2YS5A

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3
total genus 13
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys5A01
2D9ZA 1MK7B 2UZRA 4HDOA 2P0HA 2N23A 5L81A 2EC1A 1U2BA 1OY2A 1UNRA 5DIFB 1FHXA 1DDMA 5JLJB 2J59M 2VSZA 1V5UA 2COAA 1I7AA 2HE7A 4KHAA 1W1GA 1DDVA 3F5RA 2YSZA 3PEGA 4A6FB 2I1JA 4DX90 3CIKA 4K81A 2H7DA 1DYNA 2K2JA 1DDWA 1FAOA 3PVLA 5HE3A 3A8QA 5DI9B 2ELBA 2QKMA 4ZRKA 1RJ2A 2RLOA 5J3TA 2VKIA 1KZ7A 1NTVA 3MDBC 1B55A 2G35A 3PG7A 2VRWB 2ELAA 4DXAB 1SGHA 4GPTB 2M14A 3DXCA 2IFSA 2DKQA 3ULBA 1SHCA 1MIXA 1WJ1A 2EMTA 4L6EA 2ROVA 5KCVA 1GG3A 1X05A 4HAVB 5J3YA 3VIAA 2Y8GA 2MKRA 1UNQA 1TXDA 4IOYX 2KUPA 3D8DA 5DHAB 3KY9A 1NTYA 2D9WA 4F7GA 2QKLA 1WVHA 2J0KA 4K2PA 1MPHA 3QIJA 4CHMA 3GYOA 5JHGA 4Y94A 4F7HA 5D27A 3SV1A 3SNHA 1U5DA 5C16A 1X1FA 1X1GA 2BCJA 3GYPA 1XCGA 1BWNA 2Q13A 2FJLA 1U5FA 2YT1A 1XR0B 1ZC3B 5D3WA 2EJ8A 4HHVA 2YRYA 4CHJA 2V76A 3NSUA 1TQZA 1BTNA 2ADZA 2I1KA 1V5MA 2X18A 3M1IB 2GCLA 5D3XA 1K5GB 2YT0A 4GXBA 1UPRA 2J0JA 2R09A 3QBVB 5C6RA 3BJIA 2P0DA 1QC6A 3LJUX 4HAWB 1XX0A 4MY6A 1V61A 3TFMA 3P7ZA 3N7CA 3V5WA 5FI0A 2RSGA 2IYBA 2L1CA 1W1DA 4CYEA 1H10A 3AJ4A 4EMOA 1E5WA 1U27A 3KZ1A 3ODXA 4KHOA 3QWMA 2LG1A 1BAKA 1AQCA 3KRXA 2LOZA 2HTHB 3WA0A 3O96A 3U8ZA 1MIZB 4IAPA 4HB4B 1NI2A 4ZRIA 3IVFA 4Z2NA 1U5EA 2DTCA 2AEHA 1FOEA 4IFSA 2UVMA 1GC6A 2P8VA 4NSWA 2DYNA 4WVFB 1M7RA 2DKPA 2I5FA 2LKOA 1RRPB 3AU4A 5J3QA 3SYXA 2CAYA 5D3VA 3PVWA 2RUKB 1LB1A 5JHHA 3ML4A 4A6HA 3SUZA 2KGXB 2H7EA 3HK0A 3FEHA 1ZM0A 2W2XC 1Q67A 1EAZA 2DHJA 2R0DA 1UEFA 3ODWA 4C0AA 1KI1B 5CLLB 4D0NB 2LULA 4KVGB 4ZRJA 2XQNM 1Z87A 3AU5A 2MWNB 1ZVRA 1UNPA 2Z0OA 2GS0A 1MAIA 3KSYA 3D8FA 2D10A 1P6SA 1MK9B 1AWEA 3P6AA 5HE2A 1PLSA 2Y8FA 4HATB 2COCA 1KZGA 2D9YA 2DX1A 2CY5A 1V88A 4GZUA 3DXEA 3UZTA 1IRSA 4WSFA 4A6FA 1V5PA 2D4QA 5HE1A 1FHOA 2DA0A 2N0YA 4KHBB 2K2UA 3RCPA 4PQ0A 5D3YA 1OMWA 1TJ6A 1MKEA 2DN6A 1W1HA 1FB8A 3OANA 4H8SA 3U7DA 4XWXA 2LYDA 2DYQA 1I2HA 5EFXA 2DHIA 4TKNA 2DX5A 1P3RA 2GCJA 4MK0A 2W2XD 1ZC4B 4PNKA 1NU2A 1XD4A 5LOPB 4DX8A 1J19A 2DLWA 2RGNB 3T06A 1EVHA 1DROA 1XODA 2MDXA 3A98B 1LW3A 3CXBB 1ISNA 3ZVRA 1ZSQA 5CLQB 2E2XA 3BINA 3PVUA 3DXDA 4NY0A 4A6KA 2YS3A 4YONA 2YS5A 1PMSA 2UZSA 4HB0B 1Y5OA 2Y7BA 4EJNA 1X86A 1BTKA 3TO1A 4HAZB 2Z0QA 3FSSA 2RNRB 3VOQA 5DHFB 4HAXB 1WGQA 5C79A 2I5CA 4HAUB 3HW2B 5C5BB 4GMVA 1P5TA 1X11A 1V89A 1WGUA 3A8PA 1EF1A 2ROZB 3PZDA 2CRFA 5HE0A 3PP2A 5C5BA 3ODOA 3PSCA 1FGYA 1U29A 1XKEA 4KAXB 4DBBA 2EMSA 4MT7A 1M7EA 3MPXA 2M38A 1WJMA 5JP4A 2NZ8B 2J0MA 5GOWB 1K5DB 2YF0A 2LOXA 3G9WA 3TW1A 4BBKA 1UPQA 1DBHA 3ZDTA 4EKUA 5FI1A 5DH9B 2COFA 2D11A 4Z2MB 4YL8A 2KCJA 3HQCA 4K17A 1WG7A 2CY4A 4A5KA 1QQGA 2K00A 1EGXA 2D2QA 2OTXA 3WYFB 3TVVA 2MFQA 4HDQA 2PZ1A 4HB2B 2AL6A 2DFKA 2Z0PA 4WJ7A 2YVCA 1PFJA 4TYZA 2GJYA 5LONB 3KRWA 1H4RA 4HAYB 5KQ4A 2JP2A 2P0FA 2DHKA 2YS1A 3F0WA 4B6HA 5KQ1A 2OQBA 1FGZA 4P7IA 3TCAA 3ULCA 4GMXB 3D8EA 2L2IA 3FM8C 3SO6A 1GC7A 2W2WA 1U5GA 2ZPYA 4F7UP 1N3HA 2NMBA 2D9XA 1Y19B 2D9VA 3X23A 4HB3B 1OQNA 1J0WA 1WI1A 2RVBB 1FHWA 2CODA 4K2OA 4GN1A
