2YS1A

Solution structure of the ph domain of dynamin-2 from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-2
publication title Solution structure of the PH domain of Dynamin-2 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 113
sequence length 113
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys1A00
1N3HA 2DX5A 3BINA 2LYDA 1P5TA 1PMSA 2J0KA 3A8PA 4K2OA 2J0JA 4Z2MB 2ROVA 1BTKA 2YS5A 1XX0A 4B6HA 4DXAB 1WGQA 3KY9A 3ODXA 3PZDA 1SHCA 3HK0A 4A6FB 1SGHA 4XWXA 5L81A 3ZVRA 5C5BB 1PLSA 4NY0A 4MT7A 3TO1A 4A6KA 2D10A 3VIAA 1ZC4B 1U5GA 4YL8A 3TFMA 2OTXA 3N7CA 3T06A 3SYXA 4DBBA 5JHHA 2RVBB 2GS0A 1Y19B 2YF0A 2OQBA 1I2HA 3PSCA 2LULA 1FHXA 4YONA 1W1GA 2KCJA 4DX8A 1FGZA 1UNQA 4HB0B 5KQ4A 1ZM0A 2EC1A 5J3TA 1FHWA 1DDMA 2R09A 2P0FA 4PNKA 1MPHA 2M14A 1H4RA 4EKUA 1ZVRA 2ELAA 3KRWA 3KSYA 2D9XA 3UZTA 2GCLA 2EMSA 4IOYX 5C79A 1OMWA 1EVHA 4K17A 3VOQA 2LOXA 1X1GA 1OY2A 4Z2NA 5DH9B 4HAWB 3PVWA 4TYZA 4K81A 4HB2B 2RGNB 2XQNM 5DHFB 3U8ZA 2COAA 1FB8A 3HW2B 3ML4A 1H10A 3QWMA 4HAZB 2FJLA 2HE7A 2UVMA 2H7EA 2MKRA 1W1DA 1TQZA 1J0WA 2DN6A 1KZ7A 2CRFA 1V88A 2W2WA 1ZC3B 2EJ8A 4HB3B 5D3YA 1M7EA 3P6AA 4HDOA 2J59M 5D3WA 3AJ4A 2I5FA 4ZRIA 1TJ6A 3TVVA 5JLJB 5FI0A 1MK7B 3CXBB 1UPQA 2IYBA 2G35A 4HDQA 3KZ1A 1MAIA 1FOEA 1IRSA 1DBHA 3M1IB 1DDVA 2ADZA 2L1CA 1P3RA 3LJUX 4PQ0A 1GC6A 4WVFB 2N23A 5HE1A 1E5WA 2DYNA 3OANA 3F5RA 1WGUA 3GYPA 1LB1A 2DHIA 1X1FA 1P6SA 1FGYA 5DHAB 4HB4B 3U7DA 3PG7A 5CLQB 3HQCA 3ZDTA 5J3YA 2YSZA 2K2JA 3WA0A 5DI9B 5C6RA 4EMOA 1XKEA 3SNHA 2ELBA 4MY6A 1ZSQA 3NSUA 2Z0OA 1RJ2A 4A6HA 4EJNA 5D27A 3ULCA 4CHMA 2COCA 4TKNA 2I5CA 3PVLA 2LG1A 3PVUA 2BCJA 4H8SA 2L2IA 1KZGA 1V5MA 5J3QA 4IFSA 2LKOA 1RRPB 5KQ1A 2RNRB 3DXEA 2YVCA 1U2BA 2DA0A 2K00A 2CY4A 2GCJA 2YT1A 2DYQA 5C5BA 1XODA 4HHVA 1WJMA 4D0NB 2DHJA 1XCGA 1GG3A 5LOPB 3SO6A 1NU2A 5C16A 1WVHA 4HATB 5HE2A 5JHGA 1TXDA 3D8DA 2K2UA 1EAZA 2M38A 4ZRKA 2D11A 1QC6A 1OQNA 1V5UA 4K2PA 1M7RA 4Y94A 1K5GB 1BAKA 2P8VA 5JP4A 2H7DA 5D3XA 4WSFA 2Z0QA 1I7AA 1UPRA 1V89A 3O96A 3AU5A 2MWNB 2J0MA 3A8QA 3SUZA 2AL6A 2ZPYA 1Q67A 2JP2A 1U5DA 3RCPA 2VRWB 2P0DA 2W2XD 1EF1A 4IAPA 3MPXA 3KRXA 3PEGA 2NMBA 1LW3A 5HE0A 2D9ZA 1AWEA 1NI2A 3A98B 2NZ8B 3TW1A 1FAOA 2Y8GA 3FSSA 2ROZB 4C0AA 4WJ7A 2VKIA 2RLOA 3F0WA 4GMVA 5KCVA 1X05A 2V76A 4GN1A 1UNPA 2MFQA 1W1HA 2CY5A 2YS1A 1WG7A 2EMTA 1U29A 3IVFA 1AQCA 2X18A 2DX1A 2DKQA 1X86A 2D9WA 2VSZA 4GXBA 1DDWA 2Y7BA 3P7ZA 2IFSA 3AU4A 2KUPA 4CYEA 4A5KA 4HAXB 4ZRJA 3G9WA 1XD4A 2KGXB 2AEHA 1MIXA 4MK0A 2YS3A 1WI1A 5EFXA 2Y8FA 2Z0PA 1UEFA 3DXDA 4KVGB 3ULBA 1DYNA 2MDXA 3DXCA 2E2XA 1U27A 1XR0B 4HAYB 1BWNA 4A6FA 2RSGA 4F7GA 3WYFB 5FI1A 3PP2A 2D2QA 5DIFB 1GC7A 2DLWA 4KHOA 1V5PA 3SV1A 5HE3A 2RUKB 1PFJA 1DROA 2UZRA 4F7HA 2I1JA 1MIZB 1NTVA 2N0YA 3GYOA 4HAVB 5CLLB 5D3VA 4KHAA 5GOWB 4CHJA 2QKMA 2PZ1A 4DX90 2LOZA 2CAYA 1NTYA 5LONB 2DFKA 1WJ1A 4GMXB 4GZUA 2YT0A 4HAUB 4L6EA 1ISNA 4KAXB 1UNRA 4KHBB 1FHOA 3V5WA 2HTHB 1V61A 2UZSA 4F7UP 2Q13A 4P7IA 2D4QA 2GJYA 3CIKA 4NSWA 2DKPA 1MKEA 4GPTB 1Y5OA 3ODOA 2CODA 2W2XC 3QIJA 3TCAA 2DHKA 3FEHA 1QQGA 2D9YA 3BJIA 2YRYA 3D8EA 1U5EA 2COFA 3FM8C 3X23A 3MDBC 2QKLA 1EGXA 3QBVB 2DTCA 2I1KA 2R0DA 1U5FA 1BTNA 3D8FA 1X11A 3ODWA 1MK9B 1B55A 1J19A 2P0HA 1K5DB 4BBKA 1KI1B 2D9VA 1Z87A
