2YS1A

Solution structure of the ph domain of dynamin-2 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Dynamin-2 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dynamin-2
total genus 13
structure length 113
sequence length 113
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys1A00
2Q13A 2I5CA 1MAIA 2DYNA 5D27A 1SGHA 2DX5A 2P8VA 5KCVA 1AWEA 4DX90 4HDQA 1PMSA 2LYDA 3HW2B 4EJNA 1Y19B 4MY6A 2JP2A 3PZDA 4GPTB 3TVVA 2YRYA 1MK9B 1ZSQA 4WVFB 1DBHA 1E5WA 1I7AA 2RLOA 1FAOA 4WJ7A 2D4QA 2DKQA 1EGXA 3ML4A 1P3RA 2R09A 4EMOA 1OQNA 4HB2B 1RRPB 3FM8C 2N0YA 1V5PA 3KZ1A 3ZDTA 2YSZA 3TCAA 1K5GB 1NTYA 5D3WA 2Y7BA 2D9ZA 2J0MA 5HE1A 4BBKA 1UNQA 1Q67A 2J0JA 1PFJA 2EC1A 2ZPYA 4K2PA 2LULA 2I1JA 1WJ1A 5CLLB 1H4RA 1MPHA 2IFSA 2RVBB 3P6AA 3PG7A 4A6FA 3UZTA 2AL6A 4MK0A 3IVFA 2ADZA 5C16A 2YVCA 2MDXA 2FJLA 3P7ZA 2D2QA 1EVHA 1UNPA 3CXBB 2GJYA 1BAKA 1ZVRA 4WSFA 1U5DA 2ELBA 1XX0A 1V89A 2ELAA 1ZC4B 1WJMA 2DX1A 3PP2A 3MDBC 2VRWB 1OMWA 4A6KA 4NY0A 4Z2NA 4HDOA 3DXDA 3OANA 2QKLA 2D9XA 3U8ZA 2P0HA 1FOEA 2DLWA 2E2XA 4Z2MB 4TYZA 1DROA 3SV1A 1DDVA 3AU5A 1W1DA 3QIJA 2YS1A 1LB1A 1ZC3B 3SNHA 1EF1A 2V76A 2L1CA 5C79A 5JP4A 3PVLA 1BTKA 2DHIA 2HTHB 2L2IA 3SYXA 4A5KA 1WG7A 4KVGB 3NSUA 2RUKB 1QQGA 1XCGA 1W1GA 2DYQA 3U7DA 1ZM0A 2LOXA 2MWNB 3M1IB 1FGZA 1V5UA 1X1FA 1Z87A 4HAWB 1XODA 5KQ1A 3BJIA 2K2JA 4HATB 1ISNA 2RSGA 5D3VA 5LOPB 1KI1B 5JHHA 1U27A 3ODWA 2RGNB 2Z0PA 4CYEA 3D8EA 2YF0A 3FSSA 4HAUB 2D9YA 1DDWA 2W2XD 1Y5OA 4KHOA 5HE3A 3VIAA 1X1GA 2BCJA 2EMSA 3X23A 3BINA 3DXCA 2COCA 1B55A 1IRSA 3WYFB 1KZGA 1J0WA 2Z0OA 2EMTA 2Y8GA 3ODXA 2OTXA 4EKUA 5L81A 1GC6A 3QWMA 2IYBA 2DTCA 2MFQA 2P0FA 1FB8A 2DHJA 3HQCA 4F7HA 2W2WA 1XR0B 1FHWA 1WGUA 4NSWA 2K2UA 2RNRB 1V5MA 4L6EA 5HE0A 5J3QA 1LW3A 4IOYX 3D8FA 2DN6A 3PEGA 3WA0A 3KSYA 2M38A 2CRFA 2OQBA 3O96A 4KHBB 1BWNA 2CAYA 1DDMA 3A8QA 3D8DA 2YS5A 2J59M 4K17A 1OY2A 4H8SA 1U5FA 1WI1A 2CY5A 3MPXA 2KGXB 3A8PA 4CHJA 4DBBA 2KUPA 1MK7B 1J19A 4ZRJA 1I2HA 2CODA 4XWXA 2UVMA 2MKRA 3V5WA 3RCPA 4P7IA 2PZ1A 2Y8FA 4ZRIA 4GMXB 3VOQA 5DIFB 2Z0QA 3SUZA 4Y94A 2H7EA 3AJ4A 2D9WA 1MIZB 3GYOA 2I1KA 2DKPA 1U29A 1UPRA 1TQZA 5DHFB 3KRWA 3F0WA 2CY4A 3G9WA 1X11A 5D3YA 3PSCA 3ULCA 5GOWB 1U5GA 2QKMA 4PQ0A 1M7EA 4HAVB 3HK0A 3DXEA 2COAA 1W1HA 4HHVA 3PVWA 1NTVA 2W2XC 5D3XA 2VSZA 1XKEA 1X05A 2D11A 2G35A 2M14A 2ROVA 4DXAB 5KQ4A 4A6HA 1DYNA 2AEHA 1PLSA 1V88A 2P0DA 1X86A 2NZ8B 5DHAB 1GC7A 1EAZA 2UZSA 4C0AA 2KCJA 4YL8A 4HB0B 2J0KA 1UEFA 1V61A 3A98B 3F5RA 2YT1A 2DA0A 1WVHA 3SO6A 2GCJA 5HE2A 5DH9B 2R0DA 3CIKA 5FI0A 1FHXA 1MIXA 5CLQB 1U2BA 2YT0A 1NU2A 1QC6A 5J3YA 2VKIA 1FGYA 1H10A 4KHAA 4HAZB 3KY9A 5JLJB 2XQNM 1RJ2A 3TFMA 4D0NB 2DFKA 4GN1A 4HAXB 5DI9B 4GZUA 2LG1A 2LKOA 4GMVA 2UZRA 1GG3A 2I5FA 4F7UP 4YONA 4MT7A 3KRXA 2H7DA 4HAYB 1P6SA 3TW1A 1P5TA 5C6RA 3GYPA 2DHKA 1XD4A 2YS3A 3LJUX 1UPQA 1KZ7A 4A6FB 4CHMA 4GXBA 1FHOA 5C5BB 3TO1A 5C5BA 1M7RA 2GS0A 2D9VA 1K5DB 1N3HA 1UNRA 5LONB 4HB3B 4KAXB 4DX8A 2HE7A 2N23A 3ULBA 2ROZB 3ZVRA 3N7CA 2NMBA 5J3TA 3T06A 4K81A 4PNKA 2K00A 2D10A 2LOZA 4K2OA 1AQCA 1WGQA 3QBVB 1TXDA 1MKEA 4HB4B 1BTNA 1SHCA 2X18A 3PVUA 4TKNA 2COFA 3AU4A 1NI2A 5JHGA 3ODOA 2EJ8A 4IAPA 4IFSA 5EFXA 3FEHA 5FI1A 2GCLA 4B6HA 4ZRKA 4F7GA 1TJ6A 1U5EA
