2YS6A

Crystal structure of gar synthetase from geobacillus kaustophilus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
425
structure length
421
Chain Sequence
b'NLYFQSHMNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGKGVTVAQTVEEALAAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide synthetase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 120
structure length 421
sequence length 425
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ys6A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ys6A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ys6A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ys6A04
2R82A 1I7LA 4FGRA 2YS7A 3AW8A 1KBLA 1C30A 3U54A 3I12A 3G8DA 3JZIA 5C1OA 2CNQA 5LP6F 3N8DA 5LYJF 1JLLB 1A9XA 1KUTA 5JVLA 5K2MA 3V4SA 5I47A 1ULZA 3GLKA 4O4IF 2HGSA 2R6FA 4MV4A 3BSYA 1GSAA 3R5FA 1KJQA 2YS6A 5H80A 4ME6A 3R9RA 5FNVF 3ETJA 4TUYF 4EA9A 2V58A 4YBZB 1CE8A 4IWXA 1W96A 4O84A 4EAAA 1AUXA 3BG5A 4L1KA 4O86A 5HBRB 2XD4A 5BMVF 1GGOA 1EUDB 4RZQA 2FP4B 5D8DA 4M9CA 1M6VA 5JQWA 4O82A 4MV6A 1VBGA 2VQDA 2W6QA 4XYMB 2C00A 4MV9A 2R7MA 3TIGA 1SCUB 1C3OA 3UFXB 1CQJB 2YW2A 2W6NA 4IZOA 2Z04A 1W93A 1IOWA 5J2TF 4O7RA 3QFFA 3TINA 3Q2OA 4C5AA 1EYZA 3N6RA 5CB4F 3ETHA 2GPWA 2NU6B 4XZ3B 4M99A 5EZYF 4O7VA 4FFRA 4ZHQF 1M0WA 2W71A 5KX5F 1JKJB 2V5AA 2NUAB 5GONF 1GSHA 2NU7B 4FFLA 3MWEA 1I7NA 4YJ3F 3R23A 1EHIA 1T36A 5JVDF 3ORRA 2IP4A 2XCLA 4FU0A 4DLKA 4TV9F 5LOVF 4MV1A 4O83A 3TW6A 2PVPA 2QF7A 2VHEA 2DWCA 4O7NA 2VR1A 3RUPA 2NU8B 2R7NA 1GSOA 3AX6A 2FPPB 1JDEA 4IWYA 3WNZA 4HQ6A 3K5IA 2FB9A 1Z2OX 2P0AA 5JQGF 2YZLA 2W6ZA 4WBNF 2I8CA 1KJJA 5KKNB 2DZDA 4O7TA 1PK8A 2PBZA 5DMXA 3U9TA 3SE7A 2W6PA 3Q1KA 3RV3A 4HNVA 2Z02A 5IYZF 1BNCA 4O7WA 4TV8F 4O2AF 3R5XA 3RFCA 2FPIB 2W6MA 1AUVA 3KAKA 4GGMX 4M9UA 1A48A 4EGQA 3V4ZA 4O2BF 2W70A 2HJWA 1VBHA 1Z2PX 4I55F 3HO8A 4J6EA 4QSHA 4WD3A 3GIDA 2YL2A 4HR7A 1B6SA 4MA0A 1EUCB 1E4EA 4O7LA 2DIKA 1CQIB 2I80A 3JZFA 2NPOA 5C1PA 1CS0A 3VPBA 2YYAA 2R86A 1DV2A 4C5BA 4EA7A 1OBDA 2OLSA 4O4HF 1UC9A 4XX0B 2R7KA 5LXTF 2W6OA 3TIIA 2V59A 3KALA 4MAMA 3R5HA 3U55A 3OUZA 1M0TA 2GQSA 3WO0A 1WR2A 3MJFA 4YB8B 2WYOA 3KAJA 2NU9B 2DLNA 5CA0F 4NYEA 3BFPA 5CAEB 2ZDQA 4YAJB 1EZ1A 4ZOLF 2R7LA 4O81A 4ZQIA 1VKZA 3BSWA 1UC8A 5BPFA 3BSSA 4I4TF 1IOVA 1DV1A 4E4TA 1KJIA 3DF7A 3WO1A 1GLVA 2YWVA 3TQTA 1KEEA 3E5NA 2VPQA 5BPHA 2ZDGA 2R84A 2YRWA 4O7ZA 4MV8A 1KJ9A 3K5HA 5J2UF 1PX2A 2ZDHA 2X0SA 5JH7F 3VPCA 2YZGA 4C5CA 1JDBB 3G8CA 4HNTA 2QK4A 3ORQA 3MWDA 4O7YA 1DIKA 1KC7A 3LP8A 2I87A 4EGJA 4MA5A 4MV7A 5C8YF 1B6RA 2PN1A 2YZNA 3KREA 5HV6A 4M98A 3JRXA 3JRWA 1Z2NX 2SCUB 4DIMA 3K3PA 2R85A 4YJ2F 3HBLA 3VMMA 3VPDA 4FFNA 3LWBA 3VA7A 5LA6F 2CNVA 4I50F 2FPGB 4FFPA 2R87A 3HB9A 4YAKB 4EABA 3VOTA 5CA1F 4XYLB 2CNUA 2GLTA 4FFMA 1E4EB 1OBGA 2YRXA 4FFOA 3OUUA 4FE2A 4MV3A 2GPSA 3RV4A 3U9SA 4IHJF 2CZGA 4ZI7F 1KJ8A 2YZMA 2CQYA 4O4JF 4O7SA 2GQRA 4IIJF 4HNUA 4EG0A 3NUAA 4Y8VB 1BXRA 4EA8A 4O4LF 2J9GA
chains in the Genus database with same CATH superfamily
3WWDA 1JE0A 4KVGA 5AK3A 3IELA 1RRPA 4DSZA 2XNCA 3Q8LA 3RVPA 1ESNA 5CFNA 2YWEA 3L8GA 3WK8A 5F33A 2ZBDA 1EEXB 1U94A 4WXPA 4JBXA 3L7NA 1U11A 3BRWD 3PQEA 5DE3A 3JAMA 4KLAA 2YS6A 3DBVO 2R47A 4TL6A 2EGHA 3K31A 2VH5R 4B84A 4DABA 2QE7A 1TA8A 3GRCA 1WMAA 5SY4A 1N5IA 1OLXB 4OHKA 2D7DA 4KQIA 1V9SA 3FDZB 3U5TA 1O08A 4DVGA 1II8A 2IEBA 2BTEA 3G7UA 2BY4A 2YOGA 3EXEB 2C3OA 2C1ZA 5JH7B 2OC4A 1RXYA 1YE5A 3LWZA 4XX0A 1QF7A 1Z4JA 4S2UA 5KBYA 3Q2OA 2UVPB 4H3VA 1SA0A 3T12A 4HVCA 1MMFB 3A6ZA 1DXHA 4DZTA 1HOXA 3T61A 4QTXA 1R0LA 1CKOA 3Q8RB 1T2EA 2Y05A 4CM1A 2ZK7A 3OZVA 1V7CA 3G2HA 3R9IA 5FD8A 2WPNA 5ILQA 4JBIA 3D7LA 2X86A 4OXXA 2JFXA 4A92A 4GOND 3IUSA 4L50A 1VE7A 3C87A 1TQHA 2DFTA 2ZAYA 2YY5A 4BNDB 5COAA 2D0PB 2I33A 9LDBA 5I6DA 3CWZA 5F9FA 1GUAA 3BZBA 3OEWA 3OFSA 1YZ3A 4PSVA 1AV7A 4I3HA 2OESA 3WLPA 4Q34A 4L74A 4MKZA 4J0IA 1EGHA 4KQCA 3M6MD 1R0YA 4KGXA 1YFJA 1VKJA 4PLHA 3GH1A 1W85B 4KFRA 1TUBA 2I6GA 1ZK4A 4H0NA 3D2BA 4NR0A 3L4BC 4WPGA 1AJEA 4EIWA 3HOZG 3QWUA 3IAFA 1TWCA 1WQ3A 3EH2A 2P3QA 4DIDA 4B34A 3FZYA 4XZ3A 5B5SA 4DBZA 1H1LB 4OAPA 1E79A 3D2AA 3R6GA 2G5TA 3AIIA 4RK6A 2NGRA 4LEIA 2H1OA 2XUPA 1GPMA 4ZYZA 3ZW7A 3ZG6A 3S0JA 3MSXA 5EJEA 3HACA 3DULA 2YV3A 4X45A 2VAVA 3UBTA 4UCVA 1JKMA 1J07A 3CE9A 3HV0A 1PGPA 4C22A 4XVRA 1JIQA 4OHFA 3JWIA 2DHEA 3OEEA 5A04A 1C1DB 2ZYHA 1KEWA 2R93G 1NMYA 2GWRA 2RDMA 4RKQA 1X7GA 4AJNA 4NKRA 3SZMA 2AFHE 5IC4A 1BN7A 2ZTSA 3PUXA 1Q7EA 4Q3NA 4DA8A 4YFYA 3PHLA 2AW3A 1OLXA 1LK7A 4OXQA 5HMLA 3ACDA 3NTVA 4MV8A 1BKSB 3CMCO 3TW0A 3FDZA 4KX5A 3VNAA 1U7DA 3B3GA 4WTOA 1RYEA 1CV2A 2CW7A 1T2DA 1OKKD 4F4WA 2ZJ1A 1CS4C 3ZWYA 5JH7A 3B3JA 3I2GA 1P4JA 2ZPTX 4M6WB 3T9AA 4FYVA 1QRAA 2QVCA 4R1SA 4BN0A 2L19A 2PAFA 4DL2A 1HE3A 2ZVDA 5KFWA 1W1WA 2UVPA 2P79A 3NKLA 1FQKA 3U4HA 3LFTA 3WNDA 1G66A 2MT9A 2I7VA 1UBMS 4FCWA 4JI3B 4IG4A 2R8GA 3GVIA 3RRYA 1DJNA 3IV7A 2L18A 3K70D 1HGXA 3HOXG 2VC2B 4DR5H 2SNIE 1MVNA 2XOKD 4LBWA 2Z9BA 4CM8B 4O3SA 1JZSA 3HMQA 3H7AA 3M6IA 4BCBA 4Y8VB 4BNDA 3G7SA 1GTMA 2XDQB 3PS9A 3H13A 3I5MA 1MDFA 4UOZA 4P58A 4BMOB 1FYEA 