2YS5A

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor substrate 3
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys5A01
1OQNA 2GS0A 4A6FB 4A6KA 1RRPB 1XX0A 5FI0A 3F0WA 3ODWA 3WYFB 1H10A 1SHCA 4GXBA 1ZM0A 5DH9B 4KVGB 3QIJA 3GYOA 3VIAA 4WVFB 1K5DB 2CY4A 5FI1A 5KQ1A 5D3XA 1DYNA 1X05A 3OANA 2ADZA 1K5GB 4EJNA 1E5WA 2E2XA 3AJ4A 3SNHA 5D3YA 3KZ1A 2Z0QA 2KGXB 2L2IA 1UNQA 2L1CA 1XD4A 2YSZA 1V5PA 4HAWB 3FEHA 1SGHA 4WJ7A 1V5MA 4GZUA 3KRXA 5D3WA 1BWNA 2Z0PA 1AWEA 3T06A 1J0WA 4PNKA 1MAIA 3SV1A 2MWNB 3BINA 4NSWA 1FB8A 1B55A 4IAPA 5HE3A 4ZRIA 1ZC4B 3SYXA 1U5FA 1WGUA 4K17A 4A6HA 2LYDA 2N23A 1EF1A 4A6FA 2RGNB 2GCJA 2Q13A 1UNPA 4HDOA 4MT7A 1XR0B 1X86A 2ELBA 2GJYA 2DYNA 4KHOA 5L81A 3TCAA 3QWMA 2QKLA 3A98B 4K2PA 2KUPA 1DBHA 1I2HA 4GMVA 1KZ7A 5C16A 4DXAB 2CY5A 2HTHB 2D9VA 5J3TA 1X1GA 1MKEA 2P0FA 1Y19B 2DN6A 3HK0A 2MKRA 2G35A 4IFSA 2COFA 4HB0B 2XQNM 5C79A 1J19A 4PQ0A 2D9WA 2QKMA 2YT1A 2K2JA 2ROVA 3LJUX 4MK0A 2M38A 3SUZA 2DHKA 2COCA 1TXDA 1P5TA 5D27A 3TO1A 1FHWA 1H4RA 1V5UA 1WJ1A 2Y8GA 1Y5OA 4CHMA 1KI1B 1EGXA 1FGZA 1WGQA 3BJIA 1PMSA 4YL8A 1DROA 3D8FA 1EAZA 2YRYA 3X23A 3A8QA 1X11A 3U8ZA 5DI9B 3KSYA 1Q67A 5LONB 2DX1A 1X1FA 4DX8A 2UZSA 1V88A 1OY2A 2MFQA 3SO6A 2DLWA 1V89A 3GYPA 3ODOA 3G9WA 1WJMA 3ODXA 1W1GA 2IFSA 3DXCA 4KAXB 1I7AA 4MY6A 2BCJA 5JLJB 2LOZA 3AU5A 5C5BB 2DHIA 2I1KA 2DKPA 2FJLA 2VRWB 1BAKA 2CRFA 4GPTB 3WA0A 4GMXB 4HB2B 2J59M 1FOEA 2VKIA 3ULBA 1GC6A 2D11A 2NZ8B 4Y94A 4HAUB 2DFKA 1NI2A 3HQCA 2Y8FA 1XODA 4GN1A 1FAOA 2JP2A 3F5RA 2DKQA 2I1JA 3AU4A 4D0NB 1KZGA 3ML4A 3FSSA 4HHVA 2H7DA 3RCPA 2H7EA 2R09A 4NY0A 1W1DA 4WSFA 2N0YA 2YF0A 2D9YA 3N7CA 4HAYB 3NSUA 3U7DA 4F7GA 1IRSA 1UEFA 4EMOA 2YS5A 3ZDTA 5HE0A 2EMTA 1EVHA 1ZC3B 5DHAB 2I5FA 4F7UP 1XKEA 1NU2A 3CIKA 1WI1A 2EJ8A 3PEGA 1QC6A 2YS1A 2UZRA 3UZTA 4DX90 1WVHA 4H8SA 1LW3A 4HAZB 2P8VA 4IOYX 3MDBC 2PZ1A 4L6EA 3HW2B 4B6HA 5DIFB 5LOPB 2K2UA 2HE7A 4HAXB 1U29A 2D2QA 1AQCA 2CAYA 2DHJA 3FM8C 2J0JA 2VSZA 2YT0A 4HB4B 4CYEA 2Y7BA 3PP2A 2D9ZA 2DYQA 2AEHA 5CLLB 4KHBB 5D3VA 3DXDA 5C6RA 2LG1A 2W2XD 3D8EA 1BTKA 2DTCA 5HE1A 5HE2A 3O96A 4YONA 1UPRA 4ZRKA 4BBKA 1ZVRA 4HB3B 3PSCA 1PLSA 3CXBB 3TW1A 3PG7A 5CLQB 1MIZB 2DX5A 2OQBA 2GCLA 1MK7B 1ISNA 4HAVB 1UPQA 1P6SA 5KQ4A 3KRWA 1U5GA 1OMWA 2Z0OA 3PVLA 2J0KA 5JHGA 5J3YA 2RLOA 3KY9A 2D4QA 1MK9B 2M14A 2KCJA 2RUKB 1FHXA 5J3QA 1UNRA 1P3RA 4ZRJA 4EKUA 2K00A 2X18A 1LB1A 4XWXA 4TYZA 3TVVA 5DHFB 2NMBA 1XCGA 1GG3A 3MPXA 1RJ2A 3PVWA 1DDVA 2RSGA 2IYBA 4Z2NA 3VOQA 3ULCA 1U2BA 4K81A 1BTNA 4HDQA 2DA0A 3A8PA 2ROZB 2LULA 4CHJA 2EMSA 4TKNA 1M7EA 4A5KA 2YVCA 4HATB 1TQZA 2UVMA 3PZDA 2EC1A 5C5BA 3V5WA 2RNRB 2COAA 1WG7A 4KHAA 2MDXA 3DXEA 4P7IA 2V76A 2I5CA 1N3HA 2ELAA 2W2XC 2P0DA 3P6AA 2ZPYA 1FHOA 2D9XA 2YS3A 3D8DA 1MPHA 3M1IB 2P0HA 1W1HA 1FGYA 1TJ6A 5EFXA 1MIXA 2CODA 1ZSQA 1NTVA 1Z87A 5GOWB 1GC7A 1U5EA 2RVBB 1U27A 3TFMA 2W2WA 2J0MA 3QBVB 1DDMA 4Z2MB 3P7ZA 4C0AA 1QQGA 3ZVRA 4DBBA 5KCVA 1U5DA 2LKOA 3IVFA 3PVUA 4F7HA 1PFJA 1M7RA 2D10A 4K2OA 1NTYA 2AL6A 5JHHA 5JP4A 1V61A 2R0DA 1DDWA 2OTXA 2LOXA
