2YS5A

Solution structure of the complex of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
146
Chain Sequence
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Fibroblast growth factor receptor substrate 3
total genus 13
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02174 IRS PTB domain (IRS-1 type)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2ys5A01
2W2XD 2CRFA 1EGXA 1QQGA 1WGUA 4D0NB 1V5MA 3A8QA 1U2BA 3ODXA 2D9WA 2E2XA 1EF1A 2D10A 2RLOA 3F5RA 2NZ8B 5C6RA 1TJ6A 2YVCA 1P3RA 1J19A 2Y8FA 1H10A 1K5DB 3D8DA 3KRWA 1DBHA 1WGQA 3WA0A 4DXAB 5JHHA 1WI1A 1BWNA 1UNQA 2DN6A 2X18A 1Y19B 4CYEA 4KHBB 2EC1A 2CAYA 3HQCA 3X23A 2RVBB 4IOYX 3SUZA 5J3YA 2ELAA 2KUPA 2P0FA 3AU5A 1XD4A 3PVWA 2HE7A 1BTNA 3SO6A 1DDWA 3TW1A 2G35A 1PMSA 4C0AA 1X86A 1ZSQA 2H7DA 4MT7A 3RCPA 5D3XA 3TO1A 3VOQA 1BAKA 1ZM0A 1MIZB 2M14A 3CXBB 3KSYA 4YL8A 4IFSA 3F0WA 2RGNB 3AU4A 4B6HA 2FJLA 1FGZA 1OQNA 5DH9B 1DDVA 1NTYA 5D3WA 4NY0A 2EJ8A 2P0DA 2Q13A 1UPRA 1U5EA 4ZRIA 3BINA 3TFMA 4BBKA 2W2WA 2XQNM 3UZTA 3GYPA 4HAVB 4KVGB 4K17A 3LJUX 1XODA 1U29A 1WJ1A 2V76A 1V61A 3PSCA 2UZSA 5EFXA 1FHOA 2CY4A 1UNRA 1AQCA 1DDMA 1MAIA 2YT0A 2MWNB 2GS0A 3M1IB 1MIXA 2ELBA 2LYDA 5JLJB 2I5FA 2LKOA 3PP2A 2D2QA 2QKMA 2D9ZA 2GCJA 3MDBC 1MKEA 3PEGA 2MKRA 2DHKA 5C5BA 1FHWA 2DKPA 3U7DA 1KZGA 5LOPB 1UPQA 3QBVB 2K00A 5KQ1A 2DYNA 2DX5A 4P7IA 2DX1A 1WVHA 3ZDTA 1Y5OA 1EAZA 3N7CA 2YS1A 4HDQA 2I1KA 4ZRKA 1MK7B 4A5KA 1H4RA 2J0KA 2N23A 1RRPB 1IRSA 4A6HA 1I2HA 1SGHA 4F7UP 1PLSA 5C79A 1P6SA 1TQZA 5HE0A 1Z87A 4DBBA 3WYFB 5KCVA 1N3HA 4K2OA 2H7EA 4YONA 2VRWB 1XKEA 1V88A 2MFQA 4HHVA 2D4QA 5C16A 4Z2MB 2LOXA 4DX8A 2LG1A 3D8FA 1E5WA 3ODWA 3PVUA 2BCJA 1X05A 4DX90 2M38A 4EKUA 1NTVA 4XWXA 2VKIA 2VSZA 4MK0A 2Z0OA 2ZPYA 3SNHA 3KY9A 2YT1A 1V5UA 2KCJA 4K81A 3DXDA 5C5BB 5J3TA 3FM8C 2YF0A 4GXBA 5JHGA 3OANA 2DHIA 2L1CA 3PZDA 5FI0A 4MY6A 1V89A 3O96A 1FHXA 1WG7A 2IFSA 1LB1A 1I7AA 4TYZA 1UEFA 4HAYB 2DHJA 5HE1A 2DYQA 3ODOA 3MPXA 1K5GB 3T06A 1W1GA 2JP2A 2COCA 1WJMA 2R0DA 1SHCA 1M7RA 1MPHA 3D8EA 5HE3A 2Z0QA 2LULA 2J0JA 4F7HA 4HAUB 1XCGA 1FB8A 2AEHA 5DHAB 2N0YA 1ZC4B 3V5WA 4HB2B 2DLWA 4L6EA 1TXDA 4HAXB 4GN1A 1XR0B 3G9WA 2ROZB 3QWMA 5L81A 3QIJA 1FAOA 3A98B 3BJIA 2Y8GA 1J0WA 2GJYA 1AWEA 2QKLA 2MDXA 1LW3A 5CLLB 1ISNA 2Y7BA 2COFA 3HK0A 3SV1A 4KHAA 4IAPA 2DA0A 1ZVRA 3KZ1A 4HDOA 5D3YA 1DYNA 2P8VA 5DIFB 3SYXA 4GMXB 1UNPA 1W1HA 3ML4A 4TKNA 1QC6A 3NSUA 2D9YA 2P0HA 1GG3A 2I5CA 3HW2B 3ULCA 3PG7A 5DHFB 4WVFB 3KRXA 4KAXB 1DROA 2HTHB 4Y94A 4GMVA 3DXCA 2CY5A 3P6AA 1X11A 4F7GA 4WSFA 2OQBA 2I1JA 4H8SA 3CIKA 1RJ2A 5HE2A 3P7ZA 5J3QA 1M7EA 2ROVA 1U27A 1FGYA 2DFKA 1NU2A 4EMOA 2RUKB 3VIAA 5GOWB 5DI9B 2NMBA 3TVVA 1B55A 2YS5A 2DTCA 1OMWA 2PZ1A 4Z2NA 1FOEA 2COAA 4ZRJA 2L2IA 4GPTB 4GZUA 4PQ0A 1MK9B 5FI1A 1OY2A 2R09A 4HB4B 2K2UA 4HB0B 1P5TA 1EVHA 1PFJA 5D3VA 4A6FB 3GYOA 3PVLA 4A6KA 4WJ7A 1KZ7A 2K2JA 2KGXB 1Q67A 4KHOA 2LOZA 1XX0A 2IYBA 5D27A 5CLQB 2D9XA 1U5FA 2YS3A 2DKQA 2RNRB 2Z0PA 1U5DA 3FEHA 4HB3B 2UVMA 2RSGA 2YRYA 1U5GA 2UZRA 1W1DA 4HAWB 1X1FA 2YSZA 4NSWA 3ZVRA 1GC7A 4PNKA 3U8ZA 3TCAA 3FSSA 2AL6A 2J59M 1NI2A 4A6FA 2W2XC 4CHMA 1KI1B 5KQ4A 4EJNA 2EMSA 2GCLA 5LONB 1V5PA 2ADZA 3IVFA 4K2PA 2EMTA 2OTXA 1BTKA 1ZC3B 3ULBA 1X1GA 2J0MA 3AJ4A 5JP4A 1GC6A 4CHJA 2D9VA 4HAZB 4HATB 3DXEA 3A8PA 2D11A 2CODA