1X7HA 4NZYA 2YWGA 4ZN6A 1LK0A 4G9GA 4H4DA 5KJFA 2ZIXB 3IIMA 1TAEA 4CF5A 4CMFA 4S1TA 1MGPA 2CHQA 3GLKA 4EGFA 1JMYA 1H8ED 2IXBA 2LXNA 2GK3A 2P2YA 2EWVA 3BA1A 1IXRC 5KJCA 2XMQA 1W85A 4XB2A 1PVOA 1IZZA 2EFYA 3SXJA 4H7PA 4U6QA 4WJKB 4CE5A 4FS3A 5FR9A 1GU0A 5JTTA 2A58A 8ADHA 5KINB 1ORWA 1NVTA 3VSDA 2ZSJA 1DKNA 1QF9A 3AUKA 4BLPA 3HR8A 2VQ6A 3NC0C 3N0TA 1H1LA 2GKGA 2VNKA 2RGXA 4M37A 1FTQA 1QRUA 3OTOB 1XK6A 2W6NA 2O3UA 3MCTA 4IJMA 2H6EA 4N5IX 4OX9Y 3QZ8A 1XZCA 1A2KC 4LF7H 2AMVA 3O73A 3H2ZA 4R6WA 3M1AA 4XD2A 3GR6A 3BJRA 2H2FA 3E9EA 3T7RA 3I1JA 5CA1B 1HRKA 1C1DA 1T9BA 4K28A 1P91A 3G9TA 2XE7A 4ED6A 4CT4B 1ZQ7A 4IM7A 1XVIA 2GFIA 4BEVA 1S7GA 4BO6A 4FNAA 1PD0A 1P33A 2M6SA 2Q5EA 3BXZA 1J0BA 3OPXA 1QYXA 2R8PA 4BX9A 1RRGA 4MUGA 2Y0SE 4X60A 1VG8A 4PW0A 3NEPX 4Y30A 1FJXA 3MRTA 4YDQA 4WZAB 4B74A 4FBGA 4OH1A 4I4TB 4E12A 5BV8A 1K1SA 1ILWA 4P82A 1EUDA 4M6WA 5A4JA 1FL9A 2CLIB 3KETA 5KDLA 1ZOIA 3ELUA 2ZYRA 1MX5A 4G1FA 1XHLA 1L7BA 2COIA 3AIOA 2OB2A 1YDGA 1W0KA 3AKEA 3LCCA 4IIUA 3PIRA 4Q66C 4RD6A 3OT4A 3M9MB 2P77A 3KPWA 1JILA 2V97A 3P0EA 4FBUA 3PITA 1XZKA 1F9EA 2X2OA 1G63A 4IMPA 1IRIA 5LUBA 3UFBA 3DEAA 2WM8A 1NJFA 3CZ9A 5I7RA 1UFVA 2BAGA 4YQWA 5IRCD 4Y8VA 1VZ2A 1AQJA 2XDQA 4P0PB 1XZHA 2VRCA 5CURA 4RLHA 3B53X 3T4XA 3D6VA 1PTJC 2ZIXA 3WLIA 3KJHA 2VYVA 1Z0FA 2R6DA 3COZA 2GEBA 1JFSA 4AJPA 4ECTA 2V9PA 2BFFA 2IPLA 1UC4B 4GPIB 2PX4A 4QPCA 1RXEA 4BEBA 4MI9A 7MDHA 2FZGA 2WUEA 2JJ2D 2Y4OA 2WKPA 2GEDA 3VDRA 1TB4A 4GWLA 4WUTA 4LCEA 3GLUA 4ZO9A 1ZUIA 3V55A 3W1EA 4YAUA 5GOTA 1HQYE 1JSXA 3KEFA 3WGHA 1XQWA 3L3BA 5LQSA 1R5JA 4CLDA 1ZSNA 2J7PA 2FWNA 5MN4A 3K20A 2C2XA 1M5UA 3WQSB 5A5EA 3LX5A 1CF2O 1A50B 1N5MA 5KTRA 3PO2G 2IXDA 1GLNA 2LCQA 1UXIA 2BZ0A 3A3KA 4OIFA 5EP1A 1JHVA 3GDHA 4CNBA 2C5FA 2EG5A 5LA6F 2I4TA 4A0GA 2B98A 1NN3A 4MS4B 1F2DA 4UE3S 1TKRA 4B4OA 2O8EB 3RU3A 3CT4A 1WU8A 2QM3A 3KBBA 5JY6A 4LRYA 5CA1A 3FHJA 4M21A 3QKWA 2PYZA 5IJWA 4GBMA 4O1MA 5LPNA 1ZD8A 3RUHA 1RQRA 3L6OO 2WZCA 2ZSKA 4EG8A 1AUQA 2ZT5A 4IIJA 2QZSA 1OZGA 3K9QO 3HOVG 5IAEA 1DX9A 2YWRA 4KW7A 1QU3A 3RIZA 3V9AA 1I0ZA 2M9MA 4AX8A 2F4VH 1QKIA 3G1UA 3PCTA 1DCFA 3OZXA 3MJVA 1JZTA 4JJ4A 4P5EA 4RSMA 3W90A 5LC1A 4BMVA 4A3BG 4B76A 3KK0A 2VDVE 2ENWA 4UFNA 5FR1A 4JELA 1FP2A 1N2BA 2VYND 4GXTA 3ROPA 1CPYA 2BSQA 1DQSA 2JL1A 4IDBA 3PW4A 2Y71A 2FP4B 5FUYA 3BMQB 5TS2A 3K8OE 2AZTA 4PGFA 5DYNA 5CJJA 4KQEA 4GVXA 3V8VA 4PIPA 4DFDA 3BXFA 4LI3X 3ZCSA 1ATZA 1M7BA 3O4HA 3KL4A 4QJFA 1KORA 3UMMA 4F2GA 3L01A 2HQOA 3LT4A 2MYTA 1PWHA 1DU4A 3E0XA 3ANSA 4BFYA 1Z7WA 5LMZA 3PC4A 4KBGA 3DE3X 5CH8A 4G81A 2VJKA 3KO8A 2NUAB 1R4MB 2JIBA 1QHXA 1EKFA 4HY3A 3MTAA 4RJLA 3ADPA 4NCIA 2BWJA 1T9DA 2G07A 2VRNA 2GZAA 1W29A 3IHKA 2YC2C 3I0MA 4APMA 5EJFA 4FSHA 4TQ9A 5CM2Z 2LVBA 3AF5A 2B0JA 4YRGA 1AURA 3ZY4A 2IPAB 4RB2C 4QYSA 2J3MA 2ZB2A 2CL5A 4K0RA 1ZIDA 3ZCUA 2Q3CA 3FVRA 4ZAGA 3M34A 1NOKA 2OXIA 5BW8A 3BM5A 3JRNA 2G3YA 3KFLA 4HNVA 2X7JA 4Y6SA 2GFHA 1BTOA 1R9MA 4LWPA 1VSBA 1U1DA 1FYXA 3KSAC 4P7GA 4X7BA 5KDDA 5BY2A 1KY5A 3Q87B 2VXCA 3E9YA 3IIEA 2V6IA 3K0KA 4G23A 2Z3WA 1Z2AA 4MS4A 5JO9A 5DNEA 4BO4A 4E6EA 2O8EA 1BGXT 2BDTA 4PZCA 1P1FA 5EWEA 3NDJA 2UKDA 1HNNA 4PG7A 3AIKA 4A3LG 4ZAZA 1SVIA 4H27A 3DZIA 2PZGA 3ONEA 2J3HA 3O8CA 2W6JA 3O8OA 4HLCA 4RA9A 4DA4A 3QEMA 2CBGA 3FVQA 2W0SA 3RTGA 2EP7A 2PH7A 2VDOB 4JNCA 3F4BA 4OQLA 3AY0A 3B48A 1C8VB 5AVZA 1J8FA 2XQVA 2OAP1 1SCBA 3BKXA 3NT4A 1LXCA 3RGXA 3V4OA 3E27A 3MT8A 3MXOA 4A2WA 3H5TA 2X0KA 4LDJA 1YE8A 5ALIA 4RZSA 5ICFA 2HNAA 3VM6A 2YWVA 3WLQA 5JAZA 5MFZA 4ARCA 2FP4A 1GKLA 3BMQA 4HN4B 4M0UA 2KPOA 2JG3A 1PT5A 2GPBA 3P9SA 3VTAA 1UJ2A 1K97A 5KHAA 2UZ3A 3S28A 3KG2A 3PHGA 1TFRA 1WDTA 4OL0A 1XWIA 2J3LA 4O25A 4QNMA 3TWOA 2JDID 5AK6A 3ZX4A 2QT0A 1R4MA 2R6GA 3I5UA 1E4EB 5LQMA 1SD2A 4D44A 4O59O 3L7YA 4P38A 3S29A 4DMRA 2ODTX 2CLLB 4I1YA 1NKVA 1WB4A 4ZZIA 5HZMA 4X66H 4Q1EA 4GI5A 2ID8A 4HB2A 3HSYA 4E30A 4BFZA 3ZGVA 4PFKA 2VJYA 2VJDA 3UWPA 3QE4A 3SD7A 3MT0A 4QVIA 1XJ5A 4CNQA 4RQUA 3C43A 3CQZA 4QUEA 2VAPA 2AJ8A 4E07A 4A3CG 5IFLA 1JALA 2YUIA 2DP4E 3RDPA 3KJQA 2FU5C 4FC6A 5MGNA 2XF2A 1ES9A 4W5WA 3GH3A 2C3YA 1Y9AA 3FKSD 3BTSA 1YSCA 3HOYG 4JI7H 4F4FA 1T3NA 2UYYA 1YGPA 3QZUA 3DT6A 1U02A 1JDTA 1DTWB 2FX3A 2ZI4A 3T3IA 3HWRA 1GGOA 4LOIA 1GXSB 4AF8A 3EIWA 2BH2A 1MQAA 1LJUA 2WM2A 3TZCA 2INGX 2NIPA 3PX2A 3GIKA 3ED5A 1GR1A 3O03A 3DZGA 4BWYA 1SZCA 4G89A 1SHKA 4HZUB 4CWAA 4K6FA 1P80A 4P31A 3INYA 3ZYZA 2WQ6A 2ZSEA 1CX9B 1BHQ1 1X13A 3GB8B 4G0MA 3IOMA 5EJ6A 3O6VA 2PUVA 4D9CA 4JI6H 2AG0A 1TM1E 2MSNA 3HLYA 5DCLA 3K8YA 3SAJA 4O83A 1M74A 3EZ6A 3T5LA 3TLKA 2P6NA 2YMMA 3CKYA 2EDAA 3ESQA 3BC1A 2M2IA 4LTMA 3AKCA 2I8CA 3OOYA 3ORHA 1IM2A 1Z4MA 4GOMD 3VZCA 3JD0A 2ZI7A 5DEOA 4MMZB 2CK3D 5EY5B 2GK4A 1S2GA 4ZQFA 1B0UA 1SJ9A 3E82A 1KS9A 1NUSA 3BA8A 5BXQC 4F3KA 3DE7X 3ITKA 3U4IA 3DJYA 1DOAA 5LU8A 1DAOA 3PF8A 4PCVA 1ISSA 1OC2A 1OX6A 1XMJA 3ZBTA 1Z39A 4RETA 2ZGVA 1OGJA 3T52A 4A8JB 1KI8A 2W2OA 4Y1RB 2P4UA 1E4EA 4IIXA 4TYNA 2Z5GA 1T8TA 3GTQA 5E7MA 4OI4A 2QUAA 2GNOA 5BNTA 5FBWB 1OT3A 3HEMA 1OA1A 2QVGA 4J07A 1YRBA 3LDHA 2E4VA 1E3WB 4LC9A 2H1VA 1G2PA 1A4RA 3O9VA 4UEWA 4QAJA 