chains in the Genus database with same CATH superfamily
2D9ZA 1MK7B 2UZRA 4HDOA 2P0HA 2N23A 5L81A 2EC1A 1U2BA 1OY2A 1UNRA 5DIFB 1FHXA 1DDMA 4HSIA 5JLJB 2J59M 2VSZA 1V5UA 2COAA 1I7AA 2HE7A 3NWFA 4KHAA 4GOUA 1W1GA 1DDVA 3F5RA 2YSZA 3PEGA 4A6FB 2I1JA 4KHBA 4DX90 3CIKA 4K81A 2H7DA 1DYNA 2K2JA 1DDWA 1FAOA 2K49A 3PVLA 5HE3A 3A8QA 5DI9B 2ELBA 2QKMA 4ZRKA 1RJ2A 2RLOA 5J3TA 2VKIA 1KZ7A 1NTVA 3MDBC 1B55A 2G35A 3PG7A 2VRWB 2ELAA 4DXAB 1SGHA 4GPTB 2M14A 5M4YB 3DXCA 2IFSA 2DKQA 3ULBA 1SHCA 1MIXA 1WJ1A 2EMTA 4L6EA 2ROVA 5KCVA 1GG3A 1X05A 4HAVB 5J3YA 3VIAA 2Y8GA 2MKRA 4QJ5B 1UNQA 1TXDA 4IOYX 2K8EA 2KUPA 3D8DA 5DHAB 3KY9A 1NTYA 2D9WA 4OT1A 3HSAA 4F7GA 2QKLA 1WVHA 2J0KA 4K2PA 4DIXA 2KIEA 1MPHA 3B77A 3QIJA 4CHMA 3GYOA 5JHGA 4Y94A 4F7HA 5D27A 3SV1A 3SNHA 1U5DA 5C16A 1X1FA 1X1GA 2BCJA 3GYPA 2Z4DA 1XCGA 1BWNA 2Q13A 2FJLA 1U5FA 2YT1A 1XR0B 1ZC3B 2R2YA 5D3WA 2EJ8A 4HHVA 2YRYA 4CHJA 2V76A 3NSUA 1TQZA 1BTNA 2ADZA 2I1KA 1V5MA 2X18A 3M1IB 2GCLA 5D3XA 1K5GB 2YT0A 4GXBA 1UPRA 2J0JA 2R09A 3QBVB 5C6RA 3BJIA 2YT2A 2P0DA 1QC6A 3LJUX 4HAWB 1XX0A 4MY6A 1V61A 3TFMA 3P7ZA 3N7CA 3V5WA 5FI0A 2RSGA 2IYBA 2L1CA 3OHMB 1W1DA 4CYEA 1H10A 3AJ4A 4CSQA 4EMOA 2ZKMX 1E5WA 1U27A 3KZ1A 3ODXA 4KHOA 3QWMA 2LG1A 1BAKA 1AQCA 3KRXA 2LOZA 2HTHB 3WA0A 3O96A 3DCXA 3U8ZA 1MIZB 2KIGA 4IAPA 4HB4B 1NI2A 4ZRIA 3IVFA 4Z2NA 1U5EA 2DTCA 2AEHA 1FOEA 4IFSA 2UVMA 1GC6A 2P8VA 4NSWA 2DYNA 4WVFB 1M7RA 5I2SA 3HIEA 2DKPA 2I5FA 2LKOA 1RRPB 3AU4A 5J3QA 3SYXA 2CAYA 5D3VA 3PVWA 2RUKB 1LB1A 3A58A 3ML4A 5JHHA 4A6HA 3SUZA 2KGXB 2H7EA 3HK0A 3FEHA 1ZM0A 2W2XC 1Q67A 1EAZA 2DHJA 2R0DA 1UEFA 3ODWA 4C0AA 4GNKB 1KI1B 5CLLB 4D0NB 2LULA 4KVGB 4ZRJA 2KR0A 2XQNM 1Z87A 3AU5A 2MWNB 1ZVRA 1UNPA 2Z0OA 2GS0A 1MAIA 3KSYA 3D8FA 2D10A 1P6SA 1MK9B 1AWEA 3P6AA 5HE2A 1PLSA 2Y8FA 4HATB 2COCA 1KZGA 2D9YA 2DX1A 2CY5A 1V88A 4GZUA 5IRSA 3DXEA 4OSNA 3UZTA 1IRSA 4WSFA 4A6FA 1V5PA 2D4QA 5HE1A 1FHOA 3NWDA 2DA0A 2N0YA 4KHBB 2K2UA 3RCPA 3U12A 4PQ0A 5D3YA 1OMWA 1TJ6A 1MKEA 2DN6A 1W1HA 1FB8A 1T77A 2GUMA 3OANA 4H8SA 3U7DA 4XWXA 2LYDA 2DYQA 1I2HA 5EFXA 2DHIA 4TKNA 2DX5A 1P3RA 2GCJA 4MK0A 2NBVA 2W2XD 1ZC4B 4PNKA 1NU2A 1XD4A 3FVCA 5LOPB 4DX8A 1J19A 2DLWA 2RGNB 3T06A 1EVHA 1DROA 4QJ3B 1XODA 1ZYIA 2MDXA 3A98B 1LW3A 5I2MA 3CXBB 1ISNA 3ZVRA 1ZSQA 5CLQB 4L1RA 2E2XA 3BINA 3PVUA 3DXDA 4NY0A 4A6KA 2YS3A 4YONA 2YS5A 1PMSA 2UZSA 4HB0B 1Y5OA 2Z59A 2Y7BA 4EJNA 1X86A 1BTKA 3TO1A 2Z13A 4HAZB 2RRFA 2Z0QA 3FSSA 2RNRB 3VOQA 5DHFB 4HAXB 1WGQA 5C79A 2I5CA 4HAUB 3HW2B 5C5BB 4GMVA 1P5TA 1X11A 1V89A 1WGUA 3A8PA 1EF1A 2ROZB 3PZDA 2CRFA 5HE0A 3PP2A 5C5BA 3ODOA 3PSCA 1FGYA 1U29A 1XKEA 4KAXB 4DBBA 2EMSA 4MT7A 1M7EA 3MPXA 2M38A 1WJMA 5JP4A 2NZ8B 2KUQA 2J0MA 5GOWB 1K5DB 2YF0A 