chains in the Genus database with same CATH superfamily
2Z59A 1OQNA 2GS0A 4A6FB 4A6KA 1RRPB 1XX0A 5FI0A 3F0WA 3ODWA 3WYFB 1H10A 1SHCA 4GXBA 1ZM0A 4D6WA 4QJ5B 5DH9B 4KVGB 3QIJA 3GYOA 3VIAA 4WVFB 1K5DB 2CY4A 5FI1A 5KQ1A 5D3XA 1DYNA 1X05A 3OANA 2ADZA 1K5GB 4EJNA 1E5WA 2E2XA 2FJUB 3AJ4A 3SNHA 5D3YA 3KZ1A 2Z0QA 2KGXB 2KIEA 2L2IA 1UNQA 2L1CA 1XD4A 2K8EA 2YSZA 4GOUA 1V5PA 4HAWB 3FEHA 1SGHA 4WJ7A 1V5MA 4GZUA 3HSAA 3KRXA 5D3WA 1BWNA 2Z0PA 1AWEA 3T06A 1J0WA 4PNKA 1MAIA 3SV1A 2MWNB 3BINA 4NSWA 1FB8A 1B55A 4IAPA 5HE3A 4ZRIA 1ZC4B 3SYXA 1U5FA 1WGUA 4K17A 4A6HA 2LYDA 2N23A 1EF1A 4A6FA 2RGNB 2GCJA 2Q13A 1UNPA 4HDOA 4MT7A 1XR0B 2KR0A 4HSIA 1X86A 2ZKMX 2ELBA 2GJYA 2DYNA 4KHOA 5L81A 3TCAA 3QWMA 2QKLA 3A98B 4K2PA 2KUPA 1DBHA 1I2HA 4GMVA 1KZ7A 5C16A 4DXAB 2CY5A 2HTHB 2D9VA 5J3TA 1X1GA 1MKEA 2P0FA 1Y19B 2DN6A 3HK0A 2MKRA 2G35A 4IFSA 2COFA 4HB0B 2XQNM 2Z14A 1J19A 5C79A 4PQ0A 2D9WA 3NWAA 2QKMA 2YT1A 2K2JA 2ROVA 3LJUX 4MK0A 2M38A 3SUZA 2DHKA 2COCA 1TXDA 1ZYIA 1P5TA 5D27A 3TO1A 1FHWA 1H4RA 1V5UA 1WJ1A 2Y8GA 1Y5OA 4CHMA 1KI1B 1EGXA 1FGZA 1WGQA 3BJIA 1PMSA 4YL8A 1DROA 3D8FA 1EAZA 2YRYA 3X23A 3A8QA 1X11A 3U8ZA 5DI9B 3KSYA 1Q67A 5LONB 2DX1A 1X1FA 4DX8A 2UZSA 1V88A 1OY2A 2MFQA 3SO6A 5I2SA 2DLWA 1V89A 3GYPA 3ODOA 3G9WA 1WJMA 3ODXA 1W1GA 2IFSA 3DXCA 4KAXB 1I7AA 4MY6A 2BCJA 5JLJB 2LOZA 3AU5A 5C5BB 2DHIA 2I1KA 2DKPA 4DIXA 2FJLA 2VRWB 3NWDA 2CRFA 4GPTB 1BAKA 3WA0A 4GMXB 4HB2B 2J59M 1FOEA 2VKIA 3ULBA 1GC6A 2D11A 2NZ8B 4Y94A 4HAUB 2DFKA 1NI2A 3HQCA 2Y8FA 1XODA 4GN1A 1FAOA 2JP2A 3F5RA 2DKQA 2I1JA 3AU4A 4D0NB 1KZGA 3ML4A 3FSSA 4HHVA 2H7DA 3RCPA 2H7EA 2R09A 4NY0A 1W1DA 4WSFA 2N0YA 2YF0A 4GNKB 2D9YA 3N7CA 4HAYB 3NSUA 3U7DA 4F7GA 1IRSA 1UEFA 4EMOA 2YS5A 3ZDTA 5HE0A 2EMTA 1EVHA 1ZC3B 5DHAB 2I5FA 4F7UP 1XKEA 1NU2A 3CIKA 1WI1A 2EJ8A 3PEGA 3OHMB 1QC6A 2YS1A 2UZRA 3UZTA 4DX90 1WVHA 4H8SA 1LW3A 4HAZB 2P8VA 4IOYX 3MDBC 2PZ1A 4L6EA 3HW2B 4B6HA 5DIFB 5LOPB 2K2UA 2HE7A 4HAXB 1U29A 2D2QA 1AQCA 2CAYA 2DHJA 3FM8C 2KIGA 2J0JA 2VSZA 2YT0A 4HB4B 4CYEA 2NBVA 2Y7BA 3PP2A 2D9ZA 2DYQA 2AEHA 5CLLB 4KHBB 5D3VA 4CSQA 3DXDA 5C6RA 2LG1A 2W2XD 3D8EA 1BTKA 2YT2A 2DTCA 5HE1A 5HE2A 3O96A 4YONA 1UPRA 4ZRKA 4BBKA 1ZVRA 4QXAB 5IRSA 4HB3B 3PSCA 1PLSA 3CXBB 3TW1A 3PG7A 5CLQB 1MIZB 2DX5A 2OQBA 2GCLA 1MK7B 3U12A 1ISNA 4HAVB 1UPQA 1P6SA 5KQ4A 3KRWA 1U5GA 3HIEA 1OMWA 2Z0OA 3PVLA 5M4YB 2J0KA 5JHGA 5J3YA 2RLOA 3KY9A 2D4QA 1MK9B 2M14A 2KCJA 2RUKB 1FHXA 5J3QA 1UNRA 1P3RA 4ZRJA 4EKUA 2K00A 4OT1A 2X18A 1LB1A 4XWXA 4TYZA 3TVVA 2K49A 5DHFB 2NMBA 4KHBA 1XCGA 2Z13A 1GG3A 3MPXA 1RJ2A 3PVWA 1DDVA 2RSGA 2IYBA 4Z2NA 3VOQA 3ULCA 1U2BA 4K81A 1BTNA 4HDQA 2DA0A 3NWFA 3A8PA 2ROZB 2LULA 1T77A 4CHJA 2EMSA 5LG4B 4TKNA 3B77A 1M7EA 