5JCZA 4AI6A 2K4MA 5KOJB 1R9JA 1PNTA 3URMA 1M2KA 3OKPA 2RF4A 4BKUA 1TZMA 2PAAA 1WSCA 2OK7A 5KFFA 2H1WA 2NXEA 3TI9A 5JRDS 3WLHA 3H3JA 3D7MA 2PEYA 4HMOA 3BWYA 5TQ0A 1W36C 3A6KA 2DEUA 1MPXA 4TXNA 5BUZA 1DXYA 1W5EA 1RZRD 4O81A 4LZZA 3IB3A 2QOEA 2GESA 2JARA 3W8FA 3BQ2A 2VZ0A 3PJGA 5D1HA 2JIDA 3L1HA 9GPBA 3HWX1 1U3DA 1YBAA 1FPMA 1Y3FE 1DTWA 4ALLA 4BP9A 4CCAA 2ZR8A 2X40A 5K3BA 3DZCA 4IH9A 4BE9A 4O4IB 1GXSA 1WBJB 4NCXA 521PA 4JI1H 4KPGA 2ZTVA 2MSKA 1Z47A 1KVTA 5DVZA 3MUOA 3G1WA 1N4DA 2G7MC 2J3EA 1MHTA 4QG7A 4WH0A 4ALKA 1THTA 4KG7A 3BDVA 2CBXA 4AO6A 3IMGA 2SCUB 4OTZA 4ZO6A 3G9UA 1B73A 3IHTA 3WFIA 1QV9A 1OGIA 1O8BA 3PDIA 5DSTA 5CUQA 4E6NA 3CLTD 1DQZA 5KNDH 3R3XA 3SFTA 4AP9A 4ZMRA 1AS3A 3DVRX 1ECGA 2J3QA 3EDRA 3S40A 3N40P 5I8ZA 2V1UA 2XHEA 3ZR4B 1JVBA 1QYDA 2VJLA 3IAXA 1K7EB 2PK3A 2Z8YM 1ZN8A 4MPPA 3V1LA 4WZBA 3OSZA 4QXOA 1FFXB 1CJTC 3NWOA 4GI1A 4KXYA 1JTVA 3OVMA 1JMKC 3OCCA 4XARA 5C1OA 3LUHA 2A9PA 4UJ3A 3H17A 1FQJA 2P2SA 2R8ZA 1BD4A 2ZWMA 2QGZA 3U7HB 3A70A 3L06A 1VB5A 1ZA1A 4UVDA 3KL2A 1UFOA 1CDOA 4U6NA 5A5GA 1O4VA 1YR1A 3Q7EA 4R7GA 1LNQA 1EIZA 1CR0A 5KNBD 3V7FA 1PJ4A 4A8JA 2F9LA 2WNIA 4Y1RA 5TJ9A 4W1QA 1KBOA 5EMKA 4RYDA 4HLUA 4N40A 4HQNA 5BVHA 4G3XA 3JQRA 2NO0A 2P0YA 2IU6A 3K1AB 4BRZA 2LDBA 2IEGA 3DUWA 4BB0A 4QHTA 2ACVA 2E4UA 5TARA 2QD3A 5KOJA 3NBZC 2OFPA 4LWZA 3OBBA 2H7VA 4HZGA 4FBLA 3DE1X 3MWMA 1B1CA 3GRRA 2FPOA 2I2AA 4H1UA 2P5YA 4I50B 2Q46A 4ETNA 4LHYA 4XA8A 1WMDA 4HOYA 4N3AA 5F78A 3N2ZB 4N41A 4NI5A 2Z3ZA 3H5RA 3VXKA 1XDUA 3EIXA 4LXYA 3VR2D 3LQRA 1UKBA 3RGWS 1PL6A 4HRAA 1KRXA 3OPNA 1VG1A 2HXSA 3T41A 2WUFA 2YN0A 5JQGF 1QQAA 2XB9A 1FXWF 3EVDA 1K06A 2ZETA 2CKMA 5AKYA 2NMVA 1AKNA 4R84A 1M7JA 4ZD6A 4NEGA 1SIWA 3SQDA 1GZVA 3MTDA 3SBXA 1JBEA 3I9V1 2DJ5A 3FF4A 3IDQA 4DMKA 1FEZA 5E7IA 1SKQA 2RHLA 2SCUA 1XYVA 3H4BA 1QVRA 4E7PA 1G64A 5EOVA 2YWDA 2HG8A 1T2VA 4J0QA 1GILA 1FDOA 3VVMA 5F7JA 1YMQA 4P98A 4URFA 1SU7A 3AK4A 1LI4A 4RJTA 2ZBRA 3ORFA 2NTNA 2Y68A 2O14A 1QHYA 4RM3A 3MJDA 3L43A 1DB3A 1FFXA 2HMVA 2VJNA 4Z0HO 4GMHA 3HGQA 3COWA 4ECZA 4RIIA 1QB7A 1Y1SA 5DEIA 4JQZA 3EVBA 2XITA 2XRFA 4HTAA 5KNCD 4AZWA 1RPNA 3CW9A 1XZAA 1YJAA 2C3UA 4D0RA 3K2QA 4Z3DA 1KIAA 4CM9A 1GHTA 3CKKA 1GR0A 1TCAA 2JFYA 5LQNA 4ZMSA 4AZTA 4U5XA 1K5HA 4FGKA 1M1UA 5JROA 2FSIA 2V9CA 1NU8A 4NK4A 4IYRA 4IR1A 1CKEA 2IXEA 2YRWA 2OZPA 2XMRA 4RKWA 1VSVA 1VJ0A 4F1JA 1NNSA 3VYWA 2BKXA 1NFRA 3A04A 3K1AA 4W9RA 3NTOA 4KYVA 1RI4A 4HNSA 4OK3A 3UB2A 2HSEA 4NDAA 2COJA 3GQBA 3R7NA 1UJ5A 5JSZA 4R2IA 5EZ6B 4EGSA 3TEJA 1TI7A 3AMVA 2C9OA 2IYPA 2CNVA 1WD5A 4I50A 3BH0A 3PFBA 4DCCA 3DBRB 3FXAA 2RHBA 2CNWD 4DIEA 3L18A 3LM8A 3TD9A 4HG2A 1NC1A 3O2SB 1NJ5A 3JZDA 3ZV4A 5BV0A 4IRKA 4UTRA 3EIQA 5HX7A 4KO2S 4PPNA 2FHPA 4DEXA 4UC0A 4G4GA 4DR3B 5AM3A 2EW2A 3GA5A 4YMWA 1W581 1Z12A 2BGNA 3GFPA 1NMEA 1B93A 1XXHE 2XKAA 3ILSA 1NW9B 2OQVA 3E9QA 3IVCA 2OOKA 1KYZA 5H4GA 1U7PA 2CLKB 3K5PA 1VMKA 3G68A 5LP6C 2YXEA 3T9EA 1PHPA 2AHOA 4YUXA 3R5FA 3WGGA 4AROA 3OJOA 4P36A 3K72B 2IDJA 4AKGA 4LNHA 2W2VA 1JIJA 4V0SA 2ZIEA 4ND6A 1I13A 4ZXFA 5GGYA 4L02A 3T0IA 1VKHA 1Y9ZA 1NONA 2X5OA 4X7RA 2J08A 1YZFA 2TECE 5ICEA 2X1HA 1ZGAA 4LX0A 3V1MA 5FWAA 4MO9A 3UMRA 1K5DA 1EP2B 3FOEC 3GGPA 4RVGA 3PUZA 4DA0A 1J06A 4WFIA 1F6DA 1UP4A 5FD5A 2PJZA 4J94A 3E8SA 4DAAA 2J31A 2C2GA 3CE6A 4ZK6A 5ENDA 5IX8A 4KVFA 4CDMA 4R9NA 1MENA 1TT5B 2WF8A 3OSPA 1RYRA 5JV5A 2CJPA 2WLSA 2WVAA 4LRSB 4ZREA 1YI1A 4NAUA 1DELA 5ALVA 1EFKA 2NYRA 3DZHA 5H0IA 3BFVA 1NHGA 3MGBA 5GVRA 1TU3A 5EQJB 1ZJ4A 3LZ6A 6ABPA 3OICA 2FB9A 3VNSA 3REOA 4RVDA 3H0GA 3FCYA 3ZWBA 2DZDA 4EJFA 3PQ7A 3EZNA 5CA0B 1KF0A 5JNUA 4UE2A 4KI0A 4RADA 2B3DA 2PX5A 1RI3A 1K08A 3N76A 1ZGJA 4EYSA 4DKJA 5ALTA 4DJEC 4ECAA 2WJIA 4TTAA 3KUCA 3T3HA 5JD3A 4I55F 1AN0A 4KN8A 4ZMBA 2I65A 2R6JA 5FPSA 2PQ0A 1NF2A 1MB0A 3FTNA 1E2IA 1XTJA 4GMGA 2MMCA 1UCFA 1MCZA 3DBRA 3NRCA 1JHYA 4REOA 5KO2A 5DRTA 1B43A 1I2ZA 4J3JA 3ZHQA 3ZWDA 2R62A 5JJLA 3LCMA 1N9GB 1Q0UA 5E9AA 3FETA 1BRMA 3PYMA 2HMWA 4U2DA 3SKVA 2JEGA 1FNBA 4DB4A 1F12A 1UEIA 4C6HA 1YQWA 5BMOA 2Z1MA 5THXA 1E2HA 3QX3A 2OYSA 1FJHA 3K6SB 3QW4B 4JUDX 5KTOA 4LRXA 3MERA 4IR9A 3TNFA 3BFPA 1JR3A 2D1RA 2EKLA 1Z75A 1YASA 4EP1A 2O5CA 4ZYUA 1VC2A 1CIPA 1Z17A 2PBLA 4Y2QA 5E1DA 3C6KA 3U0VA 3RK4A 4XJSA 1C14A 3N8GA 1YH3A 3UA4A 2VOJA 3EPRA 3LY8A 4FMPA 3UY4A 3C4VA 2B5OA 1JB1A 5JH7F 4E5YA 4R01A 1QH0A 3LECA 4QM7A 2JIQA 4AICA 3G8CA 2EJ3A 4DS3A 1M8KA 4EYQA 1B76A 1AKMA 3QE9Y 4MS3B 3VH3A 1E8DA 4O7YA 2MSWA 3JYNA 3U17A 4RTPA 1K88A 1G5HA 1I14A 1Q2UA 2HF8A 1S2NA 4Z51A 1E7SA 3OQHA 1H4TA 3QEBZ 2WSBA 1KFEB 1TT5A 1IHUA 2HA6A 4IV8A 3U3DA 3HPQA 3CLUC 2Q7XA 3R4CA 2H8KA 2JA7A 3P0JA 4Z4CA 1P9RA 1N2GA 4GC6A 3VBCA 4H16A 3L7DA 4JBHA 1FP4A 1RAEA 2YV1A 3NRBA 4OQMA 1RSZA 4OI1A 3CNBA 1AH2A 5KFXA 3O5AA 1ZIYA 2CMDA 3TEFA 2I9PA 1GDHA 1U5BA 5F2KA 5HJEA 3MT7A 4QXPA 1ETHA 1J1UA 2GILA 1I1QB 4QJ5A 5A2GA 4F56A 5JCOC 3H1GA 1SCAA 2PUHA 5BSHA 4QEKA 1YIDA 3RSZA 4F0JA 5L95A 4CN9A 3QOYA 3NOXA 3BQ9A 3LWNA 3PJFA 5L1IA 2A7QA 2ONJA 4G3IA 3QI7A 3GPIA 4HWGA 3VUFA 3MQFA 4E2XA 3T7JA 1ZH4A 1RCUA 1WXFA 4NABA 1M0SA 3W4JA 4C4YA 1TTPB 1VCMA 3DM5A 1UKZA 