2YS5A

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
146
Chain Sequence
b'GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys5A01
3ODWA 2HTHB 4B6HA 2GCLA 2DX1A 4HAZB 2L1CA 2MKRA 5J3QA 2DYQA 1PFJA 1P5TA 2YRYA 1FOEA 3QBVB 2AEHA 3PSCA 2VKIA 4K2OA 2PZ1A 2DN6A 3IVFA 2J59M 3SV1A 2MWNB 1J0WA 1DDWA 4EJNA 2G35A 3D8DA 4A5KA 5KCVA 3TVVA 3O96A 3ODXA 1M7RA 1Q67A 5KQ4A 1U5EA 2RNRB 1I2HA 2EJ8A 5GOWB 4GMVA 2RSGA 4ZRJA 3P7ZA 1WJMA 3ML4A 3PG7A 4GZUA 2DHIA 4HB0B 2CY5A 1KZGA 1MKEA 1V5MA 1ZC4B 3SUZA 1EGXA 2KUPA 2QKMA 2DKPA 2P0HA 2GJYA 4IOYX 1KI1B 4K17A 1AQCA 4XWXA 2UZRA 2ELBA 3KY9A 4F7UP 1V5UA 1WJ1A 1IRSA 2FJLA 5HE1A 2K2JA 2OTXA 2QKLA 2W2XD 3ULBA 4C0AA 3HW2B 3FSSA 3LJUX 3AU5A 4MY6A 4HAXB 5D3YA 2ADZA 5FI1A 3TO1A 2DKQA 4WJ7A 1MAIA 4CYEA 5D3XA 1DBHA 2GS0A 3U7DA 1H4RA 4NSWA 4A6FA 2ELAA 2CODA 1WGQA 3SO6A 1U29A 3NSUA 5D27A 4YONA 3RCPA 4WSFA 1MK7B 2ZPYA 4MT7A 3M1IB 4IFSA 5D3VA 4KAXB 1ISNA 1UPRA 2D2QA 2D4QA 2YS3A 1U27A 4F7GA 1MK9B 4HATB 1BWNA 3QWMA 4K81A 4H8SA 3WA0A 1Y5OA 4YL8A 5LOPB 1PMSA 3TCAA 1M7EA 2Q13A 1WI1A 3ULCA 2R09A 4Y94A 5HE2A 5J3TA 1V89A 1W1HA 2LOXA 5C6RA 2ROVA 4A6HA 2Y7BA 2UVMA 1E5WA 2M14A 2D9XA 2DFKA 1WVHA 1MIZB 3AJ4A 1UNQA 1RJ2A 2CY4A 2M38A 5L81A 2LYDA 3KRXA 2LG1A 4EKUA 1DROA 1UNRA 2H7EA 4K2PA 2N0YA 2DHJA 2J0KA 3SNHA 4HB4B 1OY2A 4KVGB 4BBKA 1FHOA 1X86A 1SHCA 1DYNA 1ZVRA 3UZTA 2IYBA 1LW3A 2RGNB 3OANA 1W1DA 4MK0A 3VIAA 2UZSA 1K5GB 4GN1A 1AWEA 4PQ0A 1GG3A 2LOZA 1SGHA 1H10A 3MDBC 2MDXA 3ODOA 5C79A 1I7AA 3KSYA 2P0FA 3KZ1A 4A6FB 2I5FA 1X11A 2J0JA 2EMSA 2XQNM 3CXBB 2IFSA 1XR0B 4F7HA 3CIKA 3PZDA 5DI9B 1J19A 1FGZA 1V61A 2COFA 1GC6A 4A6KA 2E2XA 1BAKA 2BCJA 2W2XC 1X1GA 3T06A 1FHWA 2GCJA 2D10A 2X18A 1P3RA 2YSZA 2J0MA 2OQBA 2I1KA 5DH9B 4DXAB 5C5BB 4KHBB 2Z0OA 4HDQA 4NY0A 2DX5A 3ZVRA 2V76A 2Z0PA 2RUKB 1TQZA 2EC1A 1X1FA 5DHAB 1OQNA 3KRWA 5HE3A 4EMOA 1XCGA 4CHJA 2JP2A 5CLLB 4ZRIA 2YS5A 3V5WA 5C16A 2NZ8B 2YT1A 2COAA 1QC6A 1QQGA 2Y8GA 1BTNA 2P0DA 1DDMA 2NMBA 1PLSA 1ZSQA 4GXBA 1EF1A 2K2UA 3A98B 3F0WA 2LULA 1P6SA 1FGYA 2D9ZA 2D9VA 1UPQA 5C5BA 3GYOA 4IAPA 1NU2A 1X05A 2YS1A 3DXEA 5D3WA 3PP2A 1ZC3B 3A8PA 3TFMA 1ZM0A 5JLJB 1V88A 2Y8FA 3DXDA 4HAVB 4DX90 1U2BA 2D9WA 4DBBA 5LONB 2K00A 1MPHA 1EVHA 3DXCA 3PVLA 3FEHA 1GC7A 2DTCA 1N3HA 3QIJA 1NTVA 2COCA 3PVWA 2HE7A 5FI0A 1U5DA 5KQ1A 2N23A 4L6EA 4HHVA 4HAWB 4TKNA 1TXDA 4P7IA 4D0NB 4KHAA 4Z2NA 1WGUA 1XX0A 3A8QA 2VRWB 2W2WA 3BJIA 2CRFA 4ZRKA 2KCJA 4DX8A 1B55A 1FHXA 3FM8C 3ZDTA 2MFQA 5CLQB 1FAOA 2YVCA 2DYNA 2AL6A 2I5CA 5DHFB 4GPTB 1KZ7A 1MIXA 3GYPA 3BINA 4GMXB 1NI2A 3VOQA 3HK0A 3PEGA 2L2IA 5DIFB 2YF0A 5JHHA 1Z87A 2DA0A 2DLWA 4HB2B 1W1GA 1U5FA 1WG7A 3D8EA 5HE0A 1LB1A 2P8VA 3N7CA 2H7DA 4HAUB 3HQCA 1TJ6A 4HDOA 1BTKA 5J3YA 3G9WA 1FB8A 1XKEA 1V5PA 2YT0A 1NTYA 3D8FA 2RVBB 3MPXA 1U5GA 5EFXA 2D9YA 4WVFB 4HAYB 3X23A 4HB3B 4KHOA 3WYFB 4TYZA 2EMTA 3TW1A 2LKOA 1OMWA 5JHGA 2R0DA 2VSZA 3SYXA 2CAYA 2KGXB 3AU4A 3U8ZA 2I1JA 3P6AA 4PNKA 3PVUA 2ROZB 1EAZA 1K5DB 1UNPA 1XD4A 5JP4A 4Z2MB 2Z0QA 3F5RA 1RRPB 1DDVA 2D11A 2DHKA 1Y19B 1XODA 2RLOA 1UEFA 4CHMA