3FVCA 4A5KA 2KUQA 5I2MA 2YVCA 4HATB 1TQZA 2UVMA 4OSNA 3PZDA 2EC1A 5C5BA 3V5WA 2RNRB 2COAA 1WG7A 4KHAA 2MDXA 3DXEA 4P7IA 2V76A 2GUMA 2I5CA 1N3HA 2ELAA 2W2XC 2P0DA 3P6AA 2ZPYA 1FHOA 2D9XA 2YS3A 3D8DA 1MPHA 3M1IB 2P0HA 1W1HA 1FGYA 1TJ6A 5EFXA 1MIXA 2CODA 1ZSQA 1NTVA 2R2YA 1Z87A 5GOWB 1GC7A 1U5EA 2RVBB 1U27A 3TFMA 2W2WA 2J0MA 3QBVB 1DDMA 4Z2MB 4QJ4B 3P7ZA 4C0AA 1QQGA 4QJ3B 3ZVRA 4DBBA 3DCXA 2Z4DA 5KCVA 1U5DA 2LKOA 3IVFA 3PVUA 4F7HA 1PFJA 1M7RA 1MI1A 2D10A 3A58A 4L1RA 4K2OA 1NTYA 3NW8A 2AL6A 5JHHA 5JP4A 1V61A 2R0DA 2RRFA 1DDWA 2OTXA 2LOXA
chains in the Genus database with same CATH topology
1OQNA 2GS0A 4A6FB 4A6KA 1RRPB 1XX0A 5FI0A 3F0WA 3ODWA 3WYFB 1H10A 1SHCA 4GXBA 1ZM0A 5DH9B 4KVGB 3QIJA 3GYOA 3VIAA 4WVFB 1K5DB 2CY4A 5FI1A 5KQ1A 5D3XA 1DYNA 1X05A 3OANA 2ADZA 1K5GB 4EJNA 1E5WA 2E2XA 3AJ4A 3SNHA 5D3YA 3KZ1A 2Z0QA 2KGXB 2L2IA 1UNQA 2L1CA 1XD4A 2YSZA 1V5PA 4HAWB 3FEHA 1SGHA 4WJ7A 1V5MA 4GZUA 3KRXA 5D3WA 1BWNA 2Z0PA 1AWEA 3T06A 1J0WA 4PNKA 1MAIA 3SV1A 2MWNB 3BINA 4NSWA 1FB8A 1B55A 4IAPA 5HE3A 4ZRIA 1ZC4B 3SYXA 1U5FA 1WGUA 4K17A 4A6HA 2LYDA 2N23A 1EF1A 4A6FA 2RGNB 2GCJA 2Q13A 1UNPA 4HDOA 4MT7A 1XR0B 1X86A 2ELBA 2GJYA 2DYNA 4KHOA 5L81A 3TCAA 3QWMA 2QKLA 3A98B 4K2PA 2KUPA 1DBHA 1I2HA 4GMVA 1KZ7A 5C16A 4DXAB 2CY5A 2HTHB 2D9VA 5J3TA 1X1GA 1MKEA 2P0FA 1Y19B 2DN6A 3HK0A 2MKRA 2G35A 4IFSA 2COFA 4HB0B 2XQNM 5C79A 1J19A 4PQ0A 2D9WA 2QKMA 2YT1A 2K2JA 2ROVA 3LJUX 4MK0A 2M38A 3SUZA 2DHKA 2COCA 1TXDA 1P5TA 5D27A 3TO1A 1FHWA 1H4RA 1V5UA 1WJ1A 2Y8GA 1Y5OA 4CHMA 1KI1B 1EGXA 1FGZA 1WGQA 3BJIA 1PMSA 4YL8A 1DROA 3D8FA 1EAZA 2YRYA 3X23A 3A8QA 1X11A 3U8ZA 5DI9B 3KSYA 1Q67A 5LONB 2DX1A 1X1FA 4DX8A 2UZSA 1V88A 1OY2A 2MFQA 3SO6A 2DLWA 1V89A 3GYPA 3ODOA 3G9WA 1WJMA 3ODXA 1W1GA 2IFSA 3DXCA 4KAXB 1I7AA 4MY6A 2BCJA 5JLJB 2LOZA 3AU5A 5C5BB 2DHIA 2I1KA 2DKPA 2FJLA 2VRWB 1BAKA 2CRFA 4GPTB 3WA0A 4GMXB 4HB2B 2J59M 1FOEA 2VKIA 3ULBA 1GC6A 2D11A 2NZ8B 4Y94A 4HAUB 2DFKA 1NI2A 3HQCA 2Y8FA 1XODA 4GN1A 1FAOA 2JP2A 3F5RA 2DKQA 2I1JA 3AU4A 4D0NB 1KZGA 3ML4A 3FSSA 4HHVA 2H7DA 3RCPA 2H7EA 2R09A 4NY0A 1W1DA 4WSFA 2N0YA 2YF0A 2D9YA 3N7CA 4HAYB 3NSUA 3U7DA 4F7GA 1IRSA 1UEFA 4EMOA 2YS5A 3ZDTA 5HE0A 2EMTA 1EVHA 1ZC3B 5DHAB 2I5FA 4F7UP 1XKEA 1NU2A 3CIKA 1WI1A 2EJ8A 3PEGA 1QC6A 2YS1A 2UZRA 3UZTA 4DX90 1WVHA 4H8SA 1LW3A 4HAZB 2P8VA 4IOYX 3MDBC 2PZ1A 4L6EA 3HW2B 4B6HA 5DIFB 5LOPB 2K2UA 2HE7A 4HAXB 1U29A 2D2QA 1AQCA 2CAYA 2DHJA 3FM8C 2J0JA 2VSZA 2YT0A 4HB4B 4CYEA 2Y7BA 3PP2A 2D9ZA 2DYQA 2AEHA 5CLLB 4KHBB 5D3VA 3DXDA 5C6RA 2LG1A 2W2XD 3D8EA 1BTKA 2DTCA 5HE1A 5HE2A 3O96A 4YONA 1UPRA 4ZRKA 4BBKA 1ZVRA 4HB3B 3PSCA 1PLSA 3CXBB 3TW1A 3PG7A 5CLQB 1MIZB 2DX5A 2OQBA 2GCLA 1MK7B 1ISNA 4HAVB 1UPQA 1P6SA 5KQ4A 3KRWA 1U5GA 1OMWA 2Z0OA 3PVLA 2J0KA 5JHGA 5J3YA 2RLOA 3KY9A 2D4QA 1MK9B 2M14A 2KCJA 2RUKB 1FHXA 5J3QA 1UNRA 1P3RA 4ZRJA 4EKUA 2K00A 2X18A 1LB1A 4XWXA 