4JXUA 4CG0A 2F8LA 2R00A 1G7SA 1EGMB 3KZXA 4O2AB 1SVOA 5DW3A 3CNHA 1L7QA 1H4VB 4BXOA 4JR2A 3TO5A 2C2WA 3F2IA 1FYVA 1CB0A 1MN6A 3ITDA 1WDLA 3L02A 1NXXA 2DUUA 3UF0A 2WUVA 5HOQA 4C0JA 1FUYB 1ZNWA 4FWBA 4MWZA 4WFQA 3PG5A 5GINE 4FI3C 2GWHA 1MG0A 2BHNA 1NRXA 1Z8FA 4LXHA 2R4TA 4DL5A 3ZEIA 4K0KH 3GGSA 1XAHA 1XZBA 1ODIA 2XRMA 1DS6A 2DTEA 3K6SA 1I4EB 1ZQ9A 3IO5A 2CCKA 3K92A 1G20E 1RCTE 1GQFA 4TLLB 3OZCA 3L5OA 2RAFA 4YMLA 2BFOA 2ZCJA 3VC1A 4O3NA 1PEYA 1TZ2A 2NU8B 3CC8A 4ID9A 4ZI7B 3OLYA 2PWBA 2YZLA 1MEJA 1GM5A 4BNZA 3FROA 3LMKA 1JG2A 2P2ZA 3E3OA 4GSKA 1QV7A 4NYIR 5EL0A 2C7OA 2E2WA 3JYPA 4PYLA 1BYIA 2W8LA 3H9QA 3F9CA 3GGDA 4DDTA 2OL4A 1E3SA 4MS3A 2OV8A 4UZEA 4AS2A 4YRCA 3DMYA 4LJ7A 4DOMA 4HDNB 3OZFA 3B1JA 4LMAA 5IUJC 4RC9A 2PFSA 2AOTB 2CFRA 2PZLA 1HBJA 1HRDA 3OP1A 4JGIA 2JD0A 3H8WA 3LBNA 4JOQA 5DN6D 1CQIB 1NLZA 5EHZA 4GDFA 1OJLA 3ZH2A 2I6XA 5JPIA 1RLUA 1T1SA 2PKXA 4TKMA 4JV0A 1LSJA 2X15A 1UOEA 5DSZA 2BMVA 3W2TA 5JNVA 4OJYA 4K5QA 3CTPA 3SSOA 1OHHD 2YMPA 2BR3A 4DV2H 2J5XA 2AX3A 3MJFA 4OKNA 4WZZA 1XCJA 3WHLA 4IS3A 1YC5A 5H9VA 3O4JA 2O19A 4JLNA 3ZKWB 5HS6A 1XRLA 3ZI4A 3QY0A 2YYZA 4LQ4A 1T29A 4UAGA 4YHHB 1SXJD 4M0LA 5BSTA 4ZEVA 4KGZA 1ENPA 1KJIA 1HT2E 4PHTA 2D5BA 3A6JA 3K9BA 4QYIB 2B8JA 4J2OA 3NTLA 2POQX 1Y8RB 1U0BB 3I1YA 4Y1GA 1HE1C 4O2AA 3T5DA 5A6VA 5EXTA 1U0GA 4TMVA 2VAMA 4J9MA 2NXJA 2OCDA 4P8RA 1BIFA 1P4SA 2YJTD 5JHHB 5IT0A 4Y6OA 2KX7A 3H9EO 3UXHA 3OQBA 2Q9BA 2I87A 4EGJA 1YVRA 1IOZA 3NHWA 3VC2A 4JC5A 2CL6X 3COYA 3KQMA 1D4ZA 3PUHA 4YDSA 1LBQA 2CUTA 2J3JA 1UOOA 3AEQA 1R6VA 2ATLA 3KQLA 3LL4A 4DY4A 5CA1F 2ASEA 2EARA 2NQ2C 3TJMA 3SBOA 4YP7A 5BW6B 1WPXA 2KSQA 2ZI3A 2HK9A 5BUSA 3NHJA 2VEDA 4NVRA 4PX3A 3QVVA 3NBYB 3WRXA 1N2EA 3GEBA 1NNEA 2NU8A 4ZQGA 4IIJF 1FU4A 2WJHA 4ZI7A 4UCOA 4DPMA 2D6FA 4EUFA 1T1EA 2C2DA 1N2HA 4MX8A 2OXEA 3DS8A 1N9KA 3I04A 2H3HA 3M4IA 4M7EA 2R60A 1NQUA 5GONB 3Q5EA 3IVXA 3GMIA 3E9RA 3H5IA 3JQ7B 5BQPA 4GX1A 2XB2A 4JODA 2ZROA 1I6KA 3V6JA 3X1WA 4YRZA 1JR2A 1RWXA 3BCUA 4RVHA 4G5OA 1Y33E 1NVGA 3AOEA 4W1PA 1RJFA 4HDNA 4D8XA 5SV2A 2IV2X 1ADFA 1S4QA 1NBMA 2JAXA 4JUBA 5KYKA 2AOTA 3ZI0A 1SQGA 5A7FA 5I7VA 3VRHA 4NOJA 3FMIA 2Z2IA 3FRJA 2EBFX 3E5HA 1RACA 3GEMA 3FI0A 5JI2E 4JVNA 1CQIA 1LPOA 1B0AA 1WXWA 4O82A 2OZLB 1O97D 2ORVA 2UVWA 1V9PA 3LKVA 4RXUA 3A1EA 3UHFA 3T5BA 2Y1LA 3S70A 2YW2A 1U4OA 3AR6A 1FFYA 2HIGA 4G41A 4G1BA 3WKAA 4PZ6A 3LQKA 1RJEA 1M0WA 1AHPA 1DEXA 3BGWA 3U19A 2QX6A 2WFZA 3L8DA 4GWGA 3OBIA 1VLJA 2K7ZA 4KODA 1V7PC 4LRWA 4RYLA 1YCDA 1HDOA 3ZKWA 2X7HA 2C78A 2KM1A 3KHHA 3MG9A 1F38A 4JI2H 1ZR2A 4ZOQI 2WSYB 5BSUA 1GSOA 4V0MA 4QYIA 3THWB 1CUVA 2HHLA 1P0FA 3FHTA 3KHLA 5EXEA 2FVYA 5C4MA 3KJFA 4NCAA 4HGRA 2F1KA 1GGHA 1BS2A 3UICA 2ROQA 2Z02A 2A88A 3H8SA 3JQBC 4ZYXA 2FVXA 4XDGA 5K09A 2FPIB 3PE6A 3PE3A 4MEBA 4MIOA 2IHVA 3V1UA 3M9LA 3JQAD 3FCOA 2HFKA 5I8WA 2H4WA 1VI5A 2BVNA 3EXEA 1EKVA 4QSHA 3TKYA 2VWQA 4ARBA 4N0PA 4D26A 3RYTC 3LLSA 3L46A 3OKCA 3QPBA 4ITUA 1UPUA 4YUZA 4BNJA 3IDOA 4HH4A 4AO7A 3JZFA 3OM8A 3T3NA 2ORYA 4DANA 2R86A 2WRZA 4DC0A 1T5BA 3W7AA 1HE4A 1TRKA 2WD7B 2OBNA 2JEFA 4JV5B 2Q1XA 4BRUA 2W6OA 3ZGOA 3FPSA 1A9OA 1V8PA 2AMLA 4FLFA 4FD3A 3JQ7A 4UUGA 5A3QA 2IDZA 1Q3KA 4DV7B 1H93A 1EVIA 5AVKA 4TT3D 3CB2A 4RL4A 3EIFA 2J30A 3UM9A 2PE5A 2QYSA 1Q0LA 1Y0BA 5EHGA 2HW8A 2AXEA 3FB4A 5ITWA 2Q4RA 2ZR9A 5KC9A 3EBPA 2PNFA 2AOUB 2Y4RA 3P52A 5A5VA 1N0WA 5A0TA 4Z2YA 1IBRA 3IESA 5JARA 3DQZA 1X7XB 3R0QA 5K4AA 1NI4B 1OH7A 3I6IA 3I9KA 1XN4A 3TOZA 2DVMA 1LLQA 3PUYA 3T5PA 2QMQA 3OE1A 1CIVA 3X44A 3TE6A 4A1OA 2WTAA 4KO3S 4OFZA 2PMWB 3P0FA 1BA2A 2WC1A 5K6TA 1EI9A 3GV5B 2PN1A 3JRXA 4MYSA 4ZYYA 4E0BA 4C2MA 3ZWWA 1NYLA 4UD6A 3CSSA 4PCLA 4R1LA 3G5UA 2V7UA 2MYPA 1Y6FA 1KXJA 4PBSA 2PPLA 3TLCA 4TSKA 4QIWE 4F2PA 3GVHA 4S0XA 2V6BA 4FYMA 5LQKA 3OURA 4QWMA 3OCVA 5C4GB 4CG1A 4MWCA 4R1UA 3MGGA 3BCHA 1ZD1A 3LCJA 2G9VA 3WB1A 2PUFA 1J9ZA 3THWA 4JXXA 2ZUVA 5DGAA 2RG1A 4ZXPA 1E62A 1DBWA 1UBJS 4R9SA 4BMCA 3B9PA 4J2TA 3WY9A 1GDTA 2I7XA 3JYHA 5EDWA 2XA1A 2R44A 1WCIB 4LRTB 4MHSA 2FPIA 2W2KB 3LS2A 1XPRA 2VT3A 1Y5IA 2BFBB 1DO2A 3BWMA 4M8SA 1P4HA 1Q1AA 4DN6A 1GPDG 1CUUA 1NTOA 5KFHA 3S2FA 3HKDB 1Z0AA 1U4SA 1XRRA 3RBAA 3AI7A 3WV4A 4XJXA 4NBUA 3MGAA 1EX9A 2QL5A 4X0EA 2RIRA 2W57A 2I29A 2XYPA 1ZN2A 3MMXA 2FUKA 5CITA 2KHZA 3MTQA 3ZY3A 1KAOA 1WCYA 3IBYA 1GA6A 3E7DA 2AWNA 2WD7A 4MSUA 2ZI6A 4K3UA 5C8ZA 4CM8A 3BERA 1QJ4A 1TM7E 5CFLA 4IOMA 3LUBA 4Z7OB 3JVUA 2J6TA 2O57A 1OU0A 3S2GA 5DISC 3PZPA 3EBOA 4IQGA 3I05A 4HRVA 2AOUA 5LVAA 3PGKA 3GAAA 5G41A 4YR9A 2QPLA 1ZH2A 4BWSC 3GIWA 1R0SA 1EDBA 1X7XA 4UBLA 1OFGA 1YDWA 3DDZX 1P2DA 3FAZA 1NI4A 3FNRA 3GVCA 4R6XA 5DMHA 1MIOB 2UZAA 1WBDA 5GVSA 3VQTA 1X9IA 3BH7A 2F7SA 1NLYA 3KQQA 3E9NA 5LMNH 3II6X 1RXCA 1CR2A 1B3RA 2PL1A 2J9FB 1HDEA 1GYRA 1LVHA 1DCTA 1D1SA 4M46A 4TS1A 3M5CA 1H0RA 2PD4A 4R98A 2TMGA 3UMSA 3SNKA 3RS4A 3P27A 5IBQA 2Y0DA 2UVVA 4RJKA 1L4KA 1NAIA 3CNEA 4XWTA 4PRYA 4MOWA 1YFLA 3QFCA 4JITA 2FR1A 5L3QB 3STYA 3PW7A 1PR4A 1IHXA 5JPCA 4HWRA 3L0BA 2CUNA 1UKAA 3PC8C 4M8IA 1T6XA 3ZLTA 3RYCB 3PD0A 5FL3A 3PXUA 1IVSA 2Z09A 3I92A 3BZUA 3WWZA 4F7DA 5IKOA 2C7VA 3BMCB 