chains in the Genus database with same CATH superfamily
1N3HA 2DX5A 3BINA 2LYDA 1P5TA 1PMSA 2J0KA 3A8PA 4K2OA 2J0JA 4Z2MB 2ROVA 1BTKA 2YS5A 1XX0A 4B6HA 4DXAB 1WGQA 3KY9A 3ODXA 3PZDA 1SHCA 3HK0A 4A6FB 1SGHA 4XWXA 5L81A 3ZVRA 5C5BB 1PLSA 4NY0A 4MT7A 3TO1A 4A6KA 2D10A 3VIAA 4L1RA 1ZC4B 1U5GA 4YL8A 3TFMA 2OTXA 1ZYIA 4GNKB 3N7CA 3T06A 3SYXA 4DBBA 5JHHA 2RVBB 2GS0A 1Y19B 2YF0A 2OQBA 1I2HA 3PSCA 2LULA 1FHXA 3HIEA 3NWDA 4YONA 1W1GA 2KCJA 4DX8A 1FGZA 1UNQA 4HB0B 5KQ4A 1ZM0A 2EC1A 3FVCA 5J3TA 3HSAA 1FHWA 1MI1A 1DDMA 2R09A 2P0FA 4PNKA 1MPHA 2M14A 1H4RA 4EKUA 1ZVRA 2ELAA 3KRWA 3KSYA 2D9XA 3UZTA 2GCLA 2EMSA 4IOYX 5C79A 1OMWA 1EVHA 4K17A 4QJ5B 4D6WA 2GUMA 3VOQA 2LOXA 1X1GA 1OY2A 4Z2NA 5DH9B 4HAWB 3PVWA 4TYZA 4K81A 4HB2B 2RGNB 2XQNM 5DHFB 3U8ZA 2COAA 1FB8A 3HW2B 3ML4A 1H10A 3QWMA 4HAZB 2FJLA 2HE7A 2UVMA 2H7EA 2MKRA 1W1DA 1TQZA 1J0WA 2DN6A 1KZ7A 2CRFA 1V88A 2W2WA 1ZC3B 2EJ8A 4HB3B 5D3YA 5IRSA 1M7EA 3P6AA 4HDOA 2J59M 5D3WA 3AJ4A 2I5FA 4ZRIA 1TJ6A 3TVVA 5JLJB 5FI0A 1MK7B 3CXBB 1UPQA 2IYBA 2G35A 4HDQA 3KZ1A 4KHBA 1MAIA 1FOEA 1IRSA 1DBHA 3M1IB 1DDVA 2ADZA 2L1CA 1P3RA 3LJUX 4PQ0A 1GC6A 3B77A 4WVFB 2N23A 5HE1A 1E5WA 2DYNA 3OANA 3OHMB 3F5RA 1WGUA 3GYPA 1LB1A 2DHIA 1X1FA 1P6SA 1FGYA 5DHAB 4HB4B 3U7DA 3PG7A 5CLQB 3HQCA 3ZDTA 5J3YA 2YSZA 2K2JA 3WA0A 5DI9B 5C6RA 4EMOA 1XKEA 3SNHA 2ELBA 4MY6A 1ZSQA 3NSUA 2Z0OA 1RJ2A 4A6HA 4EJNA 5D27A 3ULCA 4CHMA 2COCA 4TKNA 2I5CA 2RRFA 3PVLA 2LG1A 3PVUA 2BCJA 4H8SA 2L2IA 2KUQA 1KZGA 1V5MA 5J3QA 4IFSA 2LKOA 1RRPB 5KQ1A 2RNRB 3DXEA 2YVCA 1U2BA 2DA0A 2K00A 2CY4A 2GCJA 2YT1A 2DYQA 4CSQA 5C5BA 1XODA 4HHVA 1WJMA 4D0NB 2DHJA 1XCGA 1GG3A 5LOPB 3SO6A 1NU2A 5C16A 2KIEA 1WVHA 4HATB 5HE2A 5JHGA 1TXDA 3D8DA 2K2UA 1EAZA 2K8EA 2M38A 4ZRKA 2D11A 3DCXA 5LG4B 1QC6A 1OQNA 1V5UA 4K2PA 1M7RA 4Y94A 1K5GB 4OSNA 1BAKA 2P8VA 5JP4A 2H7DA 5D3XA 4WSFA 2Z0QA 1I7AA 3U12A 1UPRA 1V89A 3O96A 3AU5A 2MWNB 2J0MA 3A8QA 3NW8A 3SUZA 2AL6A 2ZPYA 1Q67A 2JP2A 1U5DA 3RCPA 2VRWB 2P0DA 2W2XD 1EF1A 2Z59A 4IAPA 5I2MA 3MPXA 3KRXA 3PEGA 2NMBA 1LW3A 5HE0A 2D9ZA 1AWEA 1NI2A 3A98B 4GOUA 2NZ8B 3TW1A 1FAOA 2Y8GA 3FSSA 2ROZB 4C0AA 4WJ7A 2VKIA 2RLOA 3F0WA 4GMVA 5KCVA 2Z13A 1X05A 2V76A 4GN1A 4HSIA 2Z4DA 1UNPA 2MFQA 1W1HA 2CY5A 2YS1A 1WG7A 2YT2A 1T77A 2EMTA 1U29A 3IVFA 1AQCA 2X18A 4QXAB 2DX1A 2DKQA 1X86A 2D9WA 2VSZA 4GXBA 1DDWA 2R2YA 2Y7BA 3P7ZA 2IFSA 3NWFA 3AU4A 2KUPA 4CYEA 4A5KA 4HAXB 2KIGA 4ZRJA 3G9WA 1XD4A 2KGXB 2AEHA 1MIXA 4MK0A 2YS3A 1WI1A 5EFXA 2Y8FA 2Z0PA 1UEFA 3DXDA 4KVGB 3ULBA 1DYNA 2MDXA 3DXCA 2E2XA 1U27A 1XR0B 4HAYB 1BWNA 4A6FA 2RSGA 