chains in the Genus database with same CATH superfamily
2W2XD 2CRFA 4CSQA 1QQGA 1WGUA 4D0NB 1EGXA 1V5MA 3A8QA 1U2BA 3ODXA 2D9WA 3FVCA 2E2XA 2FJUB 1EF1A 2D10A 2RLOA 3F5RA 2K49A 2NZ8B 5C6RA 1TJ6A 2YVCA 1P3RA 1J19A 2Y8FA 1H10A 1K5DB 3D8DA 3KRWA 1DBHA 1WGQA 3WA0A 4DXAB 5JHHA 1WI1A 3HSAA 1BWNA 1UNQA 2DN6A 2X18A 1Y19B 4CYEA 4KHBB 2EC1A 2CAYA 2Z13A 3HQCA 2YT2A 3X23A 2RVBB 4IOYX 3SUZA 5J3YA 2ELAA 2KUPA 4QJ4B 2P0FA 3AU5A 1XD4A 3PVWA 2HE7A 1BTNA 2K8EA 3SO6A 1DDWA 3TW1A 2G35A 4OT1A 1PMSA 4C0AA 4QJ5B 1X86A 1ZSQA 2H7DA 4MT7A 3RCPA 5D3XA 3TO1A 3VOQA 1BAKA 1ZM0A 1MIZB 2M14A 3CXBB 4DIXA 3KSYA 4YL8A 4IFSA 3F0WA 2RGNB 3AU4A 4B6HA 2FJLA 1FGZA 1OQNA 5DH9B 1DDVA 2KR0A 1NTYA 5D3WA 4NY0A 2EJ8A 2P0DA 2Q13A 1UPRA 1U5EA 4ZRIA 4KHBA 3BINA 3TFMA 4BBKA 2W2WA 2XQNM 3NWDA 3UZTA 3GYPA 4HAVB 4KVGB 4K17A 3LJUX 1XODA 1U29A 1WJ1A 2V76A 1V61A 3PSCA 2UZSA 5EFXA 1FHOA 2CY4A 1UNRA 3NWAA 1AQCA 1DDMA 1MAIA 2YT0A 2MWNB 2GS0A 3M1IB 2KUQA 1MIXA 2ELBA 2LYDA 3B77A 5JLJB 2Z59A 2I5FA 2LKOA 3PP2A 2D2QA 2QKMA 4HSIA 2D9ZA 2GCJA 3MDBC 1MKEA 3PEGA 2MKRA 2DHKA 5C5BA 1FHWA 2DKPA 3U7DA 1KZGA 5LOPB 1UPQA 3QBVB 2K00A 5KQ1A 2DYNA 2DX5A 4P7IA 2DX1A 1WVHA 3ZDTA 2Z4DA 1Y5OA 1EAZA 3N7CA 2YS1A 3U12A 4HDQA 2I1KA 4ZRKA 1MK7B 4A5KA 1H4RA 2J0KA 2N23A 1RRPB 1IRSA 4A6HA 1I2HA 1SGHA 4F7UP 1PLSA 5C79A 1P6SA 1TQZA 5HE0A 4D6WA 1Z87A 4DBBA 3WYFB 5KCVA 2RRFA 1N3HA 4K2OA 2H7EA 4YONA 2VRWB 1XKEA 1V88A 2MFQA 4HHVA 2D4QA 5C16A 4Z2MB 2LOXA 4DX8A 2LG1A 3D8FA 1E5WA 3ODWA 3PVUA 2BCJA 1X05A 4DX90 2M38A 4EKUA 1NTVA 4XWXA 2VKIA 2VSZA 4MK0A 2Z0OA 2ZPYA 3SNHA 3KY9A 3DXDA 2YT1A 1V5UA 2KCJA 4K81A 5C5BB 5J3TA 2KIGA 3FM8C 2YF0A 4GXBA 5JHGA 3OANA 2DHIA 2L1CA 3PZDA 5FI0A 4MY6A 1V89A 3O96A 1FHXA 1WG7A 2IFSA 1LB1A 1I7AA 4TYZA 1UEFA 4HAYB 2DHJA 2NBVA 5HE1A 2DYQA 3ODOA 3MPXA 1K5GB 3T06A 1W1GA 5M4YB 2JP2A 2COCA 1WJMA 2R0DA 1SHCA 1M7RA 1MPHA 3D8EA 5HE3A 2Z0QA 2LULA 2J0JA 4F7HA 4HAUB 2ZKMX 1XCGA 1FB8A 2AEHA 5DHAB 2N0YA 1ZC4B 3V5WA 4HB2B 2DLWA 4L6EA 5I2MA 1TXDA 4HAXB 4GN1A 1XR0B 3G9WA 2ROZB 3QWMA 5L81A 3QIJA 1FAOA 3A98B 3BJIA 2Y8GA 2R2YA 1J0WA 2GJYA 1AWEA 2QKLA 2MDXA 1LW3A 5CLLB 1ISNA 2Y7BA 2COFA 3NWFA 3HK0A 3SV1A 4KHAA 4IAPA 2DA0A 1ZVRA 3KZ1A 4HDOA 5D3YA 1DYNA 2P8VA 5DIFB 3SYXA 4GMXB 1UNPA 1W1HA 3ML4A 4TKNA 1QC6A 3NSUA 2D9YA 2P0HA 1GG3A 2I5CA 3HW2B 3ULCA 3PG7A 5DHFB 4WVFB 3KRXA 4KAXB 1DROA 2HTHB 4Y94A 4GOUA 4GMVA 1MI1A 3DXCA 5IRSA 2CY5A 3P6AA 1X11A 4F7GA 3DCXA 4QJ3B 4WSFA 2OQBA 2I1JA 3OHMB 2Z14A 4H8SA 3CIKA 1RJ2A 5HE2A 3P7ZA 5J3QA 1M7EA 2ROVA 1U27A 2GUMA 