2YS5A

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
molecule keywords Fibroblast growth factor receptor substrate 3
molecule tags Signaling protein
source organism Homo sapiens
total genus 13
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys5A01
5CLQB 4ZRIA 1M7EA 2D10A 2D9ZA 3ZVRA 2D11A 4HB4B 2Z0OA 1ZSQA 2DKPA 2HTHB 3SUZA 2J59M 2D9WA 2KGXB 3ODXA 2YS5A 2DA0A 2EMSA 3SO6A 1U5FA 2GS0A 2EMTA 4MK0A 3ULCA 2ELBA 2YF0A 2I5FA 3FSSA 1FB8A 5JLJB 1J19A 4TYZA 1XR0B 1GG3A 5DHAB 1U5GA 1Y19B 2AL6A 4WSFA 3VOQA 1XODA 4A5KA 2IYBA 5JHGA 4GMVA 5KCVA 2ADZA 2DN6A 4GN1A 4DX90 1DDMA 1TQZA 2NZ8B 4KAXB 2K00A 1SHCA 1DDWA 2DYQA 2DKQA 4KHOA 3T06A 5C5BB 2BCJA 2RVBB 4H8SA 4GZUA 1KZ7A 3U8ZA 2RLOA 2LKOA 2XQNM 1Z87A 2Q13A 3CIKA 2P0FA 1UPQA 4MY6A 3ODOA 2HE7A 2CY4A 3G9WA 3FM8C 5KQ4A 1WGQA 2M14A 3HW2B 3PEGA 1ZVRA 3IVFA 2X18A 2I1JA 2V76A 2K2JA 5D27A 4CHJA 1I7AA 1K5GB 1QQGA 4L6EA 2DHIA 2ZPYA 1AQCA 2G35A 4HAYB 1X1FA 2VRWB 3PVUA 1KZGA 3M1IB 3BINA 1UNQA 1GC6A 3O96A 1FHOA 3AU4A 5C5BA 4A6HA 2FJLA 1RJ2A 2LOXA 1WI1A 3PVWA 1BTNA 1LB1A 4HATB 1XX0A 2DHKA 4GXBA 5DI9B 3F0WA 5J3TA 1H4RA 5D3XA 1E5WA 4HAZB 1DDVA 1MK9B 1U5DA 4GPTB 4F7UP 1FGZA 3ML4A 2YSZA 2DTCA 1ISNA 2YS1A 3HQCA 1MIXA 2QKMA 1XCGA 2CAYA 2E2XA 1U5EA 4HB3B 4KVGB 4DX8A 3P7ZA 4IFSA 3TW1A 4CYEA 2JP2A 1RRPB 2MDXA 2MFQA 5C16A 4IOYX 3A8PA 3CXBB 3SNHA 1BTKA 1PMSA 2ROVA 1W1DA 2IFSA 3KZ1A 4HDOA 1X1GA 1UNPA 2H7EA 2I1KA 4B6HA 1P3RA 4HDQA 1P5TA 2UZSA 4P7IA 4F7HA 1UNRA 2Z0QA 4DBBA 4EMOA 1IRSA 5J3QA 5HE0A 1OMWA 1P6SA 2OTXA 3NSUA 2L2IA 2P0DA 5D3VA 4CHMA 1Y5OA 3QBVB 1ZM0A 1U27A 4DXAB 2RSGA 1FHWA 3U7DA 5JP4A 2N0YA 4HAUB 5HE3A 5FI1A 3ZDTA 4HB2B 2LOZA 1DYNA 2R09A 3HK0A 1FGYA 3OANA 1KI1B 4GMXB 3MDBC 4Z2MB 2AEHA 2N23A 3TO1A 1B55A 2Y8GA 3PP2A 2L1CA 2LULA 5LOPB 1OY2A 2I5CA 2D2QA 2YS3A 5C6RA 1WJMA 2J0JA 3D8EA 4EKUA 5L81A 1EGXA 3KSYA 2YRYA 2YVCA 3D8FA 2CY5A 2EC1A 3AU5A 1SGHA 2CRFA 3WA0A 1OQNA 3MPXA 2GCLA 1BWNA 1PFJA 1V5UA 3P6AA 1NI2A 4YL8A 4A6FB 5DIFB 3QIJA 1W1HA 2PZ1A 1GC7A 3DXEA 1Q67A 5EFXA 2DHJA 2W2WA 2CODA 3A98B 4KHAA 1FAOA 1NTYA 2D9YA 1AWEA 2MWNB 4Y94A 3DXCA 5LONB 4BBKA 2W2XD 2GJYA 4K81A 3GYPA 1U2BA 2VKIA 1DROA 4Z2NA 3KY9A 1LW3A 2D9XA 4HAXB 1V88A 1EVHA 2LG1A 2LYDA 2KUPA 1DBHA 1X05A 3X23A 2DX5A 2ELAA 5DHFB 4C0AA 1TXDA 5GOWB 2P0HA 3BJIA 3PVLA 2DLWA 4HHVA 5HE1A 3WYFB 4WJ7A 1UEFA 1I2HA 1ZC4B 1V61A 3RCPA 4A6FA 4A6KA 4ZRJA 4PNKA 1V89A 4ZRKA 2KCJA 1X11A 1H10A 3AJ4A 5C79A 3KRXA 3KRWA 4NY0A 3TCAA 2Y8FA 4TKNA 5FI0A 3LJUX 1NU2A 2H7DA 2J0KA 5HE2A 5D3YA 3PSCA 3SV1A 4D0NB 1EAZA 1K5DB 1UPRA 1WGUA 4PQ0A 2D9VA 4K2PA 2DYNA 2MKRA 2J0MA 4HAWB 2Z0PA 3F5RA 2VSZA 1V5PA 2DX1A 4F7GA 4HB0B 4EJNA 1MKEA 2R0DA 4K2OA 3PZDA 1N3HA 2COAA 2RUKB 1MIZB 1V5MA 2COCA 5DH9B 1BAKA 3N7CA 2K2UA 2ROZB 3TFMA 5J3YA 3ULBA 1WG7A 1J0WA 4YONA 4WVFB 1X86A 1WVHA 3GYOA 1TJ6A 1XD4A 3DXDA 4KHBB 4MT7A 5D3WA 1MK7B 2Y7BA 3QWMA 1MAIA 1MPHA 2M38A 2EJ8A 1W1GA 2RNRB 2UZRA 1ZC3B 2RGNB 2GCJA 4HAVB 3A8QA 1XKEA 2YT0A 1U29A 3ODWA 2COFA 2OQBA 4IAPA 2UVMA 1EF1A 3UZTA 1M7RA 2QKLA 1PLSA 1WJ1A 3V5WA 2W2XC 3TVVA 3PG7A 1FHXA 1NTVA 2NMBA 2YT1A 1FOEA 2DFKA 3D8DA 2P8VA 1QC6A 4NSWA 2D4QA 5CLLB 5KQ1A 4K17A 3FEHA 3SYXA 5JHHA 3VIAA 4XWXA
