ZRLA 1E63A 3IQIX 3IB6A 1V5FA 3KT3A 3ZWWA 4RTNA 1W85B 4Y0NA 1SVLA 1BDJA 1ZD9A 5B2ZA 1I2KA 4EYEA 2TRSB 3QXCA 3CNOA 4M8KA 3L49A 1BFKA 2QLFA 2QX9A 3SX4A 9ABPA 2G0NA 1K5PA 4DR1H 5HKKD 1WMFA 4DDMA 4Y6SA 4MW9A 2ZS8A 3IE0A 1RJWA 1USWA 2RGCA 5JCOC 2PZFA 3ZBTA 2H16A 1UC8A 1LPOA 3P9ZA 4JITA 3H3VH 4RJ2A 4YY3B 1QVVA 3PNLA 1G66A 1WCXA 1QFYA 3LHFA 5DSZA 5A3QA 2ILVA 2C4WA 1SURA 4JENA 1U4NA 3AG5A 3M6IA 3FRJA 3WMGA 4HAOA 3M49A 4C30A 5EWMB 2PUCA 1T26A 4Q7EA 4C6HA 4LBYA 4Q4LA 4G1BA 4G0ZA 4HBGA 2O2YA 1CZRA 2W0MA 4D9GA 1NJSA 1YFZA 1SUFA 3NHKA 5CX1A 4G0XA 2AL7A 1K83A 1HT3A 1L4BA 1K1QA 3PUHA 4HNHA 1AMNA 2VTEA 2ATIA 4XIIA 5FFNA 2MU1A 4GZMA 2IDMA 4JLJA 4DPMA 2HA3A 4CL0A 4DQVA 1N6OA 2QDKA 1Y4UA 2Q2VA 3DKRA 4YBRA 5ALQA 2HUPA 1RXVA 1SZDA 4L3VA 2ASDA 1RJFA 4BX9A 3L06A 4BJ1A 3ZDYB 1ZXLA 5F21A 5JH7B 3EWSA 4HWOA 3W6NA 3FNBA 4HZUA 1WW8A 3G5MA 3L2PA 1Z0KA 1ZCFA 1HRKA 4AIRA 3ZHUA 3EVEA 4I1IA 4QARA 1ZMOA 4EQ6B 4BKMA 1U7ZA 2XUFA 3DM9B 3BJZA 2QSUA 1YMQA 3GUZA 2E5FA 4RY9A 2L42A 4O3MA 3JPWA 1Z3IX 2J45A 5LKRA 1OCEA 3HOZG 4JVOA 1Z5NA 3K5HA 5IC6A 1JYSA 4BNFA 3UFXA 4N0MA 4GMHA 4INPA 5AHXA 2JNWA 1DADA 3N28A 4XQGA 1IM5A 1JSCA 2PKCA 3CRQA 1J49A 1CEEA 4B2IA 4FYXA 4XJSA 3K30A 3RYCA 2D8AA 1UDAA 5DQIA 1E3IA 3SIPA 4HN2A 2J6CA 1WW2A 3ND8A 3LFHA 5CVEA 3WO1A 1GSAA 2FUNB 1GAEO 4YJ3A 5EXPA 3DEFA 4MWSA 3DBLB 2NXWA 4YAEA 5ALYA 3KSMA 3BJRA 2CFSA 5CK5A 4H08A 3BHNA 2OGZA 3L0IB 1WLSA 3JASB 3OPYA 3GLFE 3OPVA 5DHUA 4AMUA 2R93G 3HN7A 5KIAA 5F35A 4BRWA 2GAAA 2YWJA 4FQ5A 2SECE 2YNMA 2DHQA 1ZIOA 3A6EA 4MVJH 1Q5PA 1E60A 2GXQA 2FW6A 2PX5A 4EVIA 4D3YA 1C8KA 1JHDA 3AF1A 3ZHXA 4ZMSA 4HMOA 4PN7A 4GW3A 2M9MA 3CUVA 5BVHB 4B3SH 4TQGA 4G5QA 5L1LA 2QJFA 2ZYSA 1R4NA 3SC4A 4O7YA 2PWBA 3KXDA 1T0BA 1I2ZA 4JI0H 1VL0A 4YMHA 2RB4A 2V6IA 3COJA 2OQIA 3ENWA 2IEGA 1RYYA 3UENA 2QK4A 