1FGYA 2DFKA 1NU2A 3A58A 4EMOA 2RUKB 3VIAA 5GOWB 5DI9B 2NMBA 3TVVA 1B55A 2YS5A 2DTCA 1OMWA 2PZ1A 4Z2NA 1FOEA 2COAA 4ZRJA 2L2IA 4GPTB 4GZUA 4PQ0A 1MK9B 5FI1A 1OY2A 2R09A 4HB4B 2K2UA 4HB0B 1P5TA 1EVHA 1PFJA 5D3VA 4L1RA 4A6FB 3GYOA 3PVLA 4A6KA 2KIEA 4WJ7A 1KZ7A 2K2JA 2KGXB 1Q67A 4KHOA 2LOZA 1XX0A 2IYBA 5D27A 5CLQB 2D9XA 1U5FA 2YS3A 4QXAB 2DKQA 2RNRB 2Z0PA 1U5DA 3FEHA 4HB3B 2UVMA 2RSGA 2YRYA 1U5GA 1ZYIA 2UZRA 1W1DA 4HAWB 1X1FA 2YSZA 4NSWA 3ZVRA 1GC7A 1T77A 4PNKA 3U8ZA 3TCAA 3FSSA 2AL6A 2J59M 1NI2A 4A6FA 2W2XC 4CHMA 5I2SA 4GNKB 1KI1B 5KQ4A 4EJNA 2EMSA 2GCLA 5LONB 1V5PA 2ADZA 4OSNA 3IVFA 4K2PA 2EMTA 2OTXA 1BTKA 1ZC3B 3ULBA 5LG4B 1X1GA 2J0MA 3AJ4A 5JP4A 1GC6A 4CHJA 2D9VA 4HAZB 4HATB 3HIEA 3NW8A 3DXEA 3A8PA 2D11A 2CODA
chains in the Genus database with same CATH topology
2W2XD 2CRFA 1EGXA 1QQGA 1WGUA 4D0NB 1V5MA 3A8QA 1U2BA 3ODXA 2D9WA 2E2XA 1EF1A 2D10A 2RLOA 3F5RA 2NZ8B 5C6RA 1TJ6A 2YVCA 1P3RA 1J19A 2Y8FA 1H10A 1K5DB 3D8DA 3KRWA 1DBHA 1WGQA 3WA0A 4DXAB 5JHHA 1WI1A 1BWNA 1UNQA 2DN6A 2X18A 1Y19B 4CYEA 4KHBB 2EC1A 2CAYA 3HQCA 3X23A 2RVBB 4IOYX 3SUZA 5J3YA 2ELAA 2KUPA 2P0FA 3AU5A 1XD4A 3PVWA 2HE7A 1BTNA 3SO6A 1DDWA 3TW1A 2G35A 1PMSA 4C0AA 1X86A 1ZSQA 2H7DA 4MT7A 3RCPA 5D3XA 3TO1A 3VOQA 1BAKA 1ZM0A 1MIZB 2M14A 3CXBB 3KSYA 4YL8A 4IFSA 3F0WA 2RGNB 3AU4A 4B6HA 2FJLA 1FGZA 1OQNA 5DH9B 1DDVA 1NTYA 5D3WA 4NY0A 2EJ8A 2P0DA 2Q13A 1UPRA 1U5EA 4ZRIA 3BINA 3TFMA 4BBKA 2W2WA 2XQNM 3UZTA 3GYPA 4HAVB 4KVGB 4K17A 3LJUX 1XODA 1U29A 1WJ1A 2V76A 1V61A 3PSCA 2UZSA 5EFXA 1FHOA 2CY4A 1UNRA 1AQCA 1DDMA 1MAIA 2YT0A 2MWNB 2GS0A 3M1IB 1MIXA 2ELBA 2LYDA 5JLJB 2I5FA 2LKOA 3PP2A 2D2QA 2QKMA 2D9ZA 2GCJA 3MDBC 1MKEA 3PEGA 2MKRA 2DHKA 5C5BA 1FHWA 2DKPA 3U7DA 1KZGA 5LOPB 1UPQA 3QBVB 2K00A 5KQ1A 2DYNA 2DX5A 4P7IA 2DX1A 1WVHA 3ZDTA 1Y5OA 1EAZA 3N7CA 2YS1A 4HDQA 2I1KA 4ZRKA 1MK7B 4A5KA 1H4RA 2J0KA 2N23A 1RRPB 1IRSA 4A6HA 1I2HA 1SGHA 4F7UP 1PLSA 5C79A 1P6SA 1TQZA 5HE0A 1Z87A 4DBBA 3WYFB 5KCVA 1N3HA 4K2OA 2H7EA 4YONA 2VRWB 1XKEA 1V88A 2MFQA 4HHVA 2D4QA 5C16A 4Z2MB 2LOXA 4DX8A 2LG1A 3D8FA 1E5WA 3ODWA 3PVUA 2BCJA 1X05A 4DX90 2M38A 4EKUA 1NTVA 4XWXA 2VKIA 2VSZA 4MK0A 2Z0OA 2ZPYA 3SNHA 3KY9A 2YT1A 1V5UA 2KCJA 4K81A 3DXDA 5C5BB 5J3TA 3FM8C 2YF0A 4GXBA 5JHGA 3OANA 2DHIA 2L1CA 3PZDA 5FI0A 4MY6A 1V89A 3O96A 1FHXA 1WG7A 2IFSA 1LB1A 1I7AA 4TYZA 1UEFA 4HAYB 2DHJA 5HE1A 2DYQA 3ODOA 3MPXA 1K5GB 3T06A 1W1GA 2JP2A 2COCA 1WJMA 2R0DA 1SHCA 1M7RA 1MPHA 3D8EA 5HE3A 2Z0QA 2LULA 2J0JA 4F7HA 4HAUB 1XCGA 1FB8A 2AEHA 5DHAB 2N0YA 1ZC4B 3V5WA 4HB2B 2DLWA 4L6EA 1TXDA 4HAXB 4GN1A 1XR0B 3G9WA 2ROZB 3QWMA 5L81A 3QIJA 1FAOA 3A98B 3BJIA 2Y8GA 1J0WA 2GJYA 1AWEA 2QKLA 2MDXA 1LW3A 5CLLB 1ISNA 2Y7BA 2COFA 3HK0A 3SV1A 4KHAA 4IAPA 2DA0A 1ZVRA 3KZ1A 4HDOA 5D3YA 1DYNA 2P8VA 5DIFB 3SYXA 4GMXB 1UNPA 1W1HA 3ML4A 4TKNA 1QC6A 3NSUA 2D9YA 2P0HA 1GG3A 2I5CA 3HW2B 3ULCA 3PG7A 5DHFB 4WVFB 3KRXA 4KAXB 1DROA 2HTHB 