chains in the Genus database with same CATH superfamily
3ODWA 2HTHB 4B6HA 2GCLA 2DX1A 4HAZB 2L1CA 2MKRA 5J3QA 2DYQA 3U12A 1PFJA 1P5TA 2YRYA 1FOEA 3QBVB 2AEHA 2NBVA 3PSCA 2VKIA 4K2OA 2PZ1A 2DN6A 3IVFA 2J59M 5LG4B 2Z14A 3SV1A 2MWNB 1J0WA 1DDWA 4EJNA 2G35A 3D8DA 4A5KA 5KCVA 3TVVA 3O96A 3ODXA 1M7RA 1Q67A 5KQ4A 1U5EA 2RNRB 1I2HA 2EJ8A 5GOWB 4GMVA 2RSGA 4ZRJA 3P7ZA 1WJMA 3ML4A 3PG7A 4GZUA 2DHIA 4HB0B 2CY5A 1KZGA 1MKEA 1V5MA 1ZC4B 3SUZA 1EGXA 2KUPA 2QKMA 3NWAA 2KIEA 2DKPA 2P0HA 2GJYA 4IOYX 1KI1B 4K17A 1AQCA 4XWXA 2UZRA 2ELBA 3KY9A 4F7UP 1V5UA 1WJ1A 1IRSA 2FJLA 5HE1A 2K2JA 2OTXA 2QKLA 2W2XD 3ULBA 4C0AA 3HW2B 3FSSA 3LJUX 3AU5A 4MY6A 2Z4DA 4HAXB 5D3YA 2ADZA 5FI1A 3TO1A 2DKQA 4WJ7A 1MAIA 4CYEA 5D3XA 1DBHA 2GS0A 3U7DA 1H4RA 4NSWA 4A6FA 2ELAA 2CODA 5IRSA 1WGQA 3SO6A 1U29A 3NSUA 5D27A 4YONA 3RCPA 4WSFA 1MK7B 2ZPYA 4MT7A 3M1IB 4IFSA 5D3VA 4KAXB 1ISNA 1UPRA 2D2QA 2D4QA 2YS3A 1U27A 4F7GA 1MK9B 4CSQA 4HATB 1BWNA 3QWMA 4K81A 4H8SA 3WA0A 1Y5OA 4YL8A 5LOPB 1PMSA 3TCAA 1M7EA 2Q13A 1WI1A 3ULCA 2R09A 4Y94A 5HE2A 5J3TA 4GNKB 1V89A 1W1HA 2LOXA 5C6RA 2ROVA 4A6HA 2Y7BA 2UVMA 1E5WA 2M14A 2D9XA 2DFKA 1WVHA 1MIZB 3AJ4A 1UNQA 1RJ2A 2CY4A 2M38A 2YT2A 5L81A 2LYDA 3KRXA 2LG1A 4EKUA 1DROA 1UNRA 2H7EA 4K2PA 4DIXA 2N0YA 2DHJA 2J0KA 3SNHA 4HB4B 1OY2A 4KVGB 4BBKA 3FVCA 3NW8A 1FHOA 1X86A 1SHCA 1DYNA 1ZVRA 3UZTA 2IYBA 2KIGA 1LW3A 2RGNB 3OANA 1W1DA 4MK0A 3VIAA 2UZSA 1K5GB 4GN1A 1AWEA 4PQ0A 1GG3A 3DCXA 2LOZA 1SGHA 1H10A 3MDBC 2MDXA 3ODOA 5C79A 2K49A 1I7AA 3KSYA 2P0FA 3KZ1A 4A6FB 2I5FA 3OHMB 1X11A 2J0JA 2EMSA 2XQNM 3CXBB 2IFSA 1XR0B 1ZYIA 4F7HA 3CIKA 3PZDA 5DI9B 1J19A 1FGZA 1V61A 2COFA 1GC6A 4A6KA 2E2XA 1BAKA 2BCJA 2W2XC 1X1GA 3T06A 1FHWA 2GCJA 2D10A 2X18A 1P3RA 2YSZA 3HIEA 2J0MA 2OQBA 4OT1A 3NWDA 2I1KA 5DH9B 4DXAB 5C5BB 4KHBB 2Z0OA 4HDQA 4NY0A 2DX5A 3ZVRA 2V76A 1T77A 2Z0PA 2RUKB 1TQZA 5I2MA 2EC1A 1X1FA 3B77A 5DHAB 2KR0A 1OQNA 3KRWA 5HE3A 4EMOA 4D6WA 1XCGA 4CHJA 2JP2A 5CLLB 4ZRIA 2RRFA 2YS5A 3V5WA 5C16A 2NZ8B 2YT1A 2COAA 1QC6A 1QQGA 2Y8GA 1BTNA 2P0DA 1DDMA 2NMBA 1PLSA 1ZSQA 4GXBA 1EF1A 2K2UA 3A98B 3F0WA 2LULA 1P6SA 1FGYA 2D9ZA 4QJ3B 2D9VA 1UPQA 5C5BA 4KHBA 3GYOA 4IAPA 1NU2A 1X05A 2YS1A 3DXEA 5D3WA 3PP2A 1ZC3B 3A8PA 3TFMA 1ZM0A 5JLJB 1V88A 2Y8FA 3DXDA 4HAVB 4DX90 1U2BA 4HSIA 2D9WA 4DBBA 5LONB 4QJ4B 3NWFA 2K00A 1MPHA 5M4YB 1EVHA 3DXCA 3PVLA 1MI1A 3FEHA 1GC7A 2DTCA 1N3HA 2GUMA 3QIJA 1NTVA 2COCA 3HSAA 3PVWA 2HE7A 5FI0A 1U5DA 5KQ1A 2N23A 4L6EA 4HHVA 4HAWB 4TKNA 1TXDA 2FJUB 4P7IA 4D0NB 4KHAA 4Z2NA 1WGUA 1XX0A 2Z59A 2VRWB 2W2WA 3A8QA 3BJIA 2CRFA 4ZRKA 2KCJA 4DX8A 1B55A 1FHXA 3FM8C 3ZDTA 2MFQA 5CLQB 1FAOA 2YVCA 2DYNA 2ZKMX 2AL6A 2I5CA 5DHFB 4GPTB 1KZ7A 1MIXA 3GYPA 3BINA 4L1RA 