chains in the Genus database with same CATH superfamily
2KR0A 2Q13A 2I5CA 1MAIA 2DYNA 5D27A 2GUMA 1SGHA 2DX5A 2P8VA 5KCVA 1AWEA 4DIXA 4DX90 4HDQA 1PMSA 2LYDA 2NBVA 3HW2B 4EJNA 1Y19B 4MY6A 2K8EA 2JP2A 3PZDA 4GPTB 3TVVA 2YRYA 1MK9B 1ZSQA 4WVFB 1DBHA 1E5WA 1I7AA 2RLOA 1FAOA 4WJ7A 2D4QA 2DKQA 1EGXA 3ML4A 1P3RA 2R09A 4EMOA 1MI1A 1OQNA 4QJ5B 4HB2B 1RRPB 4OSNA 3FM8C 2N0YA 1V5PA 3KZ1A 3ZDTA 2YSZA 3TCAA 1K5GB 1NTYA 5D3WA 2Y7BA 2D9ZA 2J0MA 5HE1A 4BBKA 1UNQA 1Q67A 2J0JA 1PFJA 2EC1A 2ZPYA 4K2PA 2LULA 2I1JA 1WJ1A 5CLLB 1H4RA 1MPHA 2FJUB 2IFSA 2RVBB 3P6AA 3PG7A 4A6FA 3FVCA 3UZTA 2AL6A 4MK0A 3IVFA 2ADZA 4GNKB 5C16A 2ZKMX 2YVCA 2MDXA 2FJLA 3P7ZA 2D2QA 1EVHA 1UNPA 3CXBB 2GJYA 1BAKA 1ZVRA 3NWFA 4WSFA 1U5DA 2ELBA 4QJ3B 2KUQA 2Z13A 1XX0A 3PP2A 1V89A 1ZC4B 1WJMA 2DX1A 2ELAA 3MDBC 3NWDA 2VRWB 1OMWA 4A6KA 3A58A 4NY0A 4Z2NA 2Z4DA 4HDOA 3DXDA 5I2SA 3OANA 2QKLA 2D9XA 3U8ZA 2P0HA 1FOEA 2DLWA 2E2XA 4Z2MB 4D6WA 4TYZA 1DROA 3SV1A 1DDVA 3AU5A 1W1DA 3QIJA 2YS1A 5I2MA 1LB1A 1ZC3B 3SNHA 1EF1A 3U12A 2V76A 2L1CA 5C79A 5JP4A 3PVLA 1BTKA 2DHIA 2HTHB 2L2IA 3SYXA 4A5KA 1WG7A 4KVGB 3NSUA 2RUKB 1QQGA 1XCGA 1W1GA 2DYQA 3U7DA 1ZM0A 2LOXA 2MWNB 3M1IB 1FGZA 1V5UA 1X1FA 1Z87A 4HAWB 1XODA 5KQ1A 3BJIA 3HIEA 2K2JA 4HATB 1ISNA 2RSGA 5D3VA 5LOPB 1KI1B 5JHHA 1U27A 3ODWA 2RGNB 2Z0PA 4CYEA 3D8EA 2YF0A 3FSSA 4HAUB 2D9YA 5LG4B 1DDWA 2W2XD 1Y5OA 4KHOA 5HE3A 3VIAA 1X1GA 2BCJA 2EMSA 3X23A 3BINA 3DXCA 2COCA 1B55A 1IRSA 3WYFB 1KZGA 1J0WA 2Z0OA 4GOUA 2EMTA 2Y8GA 3ODXA 4QJ4B 2OTXA 2R2YA 4EKUA 5L81A 1ZYIA 1GC6A 3QWMA 2IYBA 2DTCA 2MFQA 2P0FA 1FB8A 2DHJA 3HQCA 4F7HA 2W2WA 1XR0B 1FHWA 1WGUA 4NSWA 2K2UA 2RNRB 1V5MA 4L6EA 5HE0A 5J3QA 1LW3A 4IOYX 3D8FA 2DN6A 3PEGA 3WA0A 3KSYA 2M38A 1T77A 2CRFA 2OQBA 3O96A 4KHBB 2Z14A 4KHBA 1BWNA 2CAYA 1DDMA 3NWAA 3A8QA 3D8DA 2YS5A 2J59M 4K17A 1OY2A 4H8SA 1U5FA 1WI1A 2CY5A 3MPXA 2KGXB 3A8PA 4CHJA 4DBBA 2KUPA 1MK7B 1J19A 4ZRJA 1I2HA 2CODA 4XWXA 2UVMA 2MKRA 3V5WA 2K49A 3RCPA 4CSQA 4P7IA 2PZ1A 2Y8FA 4ZRIA 4GMXB 3VOQA 5DIFB 2Z0QA 3SUZA 4Y94A 2H7EA 3HSAA 3AJ4A 2D9WA 1MIZB 3GYOA 2I1KA 2DKPA 3NW8A 1U29A 1UPRA 1TQZA 5DHFB 4OT1A 3KRWA 3F0WA 2CY4A 3G9WA 1X11A 5D3YA 3PSCA 4QXAB 3ULCA 5GOWB 1U5GA 2QKMA 5IRSA 4PQ0A 1M7EA 3HK0A 4HAVB 3DXEA 2COAA 2RRFA 1W1HA 3PVWA 4HHVA 1NTVA 2W2XC 5D3XA 2VSZA 1XKEA 1X05A 2D11A 2G35A 2M14A 2ROVA 4DXAB 5KQ4A 4A6HA 1DYNA 2AEHA 2YT2A 1PLSA 1V88A 2P0DA 1X86A 2NZ8B 5DHAB 1GC7A 1EAZA 2UZSA 4C0AA 2KIEA 2KCJA 4YL8A 4HB0B 3B77A 2J0KA 1UEFA 1V61A 3A98B 3F5RA 2YT1A 2DA0A 1WVHA 3SO6A 2GCJA 5HE2A 5DH9B 2R0DA 3CIKA 4L1RA 5FI0A 1FHXA 1MIXA 5CLQB 