3CO0S 4Q21A 1YQDA 2L82A 1CZKA 3ETDA 3WXBA 2HKIA 4EPWA 3P32A 3RU7A 3AONB 5KNDD 4D02A 1WCIA 3GAFA 4WEQA 3BHJA 2DLNA 3HJFA 4ED7A 3WICA 1ZNQO 2BFBA 4WWHA 3AUJB 2HI0A 2IU3A 3HKDA 5LOVB 4WZAA 4MXDA 1O77A 4I4TA 2G77B 1T9AA 5AIAA 2VJBA 1FF9A 4RY9A 4EB3A 3N2YA 2GKOA 4IMJB 4P5DA 5IXJA 3GIIA 1J49A 2MR6A 5KWEA 2JCVA 1N6IA 4OFBA 3ZHTA 3ZJYA 1OTYA 4HUQB 3QY9A 2C9ZA 1Z18A 5B57C 4AJLA 1IUKA 3TPZA 4BOYA 3H4MA 2X8BA 3H20A 1SU4A 3EC7A 1PZEA 1EH5A 1FQWA 3VGPA 4C7XA 1FJGB 1S1MA 3HFRA 5JUMA 4JR1A 4L8VA 1XO1A 2WUDA 4K2AA 1Y5NA 4RPIA 4KIUA 1ML3A 2JLRA 4B7ZA 1PJ2A 5LD2B 2FEXA 1UMCB 3ZUPA 3UJDA 4KC0A 2C5GA 4RVNA 1UBTS 1R6UA 4HDCA 2HHFB 1ZICA 3EUWA 1JTEA 3ASUA 3GCDA 3ER9A 2X4IA 1E2QA 2YZKA 4OOFA 2I78A 1VCNA 1GQSA 3G0OA 2BP7B 1V4YA 2BUCA 2HRDA 1CRPA 2J9FA 5KT4A 4F38A 5EINA 3AR3A 2FZLA 5E6SB 1CP2A 3GMTA 3FTFA 1MO4A 4OSPA 1CY2A 4H31A 1YU6A 2AC7A 2V4QA 1TLFA 1AA9A 4ZPXA 3C8MA 5AW6A 4PS1A 5KVAA 4MR7B 2EAUA 3KR0A 5K3FB 4ZCSA 3OZUA 4UTPA 3FLAA 1KZ1A 5JS1A 3IAUA 3SIRA 1IXKA 1ZSVA 4AQYH 2C97A 2P7IA 1MJHA 5L3QA 4O2LA 1I6UA 1ORHA 4RVOA 5LUAA 3MWFA 2CNDA 3CVJA 2OKGA 2IF0A 4ZVVA 2CXTA 4XOUA 1ZY2A 4EL0A 4LF5H 4RCNA 2HA4A 2OBBA 1D0SA 1B4DA 5KWIA 4WVLA 2RHCA 3BMCA 4B3RH 3AEKB 3KD3A 2AF3C 2I67A 5DXJA 4EB0A 2XQFA 3TI7A 5HF5A 3B60A 1AQ6A 2I66A 1ZGZA 4DQ0A 4CIWA 4F6CA 4WEOA 1N1EA 1NPTO 1VA5A 4NENB 2V7BA 3VSBA 2QX7A 2AH5A 2HZBA 2KJQA 4FDVA 4RTQA 3E0QA 1EUQA 2C4TA 3I2KA 3VR1A 4HPJB 2DWCA 4TSFA 1DAGA 5LOVA 1E99A 4DBVO 2PUCA 2EIYA 4XCVA 2Q28A 4LQLA 3CZPA 1H1TA 2ID7A 3OTQA 3K5IA 3HYNA 1KI6B 2HC9A 1COWD 1XTUA 3TCKA 4IICA 2J41A 2R8IA 3S2IA 4HUQA 1IUNA 3LX8A 3MFHA 1T0IA 1FS5A 1LDMA 1FNDA 1QP4A 2HMSA 4G37A 4B3XA 5CE8A 4DL7A 1ODSA 3GILA 1HYQA 3USCS 1Y5LA 2IKSA 1RVDA 4Q15A 4BZXA 1P45A 1P2SA 3U3RA 3VR6D 2B99A 4JEHA 1OPXA 1PSDA 1E7WA 3INNA 2XWJI 4GP9A 1L4YA 5FLMG 3THRA 3WBJA 1UMCA 4IKOA 3OHPA 2NUAA 3RC3A 3P9QA 1OBHA 1OTXA 2HHFA 4NMWA 4UD2A 5C5EA 3DL0A 4RB3C 3H42B 5AI6A 2O6LA 2PS0A 4A27A 3U3KA 2WWYA 2RJOA 3CX7A 2BP7A 2DX7A 4OHBA 1RWBA 1ISFA 3PQ6A 5AXDA 1KXZA 2HDWA 2XEDA 3DZBA 3LY5A 1SG6A 3BGDA 1T36B 2PRJA 2CYCA 5E6SA 3KB6A 1WDMA 3TB4A 4QZVA 1ULHA 1BFUA 3Q2IA 4MR7A 1CY6A 5K3FA 4NY1A 3PPVA 4PC2A 1TEXA 3OIGA 3KXPA 2RCNA 3RBDA 3UYLA 3V42A 3UTDA 4FNMA 4KXQA 1FDSA 5L53A 5G0WA 5B36A 1U9YA 3MFYA 5IYZB 2OZVA 5FULA 3EIEA 4Z1OA 4KBFA 3UKJA 1RC1A 2ZRHA 3PNQA 4ECRA 1I0LA 3GUYA 1Z2NX 1WABA 1XU9A 4MQMA 3QA9A 3QIAA 2JZNA 3AEKA 3MCZA 1J0XO 1IY8A 4BVKA 4HDQB 4I50F 4MW2A 4MYTA 4RF2A 1RTKA 1LC0A 4NENA 3F46A 1DLJA 4FMDF 2Q6OA 1SVUA 3TR5A 1NP7A 2HCRA 2VOEA 1UBCA 4BC0A 1GPUA 2PLAA 4UJ5A 1JDZA 2F43B 3GJSA 2B34A 3NLLA 1KI6A 1ZCZA 4YRJA 4EKIA 4YJ3B 4ALJA 3MR3A 3BRSA 3C6YA 3F1LA 4TZ0A 2YV2A 2WHXA 1G5IA 4B73A 4D9MA 1J9EA 3TQSA 3CZMA 1OYWA 1E61A 3DHYA 4QRHA 4X85A 3ZE6A 13PKA 3AUUA 4M1SA 2E89A 1TXGA 2R11A 2JI4A 1WO8A 4EYEA 3PX3A 2BI4A 2VN8A 4GZ5A 4F4CA 2YCHA 3OTIA 3QVMA 4IDEA 2R25B 4G86A 4JXKA 3T7EA 1B33N 1NL3A 4YRMA 3UANA 3UMBA 1XT6A 1YBHA 4XB1A 3BD7A 3SF8B 2AUNA 4BDSA 2W6QA 1I4LD 4DV3B 1C1YA 1X94A 1I3QA 5C7OO 3GP3A 1XZEA 3CJTA 5EIOA 3CRNA 1GKYA 4C0SA 1VL1A 2BQ3A 1ZL0A 2C0PA 3T0FA 4DUYB 4OQPA 3VNRA 1TF7A 1I9CA 4X65B 1IEWA 3BE5A 1FSZA 2JIZA 1T36A 1UT6A 4JYZA 2XLBA 5AKGA 2ECKA 5A06A 2DQKA 4UM7A 3SS7X 1AVTA 2O0LA 1EXVA 1KK0A 3VBEA 2AN9A 3FBWA 4BBPA 2XOEA 4CM4B 4EO9A 4GOKA 1XPJA 2FR8A 5CR5A 1OB5A 2P6PA 2PUGA 4BGIA 1W4RA 2PTHA 2FQXA 1J9GA 4AUKA 2WYVA 1LDGA 3I9FA 3MCAA 3VV2A 1A77A 4F85A 1A9XB 4CW7A 4A93G 4UCUA 5IYZA 4A15A 3AB8A 1EFAA 3WK9A 3IPYA 5IP9G 2XSZD 4ED8A 3W7BA 1UPBA 4EI9A 1XTTA 3MQ4A 4FYHA 2FF7A 1WHTB 4GX5A 4JJ7A 3CRRA 4D9HA 3CUTA 4FFSA 4PG6A 4HZUA 3ZXSA 3MMSA 4EY4A 2ORWA 3ZVRA 3FBGA 4MVJP 3H1PA 5JD6A 1T5TA 3BXOA 1ORVA 5JW6A 2CN1A 3X2FA 1EVKA 3DXYA 2IZ6A 4QU5A 1UC9A 2C84A 2F43A 2JGLA 3CM0A 3OIWA 3GPBA 3W5JA 2HPZA 3GPDG 4LC0A 5EZYB 1RHRA 2NTJA 2UUAB 5CH5A 3NETA 1XDSA 1FTNA 3U80A 1PJZA 5EOYA 3H2BA 4RJJA 2BE7A 5LSAA 3ODGA 4QE3A 1UC8A 3K9NA 3TN7A 3PIDA 3RVSA 2QLNA 3ABRB 4RTOA 1HFEL 1WX1A 1QKKA 2EP5A 3K4PA 3ZU6A 1I6LA 2VQFB 1AZWA 2JF0A 2YJNA 2VUHB 2AJDA 1ZXBA 2I3AA 5A9RA 4D3FA 1O58A 3S1LA 1XJCA 4JS0A 3I3OA 2C61A 4RIFA 3SF8A 4RHXA 1Z45A 1J7KA 3MWGA 4KACA 3GARA 4HNTA 2DHQA 1U2DA 3ORQA 2Q6KA 2QRUA 4ZPJA 1DIKA 5EUMA 3H1EA 3PGJA 4YCJA 3TKAA 5FTJA 3OIFA 4Y6RA 1Y9EA 2O8VA 2VIIA 4UM9D 1OLUB 3MVEA 3QHPA 4RGBA 4ACBA 3ZE8A 5IC5A 4MVYA 3ULKA 4EDFA 5KSYA 3NGLA 1E3WA 3KS9A 3KIPA 3WGTA 1KYVA 3RFFA 4KIGA 1ULSA 1T35A 3R20A 1XF9A 4Z4GA 4J16A 1X7WB 2FY8A 4TXHA 4DL6A 5DLYA 2C28A 1WW2A 1UC5B 3QEKA 1CUJA 4BGUA 3DZ8A 4CM4A 3WOVA 3OO1A 3TZBA 2O5RA 1QP0A 2ZBVA 1NNUA 2H0AA 2GM3A 2I0FA 3L2OB 5FEUA 4IG9A 4AG6A 2GD6A 4JLOA 2Q4OA 1A9XA 1RJDA 2GZ2A 4NFLA 2Y0CA 1WF6A 4YRNA 5ALYA 1YQ9A 1XL0A 2J4FA 1VB3A 4PC3A 4MV4A 2V4UA 1FNCA 4O4IA 1JHPA 3DEFA 4WUVA 2CNKA 3DFFA 4JLWA 4OMCA 1I2LA 1R6XA 4W8GA 4U5QA 1WHTA 3FM9A 1KEEB 5LN1A 3D3KA 3A11A 1G17A 1T3ZA 3UT5B 1SB8A 3FTPA 5K8UA 4JYAH 4RY8A 2HCJB 5G0UA 3MR6A 4ZYWA 4HS9A 2FWRA 1PYOA 2HK6A 4C07A 1MXHA 4NIMA 2XXAB 2GPWA 4GECA 1JHQA 4RGVA 5T4EA 5DBFA 4YJ2B 3P0IA 5EZYA 3N0RA 2ZIVB 4YRLA 1BHJA 3EULA 2HLDD 3IIJA 3ZHZA 