4GMXB 1NI2A 3VOQA 3HK0A 3PEGA 2L2IA 5DIFB 2YF0A 4OSNA 5JHHA 1Z87A 2KUQA 2DA0A 2DLWA 4HB2B 1W1GA 1U5FA 1WG7A 3D8EA 5HE0A 1LB1A 2P8VA 3N7CA 2H7DA 4HAUB 2R2YA 4QJ5B 4QXAB 3HQCA 1TJ6A 4HDOA 1BTKA 5J3YA 2Z13A 3G9WA 1FB8A 1XKEA 2YT0A 1V5PA 1NTYA 3D8FA 2K8EA 2RVBB 3MPXA 1U5GA 5EFXA 2D9YA 4WVFB 4HAYB 3X23A 4HB3B 4KHOA 3WYFB 4TYZA 2EMTA 3TW1A 2LKOA 1OMWA 5JHGA 2R0DA 2VSZA 3SYXA 2CAYA 2KGXB 3A58A 3AU4A 3U8ZA 2I1JA 3P6AA 4PNKA 3PVUA 2ROZB 1EAZA 1K5DB 1UNPA 1XD4A 4GOUA 5JP4A 4Z2MB 2Z0QA 3F5RA 1RRPB 1DDVA 2D11A 5I2SA 2DHKA 1Y19B 1XODA 2RLOA 1UEFA 4CHMA
chains in the Genus database with same CATH topology
3ODWA 2HTHB 4B6HA 2GCLA 2DX1A 4HAZB 2L1CA 2MKRA 5J3QA 2DYQA 1PFJA 1P5TA 2YRYA 1FOEA 3QBVB 2AEHA 3PSCA 2VKIA 4K2OA 2PZ1A 2DN6A 3IVFA 2J59M 3SV1A 2MWNB 1J0WA 1DDWA 4EJNA 2G35A 3D8DA 4A5KA 5KCVA 3TVVA 3O96A 3ODXA 1M7RA 1Q67A 5KQ4A 1U5EA 2RNRB 1I2HA 2EJ8A 5GOWB 4GMVA 2RSGA 4ZRJA 3P7ZA 1WJMA 3ML4A 3PG7A 4GZUA 2DHIA 4HB0B 2CY5A 1KZGA 1MKEA 1V5MA 1ZC4B 3SUZA 1EGXA 2KUPA 2QKMA 2DKPA 2P0HA 2GJYA 4IOYX 1KI1B 4K17A 1AQCA 4XWXA 2UZRA 2ELBA 3KY9A 4F7UP 1V5UA 1WJ1A 1IRSA 2FJLA 5HE1A 2K2JA 2OTXA 2QKLA 2W2XD 3ULBA 4C0AA 3HW2B 3FSSA 3LJUX 3AU5A 4MY6A 4HAXB 5D3YA 2ADZA 5FI1A 3TO1A 2DKQA 4WJ7A 1MAIA 4CYEA 5D3XA 1DBHA 2GS0A 3U7DA 1H4RA 4NSWA 4A6FA 2ELAA 2CODA 1WGQA 3SO6A 1U29A 3NSUA 5D27A 4YONA 3RCPA 4WSFA 1MK7B 2ZPYA 4MT7A 3M1IB 4IFSA 5D3VA 4KAXB 1ISNA 1UPRA 2D2QA 2D4QA 2YS3A 1U27A 4F7GA 1MK9B 4HATB 1BWNA 3QWMA 4K81A 4H8SA 3WA0A 1Y5OA 4YL8A 5LOPB 1PMSA 3TCAA 1M7EA 2Q13A 1WI1A 3ULCA 2R09A 4Y94A 5HE2A 5J3TA 1V89A 1W1HA 2LOXA 5C6RA 2ROVA 4A6HA 2Y7BA 2UVMA 1E5WA 2M14A 2D9XA 2DFKA 1WVHA 1MIZB 3AJ4A 1UNQA 1RJ2A 2CY4A 2M38A 5L81A 2LYDA 3KRXA 2LG1A 4EKUA 1DROA 1UNRA 2H7EA 4K2PA 2N0YA 2DHJA 2J0KA 3SNHA 4HB4B 1OY2A 4KVGB 4BBKA 1FHOA 1X86A 1SHCA 1DYNA 1ZVRA 3UZTA 2IYBA 1LW3A 2RGNB 3OANA 1W1DA 4MK0A 3VIAA 2UZSA 1K5GB 4GN1A 1AWEA 4PQ0A 1GG3A 2LOZA 1SGHA 1H10A 3MDBC 2MDXA 3ODOA 5C79A 1I7AA 3KSYA 2P0FA 3KZ1A 4A6FB 2I5FA 1X11A 2J0JA 2EMSA 2XQNM 3CXBB 2IFSA 1XR0B 4F7HA 3CIKA 3PZDA 5DI9B 1J19A 1FGZA 1V61A 2COFA 1GC6A 4A6KA 2E2XA 1BAKA 2BCJA 2W2XC 1X1GA 3T06A 1FHWA 2GCJA 2D10A 2X18A 1P3RA 2YSZA 2J0MA 2OQBA 2I1KA 5DH9B 4DXAB 5C5BB 4KHBB 2Z0OA 4HDQA 4NY0A 2DX5A 3ZVRA 2V76A 2Z0PA 2RUKB 1TQZA 2EC1A 1X1FA 5DHAB 1OQNA 3KRWA 5HE3A 4EMOA 1XCGA 4CHJA 2JP2A 5CLLB 4ZRIA 2YS5A 3V5WA 5C16A 2NZ8B 2YT1A 2COAA 1QC6A 1QQGA 2Y8GA 1BTNA 2P0DA 1DDMA 2NMBA 1PLSA 1ZSQA 4GXBA 1EF1A 2K2UA 3A98B 3F0WA 2LULA 1P6SA 1FGYA 2D9ZA 2D9VA 1UPQA 5C5BA 3GYOA 4IAPA 1NU2A 1X05A 2YS1A 3DXEA 5D3WA 3PP2A 1ZC3B 3A8PA 3TFMA 1ZM0A 5JLJB 1V88A 2Y8FA 3DXDA 4HAVB 4DX90 1U2BA 2D9WA 4DBBA 5LONB 2K00A 1MPHA 1EVHA 3DXCA 3PVLA 3FEHA 1GC7A 2DTCA 1N3HA 3QIJA 1NTVA 2COCA 3PVWA 2HE7A 5FI0A 1U5DA 5KQ1A 2N23A 4L6EA 4HHVA 4HAWB 4TKNA 1TXDA 4P7IA 4D0NB 4KHAA 4Z2NA 1WGUA 1XX0A 3A8QA 2VRWB 2W2WA 