2YS6A

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
425
structure length
421
Chain Sequence
NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 421
sequence length 425
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ys6A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ys6A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ys6A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ys6A04
3GIDA 4EAAA 4O7LA 3JZIA 2GQSA 1KBLA 4MV4A 3LWBA 4TV9F 2PVPA 1EUCB 2NPOA 5CB4F 3WNZA 1E4EA 1OBGA 3KAKA 1VKZA 1JKJB 2XD4A 1PX2A 2YYAA 3NUAA 1M0TA 1UC9A 4MV1A 4DIMA 3RV4A 4ZHQF 2WYOA 3U9SA 4L1KA 4ME6A 2W6QA 3HO8A 3WO0A 4YAKB 1W96A 2I87A 2Z04A 4DLKA 4C5BA 4O7WA 3R5XA 4YJ2F 4C5AA 3MWEA 1CS0A 4FFPA 5BPHA 1CQIB 3VPBA 5EZYF 3KAJA 5D8DA 5C1OA 3HBLA 3TINA 1Z2NX 4HNUA 3SE7A 1JLLB 4TUYF 4YJ3F 4EA8A 5KX5F 5BPFA 1KJJA 2FPGB 1CE8A 4IHJF 2VPQA 2NU9B 3RUPA 3K5HA 3R5FA 1GSAA 3AX6A 2R82A 4MV6A 4O7SA 1EZ1A 4O7VA 1M0WA 5K2MA 3KALA 4EG0A 5BMVF 2NU6B 2YRWA 4NYEA 2W6PA 1GSHA 2ZDHA 1E4EB 4IIJF 4FFMA 5IYZF 5C1PA 2FPPB 2NU7B 3VMMA 3R23A 1KJQA 3TW6A 2R7NA 5JH7F 3BSSA 3TIIA 4FFNA 4EA7A 2GPSA 4MAMA 4MA5A 2QK4A 1A48A 3HB9A 4HQ6A 3I12A 2YZNA 4EGJA 2P0AA 2FP4B 2R6FA 3AW8A 2W6NA 3Q1KA 5CAEB 1DV1A 4WD3A 3OUZA 1Z2OX 1KJ9A 1DIKA 4MV3A 3MJFA 4RZQA 1I7NA 4FFRA 3JZFA 1EUDB 1ULZA 4M98A 4IWYA 2PN1A 4FU0A 2HJWA 5LP6F 4XYLB 2V59A 2PBZA 1M6VA 2V5AA 3E5NA 1EHIA 1W93A 2YRXA 5JVLA 4ZQIA 4EA9A 3UFXB 1BXRA 1VBHA 2DWCA 3BG5A 4YBZB 1T36A 2C00A 4O4HF 5JQWA 4IZOA 3JRXA 1C3OA 1OBDA 4O82A 2I80A 2W6ZA 3N6RA 2YS6A 4E4TA 5LYJF 2CNVA 1B6RA 1AUXA 1GGOA 4O83A 2YZLA 2J9GA 1AUVA 3QFFA 4MA0A 2HGSA 3JRWA 4M99A 1A9XA 4J6EA 4O4JF 2XCLA 1KEEA 2X0SA 5LXTF 4O7YA 1KJIA 2DIKA 4O4LF 2W6MA 2VHEA 5HBRB 3BFPA 5FNVF 4O4IF 4HNVA 2V58A 2ZDQA 3MWDA 4HNTA 4Y8VB 3R5HA 5LOVF 1SCUB 4O84A 1DV2A 3BSYA 4M9CA 2IP4A 4O86A 4FFLA 4ZI7F 2FPIB 3VA7A 5H80A 1KUTA 4M9UA 4O7NA 2QF7A 2CNQA 2YWVA 4XYMB 4MV8A 2W71A 2YL2A 4YAJB 1KC7A 3G8CA 2YW2A 5CA1F 5KKNB 2OLSA 3K3PA 2SCUB 1C30A 2GLTA 3Q2OA 2R7MA 3ORQA 2R86A 3V4SA 5JVDF 3TIGA 5LA6F 2NUAB 1B6SA 2R85A 4FE2A 3WO1A 2R84A 4O2BF 1GSOA 1WR2A 4MV7A 4O7TA 3ETHA 2DLNA 5GONF 2ZDGA 2DZDA 2VR1A 2YZMA 3U55A 3BSWA 3VOTA 4O7RA 1I7LA 1IOVA 3U9TA 1PK8A 3RFCA 2YS7A 5CA0F 2VQDA 2CZGA 3TQTA 2I8CA 4XX0B 4YB8B 3N8DA 4WBNF 2W70A 3LP8A 2FB9A 4QSHA 4O7ZA 2GQRA 4XZ3B 3V4ZA 1JDBB 1GLVA 1Z2PX 2R7KA 4I55F 1VBGA 2GPWA 2R7LA 1IOWA 4MV9A 4I4TF 3DF7A 3K5IA 2NU8B 5I47A 4FFOA 1JDEA 3VPDA 3R9RA 5HV6A 5C8YF 3G8DA 3ORRA 4IWXA 4HR7A 5DMXA 5J2TF 1UC8A 3VPCA 2R87A 3ETJA 2Z02A 3KREA 5JQGF 1CQJB 1EYZA 4TV8F 1KJ8A 3OUUA 1BNCA 4O2AF 2W6OA 3U54A 4EGQA 4EABA 4I50F 3GLKA 4ZOLF 4FGRA 4C5CA 2CNUA 3RV3A 2YZGA 4O81A 5J2UF 2CQYA 4GGMX
chains in the Genus database with same CATH superfamily
4ZVVA 1TO2E 3G0IA 4ND2A 2XRFA 1EAMA 4JQOA 1LSJA 4FLEA 3W8RA 2OP0A 2ZUEA 2XWPA 5K1ZA 1W52X 5AKLA 3VH1A 3BJIC 4F46A 4YDSA 3I72A 2A0YA 4JFRA 5H70A 2FWIA 4ZMRA 3D4PA 3SZ3A 2PRSA 2OAGA 3N7UA 2Z8YM 3DXXA 2AYYA 1NVGA 2ASJA 3KK0A 3IMFA 3WL5A 2ROQA 1R88A 2ZITA 1OKKD 3GB9A 1T1EA 3E7XA 3AR2A 4WAUA 3KAJA 3KKZA 3KUDA 3FRIA 4K28A 2C2WA 2UZ4A 1QF9A 4LRWA 5JXJA 3S55A 2H63A 4MYDA 1KJJA 4EG3A 4P38A 2D54A 3D6HA 1MOSA 5TB5A 1NRIA 5KMGB 1N32B 4IXWA 2JAXA 3AX6A 1XYYA 4OX9Y 1ZPDA 1P7VA 9ABPA 1IN4A 1EHYA 5K5EA 1TJ5A 4HZUA 5FPHA 4EHLA 5GQSA 2QP9X 4JLVA 1SKAA 1VE7A 2J32A 1W29A 4DEYA 1JQJC 1MRZA 2GCIA 2NZJA 1N5MA 3C7AA 3IE0A 2HO5A 4BBZA 2PH5A 3FPJA 2HK6A 2VK1A 3HB0A 1HE5A 3KETA 3UHJA 3PZPA 4Q3BA 4G85A 4ENQA 4WZ6A 3R8FA 4EJMA 1IXKA 4YMWA 2MDTA 3BD6A 1MT3A 3W5VA 1CJKC 2IP1A 1CE8B 5F35A 4C2UA 3DQQA 5IAEA 2GN1A 4LYAA 3RVBA 3AV0B 5CYFA 2IE0A 4FCCA 3PHCA 1DIHA 4AFNA 1AQJA 3QOFA 4DWJA 1RYFA 1CJSA 2FUEA 2IOFK 4O08A 2Q3DA 3RR5A 3STWA 1PU2A 4HNQA 2PYDA 1H9BA 3LUAA 2R8YA 3I34X 5ARDA 4GKKB 3BREA 3A58B 4UM9B 1M1ZA 4ZTBA 3KAQA 3KT6A 5ALWA 4BRWA 4BWFB 2Y3IA 1FCJA 3RQIA 2Q8NA 1VDMA 4PZZA 4IEFB 2IXFA 2VATA 1RDFA 2XZOA 3T1OA 4HAWA 1DG3A 5IFKA 2NXWA 4MRPA 1SD5A 3I01A 1KFKB 2QRLA 5KYUA 4LJYA 3D43A 1AK2A 2Q1YA 1O94A 5DYWA 5K8CA 3ICOA 3SX0A 3ZHXA 1QYWA 4WI1A 5CB4B 1YQEA 3BL6A 3F73A 4JYCA 4ZZ3A 1O08A 3TQRA 5T5QA 3DNMA 3E84A 1PT7A 1V8ZA 3DTTA 2NUAB 1B2LA 4MV5A 4GGPA 1QH8B 2IY9A 4P93A 4O6VA 3ENZA 4IXTA 1RAGA 4XVQA 4F3TA 3HDYA 3RS4A 2F9MA 1HDOA 2O4UX 2CZGA 3GEMA 1G3IA 3T12A 4IFTA 3BQNB 3CNEA 2B5WA 2N47A 2Z2XA 1KGDA 3HXPA 3HLKA 3HKDB 4P7FA 1ZUD1 4JR1A 1IK6A 2OG2A 5FTKA 2B1GA 1ISJA 4NK5A 3OQ6A 3KVNA 2EU8A 3I0MA 2HOQA 1KRXA 2XNDA 2Y0CA 2VA3A 2OT3B 1DRKA 4HL6A 4HLUA 3SVTA 3T8YA 2WZQA 1LI7A 2GAJA 2PV0A 2MOKA 3AM1A 2X4DA 1KJ8A 2QYZA 2UVPA 1VCMA 4CKWB 2JDIA 1XWWA 2VRCD 1TU0A 2YYZA 3KKKA 3J81A 4ZVTA 1J2EA 1UANA 3KUXA 1A7JA 5EEGA 3G9XA 1U80A 3JVVA 1WHTA 1PQYA 3COJA 4LWPA 4MLPA 4DLNA 5IWAB 3LYUA 4AIRA 3TR5A 1LBHA 1G4AE 4HMQA 4EGSA 3EZLA 4QXMA 1I2CA 4CIVA 3RD5A 3T9FA 1CCWA 2BTEA 5AICA 5ED4A 4XVRA 1PDOA 1C4WA 3PI6A 1QP0A 4RHTA 3CLSC 3TQQA 3L41A 1JHQA 1F0KA 3K0CC 4C7OA 1ORDA 5CA1A 2JCXA 1ZGJA 1DEAA 1JWAB 2Q0HA 1Z2NX 4WXEA 3MMPA 2IWHA 5CPBA 5G0TA 4JJGA 5JVDA 5C0OE 1U04A 4DG8A 