2WDTA 3WMXA 1VLVA 2AMFA 5FUWA 2P4HX 4L72A 3E3NA 3KOYA 5L3VA 4MROA 2XZLA 5KFJA 3KJIA 3HNOA 4N5LA 1BMQA 1W4BA 2I22A 2QD1A 4B3GA 2XPCA 1ZDMA 4BCCA 1XCOA 4U9UA 3IG0A 3D2CA 1WIWA 4C2AA 3DOUA 3SE0A 3OQJA 1OZ0A 1FRQA 1HTTA 4ZOEA 3HRKA 4TLMB 3KQSA 1H6CA 4NP6A 3ENQA 3Q8QB 1E20A 4CGZA 3QPVA 5EGSA 4MI3A 2AK3A 4J03A 4OI0A 3N07A 1ZUD1 2N47A 3KDSE 3QLUC 5F64A 5CW1A 2W6CX 2EG9A 1OLUA 5EKDA 1U0HC 1CC1S 4J9KA 1OWPA 4C3VA 1CWUA 4H7FA 3R7SA 1NMXA 4KWTA 4G5YA 5AHRA 3QKIA 1CZUA 1L1QA 4TTRA 2JIPA 4RTNA 2O7RA 3TQFA 3PT9A 1UANA 2H4FA 3TTVA 1KTVA 2WHEA 2Y93A 1X7WA 4RSGA 1Z8NA 1GRVA 3GIJA 1VOTA 2O1SA 5L51A 4IVRA 2VEOA 3VC7A 3CBGA 4L2IB 2QZPA 2CXRA 1KRWA 4DV1H 1T0JB 2AJLI 4IZHA 5ADHA 5H5JA 3HB7A 3GRVA 3LUGA 4QNNA 3L7IA 2ODNA 5HCUA 2VK4A 1POXA 4UAJA 2IZZA 4UTOA 3R77A 4B3CA 3M6FA 1H6BA 3DP7A 1RKQA 3RABA 3RUCA 4Y2JA 1IG3A 2VTBB 3U0GA 2LWIA 2I3ZA 4B46A 2PG3A 1JJVA 1G2OA 4IDPA 4POAA 1KEEA 1Z6TA 3QYJA 4MVJA 2XUAA 4GLFA 3KXLA 4QJ3A 3CSUA 5F9LA 3UT5A 4YRSA 5DB4A 3MA0A 4D7AA 4Q3OA 1JDBB 5HIKA 3ZCQA 3HDQA 3Q9NA 2BV3A 4RE6A 2XCAA 4CDGA 3RBVA 3IBFA 1TZJA 4DG8A 2XXAA 2FGKA 2Y9MB 3DFZA 3RM3A 5KQMA 3KHTA 2GJKA 1V11B 4YJ2A 4LJYA 4DLAA 1G21E 1TRHA 1Q15A 2ONCA 2HVQA 3BJIC 5SY9A 1M34E 1WDWB 2ACEA 1DLIA 2OCYC 3JZMA 3PNKA 3UGTA 1X0XA 1NTRA 5AJHA 3RK1A 5KFCA 1RLOA 4HAIA 4RH3A 2N3ZA 1IBLB 4ZI7F 2JAQA 1E3TA 2OBFA 4N82A 3ZCPA 1U28C 2OP0A 4GWKA 5IVPA 1FP6A 4W5RA 4O7SA 5BQ3A 1R4NB 4B6GA 4ED1A 5B1IA 3NM5A 1ZCFA 3WG9A 1ANKA 4H17A 1RWOA 2YWFA 5BR8H 2WBLC 5T3UA 4YCDA 1E66A 5KVSA 3L5KA 2UZIR 1CJSA 5HUJA 3AY3A 1DIGA 2GCNA 2WYHA 3K5WA 5HPYB 2YNMC 4AQDA 1ZRHA 3LAWA 3CU5A 2DR3A 2C3PA 5AHKA 2RHWA 2SICE 4CI9A 1REQB 2JRLA 2WDZA 3GQCA 3IODA 3I04M 4JUZA 3G5TA 2H9IA 3B5IA 1T3LA 3IMEA 4WOKA 1GKIA 5FBZA 4OSOA 3C7TA 2PKQO 2E0IA 3B3AA 3NGXA 3E70C 1NZJA 1Y8QB 3FMFA 1TK2A 3OM9A 4MWGA 4IH4A 4BKPA 4DNQA 4S2EA 4KO1S 5FBLB 3P9YA 1UODA 1HYBA 1N56A 2BL4A 1H2YA 4L2IA 3E9CA 4D9IA 1PL7A 3MWDB 5L4LA 2WIBA 1S97A 1N0VC 1JX4A 3KJNA 3NHRA 1GQYA 1MQ8B 1VYHA 1I2AA 3EZFA 4P84A 3RSGA 1AQYA 1GFIA 3H4TA 5JASA 3R8CA 3CLHA 3GJ3A 3WGIA 5EWMB 2G63A 2I4LA 4K9RA 5HDQA 4XGKA 1N2JA 4KI7A 5TPZD 4EWLA 3GD7A 5B3JA 4WGFA 2J48A 1UNNC 2K2QB 4QWCA 3ETEA 1G4AE 2XUZA 1ETUA 4KAFA 1J8MF 3OFJA 5IF3A 3R7BA 3HOWG 4ARSA 2F3SA 3EPIA 3W4KA 4HLNA 2GD0A 2RAUA 1MEEA 3N7UA 3EOZA 4IFBA 3SE7A 1NJ8A 1YBVA 3E22B 1MJ5A 1OXSC 4O33A 5IT9W 2ZREA 4GE3A 4WLUA 2YASA 2UUPA 3Q0IA 1N2ZA 2Y67A 5CEEA 1ND5A 1S1CA 2QGNA 2UVDA 2H4YA 4KIWA 1L4GA 3H0GG 1V11A 3JQ9A 2CJXA 4KDEA 4LX8A 2J6SA 3GRPA 4TROA 4G1UC 1FZQA 2FCRA 1EUCB 1ZJYA 3F6EX 4YY3B 2X5JO 3GDGA 1DDGA 1UXJA 3W9BA 4DXDA 3VZRA 4M0FA 3FUCA 5ITVA 3FTQA 1QHGA 2CMHA 2FJZA 1O7JA 5KFIA 5FJIA 1R4NA 4HAUA 4ZTZB 4FD2A 1UJ4A 2ORIA 4W9NC 1TZCA 2WA1A 2D5IA 1QFXA 2J0UB 3WB9A 3SK0A 1OI4A 1U81A 3WIDA 2OV6A 1BDJA 3CVWA 2FFJA 2QNIA 5C3EG 5JSYA 5KFNA 1SWVA 1P1BA 2WPDA 1WB9A 2IHTA 1K3FA 3DXFA 4IDAA 4TSRA 4MIKA 5CA0A 1D0IA 2VHJA 2GPJA 3JS5A 3BAAA 2ZZMA 1REQA 1MEOA 1PO7A 1UKEA 4CR6A 4JEMA 3DEZA 3QJ5A 4TQUS 1KWKA 3JQ8B 5CYFA 2QUZA 2JCGA 2EOAA 5LDGA 2IS1A 5JJIA 1IXSB 1YZNA 2HTFA 2BH9A 1Y3DE 3S6JA 5BSKA 4AYTA 2O1XA 4BVBA 2XUIA 3K71B 3BWBA 4RB1A 5FL7A 2RGVA 4L3VA 5IEBA 4ZALA 3RVLA 1IL0A 3MWDA 3NANA 1SEIA 1YZTA 1UBGA 1E1RD 2DQSA 1E58A 1PBNA 3M6VA 1QCYA 1S0UA 2V55B 4DV0H 4EELA 3CMMA 3GWGA 4KKXB 3VMMA 4W9MC 1N9GA 1JGTA 2VDMB 1I4OA 3GGCA 3KE9A 3OESA 2B92A 5BURA 3BD6A 2QUKA 2OHXA 2QROA 1JECA 1XMIA 1QHHB 1UBOS 4BE4A 1MAWA 3OC0A 3ZCRA 4N9QA 4QQFA 2AG8A 1VGQA 3MHPA 2J3DA 4CHIA 3SN6A 5B2FA 1OXUA 4V0RA 3C3AA 2FPLA 3LLUA 2F1OA 4YDRA 3A9CA 4C0HA 3G6WA 2R92A 4D99A 3D8TA 2BMWA 4YUVA 3RIYA 4F5ZA 2HSWA 2Q3BA 3O2QB 5CNJA 3E22A 4DR6H 6REQB 2JA7G 1TO6A 5ABPA 3OIYA 1WXQA 3UHAA 5FOSA 3OQIB 2PQMA 3S55A 1OTHA 5TT1A 5ESDA 5J9FA 3ESYA 3UG7A 2E5LB 2VKQA 1EHCA 4Q4DA 2R48A 2J3IA 2WIFA 5HIJA 4B40A 2HREA 4AKIA 3KFXA 3V4FA 1P7VA 3OU2A 5E3HA 2CYBA 3B1FA 1EUCA 3IAS6 4FEGA 1UWKA 2OD9A 3JAKB 1S10A 3UOWA 4A3IG 1Q6YA 1XBTA 1QIGA 1MV8A 1OZFA 5F7XA 5CFPA 3RAQA 5JJKA 3FPEA 1BQ4A 3QA3E 1OE0A 3Q7PA 3PNOA 1Z13A 3UJ3X 4YQEA 2RGBA 2D2FA 4MTLA 4MI6A 1N8SA 4Z54A 3NRJA 3BXHA 4A03A 3LNCA 3HUDA 1BVHA 3KU1A 4KZKA 5M2QA 2ZT7A 2BMEA 2CFIA 2RGRA 2JJ8A 5KFMA 3JQ8A 2QS9A 1JKIA 1HEIA 1E1LA 1SG0A 1P4AA 4Q16A 2V7TA 4X97A 2QY9A 1IY9A 3B9QA 4CMAA 3Q7RA 5KKNB 4C1BA 2DPYA 4RMGA 1NW7A 2FV8A 1TVEA 4H6VA 1YZLA 2MSLA 4AYXA 2I4NA 3SU8A 3R6TA 3M81A 3A2MA 4WN9B 1YI0A 2ZRMA 3B78A 1GTJ1 4E70A 3RUIA 3EDCA 3V7YA 1N33B 3HH8A 3DA8A 3MUFA 3OX2A 1HE2A 1KJYA 3VV3A 1NE2A 4YQZA 4A8PA 1OF1A 1Z28A 2G71A 2YQ4A 3BICA 2J5QA 2EYQA 2O03A 5KG7A 3EH1A 4KXNA 3QXSA 4KXVA 3ZHSA 2AI3A 2ASVA 1QHHA 1Z06A 1AB5A 5AH0A 3SSMA 2PT9A 3G9XA 4G56A 3HO1A 5J4VA 1K83A 3T3EA 3TY5A 2ZAOA 3D5EA 4G25A 5IMSA 3P9RA 1XZJA 1DKMA 3T1QA 5ALQA 1OBCA 1Y4SA 1Z88A 3FYUB 3GC6A 3EY4A 3GOQA 4LMRA 5F9HA 3AVOA 1XCBA 1DG3A 3ISJA 3STTA 3ELBA 6REQA 2IYQA 3WKBA 1VHQA 1TYCA 2UUCH 4M4SA 1EWQA 1U8XX 1NUTA 1K27A 4RCVA 4MO2A 4L4ZA 2X4DA 5I4BA 2BBOA 4Q1CA 1UL1X 1XHEA 4I4TF 5FBVB 1EUZA 1M54A 3ZDBA 1HURA 3OMLA 4LQDA 3ND9A 2FSVA 4RK0A 2CWWA 3AEYA 3H19A 1DRWA 2HBQA 2F55A 4ISBA 