4F4FA 3KBBA 2B36A 3R3JA 3QV1A 1C81A 5E2IA 3KE9A 2C29D 1SC3A 1V95A 4XDYA 1Y8AA 5ESRA 5BR8H 4AZVA 3EZ2A 5KFKA 1FMCA 4QOGA 2WA1A 3DLCA 5KSOA 4QL3A 3AXSA 3L41A 4ACBA 5B3LA 4FBTA 3AUTA 4S1WA 4FMDF 4RVUA 4EG1A 1CUBA 4L72A 2UKDA 1VRWA 1UJ5A 4MTCA 4Q1EA 5K3OA 5T8KC 3GQBA 2D7JA 2YZ2A 5A2QA 3HM2A 4PZUA 4WFKA 3N2KB 3HBMA 3V7WA 2JK1A 3UPUA 4BMSA 5I4BA 2FN4A 3UWKA 2V7QA 1IMJA 2JFVA 3IE2A 1ZVQA 4M7OA 1Z25A 2OAEA 4Z86A 3IMKA 3ELUA 4GOKA 1A3CA 1XDUA 1YC5A 3FNGA 4FDVA 5CRIA 1TUGA 5GY7A 4X66H 1IAVA 3IR7A 1PFKA 2FLPA 1RMTA 1A8QA 4K05A 2R48A 4L7VA 4PICA 5IM4F 1OA1A 4ZYYA 1P29A 4X20A 4A0SA 5EIAA 1Q12A 1TJ5A 2H63A 2GJKA 2EZTA 3QE2A 2O8DA 4EHFA 3NGDA 4IUBS 3FNIA 3HVKA 4XGNA 2YN4A 4DV0B 1GNSA 5DHAA 5IZCC 2C95A 4AKIA 1D2EA 1X9HA 1YQ9A 4EO4A 4BP9A 1U6KA 3DZHA 3LPMA 1ABBA 3WYNA 5K8JB 3H8JA 3LMLA 1EGQA 4O4IA 1KYXA 3GN2A 2VNAA 4U7GA 1US8B 4U4AA 2OGUA 2BGGA 4OMDA 4E70A 3OQIB 1W8IA 1OZGA 1FP1D 3K09C 4UMFA 2WTBA 3NNDA 3R6WA 4W5WA 4AWBA 4N0QA 4IW3B 5DM1A 1TIPA 1B8OA 1D04A 2QVXX 4NSNA 2PX0A 3RRYA 1RZUA 3KX2A 4EJMA 1XD9A 2VPIA 1ZGZA 3DFKA 2FXVA 2L2QA 3GP5A 2ZI7A 2XH8A 4IDCA 5JDIA 3EOBI 1SUCA 1L0BA 1Q7TA 1IJKA 4KX5A 3LQKA 2A1IA 4DQKA 3T5GA 1YD7A 4BNGA 3TIFA 3NPAA 4Z99A 1CLEA 1FY2A 2Q3EA 4ZCLA 4TOIA 1L4NA 4QG7A 5HM8A 2XNKA 4I9HA 1YK1A 4CCSA 5HWSA 3FCSB 1U80A 1L4EA 1RQ7A 2O0LA 2QN7A 5LYJA 2RGVA 2VPTA 4OU5A 2GEJA 5AM4A 3VOSA 5BSWA 1HNZH 4BUJA 1HFJA 1MTOA 4Z9FA 3JWIA 3P2JA 5EJFA 2Y1DA 4GOXA 1T9KA 1Y7TA 1WB4A 4DA0A 1RYNA 1PL6A 4QJ5A 4LOHA 1EKFA 2ZJAA 1I3OA 1TTHA 1S0MA 3AJDA 2VZEA 1JAZA 1J00A 2H8KA 4EL5A 3B53X 3CN7A 4NEQA 5BV1A 2IP2A 1SVOA 1IL0A 4CCYA 2FMIA 4ED7A 4RSGA 4Y2GA 1MG5A 3GIDA 1YCFA 1CYEA 1EX9A 3C1AA 2HA2A 3DKVA 4PC3A 5CIWA 3QQMA 1YZFA 1DAKA 3AHEA 5C5EA 3EEYA 4EEZA 2HXSA 4P8RA 1EIZA 4H4CA 3EXG1 1PJQA 4YHBA 1C8BA 2HSWA 