1XL1A 3F46A 3QFSA 4W5RA 3KLNA 4GI2A 1TYCA 2HTFA 1M8PA 1W7AA 5CX1B 2AG5A 4JP2A 4HVTA 3ZBTA 1QO0D 1TF2A 3MINA 4WN9B 4EQZA 3G2OA 5K2OA 4F4WA 5G1NA 4RTKA 4NJOA 4OHBA 3L3BA 2D1RA 5KFVA 4DABA 1RBZA 4LTDA 2JFVA 1E94E 4IS2A 4ECYA 3D2BA 4JB8A 1HZJA 5TQ0B 4ENUA 3J81k 2ZUCA 5ILGA 4CQNA 1ZJ5A 4F6LA 4JBLA 3VR5A 5AP9A 2BGUA 1HDYA 1RHUA 2QYTA 3W5CA 4BZPA 4R2KA 9ATCA 2AOUA 4RVGA 2CW8A 3UV7A 1CEXA 1THGA 5M29A 4E14A 4KQCA 5A7HA 1MUUA 4Y6QA 4J0IA 3JPWA 4NBUA 4P3OA 4WOJA 1FXSA 3GAZA 3C24A 4MCAA 1E1RD 4DXDA 4D02A 1J4AA 2WTEA 4WLVA 1B8OA 1E7WA 2OD9A 4P7BA 1ZJ4A 4M9ZA 4ZQFA 4G0UA 1MDBA 1XD8A 2XIGA 4UVHA 5AM4A 4IWNA 3WK8A 1MQ8B 3REFA 2ZSUA 2VHXA 1G16A 4TVBA 5C46F 3E15A 3GFQA 4JI5H 3K9QO 4HI0E 2BF4A 3U5ZB 3TUIC 2AS0A 2G88A 2P6MA 4Z4IA 4MVYA 1RHRA 2CV0A 2BI4A 3NS7A 4PWQA 1NYQA 4W6QA 5DM4A 4NARA 3U19A 2ZYAA 3QJGA 2RIRA 1EE9A 4MITA 1AD2A 1YRBA 4U7WA 3V2GA 1RACA 3TIGA 4EUSA 3K70D 2FTKE 4DYHA 3PRYA 4MW1A 3OEHD 1KF0A 2WKSA 4BAZA 4DPMA 2CVZA 5JAIA 2G07A 2QP4A 5GM2A 3GQBA 5BSFA 2IH2A 2YXEA 3X2SA 4ASUA 3VOTA 4O7RA 3GTKA 4XFDA 3QEMA 4OREX 5BNIA 1YFKA 4PS0A 4DL7A 1X1EA 4DG5A 5E2BA 3GCGA 1L8OA 3UTCA 5AOVA 4HWOA 3DAGA 3NYRA 2H92A 5AXBA 4HX5A 3PIRA 1NXVA 3QF4A 3C4VA 4QTXA 3U6BA 4JD5A 5G4LA 4YLYA 4QARA 1YR1A 4PGHA 3I2KA 1N7IA 2O2DA 5AVSA 1PEKE 4DYDA 3U4AA 4G4SP 1A4UA 4D9FA 3RU9A 3WNDA 4D3DA 1OI4A 4ILKA 3VVCA 4PQRA 2FWMX 2GT1A 1VI5A 3GOQA 5JH7B 4EJ6A 1OBOA 3OCJA 3W2EA 5IANA 4H4DA 4TWBA 1U11A 1Q0RA 2Q5OA 3B82A 4OBBA 1DHTA 3D7RA 1UKZA 4E4RA 1ZCJA 3JWPA 2NPOA 2OD2A 4K6CA 2PEZA 4J2TA 3OZXA 1UR5A 4KRYA 2GH1A 4CM1A 3PR1A 3JQFA 1Z5GA 4RB2C 1XGKA 2FE4A 3FJOA 4ME6A 2OV4A 3QYFA 4RUAA 1VZ2A 3KKQA 2CFCA 3M5CA 6YASA 4HLCA 2Z6AA 1LLUA 3FDJA 4Z9AA 3CQ9A 1HEIA 4R8VA 2JGAA 2B63A 4GBED 2G0NA 4KLZA 2QVCA 1FFHA 3OM8A 4XIFA 1ZJ6A 2AV6A 1XZFA 3RYFB 3I61A 3SBDA 5F1KA 5BSWA 1G20A 3QA9A 2XHZA 2AEFA 2JFXA 3LC7O 3OWHA 3GRPA 2D3TA 1E98A 2OYSA 4FT2A 5AXAA 4C07A 2HNKA 1MC1A 1UM8A 5SICE 3HPQA 4QYWA 4DZRA 1M2OB 4XUCA 3K1YA 3L46A 1NW8A 1O94D 3ZGYA 3AF5A 5JS7A 2JFQA 2F1JA 5ARBA 3TNYA 4XVUA 1T8SA 3QWUA 4ZFNA 2YV5A 1ZAUA 5C8YA 4OXXA 1EDBA 3IUNA 4F3RA 1KJ9A 4DIFA 5DBHX 3BWXA 1UOEA 4YAUA 2J5RA 2CDRA 4FR2A 3K73O 4HQFA 4A2QA 4OHRA 4UCUA 5MN6A 2PD6A 2JD0A 3VTZA 2QAGC 2DWOA 4HGYA 1VBHA 2XDWA 5IVKA 1L3IA 3GFPA 1NY5A 4MLDA 3DKIA 3ZWQA 4RTRA 1TB4A 2W57A 3DWEX 3VSCA 1H9AA 3QA3E 1RK5A 1U2DC 3RUHA 2KWIA 3KYDA 3QI2A 2GZ2A 3R41A 4NNPA 3FSGA 3D6AA 4HB3A 3RRZA 2NVBA 1E63A 3T54A 1T9GR 1NT4A 5ISMA 4H4EA 4X93A 1VPTA 4C2BA 3NPMA 2QNIA 3GJXC 2NZUG 4ZYVA 1KZHA 4DR3H 3E53A 4OB6A 1RJPA 4LGYA 4S1TA 4RXUA 2LE0A 3ETCA 3D64A 3UK1A 4AYXA 3LPAA 1QZXA 2X0EA 5A62A 2FVXA 2DQ4A 4YV2A 1SC9A 3ZLBA 3DKRA 4HNAB 4G1FA 3CBQA 2QIPA 5CEEA 1OZHA 4LYJA 5CU7A 2VYVD 1NUSA 5F5LA 3D4OA 5G1PA 4HAVA 3COZA 3NJ4A 2XCRB 3S68A 3UCEA 4YIHA 1H4QA 3C43A 2HQRA 4B87A 3PKJA 1T3SA 4NU6A 2FKAA 2GDJA 2DFKB 1VLJA 4LF7B 1XYVA 1PW7A 2DLNA 4NENA 1JHDA 2OUKA 2ZTLA 1F2UB 4DRZA 4JIGA 5MDHA 3JU3A 3U7FB 1DC8A 3OCVA 2PL3A 5MFPA 1CRPA 1T2VA 4PSUA 2ZUVA 2EP5A 1FOEB 4PGMA 1ZNYA 5COBA 5T67A 2BRUA 4H6XA 2ID4A 4YRFA 2C03A 2NU8B 1Q2XA 4W7HA 2ZR8A 3Q88A 4KBYA 1JLMA 2WA1A 1AXEA 2PV7A 1U31A 5KQPA 3GZJA 1C1DA 2AN1A 3NC4A 2D4HA 4PF1A 3OUUA 3GAAA 4BXOB 2EJ3A 1K98A 4ZVUA 1D9XA 4O8ZA 3JQ7A 3MR6A 2G7MC 5AVOA 5G3ZA 1KAMA 1D2CA 5KWEA 3KLPX 4ZDJA 4X3PA 1YHYA 1L5OA 1XRQA 1OYYA 5EE0A 1YRQA 1Y3CE 4DCOA 1O0BA 2NMVA 1UM9A 4EYHB 3FOCA 4RD6A 2HK7A 3QBJA 5T3UA 3D2LA 1XVLA 2IHZA 3BH0A 2Q3FA 3J7AK 2GAOA 2PUCA 5C52B 3HO8A 1FVXA 4NV3A 4WFIA 3HYCA 3HCBA 4V1CA 1IE3A 2LVBA 4J7CA 3KPVA 1K0UA 2KPOA 4ZDWA 3WKDA 2W9CA 3U3KA 4DN6A 2ZYDA 2FN9A 5IM5A 4M1EA 3PNKA 3TVDA 4H7IA 1DAGA 3FZEA 3OESA 2EW8A 4J16A 5EPUA 2R1VB 1GAQA 2OENG 4KRXA 4REOA 2JHGA 3UJPA 4TTRA 1GUBA 1MNQA 5DWQA 5JCZA 3GRYA 4AVYA 5JARA 3BFKA 1AS0A 3VZQA 1X2BA 5FD5A 2QRUA 4M22A 2UUBB 3RAPR 1R0YA 2CXXA 4P4UA 2I62A 1ETHA 1JQBA 3VNAA 2OBFA 2HC9A 2H48A 3AW9A 4IILA 3JQAD 3OLZA 3X2FA 3UGKA 2BGRA 4CLEA 2WAMA 3KTMA 3VO8A 1UQUA 4FGLA 3KL4A 1Y7PA 2WI8A 4QT4A 2GPSA 2GXQA 2QW8A 3BXPA 3I4MG 4OU4A 3KZXA 4OVKA 2F67A 1A8QA 1D2AA 2E3JA 5EE1A 2J5KA 1I4OA 2J0UB 3ZCUA 1YC2A 3C5WP 4RKFA 2O23A 3D1VA 5LQNA 4RHXA 1PDVA 2WUEA 4XB1A 2FCAA 3ZWBA 1C4XA 4XYBA 3QVKA 2Q5HA 3WC4A 2QBYB 2JGLA 2BHSA 2J8ZA 1S89A 4X8OA 1WTCA 3QNUA 4I8IA 4PANA 4LNHA 4UTOA 4GE3A 5HUJA 4XI9A 3NUQA 1Q1GA 5B12A 1KI6A 1BXGA 5EYPB 1V7QA 3KSBC 4OYYA 4UNNA 3FCXA 1HM5A 8GPBA 3CJQA 2G6BA 2J07A 2J7PD 1WUIS 1B0UA 4XIJA 1YIOA 3DMTC 4KL8S 4KE7A 2RGGA 2FU5C 1OXBB 1C9DB 4GF5A 3L0BA 1OQAA 4GPZA 2WC1A 3OE4A 2JHCA 3MNFA 3ZEAA 5B2FA 2VK4A 4OFBA 1Z2AA 2ZWPA 1MAHA 1PJAA 1Z17A 3AF6A 4AKGA 5A4DA 5FWXA 3NBXX 2DIKA 4LYYA 2RAVA 2A2ZA 3T3EA 1X38A 4RPJA 5HSGA 1J00A 3T9DA 1YBVA 1AKVA 1QYDA 4IKPA 3WA7A 4XGRA 5HS4A 1UEXC 1QWOA 4B3JA 4G4SO 3WA6A 4OXYA 1T6XA 3TQOA 1JLRA 1E6EA 2CDAA 2B4TO 4AKHA 2H1OA 1Z4NA 2GLTA 2RF4A 2JFUA 3RCBA 1M5RA 4EF5A 1V5EA 1DJMA 4K6FA 4XR4A 1DC7A 1LW6E 3ZE7A 1GSOA 3ETHA 1KAHA 3R75A 4DUZB 4KNVA 1QYVA 3D8NA 3CVYA 3JYOA 2R2GA 2DKNA 4BKRA 2PU7A 4FIZA 1BYIA 2DLCX 4I55F 3O4RA 2FRDA 3H2YA 5E6SA 4IHJB 