4TYZA 3TVVA 5DHFB 2NMBA 1XCGA 1GG3A 3MPXA 1RJ2A 3PVWA 1DDVA 2RSGA 2IYBA 4Z2NA 3VOQA 3ULCA 1U2BA 4K81A 1BTNA 4HDQA 2DA0A 3A8PA 2ROZB 2LULA 4CHJA 2EMSA 4TKNA 1M7EA 4A5KA 2YVCA 4HATB 1TQZA 2UVMA 3PZDA 2EC1A 5C5BA 3V5WA 2RNRB 2COAA 1WG7A 4KHAA 2MDXA 3DXEA 4P7IA 2V76A 2I5CA 1N3HA 2ELAA 2W2XC 2P0DA 3P6AA 2ZPYA 1FHOA 2D9XA 2YS3A 3D8DA 1MPHA 3M1IB 2P0HA 1W1HA 1FGYA 1TJ6A 5EFXA 1MIXA 2CODA 1ZSQA 1NTVA 1Z87A 5GOWB 1GC7A 1U5EA 2RVBB 1U27A 3TFMA 2W2WA 2J0MA 3QBVB 1DDMA 4Z2MB 3P7ZA 4C0AA 1QQGA 3ZVRA 4DBBA 5KCVA 1U5DA 2LKOA 3IVFA 3PVUA 4F7HA 1PFJA 1M7RA 2D10A 4K2OA 1NTYA 2AL6A 5JHHA 5JP4A 1V61A 2R0DA 1DDWA 2OTXA 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQN A;  2GS0 A;  4A6F B;  4A6K A;  1RRP B;  1XX0 A;  5FI0 A;  3F0W A;  3ODW A;  3WYF B;  1H10 A;  1SHC A;  4GXB A;  1ZM0 A;  5DH9 B;  4KVG B;  3QIJ A;  3GYO A;  3VIA A;  4WVF B;  1K5D B;  2CY4 A;  5FI1 A;  5KQ1 A;  5D3X A;  1DYN A;  1X05 A;  3OAN A;  2ADZ A;  1K5G B;  4EJN A;  1E5W A;  2E2X A;  3AJ4 A;  3SNH A;  5D3Y A;  3KZ1 A;  2Z0Q A;  2KGX B;  2L2I A;  1UNQ A;  2L1C A;  1XD4 A;  2YSZ A;  1V5P A;  4HAW B;  3FEH A;  1SGH A;  4WJ7 A;  1V5M A;  4GZU A;  3KRX A;  5D3W A;  1BWN A;  2Z0P A;  1AWE A;  3T06 A;  1J0W A;  4PNK A;  1MAI A;  3SV1 A;  2MWN B;  3BIN A;  4NSW A;  1FB8 A;  1B55 A;  4IAP A;  5HE3 A;  4ZRI A;  1ZC4 B;  3SYX A;  1U5F A;  1WGU A;  4K17 A;  4A6H A;  2LYD A;  2N23 A;  1EF1 A;  4A6F A;  2RGN B;  2GCJ A;  2Q13 A;  1UNP A;  4HDO A;  4MT7 A;  1XR0 B;  1X86 A;  2ELB A;  2GJY A;  2DYN A;  4KHO A;  5L81 A;  3TCA A;  3QWM A;  2QKL A;  3A98 B;  4K2P A;  2KUP A;  1DBH A;  1I2H A;  4GMV A;  1KZ7 A;  5C16 A;  4DXA B;  2CY5 A;  2HTH B;  2D9V A;  5J3T A;  1X1G A;  1MKE A;  2P0F A;  1Y19 B;  2DN6 A;  3HK0 A;  2MKR A;  2G35 A;  4IFS A;  2COF A;  4HB0 B;  2XQN M;  5C79 A;  1J19 A;  4PQ0 A;  2D9W A;  2QKM A;  2YT1 A;  2K2J A;  2ROV A;  3LJU X;  4MK0 A;  2M38 A;  3SUZ A;  2DHK A;  2COC A;  1TXD A;  1P5T A;  5D27 A;  3TO1 A;  1FHW A;  1H4R A;  1V5U A;  1WJ1 A;  2Y8G A;  1Y5O A;  4CHM A;  1KI1 B;  1EGX A;  1FGZ A;  1WGQ A;  3BJI A;  1PMS A;  4YL8 A;  1DRO A;  3D8F A;  1EAZ A;  2YRY A;  3X23 A;  3A8Q A;  1X11 A;  3U8Z A;  5DI9 B;  3KSY A;  1Q67 A;  5LON B;  2DX1 A;  1X1F A;  4DX8 A;  2UZS A;  1V88 A;  1OY2 A;  2MFQ A;  3SO6 A;  2DLW A;  1V89 A;  3GYP A;  3ODO A;  3G9W A;  1WJM A;  3ODX A;  1W1G A;  2IFS A;  3DXC A;  4KAX B;  1I7A A;  4MY6 A;  2BCJ A;  5JLJ B;  2LOZ A;  3AU5 A;  5C5B B;  2DHI A;  2I1K A;  2DKP A;  2FJL A;  2VRW B;  1BAK A;  2CRF A;  4GPT B;  3WA0 A;  4GMX B;  4HB2 B;  2J59 M;  1FOE A;  2VKI A;  3ULB A;  1GC6 A;  2D11 A;  2NZ8 B;  4Y94 A;  4HAU B;  2DFK A;  1NI2 A;  3HQC A;  2Y8F A;  1XOD A;  4GN1 A;  1FAO A;  2JP2 A;  3F5R A;  2DKQ A;  2I1J A;  3AU4 A;  4D0N B;  1KZG A;  3ML4 A;  3FSS A;  4HHV A;  2H7D A;  3RCP A;  2H7E A;  2R09 