1U2BA 2YT0A 1NU2A 1QC6A 5J3YA 2VKIA 1FGYA 1H10A 4KHAA 4HAZB 3KY9A 5JLJB 2XQNM 1RJ2A 3TFMA 4D0NB 2DFKA 4GN1A 4HAXB 5DI9B 4GZUA 2LG1A 2LKOA 4GMVA 2UZRA 1GG3A 2I5FA 4F7UP 4YONA 2Z59A 4MT7A 3KRXA 2H7DA 4HAYB 1P6SA 3TW1A 2KIGA 1P5TA 5C6RA 3GYPA 2DHKA 1XD4A 2YS3A 3LJUX 1UPQA 1KZ7A 4A6FB 4CHMA 4GXBA 1FHOA 5C5BB 3TO1A 5C5BA 1M7RA 2GS0A 2D9VA 1K5DB 1N3HA 3DCXA 1UNRA 5LONB 3OHMB 4HB3B 4KAXB 4DX8A 2HE7A 2N23A 3ULBA 2ROZB 3ZVRA 3N7CA 2NMBA 5J3TA 3T06A 4K81A 4PNKA 2K00A 2D10A 2LOZA 4K2OA 1AQCA 1WGQA 3QBVB 1TXDA 1MKEA 4HSIA 4HB4B 1BTNA 1SHCA 2X18A 3PVUA 4TKNA 2COFA 3AU4A 1NI2A 5JHGA 3ODOA 2EJ8A 4IAPA 4IFSA 5M4YB 5EFXA 3FEHA 5FI1A 2GCLA 4B6HA 4ZRKA 4F7GA 1TJ6A 1U5EA
chains in the Genus database with same CATH topology
2Q13A 2I5CA 1MAIA 2DYNA 5D27A 1SGHA 2DX5A 2P8VA 5KCVA 1AWEA 4DX90 4HDQA 1PMSA 2LYDA 3HW2B 4EJNA 1Y19B 4MY6A 2JP2A 3PZDA 4GPTB 3TVVA 2YRYA 1MK9B 1ZSQA 4WVFB 1DBHA 1E5WA 1I7AA 2RLOA 1FAOA 4WJ7A 2D4QA 2DKQA 1EGXA 3ML4A 1P3RA 2R09A 4EMOA 1OQNA 4HB2B 1RRPB 3FM8C 2N0YA 1V5PA 3KZ1A 3ZDTA 2YSZA 3TCAA 1K5GB 1NTYA 5D3WA 2Y7BA 2D9ZA 2J0MA 5HE1A 4BBKA 1UNQA 1Q67A 2J0JA 1PFJA 2EC1A 2ZPYA 4K2PA 2LULA 2I1JA 1WJ1A 5CLLB 1H4RA 1MPHA 2IFSA 2RVBB 3P6AA 3PG7A 4A6FA 3UZTA 2AL6A 4MK0A 3IVFA 2ADZA 5C16A 2YVCA 2MDXA 2FJLA 3P7ZA 2D2QA 1EVHA 1UNPA 3CXBB 2GJYA 1BAKA 1ZVRA 4WSFA 1U5DA 2ELBA 1XX0A 1V89A 2ELAA 1ZC4B 1WJMA 2DX1A 3PP2A 3MDBC 2VRWB 1OMWA 4A6KA 4NY0A 4Z2NA 4HDOA 3DXDA 3OANA 2QKLA 2D9XA 3U8ZA 2P0HA 1FOEA 2DLWA 2E2XA 4Z2MB 4TYZA 1DROA 3SV1A 1DDVA 3AU5A 1W1DA 3QIJA 2YS1A 1LB1A 1ZC3B 3SNHA 1EF1A 2V76A 2L1CA 5C79A 5JP4A 3PVLA 1BTKA 2DHIA 2HTHB 2L2IA 3SYXA 4A5KA 1WG7A 4KVGB 3NSUA 2RUKB 1QQGA 1XCGA 1W1GA 2DYQA 3U7DA 1ZM0A 2LOXA 2MWNB 3M1IB 1FGZA 1V5UA 1X1FA 1Z87A 4HAWB 1XODA 5KQ1A 3BJIA 2K2JA 4HATB 1ISNA 2RSGA 5D3VA 5LOPB 1KI1B 5JHHA 1U27A 3ODWA 2RGNB 2Z0PA 4CYEA 3D8EA 2YF0A 3FSSA 4HAUB 2D9YA 1DDWA 2W2XD 1Y5OA 4KHOA 5HE3A 3VIAA 1X1GA 2BCJA 2EMSA 3X23A 3BINA 3DXCA 2COCA 1B55A 1IRSA 3WYFB 1KZGA 1J0WA 2Z0OA 2EMTA 2Y8GA 3ODXA 2OTXA 4EKUA 5L81A 1GC6A 3QWMA 2IYBA 2DTCA 2MFQA 2P0FA 1FB8A 2DHJA 3HQCA 4F7HA 2W2WA 1XR0B 1FHWA 1WGUA 4NSWA 2K2UA 2RNRB 1V5MA 4L6EA 5HE0A 5J3QA 1LW3A 4IOYX 3D8FA 2DN6A 3PEGA 3WA0A 3KSYA 2M38A 2CRFA 2OQBA 3O96A 4KHBB 1BWNA 2CAYA 1DDMA 3A8QA 3D8DA 2YS5A 2J59M 4K17A 1OY2A 4H8SA 1U5FA 1WI1A 2CY5A 3MPXA 2KGXB 3A8PA 4CHJA 4DBBA 2KUPA 1MK7B 1J19A 4ZRJA 1I2HA 2CODA 4XWXA 2UVMA 2MKRA 3V5WA 3RCPA 4P7IA 2PZ1A 2Y8FA 4ZRIA 4GMXB 3VOQA 5DIFB 2Z0QA 3SUZA 4Y94A 2H7EA 3AJ4A 2D9WA 1MIZB 3GYOA 2I1KA 2DKPA 1U29A 1UPRA 1TQZA 5DHFB 3KRWA 3F0WA 2CY4A 3G9WA 1X11A 5D3YA 3PSCA 3ULCA 5GOWB 1U5GA 2QKMA 4PQ0A 1M7EA 4HAVB 3HK0A 3DXEA 2COAA 1W1HA 4HHVA 3PVWA 1NTVA 2W2XC 5D3XA 2VSZA 1XKEA 1X05A 2D11A 2G35A 2M14A 2ROVA 4DXAB 5KQ4A 4A6HA 1DYNA 2AEHA 1PLSA 1V88A 2P0DA 1X86A 2NZ8B 5DHAB 1GC7A 1EAZA 2UZSA 4C0AA 2KCJA 4YL8A 4HB0B 2J0KA 1UEFA 1V61A 