chains in the Genus database with same CATH superfamily
5CLQB 2K49A 4ZRIA 1M7EA 3A58A 2D10A 2D9ZA 3ZVRA 2D11A 4HB4B 2Z0OA 1ZSQA 2DKPA 2HTHB 3SUZA 2J59M 2D9WA 2KGXB 3ODXA 2YS5A 2DA0A 2EMSA 3SO6A 1U5FA 2GS0A 2EMTA 4MK0A 3ULCA 2ELBA 2YF0A 2I5FA 3FSSA 5IRSA 1FB8A 5JLJB 1J19A 4TYZA 1XR0B 1GG3A 5DHAB 4OSNA 1U5GA 1Y19B 2AL6A 4WSFA 3VOQA 1XODA 4A5KA 2IYBA 5JHGA 4GMVA 5KCVA 2ADZA 2DN6A 4GN1A 2KIGA 4DX90 1DDMA 1TQZA 2NZ8B 4KAXB 2K00A 1SHCA 1DDWA 2DYQA 2DKQA 4KHOA 3T06A 5C5BB 3NWDA 2BCJA 2RVBB 4H8SA 4GZUA 1KZ7A 3U8ZA 2RLOA 2LKOA 2XQNM 1Z87A 2Q13A 3CIKA 2P0FA 1UPQA 4MY6A 3ODOA 2HE7A 2CY4A 3G9WA 3FM8C 5KQ4A 1WGQA 2M14A 3HW2B 3HIEA 3PEGA 1ZVRA 3IVFA 2Z14A 2X18A 2I1JA 2V76A 2K2JA 5D27A 4CHJA 1I7AA 1K5GB 1QQGA 1T77A 4L6EA 2DHIA 2ZPYA 1AQCA 2G35A 4HAYB 1X1FA 2VRWB 3PVUA 1KZGA 3M1IB 3BINA 1UNQA 1GC6A 3O96A 1FHOA 3AU4A 4QJ5B 5C5BA 4A6HA 2FJLA 1RJ2A 2LOXA 1WI1A 3PVWA 1BTNA 1LB1A 4HATB 1XX0A 2DHKA 4GXBA 5DI9B 3F0WA 5J3TA 1H4RA 5D3XA 1E5WA 4HAZB 1DDVA 1MK9B 1U5DA 4GPTB 4QXAB 1FGZA 4F7UP 2KUQA 3ML4A 2YSZA 2DTCA 1ISNA 2YS1A 3HQCA 1MIXA 2QKMA 1XCGA 2CAYA 2E2XA 1U5EA 4HB3B 4KVGB 4DX8A 3P7ZA 4IFSA 3TW1A 4CYEA 2JP2A 1RRPB 2MDXA 2MFQA 2KR0A 5C16A 4IOYX 3A8PA 3CXBB 3SNHA 1BTKA 4OT1A 1PMSA 2ROVA 1W1DA 2IFSA 2R2YA 3KZ1A 4HDOA 1X1GA 1UNPA 2H7EA 2I1KA 4B6HA 1P3RA 4HDQA 1P5TA 2UZSA 4P7IA 4F7HA 1UNRA 2Z0QA 4DBBA 4EMOA 1IRSA 5J3QA 5HE0A 1OMWA 1P6SA 2OTXA 3NSUA 2L2IA 4L1RA 4DIXA 2P0DA 5D3VA 4CHMA 1Y5OA 3QBVB 4D6WA 1ZM0A 1U27A 4GOUA 4DXAB 2RSGA 1FHWA 3U7DA 1MI1A 5JP4A 3NW8A 3HSAA 2N0YA 4HAUB 5HE3A 5FI1A 3ZDTA 4HB2B 2LOZA 4HSIA 1DYNA 2R09A 3HK0A 1FGYA 3OANA 1KI1B 4GMXB 3MDBC 4Z2MB 2AEHA 2GUMA 2N23A 3TO1A 3DCXA 1B55A 2Y8GA 3PP2A 2L1CA 2LULA 5LOPB 2Z13A 1OY2A 2I5CA 2D2QA 2YS3A 5C6RA 1WJMA 2J0JA 3D8EA 4EKUA 5L81A 1EGXA 3KSYA 2YRYA 2YVCA 3D8FA 2CY5A 2EC1A 3AU5A 3U12A 1SGHA 2CRFA 3WA0A 1OQNA 3MPXA 3OHMB 2GCLA 1BWNA 1PFJA 1V5UA 5LG4B 3P6AA 1NI2A 4YL8A 4A6FB 2RRFA 5DIFB 3QIJA 1W1HA 2PZ1A 1GC7A 3DXEA 1Q67A 5EFXA 2DHJA 2W2WA 2CODA 3A98B 4KHAA 1FAOA 1NTYA 2D9YA 2YT2A 1AWEA 2MWNB 4Y94A 3DXCA 5LONB 4BBKA 2W2XD 2GJYA 4K81A 3GYPA 1U2BA 2VKIA 1DROA 4Z2NA 3KY9A 1LW3A 2D9XA 4HAXB 1V88A 2Z59A 1EVHA 2LG1A 1ZYIA 4QJ4B 2LYDA 2KUPA 1DBHA 1X05A 3X23A 2DX5A 2ELAA 5DHFB 4C0AA 1TXDA 5GOWB 2FJUB 5M4YB 2P0HA 3BJIA 3PVLA 2DLWA 4HHVA 5HE1A 3WYFB 4WJ7A 1UEFA 1I2HA 3NWFA 1ZC4B 1V61A 3RCPA 4A6FA 4A6KA 4ZRJA 4PNKA 2ZKMX 1V89A 4ZRKA 2KCJA 1X11A 1H10A 3AJ4A 5C79A 3KRXA 3KRWA 4NY0A 3TCAA 2Y8FA 4TKNA 5FI0A 3LJUX 1NU2A 2H7DA 2J0KA 5HE2A 5D3YA 3PSCA 3SV1A 4D0NB 1EAZA 1K5DB 1UPRA 1WGUA 4PQ0A 2D9VA 4K2PA 2DYNA 2MKRA 5I2MA 