4Y94A 4GMVA 3DXCA 2CY5A 3P6AA 1X11A 4F7GA 4WSFA 2OQBA 2I1JA 4H8SA 3CIKA 1RJ2A 5HE2A 3P7ZA 5J3QA 1M7EA 2ROVA 1U27A 1FGYA 2DFKA 1NU2A 4EMOA 2RUKB 3VIAA 5GOWB 5DI9B 2NMBA 3TVVA 1B55A 2YS5A 2DTCA 1OMWA 2PZ1A 4Z2NA 1FOEA 2COAA 4ZRJA 2L2IA 4GPTB 4GZUA 4PQ0A 1MK9B 5FI1A 1OY2A 2R09A 4HB4B 2K2UA 4HB0B 1P5TA 1EVHA 1PFJA 5D3VA 4A6FB 3GYOA 3PVLA 4A6KA 4WJ7A 1KZ7A 2K2JA 2KGXB 1Q67A 4KHOA 2LOZA 1XX0A 2IYBA 5D27A 5CLQB 2D9XA 1U5FA 2YS3A 2DKQA 2RNRB 2Z0PA 1U5DA 3FEHA 4HB3B 2UVMA 2RSGA 2YRYA 1U5GA 2UZRA 1W1DA 4HAWB 1X1FA 2YSZA 4NSWA 3ZVRA 1GC7A 4PNKA 3U8ZA 3TCAA 3FSSA 2AL6A 2J59M 1NI2A 4A6FA 2W2XC 4CHMA 1KI1B 5KQ4A 4EJNA 2EMSA 2GCLA 5LONB 1V5PA 2ADZA 3IVFA 4K2PA 2EMTA 2OTXA 1BTKA 1ZC3B 3ULBA 1X1GA 2J0MA 3AJ4A 5JP4A 1GC6A 4CHJA 2D9VA 4HAZB 4HATB 3DXEA 3A8PA 2D11A 2CODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X D;  2CRF A;  1EGX A;  1QQG A;  1WGU A;  4D0N B;  1V5M A;  3A8Q A;  1U2B A;  3ODX A;  2D9W A;  2E2X A;  1EF1 A;  2D10 A;  2RLO A;  3F5R A;  2NZ8 B;  5C6R A;  1TJ6 A;  2YVC A;  1P3R A;  1J19 A;  2Y8F A;  1H10 A;  1K5D B;  3D8D A;  3KRW A;  1DBH A;  1WGQ A;  3WA0 A;  4DXA B;  5JHH A;  1WI1 A;  1BWN A;  1UNQ A;  2DN6 A;  2X18 A;  1Y19 B;  4CYE A;  4KHB B;  2EC1 A;  2CAY A;  3HQC A;  3X23 A;  2RVB B;  4IOY X;  3SUZ A;  5J3Y A;  2ELA A;  2KUP A;  2P0F A;  3AU5 A;  1XD4 A;  3PVW A;  2HE7 A;  1BTN A;  3SO6 A;  1DDW A;  3TW1 A;  2G35 A;  1PMS A;  4C0A A;  1X86 A;  1ZSQ A;  2H7D A;  4MT7 A;  3RCP A;  5D3X A;  3TO1 A;  3VOQ A;  1BAK A;  1ZM0 A;  1MIZ B;  2M14 A;  3CXB B;  3KSY A;  4YL8 A;  4IFS A;  3F0W A;  2RGN B;  3AU4 A;  4B6H A;  2FJL A;  1FGZ A;  1OQN A;  5DH9 B;  1DDV A;  1NTY A;  5D3W A;  4NY0 A;  2EJ8 A;  2P0D A;  2Q13 A;  1UPR A;  1U5E A;  4ZRI A;  3BIN A;  3TFM A;  4BBK A;  2W2W A;  2XQN M;  3UZT A;  3GYP A;  4HAV B;  4KVG B;  4K17 A;  3LJU X;  1XOD A;  1U29 A;  1WJ1 A;  2V76 A;  1V61 A;  3PSC A;  2UZS A;  5EFX A;  1FHO A;  2CY4 A;  1UNR A;  1AQC A;  1DDM A;  1MAI A;  2YT0 A;  2MWN B;  2GS0 A;  3M1I B;  1MIX A;  2ELB A;  2LYD A;  5JLJ B;  2I5F A;  2LKO A;  3PP2 A;  2D2Q A;  2QKM A;  2D9Z A;  2GCJ A;  3MDB C;  1MKE A;  3PEG A;  2MKR A;  2DHK A;  5C5B A;  1FHW A;  2DKP A;  3U7D A;  1KZG A;  5LOP B;  1UPQ A;  3QBV B;  2K00 A;  5KQ1 A;  2DYN A;  2DX5 A;  4P7I A;  2DX1 A;  1WVH A;  3ZDT A;  1Y5O A;  1EAZ A;  3N7C A;  2YS1 A;  4HDQ A;  2I1K A;  4ZRK A;  1MK7 B;  4A5K A;  1H4R A;  2J0K A;  2N23 A;  1RRP B;  1IRS A;  4A6H A;  1I2H A;  1SGH A;  4F7U P;  1PLS A;  5C79 A;  1P6S A;  1TQZ A;  5HE0 A;  1Z87 A;  4DBB A;  3WYF B;  5KCV A;  1N3H A;  4K2O A;  2H7E A;  4YON A;  2VRW B;  1XKE A;  1V88 A;  2MFQ A;  4HHV A;  2D4Q A;  5C16 A;  4Z2M B;  2LOX A;  4DX8 A;  2LG1 A;  3D8F A;  1E5W A;  3ODW A;  3PVU A;  2BCJ A;  1X05 A;  4DX9 0;  2M38 A;  4EKU A;  1NTV A;  4XWX A;  2VKI A;  2VSZ A;  4MK0 A;  2Z0O A;  2ZPY A;  3SNH A;  3KY9 A;  