2LOXA 4QXAB 3G9WA 4D6WA 3TW1A 4BBKA 1UPQA 1DBHA 5LG4B 3ZDTA 4EKUA 5FI1A 5DH9B 2COFA 2D11A 4Z2MB 4YL8A 2KCJA 3HQCA 4K17A 1WG7A 3NW8A 2CY4A 4A5KA 2Z14A 1QQGA 2K00A 1EGXA 2D2QA 2FJUB 2OTXA 3WYFB 3TVVA 2MFQA 4HDQA 2PZ1A 4HB2B 2AL6A 2DFKA 2Z0PA 4WJ7A 2YVCA 1PFJA 4TYZA 2GJYA 5LONB 3KRWA 1H4RA 4HAYB 5KQ4A 2JP2A 2P0FA 2DHKA 2YS1A 3F0WA 4B6HA 5KQ1A 2OQBA 1FGZA 4P7IA 3TCAA 3ULCA 4GMXB 3D8EA 2L2IA 3FM8C 3SO6A 1GC7A 3NWAA 2W2WA 1U5GA 2ZPYA 4F7UP 4QJ4B 1N3HA 2NMBA 2D9XA 1Y19B 2D9VA 3X23A 4HB3B 1OQNA 1J0WA 1MI1A 1WI1A 2RVBB 1FHWA 2CODA 4K2OA 4GN1A
chains in the Genus database with same CATH topology
2D9ZA 1MK7B 2UZRA 4HDOA 2P0HA 2N23A 5L81A 2EC1A 1U2BA 1OY2A 1UNRA 5DIFB 1FHXA 1DDMA 5JLJB 2J59M 2VSZA 1V5UA 2COAA 1I7AA 2HE7A 4KHAA 1W1GA 1DDVA 3F5RA 2YSZA 3PEGA 4A6FB 2I1JA 4DX90 3CIKA 4K81A 2H7DA 1DYNA 2K2JA 1DDWA 1FAOA 3PVLA 5HE3A 3A8QA 5DI9B 2ELBA 2QKMA 4ZRKA 1RJ2A 2RLOA 5J3TA 2VKIA 1KZ7A 1NTVA 3MDBC 1B55A 2G35A 3PG7A 2VRWB 2ELAA 4DXAB 1SGHA 4GPTB 2M14A 3DXCA 2IFSA 2DKQA 3ULBA 1SHCA 1MIXA 1WJ1A 2EMTA 4L6EA 2ROVA 5KCVA 1GG3A 1X05A 4HAVB 5J3YA 3VIAA 2Y8GA 2MKRA 1UNQA 1TXDA 4IOYX 2KUPA 3D8DA 5DHAB 3KY9A 1NTYA 2D9WA 4F7GA 2QKLA 1WVHA 2J0KA 4K2PA 1MPHA 3QIJA 4CHMA 3GYOA 5JHGA 4Y94A 4F7HA 5D27A 3SV1A 3SNHA 1U5DA 5C16A 1X1FA 1X1GA 2BCJA 3GYPA 1XCGA 1BWNA 2Q13A 2FJLA 1U5FA 2YT1A 1XR0B 1ZC3B 5D3WA 2EJ8A 4HHVA 2YRYA 4CHJA 2V76A 3NSUA 1TQZA 1BTNA 2ADZA 2I1KA 1V5MA 2X18A 3M1IB 2GCLA 5D3XA 1K5GB 2YT0A 4GXBA 1UPRA 2J0JA 2R09A 3QBVB 5C6RA 3BJIA 2P0DA 1QC6A 3LJUX 4HAWB 1XX0A 4MY6A 1V61A 3TFMA 3P7ZA 3N7CA 3V5WA 5FI0A 2RSGA 2IYBA 2L1CA 1W1DA 4CYEA 1H10A 3AJ4A 4EMOA 1E5WA 1U27A 3KZ1A 3ODXA 4KHOA 3QWMA 2LG1A 1BAKA 1AQCA 3KRXA 2LOZA 2HTHB 3WA0A 3O96A 3U8ZA 1MIZB 4IAPA 4HB4B 1NI2A 4ZRIA 3IVFA 4Z2NA 1U5EA 2DTCA 2AEHA 1FOEA 4IFSA 2UVMA 1GC6A 2P8VA 4NSWA 2DYNA 4WVFB 1M7RA 2DKPA 2I5FA 2LKOA 1RRPB 3AU4A 5J3QA 3SYXA 2CAYA 5D3VA 3PVWA 2RUKB 1LB1A 5JHHA 3ML4A 4A6HA 3SUZA 2KGXB 2H7EA 3HK0A 3FEHA 1ZM0A 2W2XC 1Q67A 1EAZA 2DHJA 2R0DA 1UEFA 3ODWA 4C0AA 1KI1B 5CLLB 4D0NB 2LULA 4KVGB 4ZRJA 2XQNM 1Z87A 3AU5A 2MWNB 1ZVRA 1UNPA 2Z0OA 2GS0A 1MAIA 3KSYA 3D8FA 2D10A 1P6SA 1MK9B 1AWEA 3P6AA 5HE2A 1PLSA 2Y8FA 4HATB 2COCA 1KZGA 2D9YA 2DX1A 2CY5A 1V88A 4GZUA 3DXEA 3UZTA 1IRSA 4WSFA 4A6FA 1V5PA 2D4QA 5HE1A 1FHOA 2DA0A 2N0YA 4KHBB 2K2UA 3RCPA 4PQ0A 5D3YA 1OMWA 1TJ6A 1MKEA 2DN6A 1W1HA 1FB8A 3OANA 4H8SA 3U7DA 4XWXA 2LYDA 2DYQA 1I2HA 5EFXA 2DHIA 4TKNA 2DX5A 1P3RA 2GCJA 4MK0A 2W2XD 1ZC4B 4PNKA 1NU2A 1XD4A 5LOPB 4DX8A 1J19A 2DLWA 2RGNB 3T06A 1EVHA 1DROA 1XODA 2MDXA 3A98B 1LW3A 3CXBB 1ISNA 3ZVRA 1ZSQA 5CLQB 2E2XA 3BINA 3PVUA 3DXDA 4NY0A 4A6KA 2YS3A 4YONA 2YS5A 1PMSA 2UZSA 4HB0B 1Y5OA 2Y7BA 4EJNA 1X86A 1BTKA 3TO1A 4HAZB 2Z0QA 3FSSA 2RNRB 3VOQA 5DHFB 4HAXB 1WGQA 5C79A 2I5CA 4HAUB 3HW2B 5C5BB 4GMVA 1P5TA 1X11A 1V89A 1WGUA 3A8PA 1EF1A 2ROZB 3PZDA 2CRFA 5HE0A 