3BJIA 2CRFA 4ZRKA 2KCJA 4DX8A 1B55A 1FHXA 3FM8C 3ZDTA 2MFQA 5CLQB 1FAOA 2YVCA 2DYNA 2AL6A 2I5CA 5DHFB 4GPTB 1KZ7A 1MIXA 3GYPA 3BINA 4GMXB 1NI2A 3VOQA 3HK0A 3PEGA 2L2IA 5DIFB 2YF0A 5JHHA 1Z87A 2DA0A 2DLWA 4HB2B 1W1GA 1U5FA 1WG7A 3D8EA 5HE0A 1LB1A 2P8VA 3N7CA 2H7DA 4HAUB 3HQCA 1TJ6A 4HDOA 1BTKA 5J3YA 3G9WA 1FB8A 1XKEA 1V5PA 2YT0A 1NTYA 3D8FA 2RVBB 3MPXA 1U5GA 5EFXA 2D9YA 4WVFB 4HAYB 3X23A 4HB3B 4KHOA 3WYFB 4TYZA 2EMTA 3TW1A 2LKOA 1OMWA 5JHGA 2R0DA 2VSZA 3SYXA 2CAYA 2KGXB 3AU4A 3U8ZA 2I1JA 3P6AA 4PNKA 3PVUA 2ROZB 1EAZA 1K5DB 1UNPA 1XD4A 5JP4A 4Z2MB 2Z0QA 3F5RA 1RRPB 1DDVA 2D11A 2DHKA 1Y19B 1XODA 2RLOA 1UEFA 4CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  2HTH B;  4B6H A;  2GCL A;  2DX1 A;  4HAZ B;  2L1C A;  2MKR A;  5J3Q A;  2DYQ A;  1PFJ A;  1P5T A;  2YRY A;  1FOE A;  3QBV B;  2AEH A;  3PSC A;  2VKI A;  4K2O A;  2PZ1 A;  2DN6 A;  3IVF A;  2J59 M;  3SV1 A;  2MWN B;  1J0W A;  1DDW A;  4EJN A;  2G35 A;  3D8D A;  4A5K A;  5KCV A;  3TVV A;  3O96 A;  3ODX A;  1M7R A;  1Q67 A;  5KQ4 A;  1U5E A;  2RNR B;  1I2H A;  2EJ8 A;  5GOW B;  4GMV A;  2RSG A;  4ZRJ A;  3P7Z A;  1WJM A;  3ML4 A;  3PG7 A;  4GZU A;  2DHI A;  4HB0 B;  2CY5 A;  1KZG A;  1MKE A;  1V5M A;  1ZC4 B;  3SUZ A;  1EGX A;  2KUP A;  2QKM A;  2DKP A;  2P0H A;  2GJY A;  4IOY X;  1KI1 B;  4K17 A;  1AQC A;  4XWX A;  2UZR A;  2ELB A;  3KY9 A;  4F7U P;  1V5U A;  1WJ1 A;  1IRS A;  2FJL A;  5HE1 A;  2K2J A;  2OTX A;  2QKL A;  2W2X D;  3ULB A;  4C0A A;  3HW2 B;  3FSS A;  3LJU X;  3AU5 A;  4MY6 A;  4HAX B;  5D3Y A;  2ADZ A;  5FI1 A;  3TO1 A;  2DKQ A;  4WJ7 A;  1MAI A;  4CYE A;  5D3X A;  1DBH A;  2GS0 A;  3U7D A;  1H4R A;  4NSW A;  4A6F A;  2ELA A;  2COD A;  1WGQ A;  3SO6 A;  1U29 A;  3NSU A;  5D27 A;  4YON A;  3RCP A;  4WSF A;  1MK7 B;  2ZPY A;  4MT7 A;  3M1I B;  4IFS A;  5D3V A;  4KAX B;  1ISN A;  1UPR A;  2D2Q A;  2D4Q A;  2YS3 A;  1U27 A;  4F7G A;  1MK9 B;  4HAT B;  1BWN A;  3QWM A;  4K81 A;  4H8S A;  3WA0 A;  1Y5O A;  4YL8 A;  5LOP B;  1PMS A;  3TCA A;  1M7E A;  2Q13 A;  1WI1 A;  3ULC A;  2R09 A;  4Y94 A;  5HE2 A;  5J3T A;  1V89 A;  1W1H A;  2LOX A;  5C6R A;  2ROV A;  4A6H A;  2Y7B A;  2UVM A;  1E5W A;  2M14 A;  2D9X A;  2DFK A;  1WVH A;  1MIZ B;  3AJ4 A;  1UNQ A;  1RJ2 A;  2CY4 A;  2M38 A;  5L81 A;  2LYD A;  3KRX A;  2LG1 A;  4EKU A;  1DRO A;  1UNR A;  2H7E A;  4K2P A;  2N0Y A;  2DHJ A;  2J0K A;  3SNH A;  4HB4 B;  1OY2 A;  4KVG B;  4BBK A;  1FHO A;  1X86 A;  1SHC A;  1DYN A;  1ZVR A;  3UZT A;  2IYB A;  1LW3 A;  2RGN B;  3OAN A;  1W1D A;  4MK0 A;  3VIA A;  2UZS A;  1K5G B;  4GN1 A;  1AWE A;  4PQ0 A;  1GG3 A;  2LOZ A;  1SGH A;  1H10 A;  3MDB C;  2MDX A;  3ODO A;  5C79 A;  1I7A A;  3KSY A;  2P0F A;  3KZ1 A;  4A6F B;  2I5F A;  1X11 A;  2J0J A;  2EMS A;  2XQN M;  3CXB B;  2IFS A;  1XR0 B;  4F7H A;  3CIK A;  3PZD A;  5DI9 B;  1J19 A;  1FGZ A;  1V61 A;  2COF A;  1GC6 A;  4A6K A;  2E2X A;  1BAK A;  2BCJ A;  2W2X C;  1X1G A;  3T06 A;  1FHW A;  2GCJ A;  2D10 A;  2X18 A;  1P3R A;  2YSZ A;  2J0M A;  2OQB A;  2I1K A;  5DH9 B;  4DXA B;  5C5B B;  4KHB B;  2Z0O A;  4HDQ A;  4NY0 A;  2DX5 A;  3ZVR A;  2V76 A;  2Z0P A;  2RUK B;  1TQZ A;  2EC1 A;  1X1F A;  5DHA B;  1OQN A;  3KRW A;  5HE3 A;  4EMO A;  1XCG A;  4CHJ A;  2JP2 A;  5CLL B;  4ZRI A;  2YS5 A;  3V5W A;  5C16 A;  2NZ8 B;  2YT1 A;  2COA A;  1QC6 A;  1QQG A;  2Y8G A;  1BTN A;  2P0D A;  1DDM A;  2NMB A;  1PLS A;  1ZSQ A;  4GXB A;  1EF1 A;  2K2U A;  3A98 B;  3F0W A;  2LUL A;  1P6S A;  1FGY A;  2D9Z A;  2D9V A;  1UPQ A;  5C5B A;  3GYO A;  4IAP A;  1NU2 A;  1X05 A;  2YS1 A;  3DXE A;  5D3W A;  3PP2 A;  1ZC3 B;  3A8P A;  3TFM A;  1ZM0 A;  5JLJ B;  1V88 A;  2Y8F A;  3DXD A;  4HAV B;  4DX9 0;  1U2B A;  2D9W A;  4DBB A;  5LON B;  2K00 A;  1MPH A;  1EVH A;  3DXC A;  3PVL A;  3FEH A;  1GC7 A;  2DTC A;  1N3H A;  3QIJ A;  1NTV A;  2COC A;  3PVW A;  2HE7 A;  5FI0 A;  1U5D A;  5KQ1 A;  2N23 A;  4L6E A;  4HHV A;  4HAW B;  4TKN A;  1TXD A;  4P7I A;  4D0N B;  4KHA A;  4Z2N A;  1WGU A;  1XX0 A;  3A8Q A;  2VRW B;  2W2W A;  3BJI A;  2CRF A;  4ZRK A;  2KCJ A;  4DX8 A;  1B55 A;  1FHX A;  3FM8 C;  3ZDT A;  2MFQ A;  5CLQ B;  1FAO A;  2YVC A;  2DYN A;  2AL6 A;  2I5C A;  5DHF B;  4GPT B;  1KZ7 A;  1MIX A;  3GYP A;  3BIN A;  4GMX B;  1NI2 A;  3VOQ A;  3HK0 A;  3PEG A;  2L2I A;  5DIF B;  2YF0 A;  5JHH A;  1Z87 A;  2DA0 A;  2DLW A;  4HB2 B;  1W1G A;  1U5F A;  1WG7 A;  3D8E A;  5HE0 A;  1LB1 A;  2P8V A;  3N7C A;  2H7D A;  4HAU B;  3HQC A;  1TJ6 A;  4HDO A;  1BTK A;  5J3Y A;  3G9W A;  1FB8 A;  1XKE A;  1V5P A;  2YT0 A;  1NTY A;  3D8F A;  2RVB B;  3MPX A;  1U5G A;  5EFX A;  2D9Y A;  4WVF B;  4HAY B;  3X23 A;  4HB3 B;  4KHO A;  3WYF B;  4TYZ A;  2EMT A;  3TW1 A;  2LKO A;  1OMW A;  5JHG A;  2R0D A;  2VSZ A;  3SYX A;  2CAY A;  2KGX B;  3AU4 A;  3U8Z A;  2I1J A;  3P6A A;  4PNK A;  3PVU A;  2ROZ B;  1EAZ A;  1K5D B;  1UNP A;  1XD4 A;  5JP4 A;  4Z2M B;  2Z0Q A;  3F5R A;  1RRP B;  1DDV A;  2D11 A;  2DHK A;  1Y19 B;  1XOD A;  2RLO A;  1UEF A;  4CHM A; 
#chains in the Genus database with same CATH topology
 3ODW A;  2HTH B;  4B6H A;  2GCL A;  2DX1 A;  4HAZ B;  2L1C A;  2MKR A;  5J3Q A;  2DYQ A;  3U12 A;  1PFJ A;  1P5T A;  2YRY A;  1FOE A;  3QBV B;  2AEH A;  2NBV A;  3PSC A;  2VKI A;  4K2O A;  2PZ1 A;  2DN6 A;  3IVF A;  2J59 M;  5LG4 B;  2Z14 A;  3SV1 A;  2MWN B;  1J0W A;  1DDW A;  4EJN A;  2G35 A;  3D8D A;  4A5K A;  5KCV A;  3TVV A;  3O96 A;  3ODX A;  1M7R A;  1Q67 A;  5KQ4 A;  1U5E A;  2RNR B;  1I2H A;  2EJ8 A;  5GOW B;  4GMV A;  2RSG A;  4ZRJ A;  3P7Z A;  1WJM A;  3ML4 A;  3PG7 A;  4GZU A;  2DHI A;  4HB0 B;  2CY5 A;  1KZG A;  1MKE A;  1V5M A;  1ZC4 B;  3SUZ A;  1EGX A;  2KUP A;  2QKM A;  3NWA A;  2KIE A;  2DKP A;  