2YT1 A;  1V5U A;  2KCJ A;  4K81 A;  3DXD A;  5C5B B;  5J3T A;  3FM8 C;  2YF0 A;  4GXB A;  5JHG A;  3OAN A;  2DHI A;  2L1C A;  3PZD A;  5FI0 A;  4MY6 A;  1V89 A;  3O96 A;  1FHX A;  1WG7 A;  2IFS A;  1LB1 A;  1I7A A;  4TYZ A;  1UEF A;  4HAY B;  2DHJ A;  5HE1 A;  2DYQ A;  3ODO A;  3MPX A;  1K5G B;  3T06 A;  1W1G A;  2JP2 A;  2COC A;  1WJM A;  2R0D A;  1SHC A;  1M7R A;  1MPH A;  3D8E A;  5HE3 A;  2Z0Q A;  2LUL A;  2J0J A;  4F7H A;  4HAU B;  1XCG A;  1FB8 A;  2AEH A;  5DHA B;  2N0Y A;  1ZC4 B;  3V5W A;  4HB2 B;  2DLW A;  4L6E A;  1TXD A;  4HAX B;  4GN1 A;  1XR0 B;  3G9W A;  2ROZ B;  3QWM A;  5L81 A;  3QIJ A;  1FAO A;  3A98 B;  3BJI A;  2Y8G A;  1J0W A;  2GJY A;  1AWE A;  2QKL A;  2MDX A;  1LW3 A;  5CLL B;  1ISN A;  2Y7B A;  2COF A;  3HK0 A;  3SV1 A;  4KHA A;  4IAP A;  2DA0 A;  1ZVR A;  3KZ1 A;  4HDO A;  5D3Y A;  1DYN A;  2P8V A;  5DIF B;  3SYX A;  4GMX B;  1UNP A;  1W1H A;  3ML4 A;  4TKN A;  1QC6 A;  3NSU A;  2D9Y A;  2P0H A;  1GG3 A;  2I5C A;  3HW2 B;  3ULC A;  3PG7 A;  5DHF B;  4WVF B;  3KRX A;  4KAX B;  1DRO A;  2HTH B;  4Y94 A;  4GMV A;  3DXC A;  2CY5 A;  3P6A A;  1X11 A;  4F7G A;  4WSF A;  2OQB A;  2I1J A;  4H8S A;  3CIK A;  1RJ2 A;  5HE2 A;  3P7Z A;  5J3Q A;  1M7E A;  2ROV A;  1U27 A;  1FGY A;  2DFK A;  1NU2 A;  4EMO A;  2RUK B;  3VIA A;  5GOW B;  5DI9 B;  2NMB A;  3TVV A;  1B55 A;  2YS5 A;  2DTC A;  1OMW A;  2PZ1 A;  4Z2N A;  1FOE A;  2COA A;  4ZRJ A;  2L2I A;  4GPT B;  4GZU A;  4PQ0 A;  1MK9 B;  5FI1 A;  1OY2 A;  2R09 A;  4HB4 B;  2K2U A;  4HB0 B;  1P5T A;  1EVH A;  1PFJ A;  5D3V A;  4A6F B;  3GYO A;  3PVL A;  4A6K A;  4WJ7 A;  1KZ7 A;  2K2J A;  2KGX B;  1Q67 A;  4KHO A;  2LOZ A;  1XX0 A;  2IYB A;  5D27 A;  5CLQ B;  2D9X A;  1U5F A;  2YS3 A;  2DKQ A;  2RNR B;  2Z0P A;  1U5D A;  3FEH A;  4HB3 B;  2UVM A;  2RSG A;  2YRY A;  1U5G A;  2UZR A;  1W1D A;  4HAW B;  1X1F A;  2YSZ A;  4NSW A;  3ZVR A;  1GC7 A;  4PNK A;  3U8Z A;  3TCA A;  3FSS A;  2AL6 A;  2J59 M;  1NI2 A;  4A6F A;  2W2X C;  4CHM A;  1KI1 B;  5KQ4 A;  4EJN A;  2EMS A;  2GCL A;  5LON B;  1V5P A;  2ADZ A;  3IVF A;  4K2P A;  2EMT A;  2OTX A;  1BTK A;  1ZC3 B;  3ULB A;  1X1G A;  2J0M A;  3AJ4 A;  5JP4 A;  1GC6 A;  4CHJ A;  2D9V A;  4HAZ B;  4HAT B;  3DXE A;  3A8P A;  2D11 A;  2COD A; 
#chains in the Genus database with same CATH topology
 2W2X D;  2CRF A;  4CSQ A;  1QQG A;  1WGU A;  4D0N B;  1EGX A;  1V5M A;  3A8Q A;  1U2B A;  3ODX A;  2D9W A;  3FVC A;  2E2X A;  2FJU B;  1EF1 A;  2D10 A;  2RLO A;  3F5R A;  2K49 A;  2NZ8 B;  5C6R A;  1TJ6 A;  2YVC A;  1P3R A;  1J19 A;  2Y8F A;  1H10 A;  1K5D B;  3D8D A;  3KRW A;  1DBH A;  1WGQ A;  3WA0 A;  4DXA B;  5JHH A;  1WI1 A;  3HSA A;  1BWN A;  1UNQ A;  2DN6 A;  2X18 A;  1Y19 B;  4CYE A;  4KHB B;  2EC1 A;  2CAY A;  2Z13 A;  3HQC A;  2YT2 A;  3X23 A;  2RVB B;  4IOY X;  3SUZ A;  5J3Y A;  2ELA A;  2KUP A;  4QJ4 B;  2P0F A;  3AU5 