4GM0A 1TM7E 3LWDA 3HDQA 2WW8A 1QQ6A 2GZSA 2PX8A 3K71B 4FOPA 5KQPA 1CSEE 4F5DA 1USGA 2G80A 4GP6A 4AS3A 3OA2A 2V55B 5CFLA 3R5TA 4A4DA 3FSRA 3F5FA 3HHPA 4D97A 2X5KO 1CZNA 4HFNA 2R86A 1EM8B 4C22A 1YZLA 2YDXA 3UGJA 2BM8A 3L84A 4JBGA 1JNXX 4DM3A 2EGGA 2RIPA 4YFYA 1EHIA 1DWPA 3NTRA 1II8B 3Q7PA 1QP8A 1KORA 2FSIA 3AKCA 1L2TA 4FSHA 4GT1A 5F64A 4L8GA 4X91A 2WJ4A 4YJ2A 3AESB 4RMIA 1RWOA 4ILKA 4MVYA 1X74A 3DZFA 1NMEA 3Q8LA 2ZS9A 5AH0A 1OJLA 4ON9A 2L0XA 2HU5A 2I7XA 2R8YA 3HZRA 3ZW7A 1SK9A 3N7UA 3CN9A 5AKKA 4DR2H 3X1MA 2WT9A 1E64A 1ZDMA 1IQPA 2ID8A 3MJTA 3QYJA 5FFMA 3LCUA 4ZJUA 3CRMA 1LK7A 2BI7A 1JEYA 1CQZA 1XCLA 1Y33E 1X94A 1R66A 1W6RA 5ESXA 1PDVA 3IYLW 3SOZA 3ZD8A 2EARA 4R01A 1ZK4A 1O0SA 2EZ4A 1KYYA 3LHDA 1S2LA 1Y6RA 1QONA 1KY5A 1ES9A 1YS4A 1RYMA 2E4WA 4GQAA 1C1XB 3NONA 4ZQGA 2GJ8A 2A5FA 4DR3B 4O3RA 1TIBA 4GHWA 4N49A 5BN1A 1L6RA 1O9GA 2O6HA 3NOXA 1DC3A 2DOKA 2ZBRA 1YVEI 4OYLA 1NQVA 2PGAA 3QKTA 2XLBA 1KP3A 3TW6A 4DNXA 2LZ0A 4BNNA 3JALB 4MS3B 2HSZA 3PPWA 4XB6B 4URXR 1Y9DA 2BM0A 3QMMA 4WXPA 4CKCA 3NM5A 1XDSA 2ZCUA 2D1QA 1BD4A 2O59A 3BN3A 2W42A 4QELA 2DKFA 2JGIA 3G0DA 1VHWA 4KN9S 4FINA 1E4OA 2XUIA 3ZWPA 3NVMB 4Q4JB 2HPVA 4LV5B 2GPYA 3LDAA 5DSTA 3STXA 2J3JA 2KWIA 3UANA 3E53A 1UEJA 2NM0A 4KNYA 4LNUA 4QFCA 1DTSA 4JYZA 4EHHA 4X1KA 2EG9A 3JARA 2VHTA 5DX0A 4C3ZA 4LF6H 3CZ4A 2JIMA 1BKYA 1L5SA 3TAUA 1A82A 4TYWA 4TRRA 4G01B 3GLTA 4WFQA 3GCDA 1ZAYA 4IG9A 4BO0A 2IRWA 5LJIA 3H7IA 4YRBA 1YR8A 2V65A 3BMCA 3ER8A 2J6HA 1UJ6A 2V7TA 3QLVA 2BP7A 3DF7A 3HV0A 3NYQA 2O2IA 2WOOA 3DZIA 3K9FC 4R84A 4F72A 1J2JA 1PKXA 4F46A 1XB2A 2IXGA 4QIHA 4E33A 4FE4A 1AQ6A 3W1WA 1MJFA 4MS1B 1NOJA 3ETGA 5JW6A 4I1SA 3GRZA 1EESA 3NBZB 3VZQA 2I80A 4UHBA 3TQFA 3Q3VA 4CR6A 3NBMA 5EMJA 5EIWA 5EJ6A 1O5OA 3Q9NA 3DNMA 5C7LO 4V0QA 4TTIA 4KO2S 4PAGA 4C2MA 1ESDA 