4F7GA 4OT1A 3WYFB 5FI1A 3PP2A 2D2QA 5DIFB 1GC7A 2DLWA 4KHOA 1V5PA 3SV1A 5HE3A 2RUKB 1PFJA 1DROA 2UZRA 4F7HA 2I1JA 1MIZB 1NTVA 2N0YA 2FJUB 3GYOA 4HAVB 5CLLB 5D3VA 5I2SA 3NWAA 4KHAA 5GOWB 4CHJA 2QKMA 2PZ1A 4DX90 2K49A 2LOZA 2CAYA 1NTYA 5LONB 2DFKA 1WJ1A 4GMXB 4GZUA 2YT0A 4HAUB 4DIXA 4L6EA 1ISNA 4KAXB 1UNRA 2ZKMX 4KHBB 1FHOA 3V5WA 2HTHB 1V61A 2UZSA 3A58A 4F7UP 4QJ4B 2Q13A 4P7IA 2D4QA 2GJYA 3CIKA 4NSWA 2DKPA 1MKEA 4GPTB 1Y5OA 3ODOA 2CODA 2W2XC 2KR0A 3QIJA 3TCAA 2DHKA 3FEHA 1QQGA 2D9YA 3BJIA 2YRYA 3D8EA 1U5EA 2COFA 3FM8C 3X23A 3MDBC 2QKLA 1EGXA 3QBVB 2DTCA 2NBVA 2I1KA 2R0DA 1U5FA 1BTNA 3D8FA 1X11A 3ODWA 2Z14A 1MK9B 5M4YB 1B55A 1J19A 2P0HA 1K5DB 4BBKA 1KI1B 2D9VA 4QJ3B 1Z87A
chains in the Genus database with same CATH topology
1N3HA 2DX5A 3BINA 2LYDA 1P5TA 1PMSA 2J0KA 3A8PA 4K2OA 2J0JA 4Z2MB 2ROVA 1BTKA 2YS5A 1XX0A 4B6HA 4DXAB 1WGQA 3KY9A 3ODXA 3PZDA 1SHCA 3HK0A 4A6FB 1SGHA 4XWXA 5L81A 3ZVRA 5C5BB 1PLSA 4NY0A 4MT7A 3TO1A 4A6KA 2D10A 3VIAA 1ZC4B 1U5GA 4YL8A 3TFMA 2OTXA 3N7CA 3T06A 3SYXA 4DBBA 5JHHA 2RVBB 2GS0A 1Y19B 2YF0A 2OQBA 1I2HA 3PSCA 2LULA 1FHXA 4YONA 1W1GA 2KCJA 4DX8A 1FGZA 1UNQA 4HB0B 5KQ4A 1ZM0A 2EC1A 5J3TA 1FHWA 1DDMA 2R09A 2P0FA 4PNKA 1MPHA 2M14A 1H4RA 4EKUA 1ZVRA 2ELAA 3KRWA 3KSYA 2D9XA 3UZTA 2GCLA 2EMSA 4IOYX 5C79A 1OMWA 1EVHA 4K17A 3VOQA 2LOXA 1X1GA 1OY2A 4Z2NA 5DH9B 4HAWB 3PVWA 4TYZA 4K81A 4HB2B 2RGNB 2XQNM 5DHFB 3U8ZA 2COAA 1FB8A 3HW2B 3ML4A 1H10A 3QWMA 4HAZB 2FJLA 2HE7A 2UVMA 2H7EA 2MKRA 1W1DA 1TQZA 1J0WA 2DN6A 1KZ7A 2CRFA 1V88A 2W2WA 1ZC3B 2EJ8A 4HB3B 5D3YA 1M7EA 3P6AA 4HDOA 2J59M 5D3WA 3AJ4A 2I5FA 4ZRIA 1TJ6A 3TVVA 5JLJB 5FI0A 1MK7B 3CXBB 1UPQA 2IYBA 2G35A 4HDQA 3KZ1A 1MAIA 1FOEA 1IRSA 1DBHA 3M1IB 1DDVA 2ADZA 2L1CA 1P3RA 3LJUX 4PQ0A 1GC6A 4WVFB 2N23A 5HE1A 1E5WA 2DYNA 3OANA 3F5RA 1WGUA 3GYPA 1LB1A 2DHIA 1X1FA 1P6SA 1FGYA 5DHAB 4HB4B 3U7DA 3PG7A 5CLQB 3HQCA 3ZDTA 5J3YA 2YSZA 2K2JA 3WA0A 5DI9B 5C6RA 4EMOA 1XKEA 3SNHA 2ELBA 4MY6A 1ZSQA 3NSUA 2Z0OA 1RJ2A 4A6HA 4EJNA 5D27A 3ULCA 4CHMA 2COCA 4TKNA 2I5CA 3PVLA 2LG1A 3PVUA 2BCJA 4H8SA 2L2IA 1KZGA 1V5MA 5J3QA 4IFSA 2LKOA 1RRPB 5KQ1A 2RNRB 3DXEA 2YVCA 1U2BA 2DA0A 2K00A 2CY4A 2GCJA 2YT1A 2DYQA 5C5BA 1XODA 4HHVA 1WJMA 4D0NB 2DHJA 1XCGA 1GG3A 5LOPB 3SO6A 1NU2A 5C16A 1WVHA 4HATB 5HE2A 5JHGA 1TXDA 3D8DA 2K2UA 1EAZA 2M38A 4ZRKA 2D11A 1QC6A 1OQNA 1V5UA 4K2PA 1M7RA 4Y94A 1K5GB 1BAKA 2P8VA 5JP4A 2H7DA 5D3XA 4WSFA 2Z0QA 1I7AA 1UPRA 1V89A 3O96A 3AU5A 2MWNB 2J0MA 3A8QA 3SUZA 2AL6A 2ZPYA 1Q67A 2JP2A 1U5DA 3RCPA 2VRWB 2P0DA 2W2XD 1EF1A 4IAPA 3MPXA 3KRXA 3PEGA 2NMBA 1LW3A 5HE0A 2D9ZA 1AWEA 1NI2A 3A98B 2NZ8B 3TW1A 1FAOA 2Y8GA 3FSSA 2ROZB 4C0AA 4WJ7A 2VKIA 2RLOA 3F0WA 4GMVA 5KCVA 1X05A 2V76A 4GN1A 1UNPA 2MFQA 1W1HA 2CY5A 2YS1A 1WG7A 2EMTA 1U29A 3IVFA 1AQCA 2X18A 2DX1A 2DKQA 1X86A 2D9WA 2VSZA 4GXBA 1DDWA 2Y7BA 3P7ZA 2IFSA 3AU4A 2KUPA 4CYEA 4A5KA 4HAXB 4ZRJA 3G9WA 1XD4A 2KGXB 2AEHA 1MIXA 4MK0A 2YS3A 1WI1A 5EFXA 2Y8FA 2Z0PA 1UEFA 3DXDA 4KVGB 3ULBA 1DYNA 2MDXA 3DXCA 2E2XA 1U27A 1XR0B 4HAYB 1BWNA 4A6FA 2RSGA 4F7GA 3WYFB 5FI1A 3PP2A 2D2QA 5DIFB 1GC7A 2DLWA 4KHOA 1V5PA 3SV1A 5HE3A 2RUKB 1PFJA 1DROA 2UZRA 4F7HA 2I1JA 1MIZB 1NTVA 2N0YA 3GYOA 4HAVB 5CLLB 5D3VA 4KHAA 5GOWB 4CHJA 2QKMA 2PZ1A 4DX90 2LOZA 2CAYA 1NTYA 5LONB 2DFKA 1WJ1A 4GMXB 4GZUA 2YT0A 4HAUB 4L6EA 1ISNA 4KAXB 1UNRA 4KHBB 1FHOA 3V5WA 2HTHB 1V61A 2UZSA 4F7UP 2Q13A 4P7IA 2D4QA 2GJYA 3CIKA 4NSWA 2DKPA 1MKEA 4GPTB 1Y5OA 3ODOA 2CODA 2W2XC 3QIJA 3TCAA 2DHKA 3FEHA 1QQGA 2D9YA 3BJIA 2YRYA 3D8EA 1U5EA 2COFA 3FM8C 3X23A 3MDBC 2QKLA 1EGXA 3QBVB 2DTCA 2I1KA 2R0DA 1U5FA 1BTNA 3D8FA 1X11A 3ODWA 1MK9B 1B55A 1J19A 2P0HA 1K5DB 4BBKA 1KI1B 2D9VA 1Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3H A;  2DX5 A;  3BIN A;  2LYD A;  1P5T A;  1PMS A;  2J0K A;  3A8P A;  4K2O A;  2J0J A;  4Z2M B;  2ROV A;  1BTK A;  2YS5 A;  1XX0 A;  4B6H A;  4DXA B;  1WGQ A;  3KY9 A;  3ODX A;  3PZD A;  1SHC A;  3HK0 A;  4A6F B;  1SGH A;  4XWX A;  5L81 A;  3ZVR A;  5C5B B;  1PLS A;  4NY0 A;  4MT7 A;  3TO1 A;  4A6K A;  2D10 A;  3VIA A;  1ZC4 B;  1U5G A;  4YL8 A;  3TFM A;  2OTX A;  3N7C A;  3T06 A;  3SYX A;  4DBB A;  5JHH A;  2RVB B;  2GS0 A;  1Y19 B;  2YF0 A;  2OQB A;  1I2H A;  3PSC A;  2LUL A;  1FHX A;  4YON A;  1W1G A;  2KCJ A;  4DX8 A;  1FGZ A;  1UNQ A;  4HB0 B;  5KQ4 A;  1ZM0 A;  2EC1 A;  5J3T A;  1FHW A;  1DDM A;  2R09 A;  2P0F A;  4PNK A;  1MPH A;  2M14 A;  1H4R A;  4EKU A;  1ZVR A;  2ELA A;  3KRW A;  3KSY A;  2D9X A;  3UZT A;  2GCL A;  2EMS A;  4IOY X;  5C79 A;  1OMW A;  1EVH A;  4K17 A;  3VOQ A;  2LOX A;  1X1G A;  1OY2 A;  4Z2N A;  5DH9 B;  4HAW B;  3PVW A;  4TYZ A;  4K81 A;  4HB2 B;  2RGN B;  2XQN M;  5DHF B;  3U8Z A;  2COA A;  1FB8 A;  3HW2 B;  3ML4 A;  1H10 A;  3QWM A;  4HAZ B;  2FJL A;  2HE7 A;  2UVM A;  2H7E A;  2MKR A;  1W1D A;  1TQZ A;  1J0W A;  2DN6 A;  1KZ7 A;  2CRF A;  1V88 A;  2W2W A;  1ZC3 B;  2EJ8 A;  4HB3 B;  5D3Y A;  1M7E A;  3P6A A;  4HDO A;  2J59 M;  5D3W A;  3AJ4 A;  2I5F A;  4ZRI A;  1TJ6 A;  3TVV A;  5JLJ B;  5FI0 A;  1MK7 B;  3CXB B;  1UPQ A;  2IYB A;  2G35 A;  4HDQ A;  3KZ1 A;  1MAI A;  1FOE A;  1IRS A;  1DBH A;  3M1I B;  1DDV A;  2ADZ A;  2L1C A;  1P3R A;  3LJU X;  4PQ0 A;  1GC6 A;  4WVF B;  2N23 A;  5HE1 A;  1E5W A;  2DYN A;  3OAN A;  3F5R A;  1WGU A;  3GYP A;  1LB1 A;  2DHI A;  1X1F A;  1P6S A;  1FGY A;  5DHA B;  4HB4 B;  3U7D A;  3PG7 A;  5CLQ B;  3HQC A;  3ZDT A;  5J3Y A;  2YSZ A;  2K2J A;  3WA0 A;  5DI9 B;  5C6R A;  4EMO A;  1XKE A;  3SNH A;  2ELB A;  4MY6 A;  1ZSQ A;  3NSU A;  2Z0O A;  1RJ2 A;  4A6H A;  4EJN A;  5D27 A;  3ULC A;  4CHM A;  2COC A;  4TKN A;  2I5C A;  3PVL A;  2LG1 A;  3PVU A;  2BCJ A;  4H8S A;  2L2I A;  1KZG A;  1V5M A;  5J3Q A;  4IFS A;  2LKO A;  1RRP B;  5KQ1 A;  2RNR B;  3DXE A;  2YVC A;  1U2B A;  2DA0 A;  2K00 