A;  1XD4 A;  3PVW A;  2HE7 A;  1BTN A;  2K8E A;  3SO6 A;  1DDW A;  3TW1 A;  2G35 A;  4OT1 A;  1PMS A;  4C0A A;  4QJ5 B;  1X86 A;  1ZSQ A;  2H7D A;  4MT7 A;  3RCP A;  5D3X A;  3TO1 A;  3VOQ A;  1BAK A;  1ZM0 A;  1MIZ B;  2M14 A;  3CXB B;  4DIX A;  3KSY A;  4YL8 A;  4IFS A;  3F0W A;  2RGN B;  3AU4 A;  4B6H A;  2FJL A;  1FGZ A;  1OQN A;  5DH9 B;  1DDV A;  2KR0 A;  1NTY A;  5D3W A;  4NY0 A;  2EJ8 A;  2P0D A;  2Q13 A;  1UPR A;  1U5E A;  4ZRI A;  4KHB A;  3BIN A;  3TFM A;  4BBK A;  2W2W A;  2XQN M;  3NWD A;  3UZT A;  3GYP A;  4HAV B;  4KVG B;  4K17 A;  3LJU X;  1XOD A;  1U29 A;  1WJ1 A;  2V76 A;  1V61 A;  3PSC A;  2UZS A;  5EFX A;  1FHO A;  2CY4 A;  1UNR A;  3NWA A;  1AQC A;  1DDM A;  1MAI A;  2YT0 A;  2MWN B;  2GS0 A;  3M1I B;  2KUQ A;  1MIX A;  2ELB A;  2LYD A;  3B77 A;  5JLJ B;  2Z59 A;  2I5F A;  2LKO A;  3PP2 A;  2D2Q A;  2QKM A;  4HSI A;  2D9Z A;  2GCJ A;  3MDB C;  1MKE A;  3PEG A;  2MKR A;  2DHK A;  5C5B A;  1FHW A;  2DKP A;  3U7D A;  1KZG A;  5LOP B;  1UPQ A;  3QBV B;  2K00 A;  5KQ1 A;  2DYN A;  2DX5 A;  4P7I A;  2DX1 A;  1WVH A;  3ZDT A;  2Z4D A;  1Y5O A;  1EAZ A;  3N7C A;  2YS1 A;  3U12 A;  4HDQ A;  2I1K A;  4ZRK A;  1MK7 B;  4A5K A;  1H4R A;  2J0K A;  2N23 A;  1RRP B;  1IRS A;  4A6H A;  1I2H A;  1SGH A;  4F7U P;  1PLS A;  5C79 A;  1P6S A;  1TQZ A;  5HE0 A;  4D6W A;  1Z87 A;  4DBB A;  3WYF B;  5KCV A;  2RRF A;  1N3H A;  4K2O A;  2H7E A;  4YON A;  2VRW B;  1XKE A;  1V88 A;  2MFQ A;  4HHV A;  2D4Q A;  5C16 A;  4Z2M B;  2LOX A;  4DX8 A;  2LG1 A;  3D8F A;  1E5W A;  3ODW A;  3PVU A;  2BCJ A;  1X05 A;  4DX9 0;  2M38 A;  4EKU A;  1NTV A;  4XWX A;  2VKI A;  2VSZ A;  4MK0 A;  2Z0O A;  2ZPY A;  3SNH A;  3KY9 A;  3DXD A;  2YT1 A;  1V5U A;  2KCJ A;  4K81 A;  5C5B B;  5J3T A;  2KIG A;  3FM8 C;  2YF0 A;  4GXB A;  5JHG A;  3OAN A;  2DHI A;  2L1C A;  3PZD A;  5FI0 A;  4MY6 A;  1V89 A;  3O96 A;  1FHX A;  1WG7 A;  2IFS A;  1LB1 A;  1I7A A;  4TYZ A;  1UEF A;  4HAY B;  2DHJ A;  2NBV A;  5HE1 A;  2DYQ A;  3ODO A;  3MPX A;  1K5G B;  3T06 A;  1W1G A;  5M4Y B;  2JP2 A;  2COC A;  1WJM A;  2R0D A;  1SHC A;  1M7R A;  1MPH A;  3D8E A;  5HE3 A;  2Z0Q A;  2LUL A;  2J0J A;  4F7H A;  4HAU B;  2ZKM X;  1XCG A;  1FB8 A;  2AEH A;  5DHA B;  2N0Y A;  1ZC4 B;  3V5W A;  4HB2 B;  2DLW A;  4L6E A;  5I2M A;  1TXD A;  4HAX B;  4GN1 A;  1XR0 B;  3G9W A;  2ROZ B;  3QWM A;  5L81 A;  3QIJ A;  1FAO A;  3A98 B;  3BJI A;  2Y8G A;  2R2Y A;  1J0W A;  2GJY A;  1AWE A;  2QKL A;  2MDX A;  1LW3 A;  5CLL B;  1ISN A;  2Y7B A;  2COF A;  3NWF A;  3HK0 A;  3SV1 A;  4KHA A;  4IAP A;  2DA0 A;  1ZVR A;  3KZ1 A;  4HDO A;  5D3Y A;  1DYN A;  2P8V A;  5DIF B;  3SYX A;  4GMX B;  1UNP A;  1W1H A;  3ML4 A;  4TKN A;  1QC6 A;  3NSU A;  2D9Y A;  2P0H A;  1GG3 A;  2I5C A;  3HW2 B;  3ULC A;  3PG7 A;  5DHF B;  4WVF B;  3KRX A;  4KAX B;  1DRO A;  2HTH B;  4Y94 A;  4GOU A;  4GMV A;  1MI1 