2J0MA 4HAWB 2Z0PA 3F5RA 2VSZA 1V5PA 3B77A 2DX1A 4F7GA 4HB0B 4EJNA 1MKEA 2R0DA 4K2OA 3PZDA 1N3HA 2COAA 2RUKB 1MIZB 1V5MA 2COCA 5DH9B 1BAKA 3N7CA 2K2UA 2ROZB 3TFMA 5J3YA 2K8EA 4QJ3B 3ULBA 1WG7A 1J0WA 4YONA 4WVFB 1X86A 1WVHA 3GYOA 1TJ6A 1XD4A 3DXDA 4KHBB 4MT7A 5D3WA 1MK7B 2Y7BA 3QWMA 1MAIA 1MPHA 2M38A 2EJ8A 1W1GA 2RNRB 2UZRA 5I2SA 1ZC3B 2KIEA 2RGNB 2GCJA 4HAVB 3A8QA 1XKEA 2YT0A 3FVCA 1U29A 3NWAA 3ODWA 2COFA 4GNKB 2OQBA 4IAPA 2UVMA 1EF1A 3UZTA 1M7RA 2QKLA 1PLSA 1WJ1A 3V5WA 2W2XC 3TVVA 3PG7A 1FHXA 1NTVA 2NMBA 2YT1A 1FOEA 2DFKA 3D8DA 2P8VA 1QC6A 4NSWA 2D4QA 5CLLB 5KQ1A 2NBVA 4K17A 3FEHA 3SYXA 2Z4DA 5JHHA 3VIAA 4XWXA 4CSQA 4KHBA
chains in the Genus database with same CATH topology
5CLQB 4ZRIA 1M7EA 2D10A 2D9ZA 3ZVRA 2D11A 4HB4B 2Z0OA 1ZSQA 2DKPA 2HTHB 3SUZA 2J59M 2D9WA 2KGXB 3ODXA 2YS5A 2DA0A 2EMSA 3SO6A 1U5FA 2GS0A 2EMTA 4MK0A 3ULCA 2ELBA 2YF0A 2I5FA 3FSSA 1FB8A 5JLJB 1J19A 4TYZA 1XR0B 1GG3A 5DHAB 1U5GA 1Y19B 2AL6A 4WSFA 3VOQA 1XODA 4A5KA 2IYBA 5JHGA 4GMVA 5KCVA 2ADZA 2DN6A 4GN1A 4DX90 1DDMA 1TQZA 2NZ8B 4KAXB 2K00A 1SHCA 1DDWA 2DYQA 2DKQA 4KHOA 3T06A 5C5BB 2BCJA 2RVBB 4H8SA 4GZUA 1KZ7A 3U8ZA 2RLOA 2LKOA 2XQNM 1Z87A 2Q13A 3CIKA 2P0FA 1UPQA 4MY6A 3ODOA 2HE7A 2CY4A 3G9WA 3FM8C 5KQ4A 1WGQA 2M14A 3HW2B 3PEGA 1ZVRA 3IVFA 2X18A 2I1JA 2V76A 2K2JA 5D27A 4CHJA 1I7AA 1K5GB 1QQGA 4L6EA 2DHIA 2ZPYA 1AQCA 2G35A 4HAYB 1X1FA 2VRWB 3PVUA 1KZGA 3M1IB 3BINA 1UNQA 1GC6A 3O96A 1FHOA 3AU4A 5C5BA 4A6HA 2FJLA 1RJ2A 2LOXA 1WI1A 3PVWA 1BTNA 1LB1A 4HATB 1XX0A 2DHKA 4GXBA 5DI9B 3F0WA 5J3TA 1H4RA 5D3XA 1E5WA 4HAZB 1DDVA 1MK9B 1U5DA 4GPTB 4F7UP 1FGZA 3ML4A 2YSZA 2DTCA 1ISNA 2YS1A 3HQCA 1MIXA 2QKMA 1XCGA 2CAYA 2E2XA 1U5EA 4HB3B 4KVGB 4DX8A 3P7ZA 4IFSA 3TW1A 4CYEA 2JP2A 1RRPB 2MDXA 2MFQA 5C16A 4IOYX 3A8PA 3CXBB 3SNHA 1BTKA 1PMSA 2ROVA 1W1DA 2IFSA 3KZ1A 4HDOA 1X1GA 1UNPA 2H7EA 2I1KA 4B6HA 1P3RA 4HDQA 1P5TA 2UZSA 4P7IA 4F7HA 1UNRA 2Z0QA 4DBBA 4EMOA 1IRSA 5J3QA 5HE0A 1OMWA 1P6SA 2OTXA 3NSUA 2L2IA 2P0DA 5D3VA 4CHMA 1Y5OA 3QBVB 1ZM0A 1U27A 4DXAB 2RSGA 1FHWA 3U7DA 5JP4A 2N0YA 4HAUB 5HE3A 5FI1A 3ZDTA 4HB2B 2LOZA 1DYNA 2R09A 3HK0A 1FGYA 3OANA 1KI1B 4GMXB 3MDBC 4Z2MB 2AEHA 2N23A 3TO1A 1B55A 2Y8GA 3PP2A 2L1CA 2LULA 5LOPB 1OY2A 2I5CA 2D2QA 2YS3A 5C6RA 1WJMA 2J0JA 3D8EA 4EKUA 5L81A 1EGXA 3KSYA 2YRYA 2YVCA 3D8FA 2CY5A 2EC1A 3AU5A 1SGHA 2CRFA 3WA0A 1OQNA 3MPXA 2GCLA 1BWNA 1PFJA 1V5UA 3P6AA 1NI2A 4YL8A 4A6FB 5DIFB 3QIJA 1W1HA 2PZ1A 1GC7A 3DXEA 1Q67A 5EFXA 2DHJA 2W2WA 2CODA 3A98B 4KHAA 1FAOA 1NTYA 2D9YA 1AWEA 2MWNB 4Y94A 3DXCA 5LONB 4BBKA 2W2XD 2GJYA 4K81A 3GYPA 1U2BA 2VKIA 1DROA 4Z2NA 3KY9A 1LW3A 2D9XA 4HAXB 1V88A 1EVHA 2LG1A 2LYDA 2KUPA 1DBHA 1X05A 3X23A 2DX5A 2ELAA 5DHFB 4C0AA 1TXDA 5GOWB 2P0HA 3BJIA 3PVLA 2DLWA 4HHVA 5HE1A 3WYFB 4WJ7A 1UEFA 1I2HA 1ZC4B 1V61A 3RCPA 4A6FA 4A6KA 4ZRJA 4PNKA 1V89A 4ZRKA 2KCJA 1X11A 1H10A 3AJ4A 5C79A 3KRXA 3KRWA 4NY0A 