3BMCA 1QFXA 3GJ5A 4LOIA 1V11A 2W4IA 2QT1A 4QTZA 1P5FA 4LRSB 4B7CA 4W9RA 3V5NA 4KN9S 1XB2A 2XRYA 3B70A 3C5HA 1C30B 1NVVQ 2RI6A 1NR1A 4TV8F 3TQFA 2H2GA 1ZD2P 1Z6ZA 2ZKIA 1JJVA 1KQOA 4UTNA 4LUCA 4UUGA 1ZICA 4RD4A 4PNZA 1W1WA 2PYZA 2IRWA 3EXHB 2WWWA 1RAIA 4Y2HA 3WGJA 2XQJA 1T5LA 4PCVA 3OOWA 1AQYA 3CLHA 1RZUA 4PHFA 4JLPA 3LAWA 3OX2A 4P0TA 1RC1A 3UAVA 5KFJA 3FDIA 4F2GA 3H3JA 1VL2A 2ILVA 1YCFA 2G36A 1ITZA 4I81A 3W2GA 1NBMA 2FSHA 1M7HA 2V74B 3SOZA 3LOUA 3UZOA 2BFCB 4WGGA 3THXB 4K3UA 5FOXA 1PI3A 1G9SA 3OP4A 3W06A 3IB3A 1BRMA 5BPHA 1RSZA 1U3WA 3JD2A 3DEZA 1ES9A 1TO6A 2QLTA 4UHKA 4Z1OA 2VSOA 2GZHA 2J3DA 2C2ZA 5BWLA 4R2XA 1CU1A 4ZQCB 3FYSA 4MB6A 2F8MA 3THWA 3BJRA 4H08A 4NEHB 4OQEA 3WWZA 2G5TA 4NCHA 3VDQA 3ECAA 3NP9A 2UUAB 2C57A 3FDXA 3BMQB 2Z83A 1KI1A 4CC6A 4E22A 5KFUA 1RI5A 2B30A 4QU8A 1KHTA 5JJLA 1ZH6A 4A2AA 4WBNA 4C0QC 3M89A 2NX2A 5AJZA 3CTPA 3ODGA 4ZZIA 3OQOA 5J5VA 2JANA 3T1HH 5FDFA 4DDHA 3NNNA 1M67A 3SU8A 1E2BA 4DQLA 1Q84A 4A2WA 1Q0LA 5EKDA 1NW7A 4DMLA 2HUPA 2C7PA 4LY3A 1E2PA 5K8IA 3M6MD 1JRLA 2BBTA 1KIFA 2FMHA 5E6RB 3B85A 2JLXA 4IR7A 1V1MA 3AF3A 1VZ3A 2Y27A 1DWOA 3BWVA 5LYJF 1JS1X 1P19A 2JHPA 3HC7A 4IGEA 4RNOA 1GGOA 5HDQA 5BNFA 4C88A 1RM5A 1BGWA 5KSZA 1GGKA 4Q3AA 3GZTB 4E3ZA 2PLFA 4IGKA 2O7NA 1JB9A 4YRZA 4RAYA 4DA0A 1KMHA 3CH7A 1AH2A 2C5SA 3KVRA 3F98A 5IX8A 3WQSB 5C4IA 1UDXA 3QX9A 2JIZA 3R9XA 3ZZ1A 3H83A 1EWKA 5JQGB 4CIDA 1K75A 2KLBA 2VWPA 4Z7OB 4A0RA 1K1QA 3ROGA 4OHYA 2CNQA 4D56A 4LSZA 4F3YA 4QJFA 3UJ9A 3F5FA 1NP3A 1NBME 3H0KA 2GFQA 3CVZA 1EFPB 3FNEA 5D5PA 3U5TA 4W7SA 3AHIA 2BFDB 4QT0A 5KWSA 4DR1B 1I36A 4AJ4A 3OE7D 5LA6F 4KXNA 5KFFA 3D2AA 3BERA 5B7NA 2REQB 2WJPA 3NC0B 2FCRA 3OJXA 2NZYA 4P7JA 3TTYA 2FFJA 2WSBA 3ST7A 4J9SA 2PT9A 3K0SA 2R7ZG 2JG3A 3RBAA 2GXUA 3WL8A 1UBMS 3WWIA 2ZXFA 2RGUA 3PJGA 4Y6LA 5A4KA 2R7KA 3QUTA 4EYGA 5AW5A 2HMUA 2YXPX 3KHSA 4BUJA 5I9MA 1PDWA 4WASA 4L5AA 3H6GA 3I09A 4LI3X 1ZD8A 3JR7A 5LIPA 4RAQA 2ERCA 4JEHA 2G6TA 2VAPA 3HVKA 3ETEA 4N48A 5IM4F 1E6CA 4ZTZB 1U28C 4JV0A 1YI8A 4X1YB 3W9UA 2CMGA 1T0HB 3TJMA 5IKPA 1WV1A 3CF6R 3IOMA 3OCWA 3ZDQA 1AG9A 4NFSA 5BOSA 1U3CA 4D9NA 4Z51A 3GNTA 4RS3A 5HQTA 3T7JA 2OXTA 1Y8AA 3NAGA 3SI8A 5LMNH 5HXAA 3GZNB 3D3WA 2BPOA 3BQ9A 1R3UA 2A0XA 5K3SA 3P9ZA 1Q0HA 3D0OA 2WRZA 3UWOA 5AM2A 3VTFA 1U3FA 2DF8A 5DI3A 2XTNA 1CUSA 4U63A 2GJAA 4ZI7A 4CDMA 1A96A 1JYFA 5A6SB 3V6KA 4L28A 1WPGA 5LL6P 5M2QA 4Q1AA 1RC0A 4PNPA 2V7TA 4EECA 1AB6A 4DCVA 4V0MA 1ZM2A 3K0EA 1OKKA 1X14A 2I4TA 4FILA 3K8YA 5ITZA 4KI7A 1Z08A 3IV7A 4EPWA 2ZBDA 2H2HA 1YFZA 4MVJI 3WK4A 3P9XA 3C15C 5HCNA 3CX8A 3LRXA 3AUFA 1RQ7A 2EAUA 2OBNA 5PGMA 3DKKA 2BP7A 4RK7A 4CQMD 5L1KA 5GIPE 3T9AA 1E3TA 3MRXA 4M21A 3OJ0A 1GQRA 3FCSB 3RHTA 2HLDD 4G5OA 1QIMA 2BOVA 2ZYWX 2QHXA 4FT4A 1TIKA 4KMSA 4EB6A 5JJBA 2XB2A 2XTMA 3EDCA 1R0WA 2TMKA 4ZCSA 5KT7A 4BLPA 2ORED 2H4XA 2XEDA 2H3HA 3CH4B 1BGXT 3NTUA 1KK0A 2ASVA 1QP4A 4EUHA 1CFZA 3L43A 3KKEA 1NW4A 3PGJA 3N0WA 2ZR7A 1SO8A 2FGKA 1W93A 4ZQIA 1VJRA 5ULLA 2OY0A 4QQKA 5TX7A 1NW9B 2AFHA 2GUGA 2ZM5A 1X15A 1FIUA 3NAQA 1IY0A 2EKDA 1HLPA 1YNOA 4JJEA 2B78A 1YU6A 2ZB8A 2QJTA 1GZ6A 2FK2A 1B2RA 5H3LA 1NRXA 4HNGA 1JIUA 3K15A 4WVFA 3ETLA 2QI9C 1DLJA 2AFIE 3O0DA 1Z0UA 4KQHA 2BZ0A 4O4JF 4YJ2A 1W9MA 4MUFA 2HHHB 2GM5A 2OCYC 1OA1A 4DMFA 4A5SA 4C08A 5BNTA 4RULA 1U4SA 2R8ZA 2CMDA 3NHRA 1WUJS 3R5HA 1BVYF 4X00A 3GFBA 4JQYA 4I99A 3G0DA 5IMBA 1AUQA 4BKOA 3NT5A 4D9KA 1PT8A 1AUPA 1FNDA 5TGDA 4M8KA 3IULA 2H2IA 3T5AA 4QSMA 1Z4QA 2FAXA 2DWQA 3NM6B 3DO5A 2CL0X 3M4ZA 1ZCZA 3M9XA 4O0MA 3KR9A 5I9TA 3NXSA 4QAJA 1L4EA 3GJZA 3UK6A 2DQYA 3LT0A 4F2PA 1Q16A 4RJ2A 4DDTA 1RHQA 3BQMB 3N8NA 3CVJA 3VKHA 3KL2A 1MMFB 2SBTA 2Z3ZA 4URUR 1F4PA 1JV2B 3LVFO 1ZM7A 3IPRA 3U9TA 4X9XA 4EA6A 3DCJA 4CT5A 3N2EA 2HHAA 3GTQA 4IRCA 3OPVA 1SN7A 4XZ3B 3JARA 4Q9IA 1Y4AE 1S8AA 4BZXA 4MWDA 2XZDA 2R8GA 2C61A 3JWIA 2A94A 2WK1A 4MV9A 1DUVG 1UINA 3DT6A 1Q50A 1V4VA 4ACAA 4JROA 3VR2D 1SCBA 5DXAA 2DCMA 3MGAA 4L4YA 1QSGA 1IYEA 2YKGA 4CM4B 5HJ5A 2BUCA 2VH2A 1QWSA 1BFKA 2RDJA 2C2YA 3KREA 2OOSA 3FNHA 2VJNA 4ZQGA 4BQFA 3IFSA 3U54A 1PLKA 1GTMA 3K05A 5IRCD 3I58A 1U1EA 1OA0A 3QUAA 1IM2A 2XQGA 4AULA 1X42A 2NPIA 4EAAA 6REQA 4IO1A 4B2IA 2CSUA 3SX4A 2BGJA 4G3IA 3AB7A 5BR7A 1ECFA 1JFFB 1YUMA 5J3JA 1Y3DE 3IAM1 1C0KA 2CF6A 1XTZA 1X2EA 3I5MA 3A05A 1H1TA 2P11A 4LJKA 3PFNA 2WJ4A 1WPXA 1K1EA 2PGDA 4L78A 3FNQA 3W1GA 4FIDA 3FWKA 1AXGA 4AZ0B 1RXWA 2HA5A 5AJWA 3GWGA 4ZOAA 2ZS9A 3ZCPA 3LPCA 2HSZA 4QYMA 1ZCFA 3N8GA 4FYYA 2FLWA 2NT3A 5KX5F 4N3BA 2FZCA 4GVLA 3ZLVA 3CVXA 1E7RA 2F6RA 1TAEA 1E61A 3PVXA 4DMRA 5BWUA 2UYCA 1NNEA 1FYDA 4J7UA 4DZTA 2X0IA 1K5GA 4J6FA 4FQ5A 3DPUA 1NLUA 4JIMA 4R5MA 4O0LA 1VLLA 2ETVA 3W79A 1LBSA 4LPSA 3MRVA 1GKYA 1K8XB 4OB7A 3CEHA 3EXFB 5K09A 3EYYA 3NBUA 2IHBA 3VSEA 5JANA 3DVLA 3RAGA 4I4CA 1P5HA 1T0PA 1XEXA 3FTNA 3EC1A 4MWSA 4EKYA 1Q3KA 1QO0A 4DWWA 4A5OA 5AH0A 2GCPA 4WD3A 4B3CA 4C43A 1EUYA 2CYBA 2VBGA 1K89A 1NL3A 2Q99A 1J22A 2X1MA 4HQRA 1GEEA 4P1ZA 4I50A 1GCGA 1ZXBA 4FD3A 2PGJA 2X15A 3NDRA 2LIPA 1KVQA 4MS1A 3DWIA 4OUDA 4E2ZA 3E0XA 1TNDA 3I1IA 3C3JA 3Q7SA 5B3KA 