3PP2A 5C5BA 3ODOA 3PSCA 1FGYA 1U29A 1XKEA 4KAXB 4DBBA 2EMSA 4MT7A 1M7EA 3MPXA 2M38A 1WJMA 5JP4A 2NZ8B 2J0MA 5GOWB 1K5DB 2YF0A 2LOXA 3G9WA 3TW1A 4BBKA 1UPQA 1DBHA 3ZDTA 4EKUA 5FI1A 5DH9B 2COFA 2D11A 4Z2MB 4YL8A 2KCJA 3HQCA 4K17A 1WG7A 2CY4A 4A5KA 1QQGA 2K00A 1EGXA 2D2QA 2OTXA 3WYFB 3TVVA 2MFQA 4HDQA 2PZ1A 4HB2B 2AL6A 2DFKA 2Z0PA 4WJ7A 2YVCA 1PFJA 4TYZA 2GJYA 5LONB 3KRWA 1H4RA 4HAYB 5KQ4A 2JP2A 2P0FA 2DHKA 2YS1A 3F0WA 4B6HA 5KQ1A 2OQBA 1FGZA 4P7IA 3TCAA 3ULCA 4GMXB 3D8EA 2L2IA 3FM8C 3SO6A 1GC7A 2W2WA 1U5GA 2ZPYA 4F7UP 1N3HA 2NMBA 2D9XA 1Y19B 2D9VA 3X23A 4HB3B 1OQNA 1J0WA 1WI1A 2RVBB 1FHWA 2CODA 4K2OA 4GN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9Z A;  1MK7 B;  2UZR A;  4HDO A;  2P0H A;  2N23 A;  5L81 A;  2EC1 A;  1U2B A;  1OY2 A;  1UNR A;  5DIF B;  1FHX A;  1DDM A;  5JLJ B;  2J59 M;  2VSZ A;  1V5U A;  2COA A;  1I7A A;  2HE7 A;  4KHA A;  1W1G A;  1DDV A;  3F5R A;  2YSZ A;  3PEG A;  4A6F B;  2I1J A;  4DX9 0;  3CIK A;  4K81 A;  2H7D A;  1DYN A;  2K2J A;  1DDW A;  1FAO A;  3PVL A;  5HE3 A;  3A8Q A;  5DI9 B;  2ELB A;  2QKM A;  4ZRK A;  1RJ2 A;  2RLO A;  5J3T A;  2VKI A;  1KZ7 A;  1NTV A;  3MDB C;  1B55 A;  2G35 A;  3PG7 A;  2VRW B;  2ELA A;  4DXA B;  1SGH A;  4GPT B;  2M14 A;  3DXC A;  2IFS A;  2DKQ A;  3ULB A;  1SHC A;  1MIX A;  1WJ1 A;  2EMT A;  4L6E A;  2ROV A;  5KCV A;  1GG3 A;  1X05 A;  4HAV B;  5J3Y A;  3VIA A;  2Y8G A;  2MKR A;  1UNQ A;  1TXD A;  4IOY X;  2KUP A;  3D8D A;  5DHA B;  3KY9 A;  1NTY A;  2D9W A;  4F7G A;  2QKL A;  1WVH A;  2J0K A;  4K2P A;  1MPH A;  3QIJ A;  4CHM A;  3GYO A;  5JHG A;  4Y94 A;  4F7H A;  5D27 A;  3SV1 A;  3SNH A;  1U5D A;  5C16 A;  1X1F A;  1X1G A;  2BCJ A;  3GYP A;  1XCG A;  1BWN A;  2Q13 A;  2FJL A;  1U5F A;  2YT1 A;  1XR0 B;  1ZC3 B;  5D3W A;  2EJ8 A;  4HHV A;  2YRY A;  4CHJ A;  2V76 A;  3NSU A;  1TQZ A;  1BTN A;  2ADZ A;  2I1K A;  1V5M A;  2X18 A;  3M1I B;  2GCL A;  5D3X A;  1K5G B;  2YT0 A;  4GXB A;  1UPR A;  2J0J A;  2R09 A;  3QBV B;  5C6R A;  3BJI A;  2P0D A;  1QC6 A;  3LJU X;  4HAW B;  1XX0 A;  4MY6 A;  1V61 A;  3TFM A;  3P7Z A;  3N7C A;  3V5W A;  5FI0 A;  2RSG A;  2IYB A;  2L1C A;  1W1D A;  4CYE A;  1H10 A;  3AJ4 A;  4EMO A;  1E5W A;  1U27 A;  3KZ1 A;  3ODX A;  4KHO A;  3QWM A;  2LG1 A;  1BAK A;  1AQC A;  3KRX A;  2LOZ A;  2HTH B;  3WA0 A;  3O96 A;  3U8Z A;  1MIZ B;  4IAP A;  4HB4 B;  1NI2 A;  4ZRI A;  3IVF A;  4Z2N A;  1U5E A;  2DTC A;  2AEH A;  1FOE A;  4IFS A;  2UVM A;  1GC6 A;  2P8V A;  4NSW A;  2DYN A;  4WVF B;  1M7R A;  2DKP A;  2I5F A;  2LKO A;  1RRP B;  3AU4 A;  5J3Q A;  3SYX A;  2CAY A;  5D3V A;  3PVW A;  2RUK B;  1LB1 A;  5JHH A;  3ML4 A;  4A6H A;  3SUZ A;  2KGX B;  2H7E A;  3HK0 A;  3FEH A;  1ZM0 A;  2W2X C;  1Q67 A;  1EAZ A;  2DHJ A;  2R0D A;  1UEF A;  3ODW A;  4C0A A;  1KI1 B;  5CLL B;  4D0N B;  2LUL A;  4KVG B;  4ZRJ A;  2XQN