3A98B 3F5RA 2YT1A 2DA0A 1WVHA 3SO6A 2GCJA 5HE2A 5DH9B 2R0DA 3CIKA 5FI0A 1FHXA 1MIXA 5CLQB 1U2BA 2YT0A 1NU2A 1QC6A 5J3YA 2VKIA 1FGYA 1H10A 4KHAA 4HAZB 3KY9A 5JLJB 2XQNM 1RJ2A 3TFMA 4D0NB 2DFKA 4GN1A 4HAXB 5DI9B 4GZUA 2LG1A 2LKOA 4GMVA 2UZRA 1GG3A 2I5FA 4F7UP 4YONA 4MT7A 3KRXA 2H7DA 4HAYB 1P6SA 3TW1A 1P5TA 5C6RA 3GYPA 2DHKA 1XD4A 2YS3A 3LJUX 1UPQA 1KZ7A 4A6FB 4CHMA 4GXBA 1FHOA 5C5BB 3TO1A 5C5BA 1M7RA 2GS0A 2D9VA 1K5DB 1N3HA 1UNRA 5LONB 4HB3B 4KAXB 4DX8A 2HE7A 2N23A 3ULBA 2ROZB 3ZVRA 3N7CA 2NMBA 5J3TA 3T06A 4K81A 4PNKA 2K00A 2D10A 2LOZA 4K2OA 1AQCA 1WGQA 3QBVB 1TXDA 1MKEA 4HB4B 1BTNA 1SHCA 2X18A 3PVUA 4TKNA 2COFA 3AU4A 1NI2A 5JHGA 3ODOA 2EJ8A 4IAPA 4IFSA 5EFXA 3FEHA 5FI1A 2GCLA 4B6HA 4ZRKA 4F7GA 1TJ6A 1U5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q13 A;  2I5C A;  1MAI A;  2DYN A;  5D27 A;  1SGH A;  2DX5 A;  2P8V A;  5KCV A;  1AWE A;  4DX9 0;  4HDQ A;  1PMS A;  2LYD A;  3HW2 B;  4EJN A;  1Y19 B;  4MY6 A;  2JP2 A;  3PZD A;  4GPT B;  3TVV A;  2YRY A;  1MK9 B;  1ZSQ A;  4WVF B;  1DBH A;  1E5W A;  1I7A A;  2RLO A;  1FAO A;  4WJ7 A;  2D4Q A;  2DKQ A;  1EGX A;  3ML4 A;  1P3R A;  2R09 A;  4EMO A;  1OQN A;  4HB2 B;  1RRP B;  3FM8 C;  2N0Y A;  1V5P A;  3KZ1 A;  3ZDT A;  2YSZ A;  3TCA A;  1K5G B;  1NTY A;  5D3W A;  2Y7B A;  2D9Z A;  2J0M A;  5HE1 A;  4BBK A;  1UNQ A;  1Q67 A;  2J0J A;  1PFJ A;  2EC1 A;  2ZPY A;  4K2P A;  2LUL A;  2I1J A;  1WJ1 A;  5CLL B;  1H4R A;  1MPH A;  2IFS A;  2RVB B;  3P6A A;  3PG7 A;  4A6F A;  3UZT A;  2AL6 A;  4MK0 A;  3IVF A;  2ADZ A;  5C16 A;  2YVC A;  2MDX A;  2FJL A;  3P7Z A;  2D2Q A;  1EVH A;  1UNP A;  3CXB B;  2GJY A;  1BAK A;  1ZVR A;  4WSF A;  1U5D A;  2ELB A;  1XX0 A;  1V89 A;  2ELA A;  1ZC4 B;  1WJM A;  2DX1 A;  3PP2 A;  3MDB C;  2VRW B;  1OMW A;  4A6K A;  4NY0 A;  4Z2N A;  4HDO A;  3DXD A;  3OAN A;  2QKL A;  2D9X A;  3U8Z A;  2P0H A;  1FOE A;  2DLW A;  2E2X A;  4Z2M B;  4TYZ A;  1DRO A;  3SV1 A;  1DDV A;  3AU5 A;  1W1D A;  3QIJ A;  2YS1 A;  1LB1 A;  1ZC3 B;  3SNH A;  1EF1 A;  2V76 A;  2L1C A;  5C79 A;  5JP4 A;  3PVL A;  1BTK A;  2DHI A;  2HTH B;  2L2I A;  3SYX A;  4A5K A;  1WG7 A;  4KVG B;  3NSU A;  2RUK B;  1QQG A;  1XCG A;  1W1G A;  2DYQ A;  3U7D A;  1ZM0 A;  2LOX A;  2MWN B;  3M1I B;  1FGZ A;  1V5U A;  1X1F A;  1Z87 A;  4HAW B;  1XOD A;  5KQ1 A;  3BJI A;  2K2J A;  4HAT B;  1ISN A;  2RSG A;  5D3V A;  5LOP B;  1KI1 B;  5JHH A;  1U27 A;  3ODW A;  2RGN B;  2Z0P A;  4CYE A;  3D8E A;  2YF0 A;  3FSS A;  4HAU B;  2D9Y A;  1DDW A;  2W2X D;  1Y5O A;  4KHO A;  5HE3 A;  3VIA A;  1X1G A;  2BCJ A;  2EMS A;  3X23 A;  3BIN A;  3DXC A;  2COC A;  1B55 A;  1IRS A;  3WYF B;  1KZG A;  1J0W A;  2Z0O A;  2EMT A;  2Y8G A;  3ODX A;  2OTX A;  4EKU A;  5L81 A;  1GC6 A;  3QWM A;  2IYB A;  2DTC A;  2MFQ A;  2P0F A;  1FB8 A;  2DHJ A;  3HQC A;  4F7H A;  2W2W A;  1XR0 B;  1FHW A;  1WGU A;  4NSW A;  2K2U