A;  4NY0 A;  1W1D A;  4WSF A;  2N0Y A;  2YF0 A;  2D9Y A;  3N7C A;  4HAY B;  3NSU A;  3U7D A;  4F7G A;  1IRS A;  1UEF A;  4EMO A;  2YS5 A;  3ZDT A;  5HE0 A;  2EMT A;  1EVH A;  1ZC3 B;  5DHA B;  2I5F A;  4F7U P;  1XKE A;  1NU2 A;  3CIK A;  1WI1 A;  2EJ8 A;  3PEG A;  1QC6 A;  2YS1 A;  2UZR A;  3UZT A;  4DX9 0;  1WVH A;  4H8S A;  1LW3 A;  4HAZ B;  2P8V A;  4IOY X;  3MDB C;  2PZ1 A;  4L6E A;  3HW2 B;  4B6H A;  5DIF B;  5LOP B;  2K2U A;  2HE7 A;  4HAX B;  1U29 A;  2D2Q A;  1AQC A;  2CAY A;  2DHJ A;  3FM8 C;  2J0J A;  2VSZ A;  2YT0 A;  4HB4 B;  4CYE A;  2Y7B A;  3PP2 A;  2D9Z A;  2DYQ A;  2AEH A;  5CLL B;  4KHB B;  5D3V A;  3DXD A;  5C6R A;  2LG1 A;  2W2X D;  3D8E A;  1BTK A;  2DTC A;  5HE1 A;  5HE2 A;  3O96 A;  4YON A;  1UPR A;  4ZRK A;  4BBK A;  1ZVR A;  4HB3 B;  3PSC A;  1PLS A;  3CXB B;  3TW1 A;  3PG7 A;  5CLQ B;  1MIZ B;  2DX5 A;  2OQB A;  2GCL A;  1MK7 B;  1ISN A;  4HAV B;  1UPQ A;  1P6S A;  5KQ4 A;  3KRW A;  1U5G A;  1OMW A;  2Z0O A;  3PVL A;  2J0K A;  5JHG A;  5J3Y A;  2RLO A;  3KY9 A;  2D4Q A;  1MK9 B;  2M14 A;  2KCJ A;  2RUK B;  1FHX A;  5J3Q A;  1UNR A;  1P3R A;  4ZRJ A;  4EKU A;  2K00 A;  2X18 A;  1LB1 A;  4XWX A;  4TYZ A;  3TVV A;  5DHF B;  2NMB A;  1XCG A;  1GG3 A;  3MPX A;  1RJ2 A;  3PVW A;  1DDV A;  2RSG A;  2IYB A;  4Z2N A;  3VOQ A;  3ULC A;  1U2B A;  4K81 A;  1BTN A;  4HDQ A;  2DA0 A;  3A8P A;  2ROZ B;  2LUL A;  4CHJ A;  2EMS A;  4TKN A;  1M7E A;  4A5K A;  2YVC A;  4HAT B;  1TQZ A;  2UVM A;  3PZD A;  2EC1 A;  5C5B A;  3V5W A;  2RNR B;  2COA A;  1WG7 A;  4KHA A;  2MDX A;  3DXE A;  4P7I A;  2V76 A;  2I5C A;  1N3H A;  2ELA A;  2W2X C;  2P0D A;  3P6A A;  2ZPY A;  1FHO A;  2D9X A;  2YS3 A;  3D8D A;  1MPH A;  3M1I B;  2P0H A;  1W1H A;  1FGY A;  1TJ6 A;  5EFX A;  1MIX A;  2COD A;  1ZSQ A;  1NTV A;  1Z87 A;  5GOW B;  1GC7 A;  1U5E A;  2RVB B;  1U27 A;  3TFM A;  2W2W A;  2J0M A;  3QBV B;  1DDM A;  4Z2M B;  3P7Z A;  4C0A A;  1QQG A;  3ZVR A;  4DBB A;  5KCV A;  1U5D A;  2LKO A;  3IVF A;  3PVU A;  4F7H A;  1PFJ A;  1M7R A;  2D10 A;  4K2O A;  1NTY A;  2AL6 A;  5JHH A;  5JP4 A;  1V61 A;  2R0D A;  1DDW A;  2OTX A;  2LOX A; 
#chains in the Genus database with same CATH topology
 2Z59 A;  1OQN A;  2GS0 A;  4A6F B;  4A6K A;  1RRP B;  1XX0 A;  5FI0 A;  3F0W A;  3ODW A;  3WYF B;  1H10 A;  1SHC A;  4GXB A;  1ZM0 A;  4D6W A;  4QJ5 B;  5DH9 B;  4KVG B;  3QIJ A;  3GYO A;  3VIA A;  4WVF B;  1K5D B;  2CY4 A;  5FI1 A;  5KQ1 A;  5D3X A;  1DYN A;  1X05 A;  3OAN A;  2ADZ A;  1K5G B;  4EJN A;  1E5W A;  2E2X A;  2FJU B;  3AJ4 A;  3SNH A;  5D3Y A;  3KZ1 A;  2Z0Q A;  2KGX B;  2KIE A;  2L2I A;  1UNQ A;  2L1C A;  1XD4 A;  2K8E A;  2YSZ A;  4GOU A;  1V5P A;  4HAW B;  3FEH A;  1SGH A;  4WJ7 A;  1V5M A;  4GZU A;  3HSA A;  3KRX A;  5D3W A;  1BWN A;  2Z0P A;  1AWE A;  3T06 A;  1J0W A;  4PNK A;  1MAI A;  3SV1 A;  