M;  1Z87 A;  3AU5 A;  2MWN B;  1ZVR A;  1UNP A;  2Z0O A;  2GS0 A;  1MAI A;  3KSY A;  3D8F A;  2D10 A;  1P6S A;  1MK9 B;  1AWE A;  3P6A A;  5HE2 A;  1PLS A;  2Y8F A;  4HAT B;  2COC A;  1KZG A;  2D9Y A;  2DX1 A;  2CY5 A;  1V88 A;  4GZU A;  3DXE A;  3UZT A;  1IRS A;  4WSF A;  4A6F A;  1V5P A;  2D4Q A;  5HE1 A;  1FHO A;  2DA0 A;  2N0Y A;  4KHB B;  2K2U A;  3RCP A;  4PQ0 A;  5D3Y A;  1OMW A;  1TJ6 A;  1MKE A;  2DN6 A;  1W1H A;  1FB8 A;  3OAN A;  4H8S A;  3U7D A;  4XWX A;  2LYD A;  2DYQ A;  1I2H A;  5EFX A;  2DHI A;  4TKN A;  2DX5 A;  1P3R A;  2GCJ A;  4MK0 A;  2W2X D;  1ZC4 B;  4PNK A;  1NU2 A;  1XD4 A;  5LOP B;  4DX8 A;  1J19 A;  2DLW A;  2RGN B;  3T06 A;  1EVH A;  1DRO A;  1XOD A;  2MDX A;  3A98 B;  1LW3 A;  3CXB B;  1ISN A;  3ZVR A;  1ZSQ A;  5CLQ B;  2E2X A;  3BIN A;  3PVU A;  3DXD A;  4NY0 A;  4A6K A;  2YS3 A;  4YON A;  2YS5 A;  1PMS A;  2UZS A;  4HB0 B;  1Y5O A;  2Y7B A;  4EJN A;  1X86 A;  1BTK A;  3TO1 A;  4HAZ B;  2Z0Q A;  3FSS A;  2RNR B;  3VOQ A;  5DHF B;  4HAX B;  1WGQ A;  5C79 A;  2I5C A;  4HAU B;  3HW2 B;  5C5B B;  4GMV A;  1P5T A;  1X11 A;  1V89 A;  1WGU A;  3A8P A;  1EF1 A;  2ROZ B;  3PZD A;  2CRF A;  5HE0 A;  3PP2 A;  5C5B A;  3ODO A;  3PSC A;  1FGY A;  1U29 A;  1XKE A;  4KAX B;  4DBB A;  2EMS A;  4MT7 A;  1M7E A;  3MPX A;  2M38 A;  1WJM A;  5JP4 A;  2NZ8 B;  2J0M A;  5GOW B;  1K5D B;  2YF0 A;  2LOX A;  3G9W A;  3TW1 A;  4BBK A;  1UPQ A;  1DBH A;  3ZDT A;  4EKU A;  5FI1 A;  5DH9 B;  2COF A;  2D11 A;  4Z2M B;  4YL8 A;  2KCJ A;  3HQC A;  4K17 A;  1WG7 A;  2CY4 A;  4A5K A;  1QQG A;  2K00 A;  1EGX A;  2D2Q A;  2OTX A;  3WYF B;  3TVV A;  2MFQ A;  4HDQ A;  2PZ1 A;  4HB2 B;  2AL6 A;  2DFK A;  2Z0P A;  4WJ7 A;  2YVC A;  1PFJ A;  4TYZ A;  2GJY A;  5LON B;  3KRW A;  1H4R A;  4HAY B;  5KQ4 A;  2JP2 A;  2P0F A;  2DHK A;  2YS1 A;  3F0W A;  4B6H A;  5KQ1 A;  2OQB A;  1FGZ A;  4P7I A;  3TCA A;  3ULC A;  4GMX B;  3D8E A;  2L2I A;  3FM8 C;  3SO6 A;  1GC7 A;  2W2W A;  1U5G A;  2ZPY A;  4F7U P;  1N3H A;  2NMB A;  2D9X A;  1Y19 B;  2D9V A;  3X23 A;  4HB3 B;  1OQN A;  1J0W A;  1WI1 A;  2RVB B;  1FHW A;  2COD A;  4K2O A;  4GN1 A; 
#chains in the Genus database with same CATH topology
 2D9Z A;  1MK7 B;  2UZR A;  4HDO A;  2P0H A;  2N23 A;  5L81 A;  2EC1 A;  1U2B A;  1OY2 A;  1UNR A;  5DIF B;  1FHX A;  1DDM A;  4HSI A;  5JLJ B;  2J59 M;  2VSZ A;  1V5U A;  2COA A;  1I7A A;  2HE7 A;  3NWF A;  4KHA A;  4GOU A;  1W1G A;  1DDV A;  3F5R A;  2YSZ A;  3PEG A;  4A6F B;  2I1J A;  4KHB A;  4DX9 0;  3CIK A;  4K81 A;  2H7D A;  1DYN A;  2K2J A;  1DDW A;  1FAO A;  2K49 A;  3PVL A;  5HE3 A;  3A8Q A;  5DI9 B;  2ELB A;  2QKM A;  4ZRK A;  1RJ2 A;  2RLO A;  5J3T A;  2VKI A;  1KZ7 A;  1NTV A;  3MDB C;  1B55 A;  2G35 A;  3PG7 A;  2VRW B;  2ELA A;  4DXA B;  1SGH A;  4GPT B;  2M14 A;  5M4Y B;  3DXC A;  2IFS A;  2DKQ A;  