2YC4C 4OHMA 2GKOA 5B58T 1J8QA 3ZJUA 2AL7A 4X64H 4QKQA 1AM4D 4DV3B 3L4BA 2Q4RA 2C3PA 1U0OC 3WGVA 1ZO8A 4DV0H 2R79A 2GZ3A 3NXKA 3UOAB 3V3KA 3V8NA 2IIVA 1KR2A 1PHPA 2JVKA 3F2VA 1SUWA 1Z47A 1N33B 2CLDX 1EVQA 2RJOA 2XB8A 3ZC3A 1XWFA 1C7IA 3ZDBA 1YOBA 1ZD9A 2VOJA 4PC1A 1YRYE 2WE7A 4LZOA 2W6MA 1V71A 1CVLA 4ZAVA 4GGOA 5C1BA 5TF0A 3BK7A 3DM5A 1GAWA 2YIMA 4MCHA 4MV0A 5EKXA 3L6BA 1W4RA 4FR5A 3R09A 3LPMA 2WVAA 4F3KA 3C8DA 3KM0A 2II6A 5EP3A 1R8YA 2UAGA 5I4KA 1MXFA 2AE2A 1UMDA 3TFWA 1VM6A 2HIHA 4WZBE 3WMWA 2F17A 1P2FA 5JWOA 3SF8A 5A4AA 4BCCA 2VBIA 4D6YA 4HCJA 1YAJA 4C29A 1HYBA 5CDTA 1TC2A 3DPSA 3IEMA 4PZDA 4QRDA 3OOEA 3B36A 3MUFA 1XK6A 3ULKA 4ZHQB 1ZGHA 2Q9BA 3RM3A 3GTGA 1TYEB 4MGHA 4BLWA 2FQ1A 3B7WA 2R11A 3AC0A 1KEEB 4MGYR 5DNUA 3T15A 3UHPA 4BE7B 5FWDA 1B04A 3OEHA 3ZBPA 2XBLA 3V2HA 1UBNA 5HFJA 1I94B 3DAPA 1RZVA 5C34B 1IOWA 3TZEA 3H4MA 5KS8A 4Q3LA 4JI4H 3KSMA 2LW7A 3G2NA 3IR7A 4WN3A 3USES 1EVLA 2VHQA 3LD9A 1T2UA 2O3RA 4E07A 1UK9A 4NDNE 3EPHA 5CLJA 1EM8B 1VMIA 1X1AA 1U6KA 4MQEA 4UBLA 4Q9HA 4LSXA 1F2TA 1Z0IA 5FFFA 2RFLA 4RCYA 2FSVA 4XYGA 4D79A 1JFTA 2PGXA 3F8WA 1MAAA 2GEDA 2X6TA 2ZU6A 2B8EA 4GPIB 3NGDA 3RIZA 5DLYA 1RXUA 3VU9B 1SM4A 4Q66C 2RGAA 4Q6BA 1PK9A 5AK3A 1HBJA 3FCOA 1OI7A 3O4GA 1NI4A 2NU7A 1S2OA 4R5HA 2YYAA 3IAXA 2I1VB 4W5JA 2AN3A 1EJ0A 5B3LA 1FYWA 3EYAA 3WTCA 2AX4A 2LGJA 3TEMA 3MT9A 4R9VA 4KR2A 4ZOEA 4MKHA 4QOJA 3SM3A 2V4UA 3WLRA 5HILA 3DR5A 2FRXA 2R1UA 4GUDA 1AIPA 1C1HA 3LFUA 4RCVA 3O4IA 1V6SA 4U8GA 2ZBQA 3CJTA 2R62A 2GBFA 4YMVA 1EUDA 1L8QA 1YV9A 5A7FA 2VCHA 1HG1A 4F6RA 3RUFA 3D6FA 3ZX5A 4CKBB 1F6DA 2IIBA 3GLVA 4XPIB 2J3LA 2W0SA 1NHWA 4A10A 5CXQA 1GZDA 5K6TA 3FWHA 3TTWA 3BQ1A 1ZY2A 2WMDA 5J4YA 2PIAA 2FMKA 2VKQA 1HC7A 4PPGA 1QK4A 2OC4A 3BRCA 2H29A 1JAIA 1G0OA 5KG4A 1ZS9A 4W1QA 4TKVA 1YB7A 3WRYA 5B3JC 3U4CA 2PT7A 3MHTA 1GPH1 5DM60 3CZ9A 4RFSA 4QHYA 4MJXA 3V8VA 4EUKA 2X8JB 2NG1A 3B6ZA 4JI2H 2HI0A 1N5RA 4NWIA 3VR0A 4ENVA 4LV5B 3O95A 2CUTA 5CHEA 1NVMB 2PUHA 2C1EA 1K83A 4LDZA 2WSYB 2FPIA 1WMBA 2NVUB 3PW0A 1TVKB 2X3UA 1Z5ZA 5B7GA 2PTGA 1VLMA 4J0QA 1DC3A 1T36A 4O4HF 3T3HA 4MGIR 2D0IA 1A9ZA 1M74A 3DPIA 4MLCA 2CKMA 2RCNA 3TZCA 1RRPA 1P1FA 4LKOA 3V2IA 3OBIA 1N8KA 1OZFA 5CVEA 1K6XA 3TR0A 3JYNA 3PDIA 3ZHOA 1VFPA 5D1OA 5TXGA 1ZBDA 4I6GA 1VIDA 1QC5B 4BVGA 1XR3A 3CT4A 3EXEA 4I7EA 3SJ7A 4C3OB 1XCLA 1SC1A 4K0RA 3DJYA 3LWDA 3ZWYA 1NQTA 4EY5A 5JTTA 4CYMA 3EPLA 3P4UA 3MWDA 3I1JA 1RI4A 1V6AA 4I5FA 1P7WA 4GM0A 4X6LA 2B8NA 4QWEA 2JIMA 1J1IA 2ZIXA 1J09A 1HQYE 4HLNA 3HUTA 4CLOA 2WAYA 1PJSA 5K05A 2QLMA 4NCXA 2SCUB 1SUBA 1NN3A 1ZK0A 1TM1E 4WDQA 2PTHA 3JQCA 4CKZA 1KQPA 3WZLA 2VYVA 4GXTA 4FC6A 5NULA 2W98A 4U2FA 3EEQA 3ZG6A 2O59A 2OCKA 4OI2A 1A9XB 5P8WA 2WJGA 3EXIA 2QTHA 3VPHA 2JZNA 1CB0A 1OLXA 2VP2A 4OJYA 5EZYB 1C8KA 2WJIA 2XE7A 2YZ2A 3SPXA 4K6NA 3LXXA 4UULA 3C0KA 2E87A 2F3RA 5C7LO 2WDPA 2EWMA 1HR0B 1OX5A 2OXCA 1N2XA 4RACA 3W5DA 1O6BA 2AGPA 1AKUA 1T0JB 3HEAA 3IP9A 4D81A 1QRTA 5FPTA 2JIDA 3AYHB 1NBIA 1IXZA 3A0RB 4E5PA 1DZ3A 4OMCA 1WA5A 1BNCA 3NDIA 3MSCA 4U2KA 4LGCA 3HH8A 4CTJA 1R6VA 4EHNA 3I9NA 5JCPA 1M34A 3L0OA 1VG1A 2ARKA 1JAXA 1EFLA 1HTWA 1IEWA 4LF4H 3KHLA 4BNDA 3BCRA 4A3DG 2UZ0A 1O9HA 1PFGA 3OQPA 3T9EA 1R64A 3LOPA 3OZ7A 3PPXA 3HKEB 1IRIA 4AN0A 4CKXA 4ZO9A 1N8TA 3C87A 2A86A 4O7WA 4C4PA 1UDWA 4BFWA 5CIYA 3GVXA 3JQGB 2D13A 2O14A 2YWGA 3KQTA 5BR8H 3KT0A 1NZJA 4NYIQ 1N9GA 2BUBA 4RANA 1O9GA 3TE7A 3EOZA 1E5VA 2AJLI 5FPQA 5KYGA 3A70A 4P35A 3NEPX 3HI6A 1X9HA 1ZC3A 3WOVA 4J91A 5JCXA 1GRCA 3O8OA 2GO7A 3KU4A 3RB3A 3I32A 5IH7A 4WOPA 3I9FA 1NW5A 3OT1B 2JHAA 2JFOA 5J5AA 4B6OA 4NP6A 2N0SA 3VH3A 4WKBA 2ZBEA 3KP1A 4R2LA 3R7NA 4MR8A 3FTEA 4QXAA 1YKFA 3ROEA 3M1IA 3RYHA 1PFWA 3ELUA 5E38A 4JC5A 7AT1A 1H6DA 3VSBA 1UJNA 3FLEA 1J5EB 1GUDA 2XBMA 3M6AA 1JDSA 2VQEH 3WSTA 3H1FA 3X1MA 1FJGB 4UTXA 4UCSA 3N8HA 4EA7A 5JRZA 4YPVA 1Y3AA 3E7PA 3G59A 1F5NA 4ARIA 3QX3A 3AWIA 5AUPB 3JQAA 1XDGA 1S2MA 3N5KA 1KNXA 4Q3OA 4M2LA 4YIKA 5T57A 3PS9A 1THMA 5HZKA 4RADA 5BN4B 4I46A 2FDRA 2WT9A 1V96A 4KODA 3X0DA 4AIIA 1PSWA 4M98A 5JNSA 2PH7A 4IVRA 4XYLB 2IY7A 1ZD1A 2VBCA 4HDKA 4J1TA 4HOYA 5KFSA 4R9UC 2EBWA 3LZCA 2VRNA 2GDZA 4K8OA 5KKAA 1KIMA 4JJ4A 5HEKA 3OZUA 3MOSA 3T6KA 3GMDA 4CCWA 4HQOA 3WP1B 3FD8A 4BGEA 3IIJA 1WRVA 4OQMA 5AOAA 1T4MA 2O6HA 1THZA 1V3TA 3HCRA 2VDRB 2QA5A 1KI2A 4ODIA 4CG2A 2X9QA 4XLLA 2H1LA 3QUQA 2OV2A 4EEXA 2J7PA 1Z12A 4EG5A 4RPKA 4R8LA 3BIWA 1UCFA 4KFCA 4Z7NB 3PYLA 4P7KA 1R16A 2A4MA 3O38A 3EFBA 3GJ8A 1XVVA 1NVUQ 4J4HA 4TRRA 3D7SA 2IV2X 2X5RA 4X95A 4O84A 3HY3A 4OYHA 2O1XA 2PL5A 4CG1A 2Z2IA 4KJXA 3K9CA 1G60A 1I9CA 2RONA 3ILXA 1WVGA 1MQ9A 2QRNA 4EARA 4X20A 4PPQA 2G76A 2IEBA 5ENZA 2J31A 4K9LA 5SZKB 4R0MA 4RLSA 1G8GA 3K3PA 3L7AA 2XMSA 1M1YA 5AHWA 3PC3A 4GMXA 3BVPA 1KMNA 1Q1AA 5BSVA 3HACA 2OEPA 3ZNPA 1E0DA 4LVUA 2RHDA 1NTRA 3CURA 2AQ4A 1SIOA 4PQYA 1PJ8A 1X92A 4RK1A 2MTBA 5FL7D 5JZSA 2ZIUB 3TQTA 3MD0A 1DBWA 3GIKA 4UOQA 2FB9A 1TKCA 4W99A 1JIKA 4BFUA 1JDBB 3IVRA 2LBPA 1AO3A 1G1AA 1LNZA 1NMSA 2F3SA 4N01A 4EX6A 2C9OA 1B00A 3H05A 2FOIA 1QP8A 3VPDA 3QMPA 4ZVMA 1L4LA 1RXVA 1UKYA 