3TCAA 2Y8FA 4TKNA 5FI0A 3LJUX 1NU2A 2H7DA 2J0KA 5HE2A 5D3YA 3PSCA 3SV1A 4D0NB 1EAZA 1K5DB 1UPRA 1WGUA 4PQ0A 2D9VA 4K2PA 2DYNA 2MKRA 2J0MA 4HAWB 2Z0PA 3F5RA 2VSZA 1V5PA 2DX1A 4F7GA 4HB0B 4EJNA 1MKEA 2R0DA 4K2OA 3PZDA 1N3HA 2COAA 2RUKB 1MIZB 1V5MA 2COCA 5DH9B 1BAKA 3N7CA 2K2UA 2ROZB 3TFMA 5J3YA 3ULBA 1WG7A 1J0WA 4YONA 4WVFB 1X86A 1WVHA 3GYOA 1TJ6A 1XD4A 3DXDA 4KHBB 4MT7A 5D3WA 1MK7B 2Y7BA 3QWMA 1MAIA 1MPHA 2M38A 2EJ8A 1W1GA 2RNRB 2UZRA 1ZC3B 2RGNB 2GCJA 4HAVB 3A8QA 1XKEA 2YT0A 1U29A 3ODWA 2COFA 2OQBA 4IAPA 2UVMA 1EF1A 3UZTA 1M7RA 2QKLA 1PLSA 1WJ1A 3V5WA 2W2XC 3TVVA 3PG7A 1FHXA 1NTVA 2NMBA 2YT1A 1FOEA 2DFKA 3D8DA 2P8VA 1QC6A 4NSWA 2D4QA 5CLLB 5KQ1A 4K17A 3FEHA 3SYXA 5JHHA 3VIAA 4XWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLQ B;  4ZRI A;  1M7E A;  2D10 A;  2D9Z A;  3ZVR A;  2D11 A;  4HB4 B;  2Z0O A;  1ZSQ A;  2DKP A;  2HTH B;  3SUZ A;  2J59 M;  2D9W A;  2KGX B;  3ODX A;  2YS5 A;  2DA0 A;  2EMS A;  3SO6 A;  1U5F A;  2GS0 A;  2EMT A;  4MK0 A;  3ULC A;  2ELB A;  2YF0 A;  2I5F A;  3FSS A;  1FB8 A;  5JLJ B;  1J19 A;  4TYZ A;  1XR0 B;  1GG3 A;  5DHA B;  1U5G A;  1Y19 B;  2AL6 A;  4WSF A;  3VOQ A;  1XOD A;  4A5K A;  2IYB A;  5JHG A;  4GMV A;  5KCV A;  2ADZ A;  2DN6 A;  4GN1 A;  4DX9 0;  1DDM A;  1TQZ A;  2NZ8 B;  4KAX B;  2K00 A;  1SHC A;  1DDW A;  2DYQ A;  2DKQ A;  4KHO A;  3T06 A;  5C5B B;  2BCJ A;  2RVB B;  4H8S A;  4GZU A;  1KZ7 A;  3U8Z A;  2RLO A;  2LKO A;  2XQN M;  1Z87 A;  2Q13 A;  3CIK A;  2P0F A;  1UPQ A;  4MY6 A;  3ODO A;  2HE7 A;  2CY4 A;  3G9W A;  3FM8 C;  5KQ4 A;  1WGQ A;  2M14 A;  3HW2 B;  3PEG A;  1ZVR A;  3IVF A;  2X18 A;  2I1J A;  2V76 A;  2K2J A;  5D27 A;  4CHJ A;  1I7A A;  1K5G B;  1QQG A;  4L6E A;  2DHI A;  2ZPY A;  1AQC A;  2G35 A;  4HAY B;  1X1F A;  2VRW B;  3PVU A;  1KZG A;  3M1I B;  3BIN A;  1UNQ A;  1GC6 A;  3O96 A;  1FHO A;  3AU4 A;  5C5B A;  4A6H A;  2FJL A;  1RJ2 A;  2LOX A;  1WI1 A;  3PVW A;  1BTN A;  1LB1 A;  4HAT B;  1XX0 A;  2DHK A;  4GXB A;  5DI9 B;  3F0W A;  5J3T A;  1H4R A;  5D3X A;  1E5W A;  4HAZ B;  1DDV A;  1MK9 B;  1U5D A;  4GPT B;  4F7U P;  1FGZ A;  3ML4 A;  2YSZ A;  2DTC A;  1ISN A;  2YS1 A;  3HQC A;  1MIX A;  2QKM A;  1XCG A;  2CAY A;  2E2X A;  1U5E A;  4HB3 B;  4KVG B;  4DX8 A;  3P7Z A;  4IFS A;  3TW1 A;  4CYE A;  2JP2 A;  1RRP B;  2MDX A;  2MFQ A;  5C16 A;  4IOY X;  3A8P A;  3CXB B;  3SNH A;  1BTK A;  1PMS A;  2ROV A;  1W1D A;  2IFS A;  3KZ1 A;  4HDO A;  1X1G A;  1UNP A;  2H7E A;  2I1K A;  4B6H A;  1P3R A;  4HDQ A;  1P5T A;  2UZS A;  4P7I A;  4F7H A;  1UNR A;  2Z0Q A;  4DBB A;  4EMO A;  1IRS A;  5J3Q A;  5HE0 A;  1OMW A;  1P6S A;  2OTX A;  3NSU A;  2L2I A;  2P0D A;  5D3V A;  4CHM A;  1Y5O A;  3QBV B;  1ZM0 A;  1U27 A;  4DXA B;  2RSG A;  1FHW A;  3U7D A;  5JP4 A;  2N0Y A;  4HAU B;  5HE3 A;  5FI1 A;  3ZDT A;  4HB2 B;  2LOZ A;  1DYN A;  2R09 A;  3HK0 A;  1FGY