A;  2CY4 A;  2GCJ A;  2YT1 A;  2DYQ A;  5C5B A;  1XOD A;  4HHV A;  1WJM A;  4D0N B;  2DHJ A;  1XCG A;  1GG3 A;  5LOP B;  3SO6 A;  1NU2 A;  5C16 A;  1WVH A;  4HAT B;  5HE2 A;  5JHG A;  1TXD A;  3D8D A;  2K2U A;  1EAZ A;  2M38 A;  4ZRK A;  2D11 A;  1QC6 A;  1OQN A;  1V5U A;  4K2P A;  1M7R A;  4Y94 A;  1K5G B;  1BAK A;  2P8V A;  5JP4 A;  2H7D A;  5D3X A;  4WSF A;  2Z0Q A;  1I7A A;  1UPR A;  1V89 A;  3O96 A;  3AU5 A;  2MWN B;  2J0M A;  3A8Q A;  3SUZ A;  2AL6 A;  2ZPY A;  1Q67 A;  2JP2 A;  1U5D A;  3RCP A;  2VRW B;  2P0D A;  2W2X D;  1EF1 A;  4IAP A;  3MPX A;  3KRX A;  3PEG A;  2NMB A;  1LW3 A;  5HE0 A;  2D9Z A;  1AWE A;  1NI2 A;  3A98 B;  2NZ8 B;  3TW1 A;  1FAO A;  2Y8G A;  3FSS A;  2ROZ B;  4C0A A;  4WJ7 A;  2VKI A;  2RLO A;  3F0W A;  4GMV A;  5KCV A;  1X05 A;  2V76 A;  4GN1 A;  1UNP A;  2MFQ A;  1W1H A;  2CY5 A;  2YS1 A;  1WG7 A;  2EMT A;  1U29 A;  3IVF A;  1AQC A;  2X18 A;  2DX1 A;  2DKQ A;  1X86 A;  2D9W A;  2VSZ A;  4GXB A;  1DDW A;  2Y7B A;  3P7Z A;  2IFS A;  3AU4 A;  2KUP A;  4CYE A;  4A5K A;  4HAX B;  4ZRJ A;  3G9W A;  1XD4 A;  2KGX B;  2AEH A;  1MIX A;  4MK0 A;  2YS3 A;  1WI1 A;  5EFX A;  2Y8F A;  2Z0P A;  1UEF A;  3DXD A;  4KVG B;  3ULB A;  1DYN A;  2MDX A;  3DXC A;  2E2X A;  1U27 A;  1XR0 B;  4HAY B;  1BWN A;  4A6F A;  2RSG A;  4F7G A;  3WYF B;  5FI1 A;  3PP2 A;  2D2Q A;  5DIF B;  1GC7 A;  2DLW A;  4KHO A;  1V5P A;  3SV1 A;  5HE3 A;  2RUK B;  1PFJ A;  1DRO A;  2UZR A;  4F7H A;  2I1J A;  1MIZ B;  1NTV A;  2N0Y A;  3GYO A;  4HAV B;  5CLL B;  5D3V A;  4KHA A;  5GOW B;  4CHJ A;  2QKM A;  2PZ1 A;  4DX9 0;  2LOZ A;  2CAY A;  1NTY A;  5LON B;  2DFK A;  1WJ1 A;  4GMX B;  4GZU A;  2YT0 A;  4HAU B;  4L6E A;  1ISN A;  4KAX B;  1UNR A;  4KHB B;  1FHO A;  3V5W A;  2HTH B;  1V61 A;  2UZS A;  4F7U P;  2Q13 A;  4P7I A;  2D4Q A;  2GJY A;  3CIK A;  4NSW A;  2DKP A;  1MKE A;  4GPT B;  1Y5O A;  3ODO A;  2COD A;  2W2X C;  3QIJ A;  3TCA A;  2DHK A;  3FEH A;  1QQG A;  2D9Y A;  3BJI A;  2YRY A;  3D8E A;  1U5E A;  2COF A;  3FM8 C;  3X23 A;  3MDB C;  2QKL A;  1EGX A;  3QBV B;  2DTC A;  2I1K A;  2R0D A;  1U5F A;  1BTN A;  3D8F A;  1X11 A;  3ODW A;  1MK9 B;  1B55 A;  1J19 A;  2P0H A;  1K5D B;  4BBK A;  1KI1 B;  2D9V A;  1Z87 A; 
#chains in the Genus database with same CATH topology
 1N3H A;  2DX5 A;  3BIN A;  2LYD A;  1P5T A;  1PMS A;  2J0K A;  3A8P A;  4K2O A;  2J0J A;  4Z2M B;  2ROV A;  1BTK A;  2YS5 A;  1XX0 A;  4B6H A;  4DXA B;  1WGQ A;  3KY9 A;  3ODX A;  3PZD A;  1SHC A;  3HK0 A;  4A6F B;  1SGH A;  4XWX A;  5L81 A;  3ZVR A;  5C5B B;  1PLS A;  4NY0 A;  4MT7 A;  3TO1 A;  4A6K A;  2D10 A;  3VIA A;  4L1R A;  1ZC4 B;  1U5G A;  4YL8 A;  3TFM A;  2OTX A;  1ZYI A;  4GNK B;  3N7C A;  3T06 A;  3SYX A;  4DBB A;  5JHH A;  2RVB B;  2GS0 A;  1Y19 B;  2YF0 A;  2OQB A;  1I2H A;  3PSC A;  2LUL A;  1FHX A;  3HIE A;  3NWD A;  4YON A;  1W1G A;  2KCJ A;  4DX8 A;  1FGZ A;  1UNQ A;  4HB0 B;  5KQ4 A;  1ZM0 A;  2EC1 A;  3FVC A;  5J3T A;  3HSA A;  1FHW A;  1MI1 A;  1DDM A;  2R09 A;  2P0F A;  4PNK A;  1MPH A;  2M14 A;  1H4R A;  4EKU A;  1ZVR A;  2ELA A;  3KRW A;  3KSY A;  2D9X A;  3UZT A;  2GCL A;  2EMS A;  4IOY X;  5C79 A;  1OMW A;  1EVH A;  4K17 A;  4QJ5 B;  4D6W A;  2GUM A;  3VOQ A;  2LOX A;  1X1G A;  1OY2 A;  4Z2N A;  5DH9 B;  4HAW B;  3PVW A;  4TYZ A;  4K81 A;  4HB2 B;  2RGN B;  2XQN M;  5DHF B;  3U8Z A;  2COA A;  1FB8 A;  3HW2 B;  3ML4 A;  1H10 A;  3QWM A;  4HAZ B;  2FJL A;  2HE7 A;  2UVM A;  2H7E A;  2MKR A;  1W1D A;  1TQZ A;  1J0W A;  2DN6 A;  1KZ7 A;  2CRF A;  1V88 A;  2W2W A;  1ZC3 B;  2EJ8 A;  4HB3 B;  5D3Y A;  5IRS A;  1M7E A;  3P6A A;  4HDO A;  2J59 M;  5D3W A;  3AJ4 A;  2I5F A;  4ZRI A;  1TJ6 A;  3TVV A;  5JLJ B;  5FI0 A;  1MK7 B;  3CXB B;  1UPQ A;  2IYB A;  2G35 A;  4HDQ A;  3KZ1 A;  4KHB A;  1MAI A;  1FOE A;  1IRS A;  1DBH A;  3M1I B;  1DDV A;  2ADZ A;  2L1C A;  1P3R A;  3LJU X;  4PQ0 A;  1GC6 A;  3B77 A;  4WVF B;  2N23 A;  5HE1 A;  1E5W A;  2DYN A;  3OAN A;  3OHM B;  3F5R A;  1WGU A;  3GYP A;  1LB1 A;  2DHI A;  1X1F A;  1P6S A;  1FGY A;  5DHA B;  4HB4 B;  3U7D A;  3PG7 A;  5CLQ B;  3HQC A;  3ZDT A;  5J3Y A;  2YSZ A;  2K2J A;  3WA0 A;  5DI9 B;  5C6R A;  4EMO A;  1XKE A;  3SNH A;  2ELB A;  4MY6 A;  1ZSQ A;  3NSU A;  2Z0O A;  1RJ2 A;  4A6H A;  4EJN A;  5D27 A;  3ULC A;  4CHM A;  2COC A;  4TKN A;  2I5C A;  2RRF A;  3PVL A;  2LG1 A;  3PVU A;  2BCJ A;  4H8S A;  2L2I A;  2KUQ A;  1KZG A;  1V5M A;  5J3Q A;  4IFS A;  2LKO A;  1RRP B;  5KQ1 A;  2RNR B;  3DXE A;  2YVC A;  1U2B A;  2DA0 A;  2K00 A;  2CY4 A;  2GCJ A;  2YT1 A;  2DYQ A;  4CSQ A;  5C5B A;  1XOD A;  4HHV A;  1WJM A;  4D0N B;  2DHJ A;  1XCG A;  1GG3 A;  5LOP B;  3SO6 A;  1NU2 A;  5C16 A;  2KIE A;  1WVH A;  4HAT B;  5HE2 A;  5JHG A;  1TXD A;  3D8D A;  2K2U A;  1EAZ A;  2K8E A;  2M38 A;  4ZRK A;  2D11 A;  3DCX A;  5LG4 B;  1QC6 A;  1OQN A;  1V5U A;  4K2P A;  1M7R A;  4Y94 A;  1K5G B;  4OSN A;  1BAK A;  2P8V A;  5JP4 A;  2H7D A;  5D3X A;  4WSF A;  2Z0Q A;  1I7A A;  3U12 A;  1UPR A;  1V89 A;  3O96 A;  3AU5 A;  2MWN B;  2J0M A;  3A8Q A;  3NW8 A;  3SUZ A;  2AL6 A;  2ZPY A;  1Q67 A;  2JP2 A;  1U5D A;  3RCP A;  2VRW B;  2P0D A;  2W2X D;  1EF1 A;  2Z59 A;  4IAP A;  5I2M A;  3MPX A;  3KRX A;  3PEG A;  2NMB A;  1LW3 A;  5HE0 A;  2D9Z A;  1AWE A;  1NI2 A;  3A98 B;  4GOU A;  2NZ8 B;  3TW1 A;  1FAO A;  2Y8G A;  3FSS A;  2ROZ B;  4C0A A;  4WJ7 A;  2VKI A;  2RLO A;  3F0W A;  4GMV A;  5KCV A;  2Z13 A;  1X05 A;  2V76 A;  4GN1 A;  4HSI A;  2Z4D A;  1UNP A;  2MFQ A;  1W1H A;  2CY5 A;  2YS1 A;  1WG7 A;  2YT2 A;  1T77 A;  2EMT A;  1U29 A;  3IVF A;  1AQC A;  2X18 A;  4QXA B;  2DX1 A;  2DKQ A;  1X86 A;  2D9W A;  2VSZ A;  4GXB A;  1DDW A;  2R2Y A;  2Y7B A;  3P7Z A;  2IFS A;  3NWF A;  3AU4 A;  2KUP A;  4CYE A;  