4F21A 5ETJA 4CUZA 1L5MA 2UXCB 3EWIA 3SJAA 4BO8A 3UAOA 2X6QA 3SG0A 3D6MA 4DHWA 4UASA 3S1AA 4B6JA 5FJ8G 1KI9A 2O0LA 4C4OA 3DHEA 1SD1A 2WTNA 5DTMA 2A5LA 3VPSA 3W6ZA 3PQ4A 4H0FA 1KH2A 2BELA 2J3IA 3T5TA 5E1OA 1XMVA 4JLBA 1SYXB 4QDJA 5HUQA 1TIPA 4D3FA 4BVJA 4NBVA 3B5JA 3GUZA 3T7KA 5L40A 5FI3A 1GL6A 3DCNA 3OSPA 1QCZA 4UEJA 4DSUA 3FYUC 1JA9A 5E6UB 3C4JA 3LRTA 1YE5A 5KTKA 1QCDA 2RHHA 2H0RA 1JDVA 4N5IX 1BCSA 3FW1A 2X8WA 4QECA 1U2GC 2EBUA 3MC1A 4EW2A 1KRHA 3T9BA 1ZHSA 1GT91 1OIWA 4J7XA 1KBZA 3TPFA 1H22A 4RF4A 3NHKA 5LQMA 1MJGM 2WEKA 4YTEA 1CRWG 2G0TA 1SVLA 4LF9H 1E4EB 5TS2A 3RABA 2H9AA 2P41A 2ACWA 5DX1A 3TEJA 4S1NA 4M53A 1DJPA 1MB3A 3CWQA 1M1YE 1B93A 3CO5A 4RZUA 1EUZA 3GFGA 4HRAA 2V1XA 3TNJA 3K5WA 3BHNA 4QNNA 3SHVA 3PUIA 2XBUA 5DSZA 1ET0A 1Q92A 3PHLA 1VKHA 2H16A 2ES4A 3KYBA 2VP9A 5BUQA 1SA0A 1E3IA 4TVSA 4DL5A 1X1CA 4O2AA 2V5AA 2WVGA 5EQDA 3C3EA 3H2IA 4PBTA 2P9EA 1S1CA 2HV8A 5ALJA 3EOBI 1ZINA 4WFQA 5F1OA 2V4ZA 1Z0AA 1DELA 4CEHB 4RQTA 5E0OA 1R5OA 1TWHA 3N6RA 1WOYA 3QLUA 5EWJB 1G20E 4G23A 3IP6A 1JAYA 3N2GA 2FMFA 1Y6ZA 2PO5A 5D1NA 3QGMA 1GZ7A 4HFNA 3OSUA 4R81A 2OBBA 1QPZA 4LRQA 2WTAA 3LUKA 1AKWA 1L7PA 4P5DA 4YUWA 2OORC 4IEIA 1YHZA 3V2UA 2RARA 1LDBA 3D5TA 1N6RA 2IITA 3KT8A 2OP1A 1KJWA 2XA2A 3ETNA 1XTPA 2I1WA 2O0KA 2FW8A 5AJXA 2A78A 4M7RA 2M1XA 4D9HA 5DT2A 2E21A 4FFLA 4FKBA 1P9RA 4UUAA 3FMPB 5H80A 2F64A 5FIUA 4E70A 1CBUA 1YR8A 1Q7EA 3CE9A 1IN5A 5T14A 2P2CA 3RFTA 4MYHA 2ALZA 3L7BA 4R1MA 5KOJA 4FNMA 3EGDA 3N2NA 4E94A 3ZW8A 5HF5A 5A5VA 4MYRA 4WX2B 2D5AA 4CCSA 2NWQA 3DVQX 1FUIA 1M76A 4LDQA 2WKQA 4JSTA 3RTDA 2IEZA 1Q1BA 3EPGA 1IIRA 4W1RA 2XWQA 1U0RA 4OHCA 1L4FA 3MLEA 1TT7A 3R7DA 3OE7A 3F4BA 4UD2A 1ISHA 2V6BA 1O1YA 2B61A 3ZZMA 1FYFA 4KNWA 1IHUA 5KWJA 4XARA 2GQRA 3PNVA 4RQAA 4TUYB 1M75A 3PL1A 1CZLA 4INZA 3UAWA 1DDGA 3TI7A 2YJ4A 2H6EA 3NKFA 2DBVO 5I9NA 4UHDA 4DVGA 2JI9A 1PUJA 3U7QB 1PUIA 2OG1A 1X77A 4BMNA 4IDFA 1CY6A 2OECA 4PQFA 1WCIA 1QGOA 2ISCA 3I05A 1L1FA 4WXPA 3IEKA 2P4EA 3PJFA 3QY9A 3ABOB 2JAOA 1JG4A 1XTVA 4JI8B 4LJ5A 4TOIA 2XUZA 1RMQA 3R0XA 4C6RA 4EHFA 4G0MA 3DG9A 3A3PA 1XZPA 5FA8A 3UXMA 3EH1A 4RK6A 2ONJA 2VHVA 4Z99A 3RHFA 3I83A 3U7IA 3NT4A 2ORVA 1WP9A 1KNQA 4MJ3A 3ZNNA 3GL9A 1STOA 3EIOA 5I5TA 3ET5A 4EL0A 1OWMA 1A5SB 3W1EA 4BUCA 3HNRA 1Z82A 3R2JA 5JMOA 1J0EA 1KEKA 1FSFA 2GRUA 3C7TA 1BIFA 1T3NA 1ZHOA 2FG5A 2J59A 2DQZA 2PGLA 2PUWA 1OREA 3EA5A 3ZGNA 2XGQA 3CEBA 2M2IA 3DAAA 1W88B 5HKKA 2O2HA 2XWJI 5A0FA 4OP3A 1N36B 3DEIA 5DJ5A 1X9IA 5JAQA 3AEYA 4O4LB 2O8EA 2WQ7A 1DCMA 2B5OA 2CB0A 4ZV9A 2QX7A 5IC4A 3QKWA 4Q5IA 2R6ZA 5KDLA 3G5MA 5CW1A 4PZ8A 4CQMA 1O6FA 3MTIA 1DAHA 1O95C 5EIEA 3C3XA 3CX3A 1KEZA 4RHYA 2AQIA 2HLDA 2GWRA 1R6BX 3HEMA 1Z3IX 4Z9XA 1TGVA 3HJAA 3QPCA 1CY8A 4R2JA 5CMLA 3VR1A 1L7AA 1BAPA 1KAGA 3C7KA 2F8SA 2VWGA 1Q7TA 4IPTA 2BMJA 1Q91A 1NNSA 2VTVA 4EDFA 2HR1A 1EP2B 2XYQA 4AROA 4FZRA 4WTOA 1QTRA 3SQMA 1VBMA 5CEFA 2WWFA 3WLLA 3HK2A 5K3EA 2WAOA 1TCBA 4GKBA 3ND6A 5K3WA 4CFYA 1WW8A 2YCBA 1XA3A 1G5FA 1KKLA 4QJIA 5FQOA 4I4TB 1YZFA 1L5VA 2JK1A 2GMWA 1SGWA 2C9YA 3O3MB 1LI5A 3RSGA 4X91A 3KB6A 3PP8A 4PLGA 3ZU3A 1YACA 3BFPA 5EKTA 3PFFA 3EG9B 2NM0A 1QX3A 2CXNA 1KFCB 5BSMA 4Y8VB 3QUBA 4QBIA 5B7PA 4UBKA 3ZUGA 2VJDA 1P1IA 3ZK8A 2FSUA 1OJLA 3TAUA 2O6LA 2NXEA 3ELBA 3TG8A 3DCYA 1G7SA 4UM8B 2E48A 1YQUA 2VP5A 3IHLA 1Z26A 2FQWA 2Q3LA 2AMLA 1S3IA 1U5BB 2ZUBA 1MQSA 5IYZA 2EKLA 3AI7A 5BR1A 1R5JA 3F8TA 1F48A 3PXBA 3TMYA 1O97C 2FDXA 1SBTA 1KRWA 2BYTA 1Z13A 2YNMD 4ALMA 4CI0B 2PCJA 4Q15A 2R00A 4TLDA 1WJGA 4DFDA 2HBZA 3DBRB 3PHHA 2EFCB 4MQ4A 3LCJA 1RWPA 3F67A 4JH0A 1KE1A 4L5YA 2GKGA 3Q0EA 2IUEA 1MAUA 2HW8A 3MQ2A 4O2BA 1ICEA 4G8CA 5EUMA 5J2TF 2ZJ1A 4RSGA 1TJYA 4DR7B 3W7BA 3IALA 3ZBUA 3Q6MA 3CR7A 4RAZA 3OICA 2Z5LA 1DCTA 3H9QA 1LGYA 4YWHA 3VR2A 3P9CA 1Z6QA 4P4LA 3JAMW 1QTQA 1P29A 3Q41A 1KTVA 1D2MA 5ITWA 3AM5A 3N5CA 4F4XA 5GPBA 3LMKA 1SVUA 4JI0H 2YHIA 3HMKA 3GFTA 4CF6A 1GRVA 2EXXA 5ENDA 2D2FA 4GKJH 2O8VA 4JASB 3IYLW 2JA5G 1RIFA 4RNMA 5LP6B 3BGWA 4LNUB 1I14A 2HL6A 4JCOA 2G0AA 4LXHA 4LOJA 3V1KA 2OUIA 2Y0DA 1J99A 3HDJA 4JR2A 5GTDA 4EY8A 4JEIA 4YH1A 2MYUA 1B73A 3BDIA 3ZQ4A 4U7FA 1FYXA 3N07A 4NFYA 4OLFA 2RKBA 1EDEA 4ARZA 3B48A 2FPGB 3GV7B 2KLHA 4M9QA 3AY3A 4XR9A 3THRA 2HSDA 2N46A 3QNWA 3KTOA 2O8DA 1LI4A 4US0R 1Z29A 3WMGA 3W7AA 4KAJA 2XE4A 5ALVA 1CLEA 2VT6A 3KZ1E 9LDBA 4Y1RA 4O5OA 2JJMA 5GJWC 2V7UA 4ZK2A 5LOVB 1C0EA 1DTEA 5J4LA 1D2EA 3AQ4A 2B1JA 3CT6A 3O84A 2RH5A 3DO6A 5CCEA 1CJCA 3A4IA 4YHHB 3FNFA 5C4GB 4LG1A 4F4JA 2JCGA 1E3WB 4RY9A 4G26A 4HH0A 4F85A 5KFEA 3C5EA 4M7PA 1DG1G 1KT8A 4GLJA 4N1AA 2BAGA 6ADHA 5C44G 4M0CA 2YWRA 3GIWA 3DZDA 1KP2A 2ZRLA 3OIYA 1GZSA 1T5DX 1NPYA 4URZR 1T3LA 3P0JA 5IS2A 3JSNA 1VLHA 5U9CA 4EVSA 4BY7G 4PN7A 4HLDA 2ZBGA 3NHAA 2JLBA 1JG3A 1USIA 2ENUA 1TWFA 1IJKA 1IZ8A 5KJEA 1SZCA 3JCZA 4B4DA 4G56A 2JGRA 1E7YA 3THYA 2IYNA 4B84A 1GTVA 2QGZA 5IJAA 3QNMA 1FRZA 4BV9A 4BFZA 4HYEA 1NN1A 2UYGA 2XMGA 4YQFA 3HU3A 4GEGA 1TKRA 5EP4A 2CXUA 4PYKA 3NVAA 2EZUA 1L4GA 5CW2A 2A58A 4DV1H 5CVVA 4NJMA 3NYWA 2NNWB 4R51A 3QELB 2AEEA 2WF8A 5DYIA 1HYHA 3GMTA 3R74A 