A;  3OAN A;  1KI1 B;  4GMX B;  3MDB C;  4Z2M B;  2AEH A;  2N23 A;  3TO1 A;  1B55 A;  2Y8G A;  3PP2 A;  2L1C A;  2LUL A;  5LOP B;  1OY2 A;  2I5C A;  2D2Q A;  2YS3 A;  5C6R A;  1WJM A;  2J0J A;  3D8E A;  4EKU A;  5L81 A;  1EGX A;  3KSY A;  2YRY A;  2YVC A;  3D8F A;  2CY5 A;  2EC1 A;  3AU5 A;  1SGH A;  2CRF A;  3WA0 A;  1OQN A;  3MPX A;  2GCL A;  1BWN A;  1PFJ A;  1V5U A;  3P6A A;  1NI2 A;  4YL8 A;  4A6F B;  5DIF B;  3QIJ A;  1W1H A;  2PZ1 A;  1GC7 A;  3DXE A;  1Q67 A;  5EFX A;  2DHJ A;  2W2W A;  2COD A;  3A98 B;  4KHA A;  1FAO A;  1NTY A;  2D9Y A;  1AWE A;  2MWN B;  4Y94 A;  3DXC A;  5LON B;  4BBK A;  2W2X D;  2GJY A;  4K81 A;  3GYP A;  1U2B A;  2VKI A;  1DRO A;  4Z2N A;  3KY9 A;  1LW3 A;  2D9X A;  4HAX B;  1V88 A;  1EVH A;  2LG1 A;  2LYD A;  2KUP A;  1DBH A;  1X05 A;  3X23 A;  2DX5 A;  2ELA A;  5DHF B;  4C0A A;  1TXD A;  5GOW B;  2P0H A;  3BJI A;  3PVL A;  2DLW A;  4HHV A;  5HE1 A;  3WYF B;  4WJ7 A;  1UEF A;  1I2H A;  1ZC4 B;  1V61 A;  3RCP A;  4A6F A;  4A6K A;  4ZRJ A;  4PNK A;  1V89 A;  4ZRK A;  2KCJ A;  1X11 A;  1H10 A;  3AJ4 A;  5C79 A;  3KRX A;  3KRW A;  4NY0 A;  3TCA A;  2Y8F A;  4TKN A;  5FI0 A;  3LJU X;  1NU2 A;  2H7D A;  2J0K A;  5HE2 A;  5D3Y A;  3PSC A;  3SV1 A;  4D0N B;  1EAZ A;  1K5D B;  1UPR A;  1WGU A;  4PQ0 A;  2D9V A;  4K2P A;  2DYN A;  2MKR A;  2J0M A;  4HAW B;  2Z0P A;  3F5R A;  2VSZ A;  1V5P A;  2DX1 A;  4F7G A;  4HB0 B;  4EJN A;  1MKE A;  2R0D A;  4K2O A;  3PZD A;  1N3H A;  2COA A;  2RUK B;  1MIZ B;  1V5M A;  2COC A;  5DH9 B;  1BAK A;  3N7C A;  2K2U A;  2ROZ B;  3TFM A;  5J3Y A;  3ULB A;  1WG7 A;  1J0W A;  4YON A;  4WVF B;  1X86 A;  1WVH A;  3GYO A;  1TJ6 A;  1XD4 A;  3DXD A;  4KHB B;  4MT7 A;  5D3W A;  1MK7 B;  2Y7B A;  3QWM A;  1MAI A;  1MPH A;  2M38 A;  2EJ8 A;  1W1G A;  2RNR B;  2UZR A;  1ZC3 B;  2RGN B;  2GCJ A;  4HAV B;  3A8Q A;  1XKE A;  2YT0 A;  1U29 A;  3ODW A;  2COF A;  2OQB A;  4IAP A;  2UVM A;  1EF1 A;  3UZT A;  1M7R A;  2QKL A;  1PLS A;  1WJ1 A;  3V5W A;  2W2X C;  3TVV A;  3PG7 A;  1FHX A;  1NTV A;  2NMB A;  2YT1 A;  1FOE A;  2DFK A;  3D8D A;  2P8V A;  1QC6 A;  4NSW A;  2D4Q A;  5CLL B;  5KQ1 A;  4K17 A;  3FEH A;  3SYX A;  5JHH A;  3VIA A;  4XWX A; 
#chains in the Genus database with same CATH topology
 5CLQ B;  2K49 A;  4ZRI A;  1M7E A;  3A58 A;  2D10 A;  2D9Z A;  3ZVR A;  2D11 A;  4HB4 B;  2Z0O A;  1ZSQ A;  2DKP A;  2HTH B;  3SUZ A;  2J59 M;  2D9W A;  2KGX B;  3ODX A;  2YS5 A;  2DA0 A;  2EMS A;  3SO6 A;  1U5F A;  2GS0 A;  2EMT A;  4MK0 A;  3ULC A;  2ELB A;  2YF0 A;  2I5F A;  3FSS A;  5IRS A;  1FB8 A;  5JLJ B;  1J19 A;  4TYZ A;  1XR0 B;  1GG3 A;  5DHA B;  4OSN A;  1U5G A;  1Y19 B;  2AL6 A;  4WSF A;  3VOQ A;  1XOD A;  4A5K A;  2IYB A;  5JHG A;  4GMV A;  5KCV A;  2ADZ A;  2DN6 A;  4GN1 A;  2KIG A;  4DX9 0;  1DDM A;  1TQZ A;  2NZ8 B;  4KAX B;  2K00 A;  1SHC A;  1DDW A;  