1C9MA 2FSSA 3GT0A 1ZGAA 4JVLA 5EE9A 3PU6A 4BY9E 2M2IA 3EEIA 3QKUA 2Z4TA 2C8LA 4UMDA 1Q83A 1IK4A 4LHXA 4GXRA 3WSVA 4G1MB 3NM6B 4AY5A 4QC2A 3MEQA 2NUBA 1KFBB 3A1EA 5SYAA 5ALLA 4WXMA 2EAUA 4Z0NA 3KJNA 1Z18A 1R6AA 3A2KA 1AGYA 4J9RA 2O23A 2ZPTX 2E4ZA 1TYZA 1THMA 3I2GA 5GJWC 2V7VA 4MDEA 1PU2A 5C4MA 3ZBPA 5JRJA 2RGRA 1WBBA 2UZ1B 4LYDA 1YKGA 1QV7A 1U7XA 1Y6JA 4XASA 4DIEA 5FA6A 3ZJTA 2IXEA 1KEZA 2ASVA 1P9NA 4H27A 2PUGA 1ZKMA 1EWVA 1CERA 3RGWS 4P83A 1L5VA 1G6OA 2AD1A 1N0WA 4Q4HB 2HSGA 3UMBA 4ZVPA 1NW7A 1L4UA 3VC2A 5EHGA 1NLUA 3EGWA 1FQOA 4C2TA 4BEBA 2QLLA 4HGOA 3BK2A 2R00A 1JWLA 2CN1A 3GEMA 3NDJA 2A2ZA 4UNIA 2ODTX 2FZKA 1VGQA 1OHHD 2O3RA 5KYUA 1RACA 1WTAA 5JLAA 4R1PA 4HXEB 4F93B 5EWJA 1OKKD 3QYAA 5KFYA 2VRBA 4LN1A 4DR6B 1MV8A 3VOBA 1MEEA 1HLDA 2WHXA 3W5OA 4ZVUA 4DDWA 4MLDA 2E3JA 4UTXA 2I87A 3T41A 2JRLA 4DM7A 4JI7B 4YFVA 1XQVA 1YSCA 4DKJA 3ZW9A 3HXTA 5JSUA 4EP1A 3LQSA 1HZJA 1MH1A 3FHJA 3A06A 1C4WA 5ELMA 5DX8A 5IXYA 1HQDA 4W4TA 3GP3A 2NLOA 4OOFA 1B23P 3IIKA 3O0TA 2Y6VA 4RH3A 3KTDA 4CU5A 2NT4A 5L7TA 3RF7A 2X3FA 1IXSB 4IBOA 1SXHA 5E2BA 4D45A 3O90A 5C3UA 2CXUA 3F46A 1TA4A 3WA6A 3JAKB 1VI2A 4I2NA 2YIJA 3ZDZB 4LAFA 3QEJA 1A71A 1TDJA 4US1R 1INLA 2G28A 3K9WA 5DGAA 4A8JB 4EFEA 3HKBA 5JO9A 3HA7A 1RZRD 2OWOA 3KR9A 5KFJA 5IT9A 3MG9A 2M6RA 1V0JA 1UP6A 5ALMA 1RWWA 2SHKA 2BHLA 4WK0B 2OLEA 4R71A 2RONA 1YJCA 4E0BA 1BJRE 2XDQB 4JC0A 3ORQA 5IBQA 1LV8A 5GV7A 1ZRMA 3BREA 1MQSA 2WU0A 3HN2A 5CT5A 4A3BG 3ENQA 4IIHA 4PZ0A 1XTQA 1Z28A 3OZIA 3QVUA 1NLMA 1MOZA 5ALRA 4BYMA 1OZHA 3Q9SA 1ULAA 3D59A 1YE8A 3EEFA 2CXNA 2DB3A 4D0SA 4PVDA 4Y9RA 1GNQA 3G2QA 4M83A 5REQA 3I73A 2SNIE 4B32A 1PSDA 1OX4A 2JCGA 5IABA 3FR7A 4RJKA 1WHTA 3LHKA 4NYEA 4GMFA 2IZ1A 2HBYA 1UC4B 5IDVA 1NHWA 3SBDA 5F9LA 3WWOA 4JUZA 1QRRA 1LH0A 5K5EA 1ZC3A 1WZ2A 1M7HA 3PITA