3BA6A 4DLRA 4G6ZA 1ABBA 4TYQA 1V2GA 1PJ3A 4L8FA 4J0GA 1S6YA 2C3MA 4KAXA 4F5WA 2JI8A 4PSKA 3KYCB 5AW2A 2DABA 4I5GA 4QUKA 3ZE8A 4A8HA 5CGZA 1Q22A 1ESCA 5DAAA 4DR5H 2B69A 3HVJA 4X3OA 3LDFA 5DG9A 4GMDA 3LJKA 3Q15C 3FR8A 3CNHA 3PTAA 1KTAA 1NOKA 4Q9DA 4BKMA 3ND8A 2AHRA 2C31A 3O2NA 4JZKA 1MQAA 4HF7A 4LOAA 4X6UA 1UBCA 5JSQA 1ZVKA 5C5JA 1JYEA 1MW9X 1P44A 4BGUA 5HKKD 4Q9KA 4II2A 1S0NA 3E3AA 5F77A 4L3OA 1Y3HA 2ZANA 3WICA 3AEQA 1A5BB 2UVUA 1GGFA 5FOSA 3TRKA 2FJPA 1TA9A 4C01A 2X5NA 2AN5A 3OQJA 1JQDA 4QUEA 2HHLA 1Q1EA 3I2IA 1GLGA 3MJVA 2AG6A 1NBEA 1GT6A 1Y1RA 1Z5UA 5FWYA 3T1YB 1Y3BE 4MKXA 3OJOA 3STUA 8ABPA 3HDTA 2JGMA 3IDAA 2IV7A 4LF8H 1ZNWA 4UDYX 1JDNA 3BJEA 3CRVA 4WNAA 4I4IA 4TV9F 4URXR 1L6IA 1S03G 3P96A 1VL8A 3GNSA 4NU5A 1OBGA 1GPYA 4I3FA 2GF2A 3QHPA 3S7ZA 2B21A 4YGYA 3NUAA 5IFLA 5LMZA 2X3YA 4R9SA 1Y4ZA 3U9SA 4KO1S 3BDAA 4PR0A 3OD5A 2C0CA 1I3KA 2HHFB 5PNTA 2G71A 3QWHA 4D80A 1DQYA 3I04M 3PLRA 5DHAA 3A27A 3AJEA 3NWEA 1XZQA 1JBEA 3GYBA 1JLLB 4EX7A 3T3DA 2XMQA 3DTVB 2DHQA 1P73A 3RUPA 5A04A 2CN1A 4B2YA 3H2BA 3R9KA 4C6SA 3LUHA 3ID6C 4LMAA 3VXKA 3BBPA 2P27A 4HQNA 5E2AA 5CR9A 4JT4A 2YV2A 1VIMA 1UXGA 3K6SB 3VMMA 4INPA 4HSEA 3WRXA 3TVTA 2C5BA 4NULA 4C7KA 3HS3A 2IODA 3G7NA 4MTEA 3IVCA 4H1UA 2X9VA 4GOND 3A3YA 2WU1A 5BY2A 3S24A 4ZYUA 3HWRA 4HDRA 4HTFA 4NEQA 5EXEA 1DIOB 4REQA 5BRNA 2R6FA 1QX4A 5C5DA 4R83A 1KYVA 1LDEA 3HWWA 3ECSA 4KK4A 4O2RA 2Z1MA 1U7WA 4Q1CA 3G5TA 2VUUA 3DEFA 4ZDIA 4V1CI 2HJWA 3K5PA 3G2QA 3IDOA 1B76A 1KVRA 3L8GA 4A91A 1C5KA 4V0ME 4RZ2A 3VYVA 5FPYA 1YJ5A 2NNLD 4K6HA 2COUA 4MRVA 3WLPA 4DTCA 1MABB 4RTSA 2E4WA 2J9FB 3QVGB 4WZZA 3T5KA 3OFVA 3P4XA 1UZUA 1NIPA 2PO7A 1ZBQA 4D4MA 5DO9A 4X1IA 4DBZA 2ZZKA 4ZV4A 3ZU2A 1WDMA 2VIIA 5KYWA 5HKBA 5L6LB 3TDNA 2QYHA 2EHJA 2X9GA 4H6PA 3MCAA 3PGA1 2OXIA 3PEWA 3FI9A 5IVIA 1SU7A 3KQQA 4QFDA 2W93A 3R7SA 2QNRA 1Z5WA 3U80A 1Q7BA 4AS2A 1U8TA 1YT5A 2OB1A 2VYNA 5KFTA 1IXYA 1ZN9A 4R8MA 1SVWA 4GMFA 2IYAA 3KD3A 3WZMA 2YINC 1E89A 4QWWA 4FYXA 4BFXA 1AZTA 5GVRA 2JGEA 5DV9A 1QGYA 4CL3A 4O29A 3M4XA 3QKTA 3FNIA 4LVCA 1M0SA 3O1JC 2O2GA 4AY3A 2AFHE 4KWCA 3JS5A 1IJEA 4B3SB 3AERB 4QHSA 3HBAA 4TKMA 2D5CA 2WQZA 3FR7A 5FUVA 2ODTX 3RSOA 4BX3A 4RVSA 2QRVA 5DP2A 1UBJS 4D4KA 3N8DA 3A6KA 1PSDA 5CP8A 2CV1A 4QQFA 4MYUA 1U4NA 2PAFA 4IQ4A 2XIQA 2VAXA 2REOA 5C35A 1NTOA 1JEYB 2MU1A 5J63A 4MGZR 2XQFA 4PYQA 5DYGA 2HQSA 3V7YA 5DLDA 5TQJA 1WZCA 5IJ9B 3UUEA 3KPUA 4EZEA 4JLUA 3L0PA 2Q5JA 4YJDA 2B98A 1GGJA 2Z9BA 2OLEA 5K0FA 4GGMX 2TMGA 2BMAA 1GUYA 5FWNA 5ERGB 2FLLA 2D7DA 2HFJA 3KQPA 3LWZA 5CB4F 2XD4A 1HX7A 1K7CA 4Q0YA 2ZT7A 4NFHA 3FAZA 2QX6A 1ZUWA 4TTVA 1ABFA 1DAOA 3DLTA 1Z7WA 2IU6A 2XGOA 1QAQA 3K0BA 1SQSA 2VXCA 2ZTVA 2DBZA 2IBKA 1WBDA 3F6EX 4N41A 1Q74A 4N7BA 4KX3A 3FSEA 2C20A 1P1RA 1T1SA 4XEHA 2E7ZA 1C41A 1ELOA 2QAGA 1II8B 4RY0A 2VA2A 1LJLA 2GHIA 3STHA 1LJUA 5EGNA 3V33A 1GSAA 1H0SA 4H31A 3KJQA 5E7QA 1MIOB 3HXTA 1M0WA 5JXIA 2H0AA 4CU5A 4MK4A 3ZQUA 4ABTA 1P33A 2WG1A 3I9V1 1U2DA 4E2WA 1YMUA 1Y9EA 5BYAA 1HMYA 5D3KA 3NTQA 1U02A 1IB0A 1J23A 2GD0A 3NDPA 1W94A 2ZE5A 3OX4A 4DGQA 3ZD6A 5JW6A 3PHJA 4KR7A 2BVNA 2XCTB 2C96A 3WY9A 4KQXA 2Q5LA 2XUOA 2RAUA 3BEOA 3LY7A 3KUCA 4BNHA 1BA3A 1XF1A 4UCTA 2CHQA 3EVZA 4FKZA 1HT3A 3B3JA 2ST1A 1IN6A 1KMIY 4N5MA 4BBJA 4XVHA 2XTZA 1OU4A 1NM5C 4RDCA 5FLMG 2WWVD 2WAXA 4LW8A 2LP4Y 5HQJA 1G59A 4YAJA 3MR3A 4ARCA 4Q1VA 4PZ0A 3KVOA 1SHZA 5MF6A 5C9ZA 5I6DA 1QV7A 4NCBA 3GJ6A 4F97A 1WXFA 2A5JA 4R1QA 3TIFA 2AFIB 2PQ0A 2CUKA 3CLSD 2XDQA 1M1UA 3NYIA 4CKCA 3MBIA 3MZ0A 2Y1DA 1U0GA 1WHSA 3G79A 1U0BB 4MRMB 5FHQA 3G2IA 1QOQB 3I23A 1WEHA 1FMJA 2HMTA 3WL4A 3EVGA 2C88A 3OZWA 3II6X 2ZUWA 3N3AC 4MQLA 4FBGA 2I7CA 3RRFA 4I0WB 4IDNA 3KXKA 3F5DA 2FH5B 1W25A 5ALGA 2BGIA 4J90A 4LVOA 3QTBA 2ZYUX 4U9IS 4MVJM 1JXQA 1OGJA 7ABPA 3TXAA 3BXXA 2IWRA 1U0SY 4OBEA 4O8CA 4JGIA 2VYFA 2RIPA 4C0KA 4QM6A 4B3MB 1DAIA 4BNNA 1MGPA 1RVDA 3CH6A 3OE5A 4IIJA 1NQOA 1SOVA 3L1KA 3PL5A 3IILA 3OSZA 1I6KA 3AM3A 4A7PA 1B0ZA 3R7WB 4A73A 4IJ6A 4PTYA 3KPWA 3DE6X 4UXIA 4JI3B 1YDMA 4KCGA 1BN7A 1G17A 4KN5A 2Q50A 1VYTA 5ALLA 4BO9A 4HH4A 1JIVA 2LZ0A 3CKKA 1Z7BA 4K40A 1L5YA 1FFWA 1XPJA 2W4MA 3W7VA 3MD9A 4B1FA 4B6EA 3EGXB 1V8PA 2G9RA 3IDSA 2IYPA 3DAOA 2WNSA 1JF8A 5FL7A 3ZHVA 1LDNA 3DFMA 3S29A 2C0PA 4H18A 1SWWA 2XB4A 2JBHA 2OCXA 1OX6A 4I6JA 3OHSX 3FYTA 1NVWQ 4NCIA 2NYRA 5COAA 1OH7A 1TM7E 5IVPA 1U9YA 4R1OA 3RKRA 1WG8A 3RBVA 1E3EA 2YQ5A 4MTDA 4AJ2A 5JR3A 5H82A 4B32A 4K26A 3PRJA 1QAOA 3IGFA 2AZTA 2HJHA 1SHLA 3H4TA 4JSRA 1YO6A 1PQWA 2X14A 1QONA 5ENVA 1CJTC 3V7FA 4B47A 4EUEA 3BHIA 1OWOA 2UU9B 4G9BA 1FP6A 5JFTA 1TI7A 3E23A 4AY4A 3VPXA 2QX8A 3K4QA 2ZQ5A 1CUDA 2CVFA 2IXEA 4NXNH 2V0GA 3JQ8A 5BUZA 5T7BA 8ADHA 4HAOA 3PE3A 2VUMA 2CYCA 2PIDA 3EGWA 1FRVA 1T9DA 5E1MA 1ENPA 1ZP6A 1XRMA 5CAEA 1W9HA 1D9ZA 1MEJA 1EKPA 3ETGA 3HDQA 4YP0A 3RRNA 1MV5A 4B40A 3JQDA 4PTLA 4FOPA 2VP3A 1PEYA 3EYWA 3O2JA 2PUJA 3QXXA 2HF2A 4FFSA 2WM9B 2IBSA 2WD9A 1KI3A 1IIBA 1XCJA 5IN4A 1X7WA 2CFTA 4B76A 4DLTA 1B74A 5EIAA 3JASA 3Q8MA 3VR6H 2I33A 1BTOA 1O8CA 3DMTA 3MOGA 3SYLA 2NV6A 2VYND 2J6UA 4EAQA 2L17A 3MTAA 