A;  2RNR B;  1V5M A;  4L6E A;  5HE0 A;  5J3Q A;  1LW3 A;  4IOY X;  3D8F A;  2DN6 A;  3PEG A;  3WA0 A;  3KSY A;  2M38 A;  2CRF A;  2OQB A;  3O96 A;  4KHB B;  1BWN A;  2CAY A;  1DDM A;  3A8Q A;  3D8D A;  2YS5 A;  2J59 M;  4K17 A;  1OY2 A;  4H8S A;  1U5F A;  1WI1 A;  2CY5 A;  3MPX A;  2KGX B;  3A8P A;  4CHJ A;  4DBB A;  2KUP A;  1MK7 B;  1J19 A;  4ZRJ A;  1I2H A;  2COD A;  4XWX A;  2UVM A;  2MKR A;  3V5W A;  3RCP A;  4P7I A;  2PZ1 A;  2Y8F A;  4ZRI A;  4GMX B;  3VOQ A;  5DIF B;  2Z0Q A;  3SUZ A;  4Y94 A;  2H7E A;  3AJ4 A;  2D9W A;  1MIZ B;  3GYO A;  2I1K A;  2DKP A;  1U29 A;  1UPR A;  1TQZ A;  5DHF B;  3KRW A;  3F0W A;  2CY4 A;  3G9W A;  1X11 A;  5D3Y A;  3PSC A;  3ULC A;  5GOW B;  1U5G A;  2QKM A;  4PQ0 A;  1M7E A;  4HAV B;  3HK0 A;  3DXE A;  2COA A;  1W1H A;  4HHV A;  3PVW A;  1NTV A;  2W2X C;  5D3X A;  2VSZ A;  1XKE A;  1X05 A;  2D11 A;  2G35 A;  2M14 A;  2ROV A;  4DXA B;  5KQ4 A;  4A6H A;  1DYN A;  2AEH A;  1PLS A;  1V88 A;  2P0D A;  1X86 A;  2NZ8 B;  5DHA B;  1GC7 A;  1EAZ A;  2UZS A;  4C0A A;  2KCJ A;  4YL8 A;  4HB0 B;  2J0K A;  1UEF A;  1V61 A;  3A98 B;  3F5R A;  2YT1 A;  2DA0 A;  1WVH A;  3SO6 A;  2GCJ A;  5HE2 A;  5DH9 B;  2R0D A;  3CIK A;  5FI0 A;  1FHX A;  1MIX A;  5CLQ B;  1U2B A;  2YT0 A;  1NU2 A;  1QC6 A;  5J3Y A;  2VKI A;  1FGY A;  1H10 A;  4KHA A;  4HAZ B;  3KY9 A;  5JLJ B;  2XQN M;  1RJ2 A;  3TFM A;  4D0N B;  2DFK A;  4GN1 A;  4HAX B;  5DI9 B;  4GZU A;  2LG1 A;  2LKO A;  4GMV A;  2UZR A;  1GG3 A;  2I5F A;  4F7U P;  4YON A;  4MT7 A;  3KRX A;  2H7D A;  4HAY B;  1P6S A;  3TW1 A;  1P5T A;  5C6R A;  3GYP A;  2DHK A;  1XD4 A;  2YS3 A;  3LJU X;  1UPQ A;  1KZ7 A;  4A6F B;  4CHM A;  4GXB A;  1FHO A;  5C5B B;  3TO1 A;  5C5B A;  1M7R A;  2GS0 A;  2D9V A;  1K5D B;  1N3H A;  1UNR A;  5LON B;  4HB3 B;  4KAX B;  4DX8 A;  2HE7 A;  2N23 A;  3ULB A;  2ROZ B;  3ZVR A;  3N7C A;  2NMB A;  5J3T A;  3T06 A;  4K81 A;  4PNK A;  2K00 A;  2D10 A;  2LOZ A;  4K2O A;  1AQC A;  1WGQ A;  3QBV B;  1TXD A;  1MKE A;  4HB4 B;  1BTN A;  1SHC A;  2X18 A;  3PVU A;  4TKN A;  2COF A;  3AU4 A;  1NI2 A;  5JHG A;  3ODO A;  2EJ8 A;  4IAP A;  4IFS A;  5EFX A;  3FEH A;  5FI1 A;  2GCL A;  4B6H A;  4ZRK A;  4F7G A;  1TJ6 A;  1U5E A; 
#chains in the Genus database with same CATH topology
 2KR0 A;  2Q13 A;  2I5C A;  1MAI A;  2DYN A;  5D27 A;  2GUM A;  1SGH A;  2DX5 A;  2P8V A;  5KCV A;  1AWE A;  4DIX A;  4DX9 0;  4HDQ A;  1PMS A;  2LYD A;  2NBV A;  3HW2 B;  4EJN A;  1Y19 B;  4MY6 A;  2K8E A;  2JP2 A;  3PZD A;  4GPT B;  3TVV A;  2YRY A;  1MK9 B;  1ZSQ A;  4WVF B;  1DBH A;  1E5W A;  1I7A A;  2RLO A;  1FAO A;  4WJ7 A;  2D4Q A;  2DKQ A;  1EGX A;  3ML4 A;  1P3R A;  2R09 A;  4EMO A;  1MI1 A;  1OQN A;  4QJ5 B;  4HB2 B;  1RRP B;  4OSN A;  3FM8 C;  2N0Y A;  1V5P A;  3KZ1 A;  3ZDT A;  2YSZ A;  3TCA A;  1K5G B;  1NTY A;  5D3W A;  2Y7B A;  2D9Z A;  2J0M