2P0H A;  2GJY A;  4IOY X;  1KI1 B;  4K17 A;  1AQC A;  4XWX A;  2UZR A;  2ELB A;  3KY9 A;  4F7U P;  1V5U A;  1WJ1 A;  1IRS A;  2FJL A;  5HE1 A;  2K2J A;  2OTX A;  2QKL A;  2W2X D;  3ULB A;  4C0A A;  3HW2 B;  3FSS A;  3LJU X;  3AU5 A;  4MY6 A;  2Z4D A;  4HAX B;  5D3Y A;  2ADZ A;  5FI1 A;  3TO1 A;  2DKQ A;  4WJ7 A;  1MAI A;  4CYE A;  5D3X A;  1DBH A;  2GS0 A;  3U7D A;  1H4R A;  4NSW A;  4A6F A;  2ELA A;  2COD A;  5IRS A;  1WGQ A;  3SO6 A;  1U29 A;  3NSU A;  5D27 A;  4YON A;  3RCP A;  4WSF A;  1MK7 B;  2ZPY A;  4MT7 A;  3M1I B;  4IFS A;  5D3V A;  4KAX B;  1ISN A;  1UPR A;  2D2Q A;  2D4Q A;  2YS3 A;  1U27 A;  4F7G A;  1MK9 B;  4CSQ A;  4HAT B;  1BWN A;  3QWM A;  4K81 A;  4H8S A;  3WA0 A;  1Y5O A;  4YL8 A;  5LOP B;  1PMS A;  3TCA A;  1M7E A;  2Q13 A;  1WI1 A;  3ULC A;  2R09 A;  4Y94 A;  5HE2 A;  5J3T A;  4GNK B;  1V89 A;  1W1H A;  2LOX A;  5C6R A;  2ROV A;  4A6H A;  2Y7B A;  2UVM A;  1E5W A;  2M14 A;  2D9X A;  2DFK A;  1WVH A;  1MIZ B;  3AJ4 A;  1UNQ A;  1RJ2 A;  2CY4 A;  2M38 A;  2YT2 A;  5L81 A;  2LYD A;  3KRX A;  2LG1 A;  4EKU A;  1DRO A;  1UNR A;  2H7E A;  4K2P A;  4DIX A;  2N0Y A;  2DHJ A;  2J0K A;  3SNH A;  4HB4 B;  1OY2 A;  4KVG B;  4BBK A;  3FVC A;  3NW8 A;  1FHO A;  1X86 A;  1SHC A;  1DYN A;  1ZVR A;  3UZT A;  2IYB A;  2KIG A;  1LW3 A;  2RGN B;  3OAN A;  1W1D A;  4MK0 A;  3VIA A;  2UZS A;  1K5G B;  4GN1 A;  1AWE A;  4PQ0 A;  1GG3 A;  3DCX A;  2LOZ A;  1SGH A;  1H10 A;  3MDB C;  2MDX A;  3ODO A;  5C79 A;  2K49 A;  1I7A A;  3KSY A;  2P0F A;  3KZ1 A;  4A6F B;  2I5F A;  3OHM B;  1X11 A;  2J0J A;  2EMS A;  2XQN M;  3CXB B;  2IFS A;  1XR0 B;  1ZYI A;  4F7H A;  3CIK A;  3PZD A;  5DI9 B;  1J19 A;  1FGZ A;  1V61 A;  2COF A;  1GC6 A;  4A6K A;  2E2X A;  1BAK A;  2BCJ A;  2W2X C;  1X1G A;  3T06 A;  1FHW A;  2GCJ A;  2D10 A;  2X18 A;  1P3R A;  2YSZ A;  3HIE A;  2J0M A;  2OQB A;  4OT1 A;  3NWD A;  2I1K A;  5DH9 B;  4DXA B;  5C5B B;  4KHB B;  2Z0O A;  4HDQ A;  4NY0 A;  2DX5 A;  3ZVR A;  2V76 A;  1T77 A;  2Z0P A;  2RUK B;  1TQZ A;  5I2M A;  2EC1 A;  1X1F A;  3B77 A;  5DHA B;  2KR0 A;  1OQN A;  3KRW A;  5HE3 A;  4EMO A;  4D6W A;  1XCG A;  4CHJ A;  2JP2 A;  5CLL B;  4ZRI A;  2RRF A;  2YS5 A;  3V5W A;  5C16 A;  2NZ8 B;  2YT1 A;  2COA A;  1QC6 A;  1QQG A;  2Y8G A;  1BTN A;  2P0D A;  1DDM A;  2NMB A;  1PLS A;  1ZSQ A;  4GXB A;  1EF1 A;  2K2U A;  3A98 B;  3F0W A;  2LUL A;  1P6S A;  1FGY A;  2D9Z A;  4QJ3 B;  2D9V A;  1UPQ A;  5C5B A;  4KHB A;  3GYO A;  4IAP A;  1NU2 A;  1X05 A;  2YS1 A;  3DXE A;  5D3W A;  3PP2 A;  1ZC3 B;  3A8P A;  3TFM A;  1ZM0 A;  5JLJ B;  1V88 A;  2Y8F A;  3DXD A;  4HAV B;  4DX9 0;  1U2B A;  4HSI A;  2D9W A;  4DBB A;  5LON B;  4QJ4 B;  3NWF A;  2K00 A;  1MPH A;  5M4Y B;  1EVH A;  3DXC A;  3PVL A;  1MI1 A;  3FEH A;  1GC7 A;  2DTC A;  1N3H A;  2GUM A;  3QIJ A;  1NTV A;  2COC A;  3HSA A;  