1F1JA 3HKCA 3QK7A 5JH7F 1QIIA 5IT5A 1KYTA 3H11A 1KZ6A 3OKCA 1VE6A 4B83A 4TL8A 3EMDA 4L73A 3LTNC 2FW7A 3D3QA 4W1SA 4JHXA 2O9JA 4N6NA 4MW0A 1YBFA 1FZQA 3CCFA 1SELA 2C54A 2CXRA 1IB6A 2GVZC 1ADYA 4MGKR 2I3GA 5FJJA 3IAM6 3BSFA 3N41B 4CE6A 4HDNA 1QH9A 4UEOA 3FB1A 2V59A 4IBOA 2QWXA 1YZGA 3IKTA 3L02A 5FPSA 1MZBA 2ATCA 4JNCA 1SXPA 2DWCA 2EG5A 4CL2A 4JI7H 4IHQA 1AQNA 2AI3A 2V6IA 1Z83A 2P7IA 4QFCA 2I80A 3KHGA 3K0AB 5L4NA 3EQZA 3FXAA 3GUUA 3SHQA 4CT0A 1G8YA 1D1SA 4KLAA 3SR3A 3ASZA 3WGYA 4HAUA 1T3TA 5CVUA 3BMNB 5BQ3A 1J8MF 4OQYA 1H85A 2DWUA 4TPKA 2UV8A 3BMOA 2H8KA 1A2QA 4LQLA 4ECUA 4XOUA 4BO3A 1CFJA 5BQOA 2QAJA 2MCFA 2V6JA 3EWNA 1Y1WG 4FWTA 1LXCA 4RNNA 4WZBB 4DLAA 5E8RA 2D0PB 1JWLA 1ESDA 4LQDA 2A7QA 2AKEA 1VJCA 4R9RA 1UC5B 3B1ZA 1JT2A 4QU9A 3DFZA 1MDFA 2G67A 5JCJA 4B3TB 4HN2A 5JBNA 5BVGA 5HMLA 4Q00A 4N40A 1JTFA 5BMVA 4RVUA 3Q9LA 4JBHA 5JO9A 3EF1A 4KQ9A 3HO6A 4UREA 4KHZA 1Q44A 2IPMA 5DHRA 1P72A 1XZHA 1IQUA 3HDVA 2ZRDA 3AJRA 4MUBA 5AW4A 4XJTA 1ZM4A 2YWEA 4J3NA 3NBZB 1OWPA 3FVVA 3INRA 4YY3B 3NHMA 1SBQA 1WD7A 2E18A 2EFGA 4E7PA 5K0GA 3AZPA 4JMLA 4GLLA 3QWIA 2GETA 1U90A 3EDOA 1D5CA 4PPYA 3KPJA 3DL7A 5CNKA 4KQMA 3QOYA 5F9HA 3IVGA 1ISRA 4LWOA 2AEMA 4H15A 4BYMA 2R2AA 4WJKB 3B13B 1XKXA 4QYIA 4C0WA 1KIAA 3TKYA 3GUYA 1GL3A 4KBFA 4DDVA 3DMNA 2UVRA 3ORHA 3SXPA 1SCDA 5ADHA 3KFXA 3PEFA 1GFSA 1N0UA 3X1DA 2VLBA 4FOTA 1R0RE 5CJPA 4BEJA 3EZ6A 4RGVA 1C8VB 3EGOA 4C5CA 4EEYA 4E51A 4HDMA 1ISIA 4N4AA 3M4IA 3AEKA 2O5VA 1Z7YA 2ISSD 2ODQA 4KHPH 1NX6A 5LPNA 3AHGA 1NC3A 4Q47A 4LJSA 1J1UA 1HY3A 2HDNB 1Y1VG 2IMWP 1XVIA 2HMSA 3LT2A 3U7JA 2IXGA 2DFDA 2AUTA 2PUDA 3KTFA 4C6HA 3OTQA 4ZPJA 1EJBA 3ROPA 3F71A 5FTNA 4Y9RA 2J5XA 1NMEA 4ND4A 4LFAH 3RT9A 4EYKA 2EJTA 1WO8A 1TOAA 4AJIA 1TUBA 5A4FS 2OHOA 1IBLH 4OJTA 4ETSA 2W00A 3AESB 2I2AA 4LK2A 5GONB 3GJ3A 1P7ZA 4M1SA 3A4MA 3H9GA 4O2LA 3GT4A 5TT1A 1KO1A 1AS2A 4P82A 1SCKA 4DV5B 3LT4A 2RGNC 2Q3BA 4AECA 5CM0A 4XUDA 3IJ5A 3WQRA 3RFFA 3FWNA 2G5CA 4LH6A 4D4LA 2O7VA 3DDNA 4GSLA 2R92G 4KXYA 4MJ7A 3ZTTA 4PS1A 1D7OA 5BT8A 1M34E 1UP6A 4DM4A 3UWDA 4JYAH 2PKXA 2JJ1D 3HJTA 3PWZA 4BV3A 4AKEA 3LQYA 1X1BA 1E0JA 3IRVA 2CHGA 1IK4A 4QW9A 4F11A 3G88A 3GCDA 1Z6PA 1ZGAA 3SF0A 4FBLA 3UYYA 3UJ6A 1XJCA 1OCEA 3E22A 1TJPB 2HRZA 4FD2A 2RDIA 4IJVA 1SHUX 4Q4JA 5E0KB 5FX2A 4BY9E 1I6MA 3AUXA 3NBYC 3IQIX 1YVEI 4ZOLA 2XE8A 4PIMA 3LT1A 2VT3A 3FBWA 5BSRA 1JG7A 1XRJA 5ECDA 3ZHBA 2E5LB 4IW3B 3T5LA 2WA2A 1DFIA 5K8VA 2QTAA 3DD1A 5KG6A 4HZUB 1I6WA 1CC1S 2CVPA 2IHVA 4IJWA 3SC3A 2YMMA 1U9JA 2DB3A 3O94A 4Z4GA 1DXHA 1U7ZA 4DSOA 2VPWA 2V97A 1RP7A 4L6AA 2YJ5A 3TECE 3VYTB 3RU7A 3COYA 3HHEA 1RWVA 2EW1A 4B3RB 3GT7A 3OX1A 4ZEVA 2DEUA 1DBRA 4YCCA 2E89A 4XRRA 2HAEA 3G0OA 1QHHA 3G23A 3P52A 3GTPA 4RZIA 2AKYA 1TQ4A 4ZOCA 4YJ3A 4YP5A 4KH0A 4BB9A 2Y68A 4F5ZA 5JJKA 4KOEC 2PH1A 3GNQA 2XXAA 4L9AA 2WIDA 4ZVKA 2FWNA 4YFVA 4UDOA 3M6FA 5JI3E 2VJBA 4MUJA 4AJ1A 3OKPA 4DNXA 2PBRA 1U28A 4M49A 3PC8C 4ZQBA 4DPKA 1I4DD 4KXUA 2H00A 1UBOS 4IL5A 2ZT5A 4HPXB 1GNPA 3A6GA 4U4AA 1H2WA 3D8BA 2Q2NA 4G0VA 3W90A 3DV9A 1OFUX 3SEAA 3PXGA 4LC0A 4ZYWA 3WHLA 2C77A 2QVGA 1BFUA 2QSUA 5C3MA 3PW7A 3SBEA 2YNMA 4G89A 3MXOA 3IO3A 3UXYA 3A9RA 5ELLA 2XYPA 1ISFA 2A35A 3NUGA 1U3VA 3P7MA 4ON9A 4UNPA 5KYUB 1AF7A 1NXQA 2OZLA 2MR6A 3SC4A 1EU1A 1KBOA 2AA3A 3IHKA 4HRXA 1A97A 5KFWA 1WY7A 2ZVPX 4R41A 2NVXA 2PKQP 4FGSA 2BSXA 1IRXA 1FBNA 3GLKA 4ACBA 3BCSA 2V9ZA 4O59O 1RYRA 4CPDA 4QJ4A 3GTMA 5F33A 1DEOA 3RRYA 4TN1A 1YB6A 5F4ZA 3CZMA 5JDIC 3BH7A 4IQ8A 4WA7A 4PG6A 4DR4H 5ALKA 2AJ8A 4MAAA 5I7EA 1RKXA 4ETWA 1U8EA 3TRHA 3KVVA 3TOSA 3ZDDA 3NQ41 5DGXA 5ALQA 2YQZA 1WWKA 4QIHA 3R76A 4D6PA 2ZULA 1YA6A 4G37A 5AHOA 3EUEA 1TX4B 3DZJA 3D0QA 5CK4A 4RB0A 4XQGA 3VC7A 2XR1A 4LZNA 5AW9A 1ECPA 2VUIB 3OF2A 2HZ7A 3GLQA 5KFRA 1RFLA 4II3A 4IHJF 2J41A 3TM5A 3IBSA 2WF5A 1JX4A 2F1HA 2J6IA 4BKQA 3CRMA 3NOQA 2X1VA 3EBOA 3ZHQA 4BRUA 1WHTB 1PQ4A 2FPUA 2W37A 3R23A 3PQDA 5JCJD 2Q49A 3ITEA 1GVNB 1R8XA 2NXCA 4NPCA 3VV3A 3AY7A 5E8JA 3TSAA 4IS3A 4NU8X 3I4FA 1HK7A 3MPOA 2XRMA 3AO0B 2Y9MB 4EO4A 1SB9A 1PZFA 5DN6D 1F0NA 2JGNA 3M8KA 2Q5FA 3JYQA 4NCKA 2UXDB 4C7OB 5CA1B 1DIKA 3FLMA 4RZQA 5BSHA 3GLIA 1JDTA 1GNSA 2LUOA 4GMGA 2Z56A 4Z9FA 3AGQA 4YCDA 4AWXA 3AG6A 2GF9A 4J9UE 4BP9A 1KZ9A 3MR2A 5ALDA 2NZ2A 1XHEA 1D03A 1WDKA 5JVLA 1Z2EA 4PYOA 1DNPA 5AI4A 2QTNA 3K0KA 1YZLA 1CB7A 3KUKA 3EHDA 5JFOA 3DWFA 4UATA 2QU8A 4GRAA 5AI5A 2M6KA 3Q7RA 1XTTA 2ZRGA 4EHAA 4GYKA 4L5IA 4KQEA 3MINB 1NVXQ 3ADOA 4L7VA 3L7CA 1LVUA 1P60A 2H57A 3D6UA 1E79A 2BCJQ 1EFRA 1A8SA 1O2DA 2V7GA 5DHTA 3FLBA 2COGA 2UVVA 5D6OA 5BNZA 4M1MA 5EHQA 3UB4A 4CGYA 2PS0A 3Q72A 3QVLA 1GM5A 2Q6LA 4HD8A 1ZR2A 2A0WA 4U7JA 3IVXA 1RZ3A 2CC2A 3PXEA 5HBGA 4JUZA 2AOUB 4R16A 3OOSA 4X60A 4A0HA 2FX2A 1I1MA 3K9LA 5IDYA 3GQVA 1U6JA 3PXAA 3LCVB 3E8MA 3NTOA 1FU4A 4BX9A 4N65A 3KPYA 2ZWOA 4XAQA 4EG6A 4NQZA 5DNAA 3O82A 1D1QA 3LDHA 4GRIA 3WAGA 5KG0A 3KKMA 1M8GA 3CRZA 4MVJF 2AWNA 1KJNA 1WKBA 1XRRA 1L0BA 2FPRA 4YQYA 3DZ8A 3FCUB 3Q9SA 2XB9A 3K53A 2YWBA 3EIHA 4TMVA 4OXNA 3V4ZA 4HWKA 3O4VA 1FUEA 4WNIA 5JHHB 3RRBA 3DH0A 1KK3A 4MKZA 1KU6A 3U39A 