3ULB A;  1SHC A;  1MIX A;  1WJ1 A;  2EMT A;  4L6E A;  2ROV A;  5KCV A;  1GG3 A;  1X05 A;  4HAV B;  5J3Y A;  3VIA A;  2Y8G A;  2MKR A;  4QJ5 B;  1UNQ A;  1TXD A;  4IOY X;  2K8E A;  2KUP A;  3D8D A;  5DHA B;  3KY9 A;  1NTY A;  2D9W A;  4OT1 A;  3HSA A;  4F7G A;  2QKL A;  1WVH A;  2J0K A;  4K2P A;  4DIX A;  2KIE A;  1MPH A;  3B77 A;  3QIJ A;  4CHM A;  3GYO A;  5JHG A;  4Y94 A;  4F7H A;  5D27 A;  3SV1 A;  3SNH A;  1U5D A;  5C16 A;  1X1F A;  1X1G A;  2BCJ A;  3GYP A;  2Z4D A;  1XCG A;  1BWN A;  2Q13 A;  2FJL A;  1U5F A;  2YT1 A;  1XR0 B;  1ZC3 B;  2R2Y A;  5D3W A;  2EJ8 A;  4HHV A;  2YRY A;  4CHJ A;  2V76 A;  3NSU A;  1TQZ A;  1BTN A;  2ADZ A;  2I1K A;  1V5M A;  2X18 A;  3M1I B;  2GCL A;  5D3X A;  1K5G B;  2YT0 A;  4GXB A;  1UPR A;  2J0J A;  2R09 A;  3QBV B;  5C6R A;  3BJI A;  2YT2 A;  2P0D A;  1QC6 A;  3LJU X;  4HAW B;  1XX0 A;  4MY6 A;  1V61 A;  3TFM A;  3P7Z A;  3N7C A;  3V5W A;  5FI0 A;  2RSG A;  2IYB A;  2L1C A;  3OHM B;  1W1D A;  4CYE A;  1H10 A;  3AJ4 A;  4CSQ A;  4EMO A;  2ZKM X;  1E5W A;  1U27 A;  3KZ1 A;  3ODX A;  4KHO A;  3QWM A;  2LG1 A;  1BAK A;  1AQC A;  3KRX A;  2LOZ A;  2HTH B;  3WA0 A;  3O96 A;  3DCX A;  3U8Z A;  1MIZ B;  2KIG A;  4IAP A;  4HB4 B;  1NI2 A;  4ZRI A;  3IVF A;  4Z2N A;  1U5E A;  2DTC A;  2AEH A;  1FOE A;  4IFS A;  2UVM A;  1GC6 A;  2P8V A;  4NSW A;  2DYN A;  4WVF B;  1M7R A;  5I2S A;  3HIE A;  2DKP A;  2I5F A;  2LKO A;  1RRP B;  3AU4 A;  5J3Q A;  3SYX A;  2CAY A;  5D3V A;  3PVW A;  2RUK B;  1LB1 A;  3A58 A;  3ML4 A;  5JHH A;  4A6H A;  3SUZ A;  2KGX B;  2H7E A;  3HK0 A;  3FEH A;  1ZM0 A;  2W2X C;  1Q67 A;  1EAZ A;  2DHJ A;  2R0D A;  1UEF A;  3ODW A;  4C0A A;  4GNK B;  1KI1 B;  5CLL B;  4D0N B;  2LUL A;  4KVG B;  4ZRJ A;  2KR0 A;  2XQN M;  1Z87 A;  3AU5 A;  2MWN B;  1ZVR A;  1UNP A;  2Z0O A;  2GS0 A;  1MAI A;  3KSY A;  3D8F A;  2D10 A;  1P6S A;  1MK9 B;  1AWE A;  3P6A A;  5HE2 A;  1PLS A;  2Y8F A;  4HAT B;  2COC A;  1KZG A;  2D9Y A;  2DX1 A;  2CY5 A;  1V88 A;  4GZU A;  5IRS A;  3DXE A;  4OSN A;  3UZT A;  1IRS A;  4WSF A;  4A6F A;  1V5P A;  2D4Q A;  5HE1 A;  1FHO A;  3NWD A;  2DA0 A;  2N0Y A;  4KHB B;  2K2U A;  3RCP A;  3U12 A;  4PQ0 A;  5D3Y A;  1OMW A;  1TJ6 A;  1MKE A;  2DN6 A;  1W1H A;  1FB8 A;  1T77 A;  2GUM A;  3OAN A;  4H8S A;  3U7D A;  4XWX A;  2LYD A;  2DYQ A;  1I2H A;  5EFX A;  2DHI A;  4TKN A;  2DX5 A;  1P3R A;  2GCJ A;  4MK0 A;  2NBV A;  2W2X D;  1ZC4 B;  4PNK A;  1NU2 A;  1XD4 A;  3FVC A;  5LOP B;  4DX8 A;  1J19 A;  2DLW A;  2RGN B;  3T06 A;  1EVH A;  1DRO A;  4QJ3 B;  1XOD A;  1ZYI A;  2MDX A;  3A98 B;  1LW3 A;  5I2M A;  3CXB B;  1ISN A;  3ZVR A;  1ZSQ A;  5CLQ B;  4L1R A;  2E2X A;  3BIN A;  3PVU A;  3DXD A;  4NY0 A;  4A6K A;  2YS3 A;  4YON A;  2YS5 A;  1PMS A;  2UZS A;  4HB0 B;  1Y5O A;  2Z59 A;  2Y7B A;  4EJN A;  1X86 A;  1BTK A;  3TO1 A;  2Z13 A;  