3PVW A;  2HE7 A;  5FI0 A;  1U5D A;  5KQ1 A;  2N23 A;  4L6E A;  4HHV A;  4HAW B;  4TKN A;  1TXD A;  2FJU B;  4P7I A;  4D0N B;  4KHA A;  4Z2N A;  1WGU A;  1XX0 A;  2Z59 A;  2VRW B;  2W2W A;  3A8Q A;  3BJI A;  2CRF A;  4ZRK A;  2KCJ A;  4DX8 A;  1B55 A;  1FHX A;  3FM8 C;  3ZDT A;  2MFQ A;  5CLQ B;  1FAO A;  2YVC A;  2DYN A;  2ZKM X;  2AL6 A;  2I5C A;  5DHF B;  4GPT B;  1KZ7 A;  1MIX A;  3GYP A;  3BIN A;  4L1R A;  4GMX B;  1NI2 A;  3VOQ A;  3HK0 A;  3PEG A;  2L2I A;  5DIF B;  2YF0 A;  4OSN A;  5JHH A;  1Z87 A;  2KUQ A;  2DA0 A;  2DLW A;  4HB2 B;  1W1G A;  1U5F A;  1WG7 A;  3D8E A;  5HE0 A;  1LB1 A;  2P8V A;  3N7C A;  2H7D A;  4HAU B;  2R2Y A;  4QJ5 B;  4QXA B;  3HQC A;  1TJ6 A;  4HDO A;  1BTK A;  5J3Y A;  2Z13 A;  3G9W A;  1FB8 A;  1XKE A;  2YT0 A;  1V5P A;  1NTY A;  3D8F A;  2K8E A;  2RVB B;  3MPX A;  1U5G A;  5EFX A;  2D9Y A;  4WVF B;  4HAY B;  3X23 A;  4HB3 B;  4KHO A;  3WYF B;  4TYZ A;  2EMT A;  3TW1 A;  2LKO A;  1OMW A;  5JHG A;  2R0D A;  2VSZ A;  3SYX A;  2CAY A;  2KGX B;  3A58 A;  3AU4 A;  3U8Z A;  2I1J A;  3P6A A;  4PNK A;  3PVU A;  2ROZ B;  1EAZ A;  1K5D B;  1UNP A;  1XD4 A;  4GOU A;  5JP4 A;  4Z2M B;  2Z0Q A;  3F5R A;  1RRP B;  1DDV A;  2D11 A;  5I2S A;  2DHK A;  1Y19 B;  1XOD A;  2RLO A;  1UEF A;  4CHM A; 
#chains in the Genus database with same CATH homology
 3ODW A;  2HTH B;  4B6H A;  2GCL A;  2DX1 A;  4HAZ B;  2L1C A;  2MKR A;  5J3Q A;  2DYQ A;  1PFJ A;  1P5T A;  2YRY A;  1FOE A;  3QBV B;  2AEH A;  3PSC A;  2VKI A;  4K2O A;  2PZ1 A;  2DN6 A;  3IVF A;  2J59 M;  3SV1 A;  2MWN B;  1J0W A;  1DDW A;  4EJN A;  2G35 A;  3D8D A;  4A5K A;  5KCV A;  3TVV A;  3O96 A;  3ODX A;  1M7R A;  1Q67 A;  5KQ4 A;  1U5E A;  2RNR B;  1I2H A;  2EJ8 A;  5GOW B;  4GMV A;  2RSG A;  4ZRJ A;  3P7Z A;  1WJM A;  3ML4 A;  3PG7 A;  4GZU A;  2DHI A;  4HB0 B;  2CY5 A;  1KZG A;  1MKE A;  1V5M A;  1ZC4 B;  3SUZ A;  1EGX A;  2KUP A;  2QKM A;  2DKP A;  2P0H A;  2GJY A;  4IOY X;  1KI1 B;  4K17 A;  1AQC A;  4XWX A;  2UZR A;  2ELB A;  3KY9 A;  4F7U P;  1V5U A;  1WJ1 A;  1IRS A;  2FJL A;  5HE1 A;  2K2J A;  2OTX A;  2QKL A;  2W2X D;  3ULB A;  4C0A A;  3HW2 B;  3FSS A;  3LJU X;  3AU5 A;  4MY6 A;  4HAX B;  5D3Y A;  2ADZ A;  5FI1 A;  3TO1 A;  2DKQ A;  4WJ7 A;  1MAI A;  4CYE A;  5D3X A;  1DBH A;  2GS0 A;  3U7D A;  1H4R A;  4NSW A;  4A6F A;  2ELA A;  2COD A;  1WGQ A;  3SO6 A;  1U29 A;  3NSU A;  5D27 A;  4YON A;  3RCP A;  4WSF A;  1MK7 B;  2ZPY A;  4MT7 A;  3M1I B;  4IFS A;  5D3V A;  4KAX B;  1ISN A;  1UPR A;  2D2Q A;  2D4Q A;  2YS3 A;  1U27 A;  4F7G A;  1MK9 B;  4HAT B;  1BWN A;  3QWM A;  4K81 A;  4H8S A;  3WA0 A;  1Y5O A;  4YL8 A;  5LOP B;  1PMS A;  3TCA A;  1M7E A;  2Q13 A;  1WI1 A;  3ULC A;  2R09 A;  4Y94 A;  5HE2 A;  5J3T A;  1V89 A;  1W1H A;  2LOX A;  5C6R A;  2ROV A;  4A6H A;  2Y7B A;  2UVM A;  1E5W A;  2M14 A;  2D9X