2DYQ A;  2DKQ A;  4KHO A;  3T06 A;  5C5B B;  3NWD A;  2BCJ A;  2RVB B;  4H8S A;  4GZU A;  1KZ7 A;  3U8Z A;  2RLO A;  2LKO A;  2XQN M;  1Z87 A;  2Q13 A;  3CIK A;  2P0F A;  1UPQ A;  4MY6 A;  3ODO A;  2HE7 A;  2CY4 A;  3G9W A;  3FM8 C;  5KQ4 A;  1WGQ A;  2M14 A;  3HW2 B;  3HIE A;  3PEG A;  1ZVR A;  3IVF A;  2Z14 A;  2X18 A;  2I1J A;  2V76 A;  2K2J A;  5D27 A;  4CHJ A;  1I7A A;  1K5G B;  1QQG A;  1T77 A;  4L6E A;  2DHI A;  2ZPY A;  1AQC A;  2G35 A;  4HAY B;  1X1F A;  2VRW B;  3PVU A;  1KZG A;  3M1I B;  3BIN A;  1UNQ A;  1GC6 A;  3O96 A;  1FHO A;  3AU4 A;  4QJ5 B;  5C5B A;  4A6H A;  2FJL A;  1RJ2 A;  2LOX A;  1WI1 A;  3PVW A;  1BTN A;  1LB1 A;  4HAT B;  1XX0 A;  2DHK A;  4GXB A;  5DI9 B;  3F0W A;  5J3T A;  1H4R A;  5D3X A;  1E5W A;  4HAZ B;  1DDV A;  1MK9 B;  1U5D A;  4GPT B;  4QXA B;  1FGZ A;  4F7U P;  2KUQ A;  3ML4 A;  2YSZ A;  2DTC A;  1ISN A;  2YS1 A;  3HQC A;  1MIX A;  2QKM A;  1XCG A;  2CAY A;  2E2X A;  1U5E A;  4HB3 B;  4KVG B;  4DX8 A;  3P7Z A;  4IFS A;  3TW1 A;  4CYE A;  2JP2 A;  1RRP B;  2MDX A;  2MFQ A;  2KR0 A;  5C16 A;  4IOY X;  3A8P A;  3CXB B;  3SNH A;  1BTK A;  4OT1 A;  1PMS A;  2ROV A;  1W1D A;  2IFS A;  2R2Y A;  3KZ1 A;  4HDO A;  1X1G A;  1UNP A;  2H7E A;  2I1K A;  4B6H A;  1P3R A;  4HDQ A;  1P5T A;  2UZS A;  4P7I A;  4F7H A;  1UNR A;  2Z0Q A;  4DBB A;  4EMO A;  1IRS A;  5J3Q A;  5HE0 A;  1OMW A;  1P6S A;  2OTX A;  3NSU A;  2L2I A;  4L1R A;  4DIX A;  2P0D A;  5D3V A;  4CHM A;  1Y5O A;  3QBV B;  4D6W A;  1ZM0 A;  1U27 A;  4GOU A;  4DXA B;  2RSG A;  1FHW A;  3U7D A;  1MI1 A;  5JP4 A;  3NW8 A;  3HSA A;  2N0Y A;  4HAU B;  5HE3 A;  5FI1 A;  3ZDT A;  4HB2 B;  2LOZ A;  4HSI A;  1DYN A;  2R09 A;  3HK0 A;  1FGY A;  3OAN A;  1KI1 B;  4GMX B;  3MDB C;  4Z2M B;  2AEH A;  2GUM A;  2N23 A;  3TO1 A;  3DCX A;  1B55 A;  2Y8G A;  3PP2 A;  2L1C A;  2LUL A;  5LOP B;  2Z13 A;  1OY2 A;  2I5C A;  2D2Q A;  2YS3 A;  5C6R A;  1WJM A;  2J0J A;  3D8E A;  4EKU A;  5L81 A;  1EGX A;  3KSY A;  2YRY A;  2YVC A;  3D8F A;  2CY5 A;  2EC1 A;  3AU5 A;  3U12 A;  1SGH A;  2CRF A;  3WA0 A;  1OQN A;  3MPX A;  3OHM B;  2GCL A;  1BWN A;  1PFJ A;  1V5U A;  5LG4 B;  3P6A A;  1NI2 A;  4YL8 A;  4A6F B;  2RRF A;  5DIF B;  3QIJ A;  1W1H A;  2PZ1 A;  1GC7 A;  3DXE A;  1Q67 A;  5EFX A;  2DHJ A;  2W2W A;  2COD A;  3A98 B;  4KHA A;  1FAO A;  1NTY A;  2D9Y A;  2YT2 A;  1AWE A;  2MWN B;  4Y94 A;  3DXC A;  5LON B;  4BBK A;  2W2X D;  2GJY A;  4K81 A;  3GYP A;  1U2B A;  2VKI A;  1DRO A;  4Z2N A;  3KY9 A;  1LW3 A;  2D9X A;  4HAX B;  1V88 A;  2Z59 A;  1EVH A;  2LG1 A;  1ZYI A;  4QJ4 B;  2LYD A;  2KUP A;  1DBH A;  1X05 A;  3X23 A;  2DX5 A;  2ELA A;  5DHF B;  4C0A A;  1TXD A;  5GOW B;  2FJU B;  5M4Y B;  2P0H A;  3BJI A;  3PVL A;  2DLW A;  4HHV A;  5HE1 A;  3WYF B;  4WJ7 A;  1UEF A;  1I2H A;  3NWF A;  1ZC4 B;  1V61 A;  3RCP A;  4A6F A;  4A6K A;  4ZRJ A;  4PNK A;  2ZKM X;  1V89 A;  4ZRK A;  2KCJ A;  1X11 A;  1H10 A;  3AJ4 A;  5C79 A;  3KRX A;  3KRW A;  4NY0 A;  3TCA A;  2Y8F A;  4TKN A;  5FI0 A;  3LJU X;  1NU2 A;  2H7D A;  2J0K A;  5HE2 A;  5D3Y A;  3PSC A;  3SV1 A;  4D0N B;  1EAZ A;  1K5D B;  1UPR A;  1WGU A;  4PQ0 A;  2D9V A;  4K2P A;  2DYN A;  2MKR A;  5I2M A;  2J0M A;  4HAW B;  2Z0P A;  3F5R A;  2VSZ A;  1V5P A;  3B77 A;  2DX1 A;  4F7G A;  4HB0 B;  4EJN A;  1MKE A;  2R0D A;  4K2O A;  3PZD A;  1N3H A;  2COA A;  2RUK B;  1MIZ B;  1V5M A;  2COC A;  5DH9 B;  1BAK A;  3N7C A;  2K2U A;  2ROZ B;  3TFM A;  5J3Y A;  2K8E A;  4QJ3 B;  3ULB A;  1WG7 A;  1J0W A;  4YON A;  4WVF B;  1X86 A;  1WVH A;  3GYO A;  1TJ6 A;  1XD4 A;  3DXD A;  4KHB B;  4MT7 A;  5D3W A;  1MK7 B;  2Y7B A;  3QWM A;  1MAI A;  1MPH A;  2M38 A;  2EJ8 A;  1W1G A;  2RNR B;  2UZR A;  5I2S A;  1ZC3 B;  2KIE A;  2RGN B;  2GCJ A;  4HAV B;  3A8Q A;  1XKE A;  2YT0 A;  3FVC A;  1U29 A;  3NWA A;  3ODW A;  2COF A;  4GNK B;  2OQB A;  4IAP A;  2UVM A;  1EF1 A;  3UZT A;  1M7R A;  2QKL A;  1PLS A;  1WJ1 A;  3V5W A;  2W2X C;  3TVV A;  3PG7 A;  1FHX A;  1NTV A;  2NMB A;  2YT1 A;  1FOE A;  2DFK A;  3D8D A;  2P8V A;  1QC6 A;  4NSW A;  2D4Q A;  5CLL B;  5KQ1 A;  2NBV A;  4K17 A;  3FEH A;  3SYX A;  2Z4D A;  5JHH A;  3VIA A;  4XWX A;  4CSQ A;  4KHB A; 
#chains in the Genus database with same CATH homology
 5CLQ B;  4ZRI A;  1M7E A;  2D10 A;  2D9Z A;  3ZVR A;  2D11 A;  4HB4 B;  2Z0O A;  1ZSQ A;  2DKP A;  2HTH B;  3SUZ A;  2J59 M;  2D9W A;  2KGX B;  3ODX A;  2YS5 A;  2DA0 A;  2EMS A;  3SO6 A;  1U5F A;  2GS0 A;  2EMT A;  4MK0 A;  3ULC A;  2ELB A;  2YF0 A;  2I5F A;  3FSS A;  1FB8 A;  5JLJ B;  1J19 A;  4TYZ A;  1XR0 B;  1GG3 A;  5DHA B;  1U5G A;  1Y19 B;  2AL6 A;  4WSF A;  3VOQ A;  1XOD A;  4A5K A;  2IYB A;  5JHG A;  4GMV A;  5KCV A;  2ADZ A;  2DN6 A;  4GN1 A;  4DX9 0;  1DDM A;  1TQZ A;  2NZ8 B;  4KAX B;  2K00 A;  1SHC A;  1DDW A;  2DYQ A;  2DKQ A;  4KHO A;  3T06 A;  5C5B B;  2BCJ A;  2RVB B;  4H8S A;  4GZU A;  1KZ7 A;  3U8Z A;  2RLO A;  2LKO A;  2XQN M;  1Z87 A;  2Q13 A;  3CIK A;  2P0F A;  1UPQ A;  4MY6 A;  3ODO A;  2HE7 A;  2CY4 A;  3G9W A;  3FM8 C;  5KQ4 A;  1WGQ A;  2M14 A;  3HW2 B;  3PEG A;  1ZVR A;  3IVF A;  2X18 A;  2I1J A;  2V76 A;  2K2J A;  5D27 A;  4CHJ A;  1I7A A;  1K5G B;  1QQG A;  4L6E A;  2DHI A;  2ZPY A;  1AQC A;  2G35 A;  4HAY B;  1X1F A;  2VRW B;  3PVU A;  1KZG A;  3M1I B;  3BIN A;  1UNQ A;  1GC6 A;  3O96 A;  1FHO A;  3AU4 A;  5C5B A;  4A6H A;  2FJL A;  1RJ2 A;  2LOX A;  1WI1 A;  3PVW A;  1BTN A;  1LB1 A;  4HAT B;  1XX0 A;  2DHK A;  4GXB A;  5DI9 B;  3F0W A;  5J3T A;  1H4R A;  5D3X A;  1E5W A;  4HAZ B;  1DDV A;  1MK9 B;  1U5D A;  4GPT B;  4F7U P;  1FGZ A;  3ML4 A;  2YSZ A;  2DTC A;  1ISN A;  2YS1 A;  3HQC A;  1MIX A;  2QKM A;  1XCG A;  2CAY A;  2E2X A;  1U5E A;  4HB3 B;  4KVG B;  4DX8 A;  3P7Z A;  