4HAZ B;  2RRF A;  2Z0Q A;  3FSS A;  2RNR B;  3VOQ A;  5DHF B;  4HAX B;  1WGQ A;  5C79 A;  2I5C A;  4HAU B;  3HW2 B;  5C5B B;  4GMV A;  1P5T A;  1X11 A;  1V89 A;  1WGU A;  3A8P A;  1EF1 A;  2ROZ B;  3PZD A;  2CRF A;  5HE0 A;  3PP2 A;  5C5B A;  3ODO A;  3PSC A;  1FGY A;  1U29 A;  1XKE A;  4KAX B;  4DBB A;  2EMS A;  4MT7 A;  1M7E A;  3MPX A;  2M38 A;  1WJM A;  5JP4 A;  2NZ8 B;  2KUQ A;  2J0M A;  5GOW B;  1K5D B;  2YF0 A;  2LOX A;  4QXA B;  3G9W A;  4D6W A;  3TW1 A;  4BBK A;  1UPQ A;  1DBH A;  5LG4 B;  3ZDT A;  4EKU A;  5FI1 A;  5DH9 B;  2COF A;  2D11 A;  4Z2M B;  4YL8 A;  2KCJ A;  3HQC A;  4K17 A;  1WG7 A;  3NW8 A;  2CY4 A;  4A5K A;  2Z14 A;  1QQG A;  2K00 A;  1EGX A;  2D2Q A;  2FJU B;  2OTX A;  3WYF B;  3TVV A;  2MFQ A;  4HDQ A;  2PZ1 A;  4HB2 B;  2AL6 A;  2DFK A;  2Z0P A;  4WJ7 A;  2YVC A;  1PFJ A;  4TYZ A;  2GJY A;  5LON B;  3KRW A;  1H4R A;  4HAY B;  5KQ4 A;  2JP2 A;  2P0F A;  2DHK A;  2YS1 A;  3F0W A;  4B6H A;  5KQ1 A;  2OQB A;  1FGZ A;  4P7I A;  3TCA A;  3ULC A;  4GMX B;  3D8E A;  2L2I A;  3FM8 C;  3SO6 A;  1GC7 A;  3NWA A;  2W2W A;  1U5G A;  2ZPY A;  4F7U P;  4QJ4 B;  1N3H A;  2NMB A;  2D9X A;  1Y19 B;  2D9V A;  3X23 A;  4HB3 B;  1OQN A;  1J0W A;  1MI1 A;  1WI1 A;  2RVB B;  1FHW A;  2COD A;  4K2O A;  4GN1 A; 
#chains in the Genus database with same CATH homology
 2D9Z A;  1MK7 B;  2UZR A;  4HDO A;  2P0H A;  2N23 A;  5L81 A;  2EC1 A;  1U2B A;  1OY2 A;  1UNR A;  5DIF B;  1FHX A;  1DDM A;  5JLJ B;  2J59 M;  2VSZ A;  1V5U A;  2COA A;  1I7A A;  2HE7 A;  4KHA A;  1W1G A;  1DDV A;  3F5R A;  2YSZ A;  3PEG A;  4A6F B;  2I1J A;  4DX9 0;  3CIK A;  4K81 A;  2H7D A;  1DYN A;  2K2J A;  1DDW A;  1FAO A;  3PVL A;  5HE3 A;  3A8Q A;  5DI9 B;  2ELB A;  2QKM A;  4ZRK A;  1RJ2 A;  2RLO A;  5J3T A;  2VKI A;  1KZ7 A;  1NTV A;  3MDB C;  1B55 A;  2G35 A;  3PG7 A;  2VRW B;  2ELA A;  4DXA B;  1SGH A;  4GPT B;  2M14 A;  3DXC A;  2IFS A;  2DKQ A;  3ULB A;  1SHC A;  1MIX A;  1WJ1 A;  2EMT A;  4L6E A;  2ROV A;  5KCV A;  1GG3 A;  1X05 A;  4HAV B;  5J3Y A;  3VIA A;  2Y8G A;  2MKR A;  1UNQ A;  1TXD A;  4IOY X;  2KUP A;  3D8D A;  5DHA B;  3KY9 A;  1NTY A;  2D9W A;  4F7G A;  2QKL A;  1WVH A;  2J0K A;  4K2P A;  1MPH A;  3QIJ A;  4CHM A;  3GYO A;  5JHG A;  4Y94 A;  4F7H A;  5D27 A;  3SV1 A;  3SNH A;  1U5D A;  5C16 A;  1X1F A;  1X1G A;  2BCJ A;  3GYP A;  1XCG A;  1BWN A;  2Q13 A;  2FJL A;  1U5F A;  2YT1 A;  1XR0 B;  1ZC3 B;  5D3W A;  2EJ8 A;  4HHV A;  2YRY A;  4CHJ A;  2V76 A;  3NSU A;  1TQZ A;  1BTN A;  2ADZ A;  2I1K A;  1V5M A;  2X18 A;  3M1I B;  2GCL A;  5D3X A;  1K5G B;  2YT0 A;  4GXB A;  1UPR A;  2J0J A;  2R09 A;  3QBV B;  5C6R A;  3BJI A;  2P0D A;  1QC6 A;  3LJU X;  4HAW B;  1XX0 A;  4MY6 A;  1V61 A;  3TFM A;  3P7Z A;  3N7C A;  3V5W A;  5FI0 A;  2RSG A;  2IYB A;  2L1C A;  1W1D A;  4CYE A;  1H10 A;  3AJ4 A;  4EMO