4A5K A;  4HAX B;  2KIG A;  4ZRJ A;  3G9W A;  1XD4 A;  2KGX B;  2AEH A;  1MIX A;  4MK0 A;  2YS3 A;  1WI1 A;  5EFX A;  2Y8F A;  2Z0P A;  1UEF A;  3DXD A;  4KVG B;  3ULB A;  1DYN A;  2MDX A;  3DXC A;  2E2X A;  1U27 A;  1XR0 B;  4HAY B;  1BWN A;  4A6F A;  2RSG A;  4F7G A;  4OT1 A;  3WYF B;  5FI1 A;  3PP2 A;  2D2Q A;  5DIF B;  1GC7 A;  2DLW A;  4KHO A;  1V5P A;  3SV1 A;  5HE3 A;  2RUK B;  1PFJ A;  1DRO A;  2UZR A;  4F7H A;  2I1J A;  1MIZ B;  1NTV A;  2N0Y A;  2FJU B;  3GYO A;  4HAV B;  5CLL B;  5D3V A;  5I2S A;  3NWA A;  4KHA A;  5GOW B;  4CHJ A;  2QKM A;  2PZ1 A;  4DX9 0;  2K49 A;  2LOZ A;  2CAY A;  1NTY A;  5LON B;  2DFK A;  1WJ1 A;  4GMX B;  4GZU A;  2YT0 A;  4HAU B;  4DIX A;  4L6E A;  1ISN A;  4KAX B;  1UNR A;  2ZKM X;  4KHB B;  1FHO A;  3V5W A;  2HTH B;  1V61 A;  2UZS A;  3A58 A;  4F7U P;  4QJ4 B;  2Q13 A;  4P7I A;  2D4Q A;  2GJY A;  3CIK A;  4NSW A;  2DKP A;  1MKE A;  4GPT B;  1Y5O A;  3ODO A;  2COD A;  2W2X C;  2KR0 A;  3QIJ A;  3TCA A;  2DHK A;  3FEH A;  1QQG A;  2D9Y A;  3BJI A;  2YRY A;  3D8E A;  1U5E A;  2COF A;  3FM8 C;  3X23 A;  3MDB C;  2QKL A;  1EGX A;  3QBV B;  2DTC A;  2NBV A;  2I1K A;  2R0D A;  1U5F A;  1BTN A;  3D8F A;  1X11 A;  3ODW A;  2Z14 A;  1MK9 B;  5M4Y B;  1B55 A;  1J19 A;  2P0H A;  1K5D B;  4BBK A;  1KI1 B;  2D9V A;  4QJ3 B;  1Z87 A; 
#chains in the Genus database with same CATH homology
 1N3H A;  2DX5 A;  3BIN A;  2LYD A;  1P5T A;  1PMS A;  2J0K A;  3A8P A;  4K2O A;  2J0J A;  4Z2M B;  2ROV A;  1BTK A;  2YS5 A;  1XX0 A;  4B6H A;  4DXA B;  1WGQ A;  3KY9 A;  3ODX A;  3PZD A;  1SHC A;  3HK0 A;  4A6F B;  1SGH A;  4XWX A;  5L81 A;  3ZVR A;  5C5B B;  1PLS A;  4NY0 A;  4MT7 A;  3TO1 A;  4A6K A;  2D10 A;  3VIA A;  1ZC4 B;  1U5G A;  4YL8 A;  3TFM A;  2OTX A;  3N7C A;  3T06 A;  3SYX A;  4DBB A;  5JHH A;  2RVB B;  2GS0 A;  1Y19 B;  2YF0 A;  2OQB A;  1I2H A;  3PSC A;  2LUL A;  1FHX A;  4YON A;  1W1G A;  2KCJ A;  4DX8 A;  1FGZ A;  1UNQ A;  4HB0 B;  5KQ4 A;  1ZM0 A;  2EC1 A;  5J3T A;  1FHW A;  1DDM A;  2R09 A;  2P0F A;  4PNK A;  1MPH A;  2M14 A;  1H4R A;  4EKU A;  1ZVR A;  2ELA A;  3KRW A;  3KSY A;  2D9X A;  3UZT A;  2GCL A;  2EMS A;  4IOY X;  5C79 A;  1OMW A;  1EVH A;  4K17 A;  3VOQ A;  2LOX A;  1X1G A;  1OY2 A;  4Z2N A;  5DH9 B;  4HAW B;  3PVW A;  4TYZ A;  4K81 A;  4HB2 B;  2RGN B;  2XQN M;  5DHF B;  3U8Z A;  2COA A;  1FB8 A;  3HW2 B;  3ML4 A;  1H10 A;  3QWM A;  4HAZ B;  2FJL A;  2HE7 A;  2UVM A;  2H7E A;  2MKR A;  1W1D A;  1TQZ A;  1J0W A;  2DN6 A;  1KZ7 A;  2CRF A;  1V88 A;  2W2W A;  1ZC3 B;  2EJ8 A;  4HB3 B;  5D3Y A;  1M7E A;  3P6A A;  4HDO A;  2J59 M;  5D3W A;  3AJ4 A;  2I5F A;  4ZRI A;  1TJ6 A;  3TVV A;  5JLJ B;  5FI0 A;  1MK7 B;  3CXB B;  1UPQ A;  2IYB A;  2G35 A;  4HDQ A;  3KZ1 A;  1MAI A;  1FOE A;  1IRS A;  1DBH A;  3M1I B;  1DDV A;  2ADZ A;  2L1C A;  1P3R A;  3LJU X;  4PQ0 A;  1GC6 A;  