A;  5HE1 A;  4BBK A;  1UNQ A;  1Q67 A;  2J0J A;  1PFJ A;  2EC1 A;  2ZPY A;  4K2P A;  2LUL A;  2I1J A;  1WJ1 A;  5CLL B;  1H4R A;  1MPH A;  2FJU B;  2IFS A;  2RVB B;  3P6A A;  3PG7 A;  4A6F A;  3FVC A;  3UZT A;  2AL6 A;  4MK0 A;  3IVF A;  2ADZ A;  4GNK B;  5C16 A;  2ZKM X;  2YVC A;  2MDX A;  2FJL A;  3P7Z A;  2D2Q A;  1EVH A;  1UNP A;  3CXB B;  2GJY A;  1BAK A;  1ZVR A;  3NWF A;  4WSF A;  1U5D A;  2ELB A;  4QJ3 B;  2KUQ A;  2Z13 A;  1XX0 A;  3PP2 A;  1V89 A;  1ZC4 B;  1WJM A;  2DX1 A;  2ELA A;  3MDB C;  3NWD A;  2VRW B;  1OMW A;  4A6K A;  3A58 A;  4NY0 A;  4Z2N A;  2Z4D A;  4HDO A;  3DXD A;  5I2S A;  3OAN A;  2QKL A;  2D9X A;  3U8Z A;  2P0H A;  1FOE A;  2DLW A;  2E2X A;  4Z2M B;  4D6W A;  4TYZ A;  1DRO A;  3SV1 A;  1DDV A;  3AU5 A;  1W1D A;  3QIJ A;  2YS1 A;  5I2M A;  1LB1 A;  1ZC3 B;  3SNH A;  1EF1 A;  3U12 A;  2V76 A;  2L1C A;  5C79 A;  5JP4 A;  3PVL A;  1BTK A;  2DHI A;  2HTH B;  2L2I A;  3SYX A;  4A5K A;  1WG7 A;  4KVG B;  3NSU A;  2RUK B;  1QQG A;  1XCG A;  1W1G A;  2DYQ A;  3U7D A;  1ZM0 A;  2LOX A;  2MWN B;  3M1I B;  1FGZ A;  1V5U A;  1X1F A;  1Z87 A;  4HAW B;  1XOD A;  5KQ1 A;  3BJI A;  3HIE A;  2K2J A;  4HAT B;  1ISN A;  2RSG A;  5D3V A;  5LOP B;  1KI1 B;  5JHH A;  1U27 A;  3ODW A;  2RGN B;  2Z0P A;  4CYE A;  3D8E A;  2YF0 A;  3FSS A;  4HAU B;  2D9Y A;  5LG4 B;  1DDW A;  2W2X D;  1Y5O A;  4KHO A;  5HE3 A;  3VIA A;  1X1G A;  2BCJ A;  2EMS A;  3X23 A;  3BIN A;  3DXC A;  2COC A;  1B55 A;  1IRS A;  3WYF B;  1KZG A;  1J0W A;  2Z0O A;  4GOU A;  2EMT A;  2Y8G A;  3ODX A;  4QJ4 B;  2OTX A;  2R2Y A;  4EKU A;  5L81 A;  1ZYI A;  1GC6 A;  3QWM A;  2IYB A;  2DTC A;  2MFQ A;  2P0F A;  1FB8 A;  2DHJ A;  3HQC A;  4F7H A;  2W2W A;  1XR0 B;  1FHW A;  1WGU A;  4NSW A;  2K2U A;  2RNR B;  1V5M A;  4L6E A;  5HE0 A;  5J3Q A;  1LW3 A;  4IOY X;  3D8F A;  2DN6 A;  3PEG A;  3WA0 A;  3KSY A;  2M38 A;  1T77 A;  2CRF A;  2OQB A;  3O96 A;  4KHB B;  2Z14 A;  4KHB A;  1BWN A;  2CAY A;  1DDM A;  3NWA A;  3A8Q A;  3D8D A;  2YS5 A;  2J59 M;  4K17 A;  1OY2 A;  4H8S A;  1U5F A;  1WI1 A;  2CY5 A;  3MPX A;  2KGX B;  3A8P A;  4CHJ A;  4DBB A;  2KUP A;  1MK7 B;  1J19 A;  4ZRJ A;  1I2H A;  2COD A;  4XWX A;  2UVM A;  2MKR A;  3V5W A;  2K49 A;  3RCP A;  4CSQ A;  4P7I A;  2PZ1 A;  2Y8F A;  4ZRI A;  4GMX B;  3VOQ A;  5DIF B;  2Z0Q A;  3SUZ A;  4Y94 A;  2H7E A;  3HSA A;  3AJ4 A;  2D9W A;  1MIZ B;  3GYO A;  2I1K A;  2DKP A;  3NW8 A;  1U29 A;  1UPR A;  1TQZ A;  5DHF B;  4OT1 A;  3KRW A;  3F0W A;  2CY4 A;  3G9W A;  1X11 A;  5D3Y A;  3PSC A;  4QXA B;  3ULC A;  5GOW B;  1U5G A;  2QKM A;  5IRS A;  4PQ0 A;  1M7E A;  3HK0 A;  4HAV B;  3DXE A;  2COA A;  2RRF A;  1W1H A;  3PVW A;  4HHV A;  1NTV A;  2W2X C;  5D3X A;  2VSZ A;  1XKE A;  1X05 A;  2D11 A;  2G35 A;  2M14 A;  2ROV A;  4DXA B;  5KQ4 A;  4A6H A;  1DYN A;  2AEH A;  2YT2 A;  1PLS A;  1V88 A;  2P0D