4C01A 3GLFB 1WNFA 3JAKA 1UDAA 4I46A 1QGYA 4C4OA 3FUWA 1EVQA 3LLMA 4ZVTA 3FMVA 4D6XA 4I99A 4H7DA 5EJMA 4G36A 4J3NA 3U4CA 1X86B 3ACBA 4Q4HB 3GLQA 3MC1A 4I5DA 1ZUWA 3MIIA 2ZAIA 2QYZA 5CGQB 1R0WA 3K0CA 2PVSA 4NU6A 1T3SA 2FPGB 3QUBA 1X77A 4E7OA 1W4ZA 2GCOB 5JHGB 4OLBA 4LMPA 2VNSA 1Y37A 2XCPA 1KKMA 5FBRB 2ZQYA 4ENRA 4N4AA 2DERA 2Z83A 1PCXA 5LMUH 3UXEA 1NVBA 4RKEA 5D6OA 2C77A 5E0KB 2W9XA 3MB5A 2R79A 1KBLA 2JKVA 1XU7A 1TD9A 4BNHA 4FTWA 1E4YA 3D5QA 4QWDA 1SN7A 1Z9BA 5L4SA 3S81A 1FSSA 1ZM7A 1NG9A 4WASA 4LV8B 1UBSB 3N0VA 3QWAA 1Y8RA 5B12A 5ALDA 4N65A 3NJ4A 4WN9A 3HZHA 1QH8B 4A2PA 4QREA 3UHPA 2NV0A 3EEFA 5CBKA 4QEDA 4KITB 4IZIA 3AKYA 1U04A 2F00A 1Q83A 4R1NA 4WZBE 1RK5A 2C54A 2ZWOA 3QVGB 2GTHA 4C29A 5BWUA 2F8SA 5F7ZA 3PDUA 5FAXA 3C70A 3T38A 4Q9JA 5TSDA 4DIOA 3CIOA 2AKAB 2BM9A 3N2KB 2AYXA 1GJRA 4MYCA 3IKTA 3NKFA 2Y8EA 3ZIAD 2HD4A 3FSGA 1NP3A 1V3VA 3O2NA 3WK7A 2H5IA 2QTGA 3EFOB 3FYUA 3ZE9A 1W93A 3DQQA 10MHA 2APJA 3K8QA 5DTJA 4LWQA 5K7SA 3IMKA 2X1VA 2PUJA 1FXUA 1U7XA 4XJTA 1Y14B 3QVTA 4WDQA 5GONA 1GL6A 1L4LA 1EZZA 5T6BA 2CD7A 5LOVF 3K05A 3LIPA 4BQIA 3PQCA 2QF7A 1J24A 1JFVA 2DSNA 3E7PA 1TDJA 1M1NB 1BGVA 3T7IA 2ZANA 3OJFA 1P8JA 4BVHA 3OTWA 5TGDA 3GLFA 3E5MA 1JHMA 1YB4A 2DRIA 2FZKA 1ZIXA 3GLHB 4MPDA 1UEJA 4OM8A 4PZ9A 1GPWB 4AJHA 4AP5A 4I1VA 1W36D 5EA2A 1C3EA 1VBKA 3C16C 1MG5A 1YL6A 3A4YA 2X9QA 5AT1A 1KDRA 2FSPA 4AT1A 2AQHA 5FF9A 4YMVA 2OZLA 4Q4HA 1DC6A 1BXGB 3T99A 2IL1A 2FPGA 5DZSA 1SCKA 3SHWA 1ECLA 1XK5A 4LRUA 2MJLA 4DDWA 2O8CB 3I39X 1KH3A 3M3PA 6GPBA 3RJ5A 2CL0X 1N2XA 4PQRA 3VPBA 4D25A 2ZJ2A 1DV2A 2R7ZA 3ZTTA 1H2RS 4OXRA 4JASB 1L3CA 2XCUA 3LC0A 3QKRB 1DAPA 5DHAA 3IQHX 1Z0KA 3OEYA 1SULA 3V4VB 5LZ7A 4EFKA 5JAPA 3LA8A 1TAHA 3C8DA 4IUBS 4U7JA 4F97A 4HWSA 1OSNA 3ZU4A 2WSLA 5JSFA 3MRVA 3WGOA 1LLFA 3FPHA 1VYVA 4A91A 2JGKA 3C39A 2UU9H 2CL7X 2JC3A 1QH8A 1JAYA 1A72A 2ZI9A 1NW4A 3MWLA 3O8QB 3REGA 3ZDXB 2GCGA 1YL5A 2CHFA 4D9GA 3HY6A 1DV1A 1DADA 4RX1A 4LGVA 2I2FA 5JAQA 2ZS7A 1MC1A 4I7HA 5CVUA 3UW3A 1JSLA 3QVGA 2BD0A 2HXYA 1IVYA 3H2KA 3QLVA 4I3GA 1JLMA 4KXUA 3I0NA 1F0PA 4GGOA 1SIBE 1QCCA 3N2KA 5K9ZA 4XDZA 3PQFA 3RYFB 2AXQA 1BEZA 1EK5A 4UM5A 3EFOA 4K6HA 1Q50A 4X8MA 3D3EA 4JI3H 4F4UA 3I23A 1TJ3A 5TS3A 3V8RA 4QWWA 3ZS9A 4AD8A 1JHOA 2KBEA 4L8YA 1Y4UA 3WZ2A 1KYIA 5FFFA 3SLKA 3TTXA 4NZMA 1HKHA 1GG8A 2ZRLA 3WJ1A 1NY5A 2ZJFA 1KJ8A 1G8PA 1YR8A 5IYCG 1XEWX 3HADA 1M1NA 4O0LA 2OH2A 5BYJA 3NHLA 2C7BA 2IHZA 4HXEB 1B6TA 1BQEA 1XI2A 3LYLA 3T5GA 2QW0X 1H2AS 2QTHA 1CEXA 4H7HA 1YVEI 1PJRA 3D0RA 1ULZA 2Q1SA 4JUIA 4BJ1A 4MB2A 4Q7KA 2JGAA 4LGMA 1GSAA 3RSFA 4RLQA 2VPSA 4WKPA 1BXGA 2V1XA 1FFHA 2BGIA 2WSIA 3LXXA 4D82A 5BYBA 4YV1A 5HEKA 2O8CA 1QRDA 1NVKA 4AMBA 2V9ZA 4IV0A 4HH0A 1JXLA 4S1NA 1GAEO 3OTOH 4D98A 3EGOA 2E4YA 3BJYA 4OJQA 3HBAA 3QKRA 3KOMA 3KB1A 1JDVA 2ZYAA 3A8TA 3L41A 3LQ2A 3NIWA 2A92A 1U1IA 3CX3A 3N6XA 5KVCA 5AQEA 3F5QA 3F5DA 3PLNA 2UYGA 4LYYA 4NONA 4BNMA 4PYKA 5K5EA 4RJ2A 4JWTA 5K8IA 4MDYA 4Z53A 3JR3A 2CVZA 4D4JA 2IYNA 5AOBA 2HHHB 3LF1A 4YJGB 3MTGA 3IP1A 1FS4A 4J0GA 3BFJA 3QKUA 3RUEA 4D0LB 1UEXC 3O8QA 4X61A 5AFSA 4LW8A 2W2KA 3TDMA 5BWVA 3BWVA 1GPAA 2FE1A 3A31A 3ZN2A 3EX7C 1KSFX 1E77A 4IVNA 4LE1A 2J45A 1XTBA 2Z1DA 5EMLA 2VATA 4G85A 5LFAA 1DC5A 4X3OA 5IYZF 4ZVLA 3MSCA 4FP9A 4BO9A 4UMFA 3RJ0A 1Y1QA 1Q1EA 3FRIA 5CFMA 1IJEA 1U5CA 1AGYA 3I52A 3OA2A 3W78A 3DNMA 3RYFA 3TFOA 3OJLA 4D1YA 4J0DA 2AW5A 4B6SA 5F9MA 2FQYA 1GOTA 1W0JD 4CM3A 4C04A 1U8CB 2C9YA 1V8BA 4XQ0A 1IBKB 4HR7A 3A1VA 2DY1A 3HCBA 3JPWA 3TXAA 2XE4A 5SZIA 3A6LA 2P75A 4OUDB 2IYVA 1JFRA 4Q43A 3BE8A 5FYQA 3G85A 3AW9A 4Y6QA 1KZ9A 1RBMA 3DLCA 2CYAA 3JV7A 3CNLA 1A0OA 4MGHA 4ESVA 1J22A 4ZA2A 2W6ID 1GL9B 3SFVA 3MWJA 3IP5A 1I36A 3HGTA 2H48A 3M4ZA 4XGIA 3E9DA 2WK1A 3RJZA 4HH1A 5D1PA 2AZ4A 4GKKB 4Y2UA 3Q41A 3MTBA 3UK1A 5KFSA 3EVFA 5H59A 2REQB 2J9RA 4AL4A 1MIOA 4D5EA 4F4IA 2GAAA 3C6BA 3VPHA 2Y6UA 3UIEA 3IE0A 3FCXA 2NO6A 7ADHA 3LBYA 4IINA 1HTWA 3F3YA 3DF7A 1U9IA 3KPJA 3GUUA 4JR0A 3U37A 1OLOA 3FWPA 4K7JA 4URXR 2QW8A 2O2CA 4CN8A 5JU6A 2GFQA 4IGKA 1FLNA 2PANA 1KDYA 1VTKA 3K5HA 4PN3A 3L92A 2OORA 3ZNPA 1JYEA 3D7KA 1OI7A 1XZGA 1CNMA 4DUGD 1RE0A 1YF3A 1QTNA 2WG1A 1J5EH 2PO5A 1W9MA 2ONZA 1BXZA 4RKRA 1IATA 1H4SA 2ISQA 4PWQA 4TM8A 3T3MB 2G83A 2ZYIA 2ZT6A 4L4SA 4Y3UA 5E8RA 4ENPA 3RYCA 3HC7A 4YJGA 3FCEA 4ZVNA 5EG5A 4RHTA 1U2TA 1NJ2A 5KYGA 4HAZA 1ONSA 1FBNA 4QYWA 3O84A 3CUEF 2K2WA 1HLFA 4D81A 4ZODA 3E5RA 2PL3A 3UXYA 1DAHA 5IM5A 2Q99A 2GAFA 3SJZA 4J90A 3DOFA 2Z2ZA 1BE0A 1H8HA 2IUEA 1GCGA 2R9VA 4O4IF 4S24A 4YXWA 3CZAA 1KO5A 1WXHA 3BBLA 3DBOB 4ED0A 1P17A 1TAGA 1DTEA 1N2OA 3G49A 1EXDA 4DCGA 3KOZA 1BS1A 2EX1A 1Q77A 2BELA 3BHNA 4KAJA 4OMDA 2YNMD 4UBIA 1X9HA 4N5DA 4OUDA 4YRRA 3LLVA 3PHIA 1L4HA 3IEVA 1WR8A 1NVVR 1VE6A 3P0RA 2X9LA 4GLOA 3NB0A 3QNWA 3OX1A 2VJQA 1FDWA 3AKZA 1MZBA 4JC8A 3LTNC 2XYQA 3DDWA 4GOXA 1OIVA 4KXMA 5IDYA 1Y1WA 2J6BA 4C0QC 1X1EA 1T26A 5DP1A 4GC7A 3B6IA 1G6HA 3FFAA 5EZYF 3ISTA 1H2HA 2Z58A 4R83A 5BWTA 5INTA 4UM8B 2NVWA 4IJVA 4CEIB 2XYVA 4OHVA 3B7GA 1EDDA 1K3TA 4BV8A 1QCDA 2REQA 4RENA 5K3CA 5G1OA 3ZX5A 5JT1A 4M0JA 1IULA 5LLSA 4JKIA 4G1VA 