A;  3DXC A;  5IRS A;  2CY5 A;  3P6A A;  1X11 A;  4F7G A;  3DCX A;  4QJ3 B;  4WSF A;  2OQB A;  2I1J A;  3OHM B;  2Z14 A;  4H8S A;  3CIK A;  1RJ2 A;  5HE2 A;  3P7Z A;  5J3Q A;  1M7E A;  2ROV A;  1U27 A;  2GUM A;  1FGY A;  2DFK A;  1NU2 A;  3A58 A;  4EMO A;  2RUK B;  3VIA A;  5GOW B;  5DI9 B;  2NMB A;  3TVV A;  1B55 A;  2YS5 A;  2DTC A;  1OMW A;  2PZ1 A;  4Z2N A;  1FOE A;  2COA A;  4ZRJ A;  2L2I A;  4GPT B;  4GZU A;  4PQ0 A;  1MK9 B;  5FI1 A;  1OY2 A;  2R09 A;  4HB4 B;  2K2U A;  4HB0 B;  1P5T A;  1EVH A;  1PFJ A;  5D3V A;  4L1R A;  4A6F B;  3GYO A;  3PVL A;  4A6K A;  2KIE A;  4WJ7 A;  1KZ7 A;  2K2J A;  2KGX B;  1Q67 A;  4KHO A;  2LOZ A;  1XX0 A;  2IYB A;  5D27 A;  5CLQ B;  2D9X A;  1U5F A;  2YS3 A;  4QXA B;  2DKQ A;  2RNR B;  2Z0P A;  1U5D A;  3FEH A;  4HB3 B;  2UVM A;  2RSG A;  2YRY A;  1U5G A;  1ZYI A;  2UZR A;  1W1D A;  4HAW B;  1X1F A;  2YSZ A;  4NSW A;  3ZVR A;  1GC7 A;  1T77 A;  4PNK A;  3U8Z A;  3TCA A;  3FSS A;  2AL6 A;  2J59 M;  1NI2 A;  4A6F A;  2W2X C;  4CHM A;  5I2S A;  4GNK B;  1KI1 B;  5KQ4 A;  4EJN A;  2EMS A;  2GCL A;  5LON B;  1V5P A;  2ADZ A;  4OSN A;  3IVF A;  4K2P A;  2EMT A;  2OTX A;  1BTK A;  1ZC3 B;  3ULB A;  5LG4 B;  1X1G A;  2J0M A;  3AJ4 A;  5JP4 A;  1GC6 A;  4CHJ A;  2D9V A;  4HAZ B;  4HAT B;  3HIE A;  3NW8 A;  3DXE A;  3A8P A;  2D11 A;  2COD A; 
#chains in the Genus database with same CATH homology
 2W2X D;  2CRF A;  1EGX A;  1QQG A;  1WGU A;  4D0N B;  1V5M A;  3A8Q A;  1U2B A;  3ODX A;  2D9W A;  2E2X A;  1EF1 A;  2D10 A;  2RLO A;  3F5R A;  2NZ8 B;  5C6R A;  1TJ6 A;  2YVC A;  1P3R A;  1J19 A;  2Y8F A;  1H10 A;  1K5D B;  3D8D A;  3KRW A;  1DBH A;  1WGQ A;  3WA0 A;  4DXA B;  5JHH A;  1WI1 A;  1BWN A;  1UNQ A;  2DN6 A;  2X18 A;  1Y19 B;  4CYE A;  4KHB B;  2EC1 A;  2CAY A;  3HQC A;  3X23 A;  2RVB B;  4IOY X;  3SUZ A;  5J3Y A;  2ELA A;  2KUP A;  2P0F A;  3AU5 A;  1XD4 A;  3PVW A;  2HE7 A;  1BTN A;  3SO6 A;  1DDW A;  3TW1 A;  2G35 A;  1PMS A;  4C0A A;  1X86 A;  1ZSQ A;  2H7D A;  4MT7 A;  3RCP A;  5D3X A;  3TO1 A;  3VOQ A;  1BAK A;  1ZM0 A;  1MIZ B;  2M14 A;  3CXB B;  3KSY A;  4YL8 A;  4IFS A;  3F0W A;  2RGN B;  3AU4 A;  4B6H A;  2FJL A;  1FGZ A;  1OQN A;  5DH9 B;  1DDV A;  1NTY A;  5D3W A;  4NY0 A;  2EJ8 A;  2P0D A;  2Q13 A;  1UPR A;  1U5E A;  4ZRI A;  3BIN A;  3TFM A;  4BBK A;  2W2W A;  2XQN M;  3UZT A;  3GYP A;  4HAV B;  4KVG B;  4K17 A;  3LJU X;  1XOD A;  1U29 A;  1WJ1 A;  2V76 A;  1V61 A;  3PSC A;  2UZS A;  5EFX A;  1FHO A;  2CY4 A;  1UNR A;  1AQC A;  1DDM A;  1MAI A;  2YT0 A;  2MWN B;  2GS0 A;  3M1I B;  1MIX A;  2ELB A;  2LYD A;  5JLJ B;  2I5F A;  2LKO A;  3PP2 A;  2D2Q A;  2QKM A;  2D9Z A;  2GCJ A;  3MDB C;  1MKE A;  3PEG A;  2MKR A;  2DHK A;  5C5B A;  1FHW A;  2DKP A;  3U7D A;  1KZG A;  5LOP B;  1UPQ A;  3QBV B;  2K00 A;  5KQ1 A;  2DYN A;  2DX5 A;  4P7I A;  2DX1 A;  1WVH A;  3ZDT A;  1Y5O