A;  1X86 A;  2NZ8 B;  5DHA B;  1GC7 A;  1EAZ A;  2UZS A;  4C0A A;  2KIE A;  2KCJ A;  4YL8 A;  4HB0 B;  3B77 A;  2J0K A;  1UEF A;  1V61 A;  3A98 B;  3F5R A;  2YT1 A;  2DA0 A;  1WVH A;  3SO6 A;  2GCJ A;  5HE2 A;  5DH9 B;  2R0D A;  3CIK A;  4L1R A;  5FI0 A;  1FHX A;  1MIX A;  5CLQ B;  1U2B A;  2YT0 A;  1NU2 A;  1QC6 A;  5J3Y A;  2VKI A;  1FGY A;  1H10 A;  4KHA A;  4HAZ B;  3KY9 A;  5JLJ B;  2XQN M;  1RJ2 A;  3TFM A;  4D0N B;  2DFK A;  4GN1 A;  4HAX B;  5DI9 B;  4GZU A;  2LG1 A;  2LKO A;  4GMV A;  2UZR A;  1GG3 A;  2I5F A;  4F7U P;  4YON A;  2Z59 A;  4MT7 A;  3KRX A;  2H7D A;  4HAY B;  1P6S A;  3TW1 A;  2KIG A;  1P5T A;  5C6R A;  3GYP A;  2DHK A;  1XD4 A;  2YS3 A;  3LJU X;  1UPQ A;  1KZ7 A;  4A6F B;  4CHM A;  4GXB A;  1FHO A;  5C5B B;  3TO1 A;  5C5B A;  1M7R A;  2GS0 A;  2D9V A;  1K5D B;  1N3H A;  3DCX A;  1UNR A;  5LON B;  3OHM B;  4HB3 B;  4KAX B;  4DX8 A;  2HE7 A;  2N23 A;  3ULB A;  2ROZ B;  3ZVR A;  3N7C A;  2NMB A;  5J3T A;  3T06 A;  4K81 A;  4PNK A;  2K00 A;  2D10 A;  2LOZ A;  4K2O A;  1AQC A;  1WGQ A;  3QBV B;  1TXD A;  1MKE A;  4HSI A;  4HB4 B;  1BTN A;  1SHC A;  2X18 A;  3PVU A;  4TKN A;  2COF A;  3AU4 A;  1NI2 A;  5JHG A;  3ODO A;  2EJ8 A;  4IAP A;  4IFS A;  5M4Y B;  5EFX A;  3FEH A;  5FI1 A;  2GCL A;  4B6H A;  4ZRK A;  4F7G A;  1TJ6 A;  1U5E A; 
#chains in the Genus database with same CATH homology
 2Q13 A;  2I5C A;  1MAI A;  2DYN A;  5D27 A;  1SGH A;  2DX5 A;  2P8V A;  5KCV A;  1AWE A;  4DX9 0;  4HDQ A;  1PMS A;  2LYD A;  3HW2 B;  4EJN A;  1Y19 B;  4MY6 A;  2JP2 A;  3PZD A;  4GPT B;  3TVV A;  2YRY A;  1MK9 B;  1ZSQ A;  4WVF B;  1DBH A;  1E5W A;  1I7A A;  2RLO A;  1FAO A;  4WJ7 A;  2D4Q A;  2DKQ A;  1EGX A;  3ML4 A;  1P3R A;  2R09 A;  4EMO A;  1OQN A;  4HB2 B;  1RRP B;  3FM8 C;  2N0Y A;  1V5P A;  3KZ1 A;  3ZDT A;  2YSZ A;  3TCA A;  1K5G B;  1NTY A;  5D3W A;  2Y7B A;  2D9Z A;  2J0M A;  5HE1 A;  4BBK A;  1UNQ A;  1Q67 A;  2J0J A;  1PFJ A;  2EC1 A;  2ZPY A;  4K2P A;  2LUL A;  2I1J A;  1WJ1 A;  5CLL B;  1H4R A;  1MPH A;  2IFS A;  2RVB B;  3P6A A;  3PG7 A;  4A6F A;  3UZT A;  2AL6 A;  4MK0 A;  3IVF A;  2ADZ A;  5C16 A;  2YVC A;  2MDX A;  2FJL A;  3P7Z A;  2D2Q A;  1EVH A;  1UNP A;  3CXB B;  2GJY A;  1BAK A;  1ZVR A;  4WSF A;  1U5D A;  2ELB A;  1XX0 A;  1V89 A;  2ELA A;  1ZC4 B;  1WJM A;  2DX1 A;  3PP2 A;  3MDB C;  2VRW B;  1OMW A;  4A6K A;  4NY0 A;  4Z2N A;  4HDO A;  3DXD A;  3OAN A;  2QKL A;  2D9X A;  3U8Z A;  2P0H A;  1FOE A;  2DLW A;  2E2X A;  4Z2M B;  4TYZ A;  1DRO A;  3SV1 A;  1DDV A;  3AU5 A;  1W1D A;  3QIJ A;  2YS1 A;  1LB1 A;  1ZC3 B;  3SNH A;  1EF1 A;  2V76 A;  2L1C A;  5C79 A;  5JP4 A;  3PVL A;  1BTK A;  2DHI A;  2HTH B;  2L2I A;  3SYX A;  4A5K A;  1WG7 A;  4KVG B;  3NSU A;  2RUK B;  1QQG A;  1XCG A;  1W1G A;  2DYQ A;  3U7D A;  1ZM0 A;  2LOX A;  2MWN B;  3M1I B;  1FGZ A;  1V5U A;  1X1F A;  1Z87 