1OBFO 5KFYA 3MAJA 3FB1A 4YA6A 2ZUFA 2YWXA 4J2HA 3QUSA 2YHUA 2V3CC 1WB5A 1YS2X 3F8WA 3EQ2A 3GRAA 4BLUA 5DLDA 3WNBA 5HKKA 3VTZA 1FLAA 3S8EA 4MAFA 3IT0A 3FX2A 4OHYA 3FMGA 2VJOA 1D04A 2C2ZA 2W2MA 4JB8A 2WTNA 1KYYA 3N8KA 4H6PA 5TEVA 4E31A 1EVEA 3HN7A 5E9WA 4U6SA 1BXKA 2BSXA 1FPQA 3NYRA 3PFIA 3DFMA 1KWGA 4L5IA 4EGQA 2VHQA 1X1TA 2X1LA 4IHAA 5KTSA 1RAIA 1GU1A 4WOJA 1O3YA 2P30A 1DCMA 5AWFC 4WE3A 2QN8A 1E60A 1DIOB 2JFWA 3CH4B 2X58A 3U61B 1HV8A 1VRWA 3LX4A 3OOWA 1DFHA 4F4XA 3OSNA 2VHTA 2W42A 3NUQA 2QUJA 4B47A 4CLXA 2Z8ZA 4EUKA 2CZQA 5A4AA 3T4EA 3F4KA 1H05A 4DAOA 3NX4A 3QU4A 1Y1RA 4U9IS 4EHDA 2EKDA 4LYGA 4N0EA 3IRVA 4C20A 1R18A 5B7PA 5TJHA 3UK0A 3WNCA 5CX4A 3UJBA 3QITA 1DC8A 3QX8A 4NHEA 4MAMA 4S1OA 4AP6A 4S35A 3ZY6A 2XVXA 3U44B 2NM0A 3CLUD 4EO4A 3L4SO 4GH5A 3SHTA 3F49S 4A0SA 4HGNA 3A9VA 2HYIC 3F7OA 1GT6A 1X70A 2AQKA 4AIRA 3GFFA 4Z4FA 5I5VA 1PFUA 5DYTA 3BWXA 1FNNA 5CXXA 4MVJF 3C3KA 3KHRA 4WXHA 4CU5A 4F60A 4JI8H 2Q9UA 3EVGA 2VPQA 1XRPA 5LNK6 4L9WA 1TC1A 4WXMA 2WVJA 5JWHA 1N6OA 3VPCA 2FE3A 5AP9A 1YQXA 2YICA 5B6PA 1Z5NA 4M1MA 3H8JA 1E7MA 2CWDA 4C0XA 3FPBA 3BGSA 2VPTA 3S1AB 4YJ2F 4CUZA 4F4JA 1QYVA 3ZHVA 4FMBB 1U0FA 3ZNOA 4PNHA 1NBWB 5KOYA 4CEIA 4UBKA 4FFMA 1Q57A 4XGQA 5KZMB 5F73A 3F47A 3HI6A 4I4NA 2BFNA 4MCJA 3JY6A 2WIGA 4JP1A 1H1DA 3TBFA 3RV4A 4OBWA 1M2NA 2AN5A 2P9YA 4G63A 2XUDA 4QUHA 4HNUA 1Q0SA 4RLFA 1Z07A 1N48A 2VDPB 1U0SY 3ND5A 5FOXA 4DE5A 4KP7A 4BNFA 3L8YA 2FN9A 5EHXA 1AKYA 4YFVA 1K2WA 2XKKA 2YCLA 3PUIA 4FS1A 2HGSA 4BV9A 4UDYX 1O9BA 2RGEA 5IVIA 4EJ6A 4GR5A 4YN3A 4Q03A 2ZB3A 3P45A 3WBKA 4EA9A 1KDTA 3BG5A 1I4TD 3IDSA 3ON5A 4WSOA 5IZCA 5TGZA 2QRZA 5DHSA 1C4XA 2ASJA 2PH5A 2AC4A 1HG0A 3ST7A 3W9YA 2IH4A 4XQ9A 2J7KA 5EQDA 4KQGA 3QHQA 4LFCH 3ICWA 1M6YA 2LE0A 1A5TA 1L4MA 2MOKA 4PR3A 1SOUA 1Z26A 1ZCAA 5SYAA 3FY4A 1PW7A 1JQEA 2PD3A 2XGOA 1NUUA 3C2QA 4HNGA 2JNWA 3HABA 4HWOA 2YKGA 1NBME 3OFNA 2C20A 3U44A 1JU9A 4O02B 5KPJA 4BFTA 3BWDD 1RYNA 4HADA 3SJCA 1UXKA 4YJ3A 3AVQA 1VL6A 3GTMA 2E49A 4YECA 2R8JA 4JUCA 2PO7A 4N3CA 3O21A 3NHAA 3CJQA 2W9CB 4MI1A 2FPPB 4CIXA 3DBLB 4B7UA 5AVOA 3LDUA 4Q24A 3NV7A 4R2KA 3NTUA 1UFRA 1RXIA 4Q9KA 1UDWA 1UXGA 1DKUA 4HB0A 2GXSA 4OGGA 3LY7A 4FOOA 4KPEC 2QTWB 4HYQA 3Q8WA 1XCMA 1AZTA 4EBFA 4RBNA 4EYHB 5ICMA 3QVXA 3N53A 5CTJA 2O2EA 1EFHA 1A9RA 1XXLA 2W70A 4AECA 3DCIA 1T43A 2CC2A 4DW8A 3QRWA 4WFKA 2K6GA 4DPLA 3HA2A 1OWOA 1DAMA 2HIAA 4DLUA 4JA2A 3VNNA 4V0ME 1MGOA 5AVYA 4KVZA 1K6IA 3KQVA 2P1RA 3HJNA 1HLPA 1II9A 4JWKA 5EIWA 5A2QW 2G70A 5BSMA 5C1IA 4OHRA 4IDOA 2JH3A 1M3SA 4J4TA 3PSAA 2R7KA 5I7UA 2O7VA 1R0BA 2P8JA 3FFBA 2P9QA 3SHFA 5AI5A 4MJ3A 4J8PA 4FE3A 5FWDA 1KO7A 2HY7A 4B6QA 3NU1A 3WO0A 1BJRE 2BTOA 4CE6A 1DJOA 1U98A 4YB8B 4HD8A 3RTCA 1JL3A 3ROZA 4X94A 2WSSD 2UDPA 5DG7A 3K1JA 5CA0F 5JYEA 1XRMA 4YC7A 4U7GA 5JCJA 1EX7A 2O9JA 2VTDA 4NYJQ 2D8AA 3KD2A 4CGYA 2XC9A 4S3MA 1W46A 4U39A 3PXCX 2O0JA 4DA7A 3NVDA 1JKXA 3SF0A 5K8VA 1D5CA 3C3EA 1N7IA 3FFXA 3RPEA 1TM3E 2FE4A 2CEKA 2JAOA 5FLKA 4EUSA 4X1IB 1B1AA 5K3SA 2D1SA 4C7MA 4MKGA 3N87A 8OHMA 3BILA 2PR2A 4JL5A 2PLRA 4Y9UA 1OYOA 4XD7A 1L7AA 2QL7A 4NPCA 1UDRA 2XNHA 3VVLA 3D4IA 5IAGA 4L73A 4FGSA 2QDKA 2JLWA 5F7OA 2CXOA 1FVOA 1U3GA 4YAFA 1SXQA 3RVRA 2YJ4A 4IP0A 4R3NA 3LVBA 2WJZB 3AERB 1LBEA 4JQCA 4JT2A 1B2RA 2OCXA 2C8JA 1PJSA 4HB4A 3L7CA 3QVOA 1CJKC 5SICE 4RFVA 2ETVA 5KI6A 2OWEA 2X7XA 4WBSA 1U90A 4ZRDA 2W9CA 1T8WA 2FPPA 3TX6A 3DBLA 4IIVA 2ZSUA 1K92A 2A57A 3LPMA 2PWYA 3U3MA 5G02A 5BNFA 1GARA 1VXRA 2IJGX 1EA5A 3MCVA 3SJUA 4A0HA 5FLXW 5ILOA 4N6NA 2FGJA 3QPCA 3PZRA 3TOSA 5L7TA 4B83A 1ECPA 2XRZA 1N34B 4RTJA 1C0LA 1JWAB 2EF1A 1Q92A 2JFBA 2HBZA 3LT2A 4QWBA 4N47A 1PTKA 3BE6A 4DMFA 3SEQA 3SICE 1U0EA 3EA5A 2NPFA 4A8JC 5D7NA 3SGLA 4R9RA 1XTIA 4FE7A 4HLUC 4R1PA 5DI9A 5G3YA 4NHOA 2YFKA 4PEVA 1G7TA 1BC5A 1LGYA 3CNNA 1DIRA 3CS3A 1H2ZA 2ADMA 4W99A 1KYTA 5EUQB 4PX5A 4YIKA 3HP1A 2XTJA 2WWTA 5CH3A 2XTZA 4RPLA 1K66A 4UHEA 4YB8A 2CHUA 2XNDD 4ZZ1A 5C81A 3GA7A 1MFZA 4HX2A 4YRFA 3M4XA 3HCFA 1SQFA 3BF7A 3P2OA 1VIYA 3W06A 1VJDA 1V0JA 1YS4A 1ENOA 4YAWA 4PF1A 5BV7A 3EF0A 5CIWA 3AX6A 2JK1A 4YYEA 1K1QA 4ID3A 1I94B 5A4DA 2QQEA 4ZYTA 1L8QA 1GTSA 2MR5A 1XEAA 5HIIA 1JE1A 1I1NA 2CDNA 1U0LA 3A4MA 3FF1A 4E03A 4WBXC 3Q6MA 1NSFA 4X1IA 5KDOA 4CCWA 3Q1KA 3HL4A 1X2BA 5K2OA 2R4QA 4O2AF 2WOOA 3BMXA 2H06A 3RFCA 3MJTA 4X62B 3FSEA 1FX0B 4X20B 3UUGA 3VR0A 4DWWA 1OFVA 3E1GA 5FUBA 5M7EA 1SQ0A 1ONOA 4BAUA 5DBEX 3T4UA 1QHEA 2JLQA 3ETLA 5A05A 5HF8A 3AERA 2VQEB 3SZGA 3ENVA 4NV3A 1AMUA 2GCEA 4ZT5A 1CJBA 1RAHA 1TQ4A 3DAAA 4UAUA 1CY8A 4ZFNA 1YD7A 1DKOA 3UJ7A 1P9OA 3CHYA 4M1TA 2Z56A 2B20A 1FVIA 3NYWA 1TFUA 4BO5A 5I5WA 1PKEA 1Z6XA 3C5EA 2R1VB 4XYEA 5DQIA 3V6HA 1SUWA 4OY3A 4DL3A 4UHFA 1YRHA 4FQ8A 1J8YF 1Z5WA 4F06A 2B1RA 1O0SA 1RYSA 3DKIA 3VU1A 1R8XA 4UNSA 4BB5A 5BQ5A 3MRSA 2PMCA 4GKJH 1U2ZA 3ILYA 2H08A 1JEYB 3OLQA 4LWOA 1XKTA 4G0UA 4M9SA 2GZRA 4B3TB 4ZT4A 4LOHA 4EI8A 1G59A 4QUAA 4L9AA 3SZOA 2OFFA 4KXWA 2GM9A 4QDOA 1P9LA 1E3IA 4Q39A 5KMGB 1D9ZA 4UFPA 4ENWA 4PTYA 4ND7A 2QK4A 1P5ZB 2R4UA 4MPRA 5F5NA 2AGPA 3WGNA 5KTYA 1GD1O 2EZ4A 3LBHA 3STHA 4EYOA 4Q19A 3FNBA 4MVJG