4WVF B;  2N23 A;  5HE1 A;  1E5W A;  2DYN A;  3OAN A;  3F5R A;  1WGU A;  3GYP A;  1LB1 A;  2DHI A;  1X1F A;  1P6S A;  1FGY A;  5DHA B;  4HB4 B;  3U7D A;  3PG7 A;  5CLQ B;  3HQC A;  3ZDT A;  5J3Y A;  2YSZ A;  2K2J A;  3WA0 A;  5DI9 B;  5C6R A;  4EMO A;  1XKE A;  3SNH A;  2ELB A;  4MY6 A;  1ZSQ A;  3NSU A;  2Z0O A;  1RJ2 A;  4A6H A;  4EJN A;  5D27 A;  3ULC A;  4CHM A;  2COC A;  4TKN A;  2I5C A;  3PVL A;  2LG1 A;  3PVU A;  2BCJ A;  4H8S A;  2L2I A;  1KZG A;  1V5M A;  5J3Q A;  4IFS A;  2LKO A;  1RRP B;  5KQ1 A;  2RNR B;  3DXE A;  2YVC A;  1U2B A;  2DA0 A;  2K00 A;  2CY4 A;  2GCJ A;  2YT1 A;  2DYQ A;  5C5B A;  1XOD A;  4HHV A;  1WJM A;  4D0N B;  2DHJ A;  1XCG A;  1GG3 A;  5LOP B;  3SO6 A;  1NU2 A;  5C16 A;  1WVH A;  4HAT B;  5HE2 A;  5JHG A;  1TXD A;  3D8D A;  2K2U A;  1EAZ A;  2M38 A;  4ZRK A;  2D11 A;  1QC6 A;  1OQN A;  1V5U A;  4K2P A;  1M7R A;  4Y94 A;  1K5G B;  1BAK A;  2P8V A;  5JP4 A;  2H7D A;  5D3X A;  4WSF A;  2Z0Q A;  1I7A A;  1UPR A;  1V89 A;  3O96 A;  3AU5 A;  2MWN B;  2J0M A;  3A8Q A;  3SUZ A;  2AL6 A;  2ZPY A;  1Q67 A;  2JP2 A;  1U5D A;  3RCP A;  2VRW B;  2P0D A;  2W2X D;  1EF1 A;  4IAP A;  3MPX A;  3KRX A;  3PEG A;  2NMB A;  1LW3 A;  5HE0 A;  2D9Z A;  1AWE A;  1NI2 A;  3A98 B;  2NZ8 B;  3TW1 A;  1FAO A;  2Y8G A;  3FSS A;  2ROZ B;  4C0A A;  4WJ7 A;  2VKI A;  2RLO A;  3F0W A;  4GMV A;  5KCV A;  1X05 A;  2V76 A;  4GN1 A;  1UNP A;  2MFQ A;  1W1H A;  2CY5 A;  2YS1 A;  1WG7 A;  2EMT A;  1U29 A;  3IVF A;  1AQC A;  2X18 A;  2DX1 A;  2DKQ A;  1X86 A;  2D9W A;  2VSZ A;  4GXB A;  1DDW A;  2Y7B A;  3P7Z A;  2IFS A;  3AU4 A;  2KUP A;  4CYE A;  4A5K A;  4HAX B;  4ZRJ A;  3G9W A;  1XD4 A;  2KGX B;  2AEH A;  1MIX A;  4MK0 A;  2YS3 A;  1WI1 A;  5EFX A;  2Y8F A;  2Z0P A;  1UEF A;  3DXD A;  4KVG B;  3ULB A;  1DYN A;  2MDX A;  3DXC A;  2E2X A;  1U27 A;  1XR0 B;  4HAY B;  1BWN A;  4A6F A;  2RSG A;  4F7G A;  3WYF B;  5FI1 A;  3PP2 A;  2D2Q A;  5DIF B;  1GC7 A;  2DLW A;  4KHO A;  1V5P A;  3SV1 A;  5HE3 A;  2RUK B;  1PFJ A;  1DRO A;  2UZR A;  4F7H A;  2I1J A;  1MIZ B;  1NTV A;  2N0Y A;  3GYO A;  4HAV B;  5CLL B;  5D3V A;  4KHA A;  5GOW B;  4CHJ A;  2QKM A;  2PZ1 A;  4DX9 0;  2LOZ A;  2CAY A;  1NTY A;  5LON B;  2DFK A;  1WJ1 A;  4GMX B;  4GZU A;  2YT0 A;  4HAU B;  4L6E A;  1ISN A;  4KAX B;  1UNR A;  4KHB B;  1FHO A;  3V5W A;  2HTH B;  1V61 A;  2UZS A;  4F7U P;  2Q13 A;  4P7I A;  2D4Q A;  2GJY A;  3CIK A;  4NSW A;  2DKP A;  1MKE A;  4GPT B;  1Y5O A;  3ODO A;  2COD A;  2W2X C;  3QIJ A;  3TCA A;  2DHK A;  3FEH A;  1QQG A;  2D9Y A;  3BJI A;  2YRY A;  3D8E A;  1U5E A;  2COF A;  3FM8 C;  3X23 A;  3MDB C;  2QKL A;  1EGX A;  3QBV B;  2DTC A;  2I1K A;  2R0D A;  1U5F A;  1BTN A;  3D8F A;  1X11 A;  3ODW A;  1MK9 B;  1B55 A;  1J19 A;  2P0H A;  1K5D B;  4BBK A;  1KI1 B;  2D9V A;  1Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...