A;  1E5W A;  1U27 A;  3KZ1 A;  3ODX A;  4KHO A;  3QWM A;  2LG1 A;  1BAK A;  1AQC A;  3KRX A;  2LOZ A;  2HTH B;  3WA0 A;  3O96 A;  3U8Z A;  1MIZ B;  4IAP A;  4HB4 B;  1NI2 A;  4ZRI A;  3IVF A;  4Z2N A;  1U5E A;  2DTC A;  2AEH A;  1FOE A;  4IFS A;  2UVM A;  1GC6 A;  2P8V A;  4NSW A;  2DYN A;  4WVF B;  1M7R A;  2DKP A;  2I5F A;  2LKO A;  1RRP B;  3AU4 A;  5J3Q A;  3SYX A;  2CAY A;  5D3V A;  3PVW A;  2RUK B;  1LB1 A;  5JHH A;  3ML4 A;  4A6H A;  3SUZ A;  2KGX B;  2H7E A;  3HK0 A;  3FEH A;  1ZM0 A;  2W2X C;  1Q67 A;  1EAZ A;  2DHJ A;  2R0D A;  1UEF A;  3ODW A;  4C0A A;  1KI1 B;  5CLL B;  4D0N B;  2LUL A;  4KVG B;  4ZRJ A;  2XQN M;  1Z87 A;  3AU5 A;  2MWN B;  1ZVR A;  1UNP A;  2Z0O A;  2GS0 A;  1MAI A;  3KSY A;  3D8F A;  2D10 A;  1P6S A;  1MK9 B;  1AWE A;  3P6A A;  5HE2 A;  1PLS A;  2Y8F A;  4HAT B;  2COC A;  1KZG A;  2D9Y A;  2DX1 A;  2CY5 A;  1V88 A;  4GZU A;  3DXE A;  3UZT A;  1IRS A;  4WSF A;  4A6F A;  1V5P A;  2D4Q A;  5HE1 A;  1FHO A;  2DA0 A;  2N0Y A;  4KHB B;  2K2U A;  3RCP A;  4PQ0 A;  5D3Y A;  1OMW A;  1TJ6 A;  1MKE A;  2DN6 A;  1W1H A;  1FB8 A;  3OAN A;  4H8S A;  3U7D A;  4XWX A;  2LYD A;  2DYQ A;  1I2H A;  5EFX A;  2DHI A;  4TKN A;  2DX5 A;  1P3R A;  2GCJ A;  4MK0 A;  2W2X D;  1ZC4 B;  4PNK A;  1NU2 A;  1XD4 A;  5LOP B;  4DX8 A;  1J19 A;  2DLW A;  2RGN B;  3T06 A;  1EVH A;  1DRO A;  1XOD A;  2MDX A;  3A98 B;  1LW3 A;  3CXB B;  1ISN A;  3ZVR A;  1ZSQ A;  5CLQ B;  2E2X A;  3BIN A;  3PVU A;  3DXD A;  4NY0 A;  4A6K A;  2YS3 A;  4YON A;  2YS5 A;  1PMS A;  2UZS A;  4HB0 B;  1Y5O A;  2Y7B A;  4EJN A;  1X86 A;  1BTK A;  3TO1 A;  4HAZ B;  2Z0Q A;  3FSS A;  2RNR B;  3VOQ A;  5DHF B;  4HAX B;  1WGQ A;  5C79 A;  2I5C A;  4HAU B;  3HW2 B;  5C5B B;  4GMV A;  1P5T A;  1X11 A;  1V89 A;  1WGU A;  3A8P A;  1EF1 A;  2ROZ B;  3PZD A;  2CRF A;  5HE0 A;  3PP2 A;  5C5B A;  3ODO A;  3PSC A;  1FGY A;  1U29 A;  1XKE A;  4KAX B;  4DBB A;  2EMS A;  4MT7 A;  1M7E A;  3MPX A;  2M38 A;  1WJM A;  5JP4 A;  2NZ8 B;  2J0M A;  5GOW B;  1K5D B;  2YF0 A;  2LOX A;  3G9W A;  3TW1 A;  4BBK A;  1UPQ A;  1DBH A;  3ZDT A;  4EKU A;  5FI1 A;  5DH9 B;  2COF A;  2D11 A;  4Z2M B;  4YL8 A;  2KCJ A;  3HQC A;  4K17 A;  1WG7 A;  2CY4 A;  4A5K A;  1QQG A;  2K00 A;  1EGX A;  2D2Q A;  2OTX A;  3WYF B;  3TVV A;  2MFQ A;  4HDQ A;  2PZ1 A;  4HB2 B;  2AL6 A;  2DFK A;  2Z0P A;  4WJ7 A;  2YVC A;  1PFJ A;  4TYZ A;  2GJY A;  5LON B;  3KRW A;  1H4R A;  4HAY B;  5KQ4 A;  2JP2 A;  2P0F A;  2DHK A;  2YS1 A;  3F0W A;  4B6H A;  5KQ1 A;  2OQB A;  1FGZ A;  4P7I A;  3TCA A;  3ULC A;  4GMX B;  3D8E A;  2L2I A;  3FM8 C;  3SO6 A;  1GC7 A;  2W2W A;  1U5G A;  2ZPY A;  4F7U P;  1N3H A;  2NMB A;  2D9X A;  1Y19 B;  2D9V A;  3X23 A;  4HB3 B;  1OQN A;  1J0W A;  1WI1 A;  2RVB B;  1FHW A;  2COD A;  4K2O A;  4GN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...