1OLUA 1JL3A 4S1VA 4LF5H 2A67A 5ALHA 5KAPA 3BABA 5WRFA 3M1YA 3A1CA 3EDQA 3JSLA 2XI4A 3AFNA 2PMKA 3W8EA 4RA6A 4ZVPA 1J39A 2IVFA 1PSZA 2B82A 1U7TA 5JQGF 3BS4A 2ZJZA 3QG5A 1E2GA 2XCIA 4DJ5X 1L7QA 3SHWA 3WISA 2N42A 5GGYA 1DMSA 1WF3A 2CUNA 3TW0A 3Q3CA 4GM1A 3UPDA 3EEYA 2WILA 1KSFX 1XMSA 3MLBA 3MWLA 3GQBB 2PVPA 3ORSA 5F21A 1MB4A 3T5CA 3BWDD 1NKSA 4KQIA 5UKDA 3PX3A 3WXBA 3QEMB 1V1RA 2WE6A 1KK2A 3BUSA 2OCAA 4NYMQ 3KQMA 2OHXA 1IBMB 4FUTA 3LLVA 4ED2A 1DAAA 3ICCA 1T1IA 3DEJA 4PE5B 1CNMA 4N8SA 3DONA 3QF4B 3R3VA 3PKIA 1G8HA 3FF4A 1Z8NA 4LJ7A 3X2EA 4CETA 3CEPB 4N8EA 4CU2A 3D3NA 2P5TB 5DBGA 4HUJA 2UZ3A 1JR2A 1PG2A 3VQTA 4XKJA 1FJHA 4Y2YA 5E9JA 4ZN6A 3IP5A 4IG9A 1CY4A 4AMGA 4EBEA 4QIWA 1KBQA 4RMIA 2IUTA 3HL4A 3ILSA 1WSDA 2LCQA 5EOYA 4CVNA 2YJTD 2H18A 4PDBA 3VNRA 1UJCA 1QE3A 3EK2A 3AUAA 1NZFA 4J4BA 2B6HA 1ZGZA 1QIDA 1PGOA 2R93A 3D02A 1XBTA 2P35A 3I2HA 2MIIA 2EATA 4JUAA 4KFSA 3HCCA 4HWSA 2B34A 2Q3CA 2PJZA 4FWBA 2O2JA 2LIVA 2ZRMA 3FSJX 3MCVA 4DV2H 1G2OA 1GZUA 2DHDA 1YDHA 5HBRA 4MNTA 3IJPA 2XKBA 4F1WA 2JIQA 5HIJA 4PZCA 3L79A 2QN1A 4EI7A 1GSIA 1Z06A 5LMUH 2ZSEA 3PRKE 2ZI4A 3UMMA 4XJSA 3ONWA 1SEIA 1N7JA 3LQ4A 1G42A 5DWVA 3DVRX 4GBGA 5CG2A 1ZHHA 1G20B 2DXIA 2PH3A 3KZVA 1OE0A 3HNOA 3FMVA 4B4KA 1C3OA 3HPRA 4AG6A 4CBVA 3DXZA 5F1YA 1L5KA 4C3VA 1U0EA 1SXJC 4B3GA 2RKOA 2A14A 2QLJA 4UVDA 3C48A 1MNAA 4YNBA 1L1EA 3RWBA 1CQWA 1VC2A 4QQNA 4LMRA 1OD6A 4AURA 3SKYA 1SBIA 5LP1A 2XDAA 5JSYA 1N1EA 3HWSA 4CL8A 5AKKA 2PLNA 4X7RA 2W7TA 4L8YA 4DA9A 3UGTA 2FW6A 1IVSA 4BO7A 5C8YB 3HCOA 3WYFA 1IBSA 1J2RA 1RKBA 4Q9NA 3QEOA 3W8NA 4MS4A 4WXHA 3V6HA 1ESMA 5J47A 2RBEA 4X6XA 1JPJA 3VYRB 1I30A 1N57A 1TD9A 5F98A 2VDPB 3GDOA 5BV1A 2VVTA 1COWD 2IK8A 2JNWA 3Q7QA 1V9CA 2PE5A 4W6ZA 2PKQO 3R3WA 1NV9A 4DWVA 4UU7A 4L22A 1KERA 3FUCA 2Y1FA 4E13A 3SYTA 4M8SA 1D5WA 3T5MA 1J6UA 4F96A 2AXNA 3KYDB 3UMGA 3MW8A 2AZ4A 2DVMA 1C8BA 2J6SA 3MK31 2IYRA 2ZXEA 1FFXA 4UNQA 2SICE 1S1MA 4HDAA 2P8SA 5C51B 2Y77A 2ZCVA 4K0KH 2BKAA 3IV9A 4UCWA 1X86B 4XWGA 1LVHA 4QIWE 1VHJA 5CT9A 4R05A 4HMPA 4P54A 2A9KA 3V8BA 2YUTA 2NTYC 2Q6IA 4Z86A 4CG3A 4NPAA 3U49A 1N8NA 1UAGA 4RZ3A 3F5QA 1XLUA 3UVEA 2WU8A 5I47A 3X1KA 4D44A 2ORIA 3GG2A 4DL4A 2E2HA 2JFNA 4M86A 3NU1A 1I80A 3AL3A 1IBKB 221PA 1G38A 4RV5A 3ETJA 2PNFA 5LZ7A 1TU3A 5BW6B 5IYCG 3ZV4A 4GZMA 4B80A 3BD9A 5JD6A 2BQUA 4IZHA 1FLNA 4F06A 4BMSA 4ZRDA 3PQ3A 4NENB 2INGX 4AF6A 2HEIA 4E5VA 1QK5A 5ICEA 3EBLA 3SZOA 2WNHA 2PT5A 3ZCXA 4DJJA 3VZDA 1FFYA 5LXTA 1LBEA 1HV8A 2C0QA 3EIWA 2XZTA 1XAGA 1CY7A 3HY6A 1L9XA 4XM1A 3GGCA 4TKLA 1D2RA 4D9IA 3M70A 3N3BC 5B3JA 4A16A 3ZDEA 1N6OA 4JHLA 2OCPA 1GY8A 2BEWA 3HEBA 4ZJUA 2XKAA 5KFCA 1DPGA 1PS9A 3A37A 4HMOA 2FMUA 2BDTA 4DR6B 4EBBA 5IABA 3OEYA 4Z54A 4G25A 1C1DB 1E79D 1M8KA 2IKSA 1EFRD 1MPXA 4RTQA 3RVPA 2E4VA 4ISBA 2HEGA 1VSQA 4J9MA 4WBSA 2I6TA 3JQ7B 3SZLA 3TSZA 5TF4A 4FGZA 4FS8A 1TWCA 1BS9A 5F4BA 1RCFA 2ZAIA 2K5UA 3GLFA 1YH3A 1AVTA 3U3XA 3BGDA 4GX5A 2OGSA 4F5YA 4HRYA 3VR6D 1UM9B 4GKAA 1B26A 3GWZA 1QF6A 3I4LA 5C5IA 1GGMA 2SHKA 4QNMA 4AS1A 3LECA 4LXIA 1UF9A 3GELA 4V1CB 2CL7X 5JBQA 2VPSA 1XMOH 3L1JA 2XMPA 1SULA 2QDKA 4JOBA 2C8VA 3I01M 3GPBA 3H9JA 2Q46A 4UZSA 2YJ3A 1QV6A 4DY4A 2V5VA 3T06B 1I1KA 1CUHA 2J7KA 2BKXA 2EX0A 1YJCA 2IUFA 3QXHA 1NOJA 1M10A 3HO1A 1YDFA 1FY2A 4YCLA 2VNIA 2GD1O 1AGRA 4XQCA 3SE0A 1ZH0A 3WDSA 3W34A 4DEVA 1U8XX 1H3EA 7REQA 3QMMA 3KELA 3IXLA 3KOMA 2O3SA 1TMOA 2G3YA 1A9PA 1C0LA 4BV2A 1U7XA 2VJKA 3L8MA 4GMKA 1J5PA 5DSTA 5DGIA 3JALA 3OZVA 3PQ2A 5C7IO 3GF4A 3B52X 3K0CA 3M5PA 4DJTA 4GG1A 1G4UR 5KG3A 1B41A 4TQRA 2B37A 5HOEA 3V7UA 2ZDQA 1EXDA 2VAWA 3WRWA 4GD3Q 4D0NA 1M2GA 4ZAGA 2NAFA 1V7ZA 4OIFA 1DO0A 4P6VF 1KI6B 1QGED 1BXGB 4Q34A 4LOLA 1DKQA 2Q4OA 4OUKX 3GHYA 5AUNB 3CUYA 4BNKA 2SKEA 3BORA 3RE1A 1KY4A 1X7YA 4N3GA 4NMLA 4HT3B 4L50A 2PLRA 3ADKA 3IUEA 4QEKA 1MVOA 3H9BA 3VZRA 4Q01A 4Q3CA 3ZY4A 1RYHA 4U1RA 2QZ4A 4J75A 5G02A 1EUCA 3MUNA 1W75A 3MS2A 1KH1A 5FWXB 1A04A 3M34A 4FFBA 3PU6A 5AKYA 2WMYA 3WV5A 3ROZA 5FOVA 4GU5A 4UQPA 3HXKA 1QHNA 3ZJ4A 2V98A 4ESVA 4GYYA 4IKEA 3UZBA 2QRPA 3V4PB 3QF7A 5EXSA 5IN5A 4DUYH 5ERXA 1YMQA 1IZ9A 3N0TA 1SUSA 1QANA 3HCEA 1Q77A 4R1NA 4GR9A 1Y8QA 4DNPA 1ATIA 3AKZA 2B9VA 2EZTA 2C5HA 5A71A 2AFVA 2ASEA 4M60A 1FU8A 3EGIA 4LH7A 3E61A 4RFVA 2Q1TA 1P2SA 2A9FA 2J33A 3T0GA 1I50A 2GQSA 1I24A 2K6GA 4B2PA 4HVAA 4GXRA 3BILA 3WNZA 1OXMA 1X19A 4EW6A 1DRVA 4GX0A 1PZEA 4KVAA 3BL8A 3FVRA 3BM5A 4ZHQF 4K8RB 1UKAA 2EFEB 5E6SB 1KGSA 3BMCB 5EXXA 3IIIA 1V11B 4QDTA 5FBHA 2PPVA 4EI8A 2HB6A 4E11A 1GNTA 1QFSA 4FBTA 1CWUA 1BD3A 5EVCA 1Z3CA 3GVHA 3FLAA 4PYJA 4DQVA 3MUEA 2YX1A 3AB8A 2C2DA 4MKFA 4MQ6A 2CVQA 3M9WA 1FRQA 1SCQA 1IEQA 5K2MA 2EF0A 5BWMA 1Y81A 2PKYX 3M0EA 1IUKA 3AQIA 1B0PA 4B31A 1VP3A 1RWNA 4YR2A 2Z3VA 4UXHA 1ISPA 1YIAA 4XM2A 1V8BA 3ZKAA 3BH6A 3HSSA 3N1UA 4BQQA 2NO5A 1TCAA 4YP3A 2MSLA 2QD1A 4I1YA 1HL3A 4Y6RA 4JP3A 4BMDA 5EJ4A 4R2HA 4C2MA 2Q5IA 3HOVG 1G3MA 4BFSA 3HQ4O 3K4PA 3KB1A 1U8UA 1KKUA 3DLPX 4BNXA 2B6NA 5JWHA 4CIAA 1TEXA 5DKFA 1A8HA 1E59A 2C7RA 2FK3A 2C9MA 3BACA 4A3FG 3THWB 1RAFA 1T91A 4TS3A 1MX1A 4N39A 5KNCH