2MWN B;  3BIN A;  4NSW A;  1FB8 A;  1B55 A;  4IAP A;  5HE3 A;  4ZRI A;  1ZC4 B;  3SYX A;  1U5F A;  1WGU A;  4K17 A;  4A6H A;  2LYD A;  2N23 A;  1EF1 A;  4A6F A;  2RGN B;  2GCJ A;  2Q13 A;  1UNP A;  4HDO A;  4MT7 A;  1XR0 B;  2KR0 A;  4HSI A;  1X86 A;  2ZKM X;  2ELB A;  2GJY A;  2DYN A;  4KHO A;  5L81 A;  3TCA A;  3QWM A;  2QKL A;  3A98 B;  4K2P A;  2KUP A;  1DBH A;  1I2H A;  4GMV A;  1KZ7 A;  5C16 A;  4DXA B;  2CY5 A;  2HTH B;  2D9V A;  5J3T A;  1X1G A;  1MKE A;  2P0F A;  1Y19 B;  2DN6 A;  3HK0 A;  2MKR A;  2G35 A;  4IFS A;  2COF A;  4HB0 B;  2XQN M;  2Z14 A;  1J19 A;  5C79 A;  4PQ0 A;  2D9W A;  3NWA A;  2QKM A;  2YT1 A;  2K2J A;  2ROV A;  3LJU X;  4MK0 A;  2M38 A;  3SUZ A;  2DHK A;  2COC A;  1TXD A;  1ZYI A;  1P5T A;  5D27 A;  3TO1 A;  1FHW A;  1H4R A;  1V5U A;  1WJ1 A;  2Y8G A;  1Y5O A;  4CHM A;  1KI1 B;  1EGX A;  1FGZ A;  1WGQ A;  3BJI A;  1PMS A;  4YL8 A;  1DRO A;  3D8F A;  1EAZ A;  2YRY A;  3X23 A;  3A8Q A;  1X11 A;  3U8Z A;  5DI9 B;  3KSY A;  1Q67 A;  5LON B;  2DX1 A;  1X1F A;  4DX8 A;  2UZS A;  1V88 A;  1OY2 A;  2MFQ A;  3SO6 A;  5I2S A;  2DLW A;  1V89 A;  3GYP A;  3ODO A;  3G9W A;  1WJM A;  3ODX A;  1W1G A;  2IFS A;  3DXC A;  4KAX B;  1I7A A;  4MY6 A;  2BCJ A;  5JLJ B;  2LOZ A;  3AU5 A;  5C5B B;  2DHI A;  2I1K A;  2DKP A;  4DIX A;  2FJL A;  2VRW B;  3NWD A;  2CRF A;  4GPT B;  1BAK A;  3WA0 A;  4GMX B;  4HB2 B;  2J59 M;  1FOE A;  2VKI A;  3ULB A;  1GC6 A;  2D11 A;  2NZ8 B;  4Y94 A;  4HAU B;  2DFK A;  1NI2 A;  3HQC A;  2Y8F A;  1XOD A;  4GN1 A;  1FAO A;  2JP2 A;  3F5R A;  2DKQ A;  2I1J A;  3AU4 A;  4D0N B;  1KZG A;  3ML4 A;  3FSS A;  4HHV A;  2H7D A;  3RCP A;  2H7E A;  2R09 A;  4NY0 A;  1W1D A;  4WSF A;  2N0Y A;  2YF0 A;  4GNK B;  2D9Y A;  3N7C A;  4HAY B;  3NSU A;  3U7D A;  4F7G A;  1IRS A;  1UEF A;  4EMO A;  2YS5 A;  3ZDT A;  5HE0 A;  2EMT A;  1EVH A;  1ZC3 B;  5DHA B;  2I5F A;  4F7U P;  1XKE A;  1NU2 A;  3CIK A;  1WI1 A;  2EJ8 A;  3PEG A;  3OHM B;  1QC6 A;  2YS1 A;  2UZR A;  3UZT A;  4DX9 0;  1WVH A;  4H8S A;  1LW3 A;  4HAZ B;  2P8V A;  4IOY X;  3MDB C;  2PZ1 A;  4L6E A;  3HW2 B;  4B6H A;  5DIF B;  5LOP B;  2K2U A;  2HE7 A;  4HAX B;  1U29 A;  2D2Q A;  1AQC A;  2CAY A;  2DHJ A;  3FM8 C;  2KIG A;  2J0J A;  2VSZ A;  2YT0 A;  4HB4 B;  4CYE A;  2NBV A;  2Y7B A;  3PP2 A;  2D9Z A;  2DYQ A;  2AEH A;  5CLL B;  4KHB B;  5D3V A;  4CSQ A;  3DXD A;  5C6R A;  2LG1 A;  2W2X D;  3D8E A;  1BTK A;  2YT2 A;  2DTC A;  5HE1 A;  5HE2 A;  3O96 A;  4YON A;  1UPR A;  4ZRK A;  4BBK A;  1ZVR A;  4QXA B;  5IRS A;  4HB3 B;  3PSC A;  1PLS A;  3CXB B;  3TW1 A;  3PG7 A;  5CLQ B;  1MIZ B;  2DX5 A;  2OQB A;  2GCL A;  1MK7 B;  3U12 A;  1ISN A;  4HAV B;  1UPQ A;  1P6S A;  5KQ4 A;  3KRW A;  1U5G A;  3HIE A;  1OMW A;  2Z0O A;  3PVL A;  5M4Y B;  2J0K A;  5JHG A;  5J3Y A;  2RLO A;  3KY9 A;  2D4Q A;  1MK9 B;  2M14 