A;  2DFK A;  1WVH A;  1MIZ B;  3AJ4 A;  1UNQ A;  1RJ2 A;  2CY4 A;  2M38 A;  5L81 A;  2LYD A;  3KRX A;  2LG1 A;  4EKU A;  1DRO A;  1UNR A;  2H7E A;  4K2P A;  2N0Y A;  2DHJ A;  2J0K A;  3SNH A;  4HB4 B;  1OY2 A;  4KVG B;  4BBK A;  1FHO A;  1X86 A;  1SHC A;  1DYN A;  1ZVR A;  3UZT A;  2IYB A;  1LW3 A;  2RGN B;  3OAN A;  1W1D A;  4MK0 A;  3VIA A;  2UZS A;  1K5G B;  4GN1 A;  1AWE A;  4PQ0 A;  1GG3 A;  2LOZ A;  1SGH A;  1H10 A;  3MDB C;  2MDX A;  3ODO A;  5C79 A;  1I7A A;  3KSY A;  2P0F A;  3KZ1 A;  4A6F B;  2I5F A;  1X11 A;  2J0J A;  2EMS A;  2XQN M;  3CXB B;  2IFS A;  1XR0 B;  4F7H A;  3CIK A;  3PZD A;  5DI9 B;  1J19 A;  1FGZ A;  1V61 A;  2COF A;  1GC6 A;  4A6K A;  2E2X A;  1BAK A;  2BCJ A;  2W2X C;  1X1G A;  3T06 A;  1FHW A;  2GCJ A;  2D10 A;  2X18 A;  1P3R A;  2YSZ A;  2J0M A;  2OQB A;  2I1K A;  5DH9 B;  4DXA B;  5C5B B;  4KHB B;  2Z0O A;  4HDQ A;  4NY0 A;  2DX5 A;  3ZVR A;  2V76 A;  2Z0P A;  2RUK B;  1TQZ A;  2EC1 A;  1X1F A;  5DHA B;  1OQN A;  3KRW A;  5HE3 A;  4EMO A;  1XCG A;  4CHJ A;  2JP2 A;  5CLL B;  4ZRI A;  2YS5 A;  3V5W A;  5C16 A;  2NZ8 B;  2YT1 A;  2COA A;  1QC6 A;  1QQG A;  2Y8G A;  1BTN A;  2P0D A;  1DDM A;  2NMB A;  1PLS A;  1ZSQ A;  4GXB A;  1EF1 A;  2K2U A;  3A98 B;  3F0W A;  2LUL A;  1P6S A;  1FGY A;  2D9Z A;  2D9V A;  1UPQ A;  5C5B A;  3GYO A;  4IAP A;  1NU2 A;  1X05 A;  2YS1 A;  3DXE A;  5D3W A;  3PP2 A;  1ZC3 B;  3A8P A;  3TFM A;  1ZM0 A;  5JLJ B;  1V88 A;  2Y8F A;  3DXD A;  4HAV B;  4DX9 0;  1U2B A;  2D9W A;  4DBB A;  5LON B;  2K00 A;  1MPH A;  1EVH A;  3DXC A;  3PVL A;  3FEH A;  1GC7 A;  2DTC A;  1N3H A;  3QIJ A;  1NTV A;  2COC A;  3PVW A;  2HE7 A;  5FI0 A;  1U5D A;  5KQ1 A;  2N23 A;  4L6E A;  4HHV A;  4HAW B;  4TKN A;  1TXD A;  4P7I A;  4D0N B;  4KHA A;  4Z2N A;  1WGU A;  1XX0 A;  3A8Q A;  2VRW B;  2W2W A;  3BJI A;  2CRF A;  4ZRK A;  2KCJ A;  4DX8 A;  1B55 A;  1FHX A;  3FM8 C;  3ZDT A;  2MFQ A;  5CLQ B;  1FAO A;  2YVC A;  2DYN A;  2AL6 A;  2I5C A;  5DHF B;  4GPT B;  1KZ7 A;  1MIX A;  3GYP A;  3BIN A;  4GMX B;  1NI2 A;  3VOQ A;  3HK0 A;  3PEG A;  2L2I A;  5DIF B;  2YF0 A;  5JHH A;  1Z87 A;  2DA0 A;  2DLW A;  4HB2 B;  1W1G A;  1U5F A;  1WG7 A;  3D8E A;  5HE0 A;  1LB1 A;  2P8V A;  3N7C A;  2H7D A;  4HAU B;  3HQC A;  1TJ6 A;  4HDO A;  1BTK A;  5J3Y A;  3G9W A;  1FB8 A;  1XKE A;  1V5P A;  2YT0 A;  1NTY A;  3D8F A;  2RVB B;  3MPX A;  1U5G A;  5EFX A;  2D9Y A;  4WVF B;  4HAY B;  3X23 A;  4HB3 B;  4KHO A;  3WYF B;  4TYZ A;  2EMT A;  3TW1 A;  2LKO A;  1OMW A;  5JHG A;  2R0D A;  2VSZ A;  3SYX A;  2CAY A;  2KGX B;  3AU4 A;  3U8Z A;  2I1J A;  3P6A A;  4PNK A;  3PVU A;  2ROZ B;  1EAZ A;  1K5D B;  1UNP A;  1XD4 A;  5JP4 A;  4Z2M B;  2Z0Q A;  3F5R A;  1RRP B;  1DDV A;  2D11 A;  2DHK A;  1Y19 B;  1XOD A;  2RLO A;  1UEF A;  4CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...