A;  4HAW B;  1XOD A;  5KQ1 A;  3BJI A;  2K2J A;  4HAT B;  1ISN A;  2RSG A;  5D3V A;  5LOP B;  1KI1 B;  5JHH A;  1U27 A;  3ODW A;  2RGN B;  2Z0P A;  4CYE A;  3D8E A;  2YF0 A;  3FSS A;  4HAU B;  2D9Y A;  1DDW A;  2W2X D;  1Y5O A;  4KHO A;  5HE3 A;  3VIA A;  1X1G A;  2BCJ A;  2EMS A;  3X23 A;  3BIN A;  3DXC A;  2COC A;  1B55 A;  1IRS A;  3WYF B;  1KZG A;  1J0W A;  2Z0O A;  2EMT A;  2Y8G A;  3ODX A;  2OTX A;  4EKU A;  5L81 A;  1GC6 A;  3QWM A;  2IYB A;  2DTC A;  2MFQ A;  2P0F A;  1FB8 A;  2DHJ A;  3HQC A;  4F7H A;  2W2W A;  1XR0 B;  1FHW A;  1WGU A;  4NSW A;  2K2U A;  2RNR B;  1V5M A;  4L6E A;  5HE0 A;  5J3Q A;  1LW3 A;  4IOY X;  3D8F A;  2DN6 A;  3PEG A;  3WA0 A;  3KSY A;  2M38 A;  2CRF A;  2OQB A;  3O96 A;  4KHB B;  1BWN A;  2CAY A;  1DDM A;  3A8Q A;  3D8D A;  2YS5 A;  2J59 M;  4K17 A;  1OY2 A;  4H8S A;  1U5F A;  1WI1 A;  2CY5 A;  3MPX A;  2KGX B;  3A8P A;  4CHJ A;  4DBB A;  2KUP A;  1MK7 B;  1J19 A;  4ZRJ A;  1I2H A;  2COD A;  4XWX A;  2UVM A;  2MKR A;  3V5W A;  3RCP A;  4P7I A;  2PZ1 A;  2Y8F A;  4ZRI A;  4GMX B;  3VOQ A;  5DIF B;  2Z0Q A;  3SUZ A;  4Y94 A;  2H7E A;  3AJ4 A;  2D9W A;  1MIZ B;  3GYO A;  2I1K A;  2DKP A;  1U29 A;  1UPR A;  1TQZ A;  5DHF B;  3KRW A;  3F0W A;  2CY4 A;  3G9W A;  1X11 A;  5D3Y A;  3PSC A;  3ULC A;  5GOW B;  1U5G A;  2QKM A;  4PQ0 A;  1M7E A;  4HAV B;  3HK0 A;  3DXE A;  2COA A;  1W1H A;  4HHV A;  3PVW A;  1NTV A;  2W2X C;  5D3X A;  2VSZ A;  1XKE A;  1X05 A;  2D11 A;  2G35 A;  2M14 A;  2ROV A;  4DXA B;  5KQ4 A;  4A6H A;  1DYN A;  2AEH A;  1PLS A;  1V88 A;  2P0D A;  1X86 A;  2NZ8 B;  5DHA B;  1GC7 A;  1EAZ A;  2UZS A;  4C0A A;  2KCJ A;  4YL8 A;  4HB0 B;  2J0K A;  1UEF A;  1V61 A;  3A98 B;  3F5R A;  2YT1 A;  2DA0 A;  1WVH A;  3SO6 A;  2GCJ A;  5HE2 A;  5DH9 B;  2R0D A;  3CIK A;  5FI0 A;  1FHX A;  1MIX A;  5CLQ B;  1U2B A;  2YT0 A;  1NU2 A;  1QC6 A;  5J3Y A;  2VKI A;  1FGY A;  1H10 A;  4KHA A;  4HAZ B;  3KY9 A;  5JLJ B;  2XQN M;  1RJ2 A;  3TFM A;  4D0N B;  2DFK A;  4GN1 A;  4HAX B;  5DI9 B;  4GZU A;  2LG1 A;  2LKO A;  4GMV A;  2UZR A;  1GG3 A;  2I5F A;  4F7U P;  4YON A;  4MT7 A;  3KRX A;  2H7D A;  4HAY B;  1P6S A;  3TW1 A;  1P5T A;  5C6R A;  3GYP A;  2DHK A;  1XD4 A;  2YS3 A;  3LJU X;  1UPQ A;  1KZ7 A;  4A6F B;  4CHM A;  4GXB A;  1FHO A;  5C5B B;  3TO1 A;  5C5B A;  1M7R A;  2GS0 A;  2D9V A;  1K5D B;  1N3H A;  1UNR A;  5LON B;  4HB3 B;  4KAX B;  4DX8 A;  2HE7 A;  2N23 A;  3ULB A;  2ROZ B;  3ZVR A;  3N7C A;  2NMB A;  5J3T A;  3T06 A;  4K81 A;  4PNK A;  2K00 A;  2D10 A;  2LOZ A;  4K2O A;  1AQC A;  1WGQ A;  3QBV B;  1TXD A;  1MKE A;  4HB4 B;  1BTN A;  1SHC A;  2X18 A;  3PVU A;  4TKN A;  2COF A;  3AU4 A;  1NI2 A;  5JHG A;  3ODO A;  2EJ8 A;  4IAP A;  4IFS A;  5EFX A;  3FEH A;  5FI1 A;  2GCL A;  4B6H A;  4ZRK A;  4F7G A;  1TJ6 A;  1U5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...