A;  2KCJ A;  2RUK B;  1FHX A;  5J3Q A;  1UNR A;  1P3R A;  4ZRJ A;  4EKU A;  2K00 A;  4OT1 A;  2X18 A;  1LB1 A;  4XWX A;  4TYZ A;  3TVV A;  2K49 A;  5DHF B;  2NMB A;  4KHB A;  1XCG A;  2Z13 A;  1GG3 A;  3MPX A;  1RJ2 A;  3PVW A;  1DDV A;  2RSG A;  2IYB A;  4Z2N A;  3VOQ A;  3ULC A;  1U2B A;  4K81 A;  1BTN A;  4HDQ A;  2DA0 A;  3NWF A;  3A8P A;  2ROZ B;  2LUL A;  1T77 A;  4CHJ A;  2EMS A;  5LG4 B;  4TKN A;  3B77 A;  1M7E A;  3FVC A;  4A5K A;  2KUQ A;  5I2M A;  2YVC A;  4HAT B;  1TQZ A;  2UVM A;  4OSN A;  3PZD A;  2EC1 A;  5C5B A;  3V5W A;  2RNR B;  2COA A;  1WG7 A;  4KHA A;  2MDX A;  3DXE A;  4P7I A;  2V76 A;  2GUM A;  2I5C A;  1N3H A;  2ELA A;  2W2X C;  2P0D A;  3P6A A;  2ZPY A;  1FHO A;  2D9X A;  2YS3 A;  3D8D A;  1MPH A;  3M1I B;  2P0H A;  1W1H A;  1FGY A;  1TJ6 A;  5EFX A;  1MIX A;  2COD A;  1ZSQ A;  1NTV A;  2R2Y A;  1Z87 A;  5GOW B;  1GC7 A;  1U5E A;  2RVB B;  1U27 A;  3TFM A;  2W2W A;  2J0M A;  3QBV B;  1DDM A;  4Z2M B;  4QJ4 B;  3P7Z A;  4C0A A;  1QQG A;  4QJ3 B;  3ZVR A;  4DBB A;  3DCX A;  2Z4D A;  5KCV A;  1U5D A;  2LKO A;  3IVF A;  3PVU A;  4F7H A;  1PFJ A;  1M7R A;  1MI1 A;  2D10 A;  3A58 A;  4L1R A;  4K2O A;  1NTY A;  3NW8 A;  2AL6 A;  5JHH A;  5JP4 A;  1V61 A;  2R0D A;  2RRF A;  1DDW A;  2OTX A;  2LOX A; 
#chains in the Genus database with same CATH homology
 1OQN A;  2GS0 A;  4A6F B;  4A6K A;  1RRP B;  1XX0 A;  5FI0 A;  3F0W A;  3ODW A;  3WYF B;  1H10 A;  1SHC A;  4GXB A;  1ZM0 A;  5DH9 B;  4KVG B;  3QIJ A;  3GYO A;  3VIA A;  4WVF B;  1K5D B;  2CY4 A;  5FI1 A;  5KQ1 A;  5D3X A;  1DYN A;  1X05 A;  3OAN A;  2ADZ A;  1K5G B;  4EJN A;  1E5W A;  2E2X A;  3AJ4 A;  3SNH A;  5D3Y A;  3KZ1 A;  2Z0Q A;  2KGX B;  2L2I A;  1UNQ A;  2L1C A;  1XD4 A;  2YSZ A;  1V5P A;  4HAW B;  3FEH A;  1SGH A;  4WJ7 A;  1V5M A;  4GZU A;  3KRX A;  5D3W A;  1BWN A;  2Z0P A;  1AWE A;  3T06 A;  1J0W A;  4PNK A;  1MAI A;  3SV1 A;  2MWN B;  3BIN A;  4NSW A;  1FB8 A;  1B55 A;  4IAP A;  5HE3 A;  4ZRI A;  1ZC4 B;  3SYX A;  1U5F A;  1WGU A;  4K17 A;  4A6H A;  2LYD A;  2N23 A;  1EF1 A;  4A6F A;  2RGN B;  2GCJ A;  2Q13 A;  1UNP A;  4HDO A;  4MT7 A;  1XR0 B;  1X86 A;  2ELB A;  2GJY A;  2DYN A;  4KHO A;  5L81 A;  3TCA A;  3QWM A;  2QKL A;  3A98 B;  4K2P A;  2KUP A;  1DBH A;  1I2H A;  4GMV A;  1KZ7 A;  5C16 A;  4DXA B;  2CY5 A;  2HTH B;  2D9V A;  5J3T A;  1X1G A;  1MKE A;  2P0F A;  1Y19 B;  2DN6 A;  3HK0 A;  2MKR A;  2G35 A;  4IFS A;  2COF A;  4HB0 B;  2XQN M;  5C79 A;  1J19 A;  4PQ0 A;  2D9W A;  2QKM A;  2YT1 A;  2K2J A;  2ROV A;  3LJU X;  4MK0 A;  2M38 A;  3SUZ A;  2DHK A;  2COC A;  1TXD A;  1P5T A;  5D27 A;  3TO1 A;  1FHW A;  1H4R A;  1V5U A;  1WJ1 A;  2Y8G A;  1Y5O A;  4CHM A;  1KI1 B;  1EGX A;  1FGZ A;  1WGQ A;  3BJI A;  1PMS A;  4YL8 A;  1DRO A;  3D8F A;  1EAZ A;  2YRY A;  3X23 A;  3A8Q A;  1X11 A;  3U8Z A;  5DI9 