A;  1EAZ A;  3N7C A;  2YS1 A;  4HDQ A;  2I1K A;  4ZRK A;  1MK7 B;  4A5K A;  1H4R A;  2J0K A;  2N23 A;  1RRP B;  1IRS A;  4A6H A;  1I2H A;  1SGH A;  4F7U P;  1PLS A;  5C79 A;  1P6S A;  1TQZ A;  5HE0 A;  1Z87 A;  4DBB A;  3WYF B;  5KCV A;  1N3H A;  4K2O A;  2H7E A;  4YON A;  2VRW B;  1XKE A;  1V88 A;  2MFQ A;  4HHV A;  2D4Q A;  5C16 A;  4Z2M B;  2LOX A;  4DX8 A;  2LG1 A;  3D8F A;  1E5W A;  3ODW A;  3PVU A;  2BCJ A;  1X05 A;  4DX9 0;  2M38 A;  4EKU A;  1NTV A;  4XWX A;  2VKI A;  2VSZ A;  4MK0 A;  2Z0O A;  2ZPY A;  3SNH A;  3KY9 A;  2YT1 A;  1V5U A;  2KCJ A;  4K81 A;  3DXD A;  5C5B B;  5J3T A;  3FM8 C;  2YF0 A;  4GXB A;  5JHG A;  3OAN A;  2DHI A;  2L1C A;  3PZD A;  5FI0 A;  4MY6 A;  1V89 A;  3O96 A;  1FHX A;  1WG7 A;  2IFS A;  1LB1 A;  1I7A A;  4TYZ A;  1UEF A;  4HAY B;  2DHJ A;  5HE1 A;  2DYQ A;  3ODO A;  3MPX A;  1K5G B;  3T06 A;  1W1G A;  2JP2 A;  2COC A;  1WJM A;  2R0D A;  1SHC A;  1M7R A;  1MPH A;  3D8E A;  5HE3 A;  2Z0Q A;  2LUL A;  2J0J A;  4F7H A;  4HAU B;  1XCG A;  1FB8 A;  2AEH A;  5DHA B;  2N0Y A;  1ZC4 B;  3V5W A;  4HB2 B;  2DLW A;  4L6E A;  1TXD A;  4HAX B;  4GN1 A;  1XR0 B;  3G9W A;  2ROZ B;  3QWM A;  5L81 A;  3QIJ A;  1FAO A;  3A98 B;  3BJI A;  2Y8G A;  1J0W A;  2GJY A;  1AWE A;  2QKL A;  2MDX A;  1LW3 A;  5CLL B;  1ISN A;  2Y7B A;  2COF A;  3HK0 A;  3SV1 A;  4KHA A;  4IAP A;  2DA0 A;  1ZVR A;  3KZ1 A;  4HDO A;  5D3Y A;  1DYN A;  2P8V A;  5DIF B;  3SYX A;  4GMX B;  1UNP A;  1W1H A;  3ML4 A;  4TKN A;  1QC6 A;  3NSU A;  2D9Y A;  2P0H A;  1GG3 A;  2I5C A;  3HW2 B;  3ULC A;  3PG7 A;  5DHF B;  4WVF B;  3KRX A;  4KAX B;  1DRO A;  2HTH B;  4Y94 A;  4GMV A;  3DXC A;  2CY5 A;  3P6A A;  1X11 A;  4F7G A;  4WSF A;  2OQB A;  2I1J A;  4H8S A;  3CIK A;  1RJ2 A;  5HE2 A;  3P7Z A;  5J3Q A;  1M7E A;  2ROV A;  1U27 A;  1FGY A;  2DFK A;  1NU2 A;  4EMO A;  2RUK B;  3VIA A;  5GOW B;  5DI9 B;  2NMB A;  3TVV A;  1B55 A;  2YS5 A;  2DTC A;  1OMW A;  2PZ1 A;  4Z2N A;  1FOE A;  2COA A;  4ZRJ A;  2L2I A;  4GPT B;  4GZU A;  4PQ0 A;  1MK9 B;  5FI1 A;  1OY2 A;  2R09 A;  4HB4 B;  2K2U A;  4HB0 B;  1P5T A;  1EVH A;  1PFJ A;  5D3V A;  4A6F B;  3GYO A;  3PVL A;  4A6K A;  4WJ7 A;  1KZ7 A;  2K2J A;  2KGX B;  1Q67 A;  4KHO A;  2LOZ A;  1XX0 A;  2IYB A;  5D27 A;  5CLQ B;  2D9X A;  1U5F A;  2YS3 A;  2DKQ A;  2RNR B;  2Z0P A;  1U5D A;  3FEH A;  4HB3 B;  2UVM A;  2RSG A;  2YRY A;  1U5G A;  2UZR A;  1W1D A;  4HAW B;  1X1F A;  2YSZ A;  4NSW A;  3ZVR A;  1GC7 A;  4PNK A;  3U8Z A;  3TCA A;  3FSS A;  2AL6 A;  2J59 M;  1NI2 A;  4A6F A;  2W2X C;  4CHM A;  1KI1 B;  5KQ4 A;  4EJN A;  2EMS A;  2GCL A;  5LON B;  1V5P A;  2ADZ A;  3IVF A;  4K2P A;  2EMT A;  2OTX A;  1BTK A;  1ZC3 B;  3ULB A;  1X1G A;  2J0M A;  3AJ4 A;  5JP4 A;  1GC6 A;  4CHJ A;  2D9V A;  4HAZ B;  4HAT B;  3DXE A;  3A8P A;  2D11 A;  2COD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...