4IFS A;  3TW1 A;  4CYE A;  2JP2 A;  1RRP B;  2MDX A;  2MFQ A;  5C16 A;  4IOY X;  3A8P A;  3CXB B;  3SNH A;  1BTK A;  1PMS A;  2ROV A;  1W1D A;  2IFS A;  3KZ1 A;  4HDO A;  1X1G A;  1UNP A;  2H7E A;  2I1K A;  4B6H A;  1P3R A;  4HDQ A;  1P5T A;  2UZS A;  4P7I A;  4F7H A;  1UNR A;  2Z0Q A;  4DBB A;  4EMO A;  1IRS A;  5J3Q A;  5HE0 A;  1OMW A;  1P6S A;  2OTX A;  3NSU A;  2L2I A;  2P0D A;  5D3V A;  4CHM A;  1Y5O A;  3QBV B;  1ZM0 A;  1U27 A;  4DXA B;  2RSG A;  1FHW A;  3U7D A;  5JP4 A;  2N0Y A;  4HAU B;  5HE3 A;  5FI1 A;  3ZDT A;  4HB2 B;  2LOZ A;  1DYN A;  2R09 A;  3HK0 A;  1FGY A;  3OAN A;  1KI1 B;  4GMX B;  3MDB C;  4Z2M B;  2AEH A;  2N23 A;  3TO1 A;  1B55 A;  2Y8G A;  3PP2 A;  2L1C A;  2LUL A;  5LOP B;  1OY2 A;  2I5C A;  2D2Q A;  2YS3 A;  5C6R A;  1WJM A;  2J0J A;  3D8E A;  4EKU A;  5L81 A;  1EGX A;  3KSY A;  2YRY A;  2YVC A;  3D8F A;  2CY5 A;  2EC1 A;  3AU5 A;  1SGH A;  2CRF A;  3WA0 A;  1OQN A;  3MPX A;  2GCL A;  1BWN A;  1PFJ A;  1V5U A;  3P6A A;  1NI2 A;  4YL8 A;  4A6F B;  5DIF B;  3QIJ A;  1W1H A;  2PZ1 A;  1GC7 A;  3DXE A;  1Q67 A;  5EFX A;  2DHJ A;  2W2W A;  2COD A;  3A98 B;  4KHA A;  1FAO A;  1NTY A;  2D9Y A;  1AWE A;  2MWN B;  4Y94 A;  3DXC A;  5LON B;  4BBK A;  2W2X D;  2GJY A;  4K81 A;  3GYP A;  1U2B A;  2VKI A;  1DRO A;  4Z2N A;  3KY9 A;  1LW3 A;  2D9X A;  4HAX B;  1V88 A;  1EVH A;  2LG1 A;  2LYD A;  2KUP A;  1DBH A;  1X05 A;  3X23 A;  2DX5 A;  2ELA A;  5DHF B;  4C0A A;  1TXD A;  5GOW B;  2P0H A;  3BJI A;  3PVL A;  2DLW A;  4HHV A;  5HE1 A;  3WYF B;  4WJ7 A;  1UEF A;  1I2H A;  1ZC4 B;  1V61 A;  3RCP A;  4A6F A;  4A6K A;  4ZRJ A;  4PNK A;  1V89 A;  4ZRK A;  2KCJ A;  1X11 A;  1H10 A;  3AJ4 A;  5C79 A;  3KRX A;  3KRW A;  4NY0 A;  3TCA A;  2Y8F A;  4TKN A;  5FI0 A;  3LJU X;  1NU2 A;  2H7D A;  2J0K A;  5HE2 A;  5D3Y A;  3PSC A;  3SV1 A;  4D0N B;  1EAZ A;  1K5D B;  1UPR A;  1WGU A;  4PQ0 A;  2D9V A;  4K2P A;  2DYN A;  2MKR A;  2J0M A;  4HAW B;  2Z0P A;  3F5R A;  2VSZ A;  1V5P A;  2DX1 A;  4F7G A;  4HB0 B;  4EJN A;  1MKE A;  2R0D A;  4K2O A;  3PZD A;  1N3H A;  2COA A;  2RUK B;  1MIZ B;  1V5M A;  2COC A;  5DH9 B;  1BAK A;  3N7C A;  2K2U A;  2ROZ B;  3TFM A;  5J3Y A;  3ULB A;  1WG7 A;  1J0W A;  4YON A;  4WVF B;  1X86 A;  1WVH A;  3GYO A;  1TJ6 A;  1XD4 A;  3DXD A;  4KHB B;  4MT7 A;  5D3W A;  1MK7 B;  2Y7B A;  3QWM A;  1MAI A;  1MPH A;  2M38 A;  2EJ8 A;  1W1G A;  2RNR B;  2UZR A;  1ZC3 B;  2RGN B;  2GCJ A;  4HAV B;  3A8Q A;  1XKE A;  2YT0 A;  1U29 A;  3ODW A;  2COF A;  2OQB A;  4IAP A;  2UVM A;  1EF1 A;  3UZT A;  1M7R A;  2QKL A;  1PLS A;  1WJ1 A;  3V5W A;  2W2X C;  3TVV A;  3PG7 A;  1FHX A;  1NTV A;  2NMB A;  2YT1 A;  1FOE A;  2DFK A;  3D8D A;  2P8V A;  1QC6 A;  4NSW A;  2D4Q A;  5CLL B;  5KQ1 A;  4K17 A;  3FEH A;  3SYX A;  5JHH A;  3VIA A;  4XWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...