B;  3KSY A;  1Q67 A;  5LON B;  2DX1 A;  1X1F A;  4DX8 A;  2UZS A;  1V88 A;  1OY2 A;  2MFQ A;  3SO6 A;  2DLW A;  1V89 A;  3GYP A;  3ODO A;  3G9W A;  1WJM A;  3ODX A;  1W1G A;  2IFS A;  3DXC A;  4KAX B;  1I7A A;  4MY6 A;  2BCJ A;  5JLJ B;  2LOZ A;  3AU5 A;  5C5B B;  2DHI A;  2I1K A;  2DKP A;  2FJL A;  2VRW B;  1BAK A;  2CRF A;  4GPT B;  3WA0 A;  4GMX B;  4HB2 B;  2J59 M;  1FOE A;  2VKI A;  3ULB A;  1GC6 A;  2D11 A;  2NZ8 B;  4Y94 A;  4HAU B;  2DFK A;  1NI2 A;  3HQC A;  2Y8F A;  1XOD A;  4GN1 A;  1FAO A;  2JP2 A;  3F5R A;  2DKQ A;  2I1J A;  3AU4 A;  4D0N B;  1KZG A;  3ML4 A;  3FSS A;  4HHV A;  2H7D A;  3RCP A;  2H7E A;  2R09 A;  4NY0 A;  1W1D A;  4WSF A;  2N0Y A;  2YF0 A;  2D9Y A;  3N7C A;  4HAY B;  3NSU A;  3U7D A;  4F7G A;  1IRS A;  1UEF A;  4EMO A;  2YS5 A;  3ZDT A;  5HE0 A;  2EMT A;  1EVH A;  1ZC3 B;  5DHA B;  2I5F A;  4F7U P;  1XKE A;  1NU2 A;  3CIK A;  1WI1 A;  2EJ8 A;  3PEG A;  1QC6 A;  2YS1 A;  2UZR A;  3UZT A;  4DX9 0;  1WVH A;  4H8S A;  1LW3 A;  4HAZ B;  2P8V A;  4IOY X;  3MDB C;  2PZ1 A;  4L6E A;  3HW2 B;  4B6H A;  5DIF B;  5LOP B;  2K2U A;  2HE7 A;  4HAX B;  1U29 A;  2D2Q A;  1AQC A;  2CAY A;  2DHJ A;  3FM8 C;  2J0J A;  2VSZ A;  2YT0 A;  4HB4 B;  4CYE A;  2Y7B A;  3PP2 A;  2D9Z A;  2DYQ A;  2AEH A;  5CLL B;  4KHB B;  5D3V A;  3DXD A;  5C6R A;  2LG1 A;  2W2X D;  3D8E A;  1BTK A;  2DTC A;  5HE1 A;  5HE2 A;  3O96 A;  4YON A;  1UPR A;  4ZRK A;  4BBK A;  1ZVR A;  4HB3 B;  3PSC A;  1PLS A;  3CXB B;  3TW1 A;  3PG7 A;  5CLQ B;  1MIZ B;  2DX5 A;  2OQB A;  2GCL A;  1MK7 B;  1ISN A;  4HAV B;  1UPQ A;  1P6S A;  5KQ4 A;  3KRW A;  1U5G A;  1OMW A;  2Z0O A;  3PVL A;  2J0K A;  5JHG A;  5J3Y A;  2RLO A;  3KY9 A;  2D4Q A;  1MK9 B;  2M14 A;  2KCJ A;  2RUK B;  1FHX A;  5J3Q A;  1UNR A;  1P3R A;  4ZRJ A;  4EKU A;  2K00 A;  2X18 A;  1LB1 A;  4XWX A;  4TYZ A;  3TVV A;  5DHF B;  2NMB A;  1XCG A;  1GG3 A;  3MPX A;  1RJ2 A;  3PVW A;  1DDV A;  2RSG A;  2IYB A;  4Z2N A;  3VOQ A;  3ULC A;  1U2B A;  4K81 A;  1BTN A;  4HDQ A;  2DA0 A;  3A8P A;  2ROZ B;  2LUL A;  4CHJ A;  2EMS A;  4TKN A;  1M7E A;  4A5K A;  2YVC A;  4HAT B;  1TQZ A;  2UVM A;  3PZD A;  2EC1 A;  5C5B A;  3V5W A;  2RNR B;  2COA A;  1WG7 A;  4KHA A;  2MDX A;  3DXE A;  4P7I A;  2V76 A;  2I5C A;  1N3H A;  2ELA A;  2W2X C;  2P0D A;  3P6A A;  2ZPY A;  1FHO A;  2D9X A;  2YS3 A;  3D8D A;  1MPH A;  3M1I B;  2P0H A;  1W1H A;  1FGY A;  1TJ6 A;  5EFX A;  1MIX A;  2COD A;  1ZSQ A;  1NTV A;  1Z87 A;  5GOW B;  1GC7 A;  1U5E A;  2RVB B;  1U27 A;  3TFM A;  2W2W A;  2J0M A;  3QBV B;  1DDM A;  4Z2M B;  3P7Z A;  4C0A A;  1QQG A;  3ZVR A;  4DBB A;  5KCV A;  1U5D A;  2LKO A;  3IVF A;  3PVU A;  4F7H A;  1PFJ A;  1M7R A;  2D10 A;  4K2O A;  1NTY A;  2AL6 A;  5JHH A;  5JP4 A;  1V61 A;  2R0D A;  1DDW A;  2OTX A;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...