2YS9A

Structure of the third homeodomain from the human homeobox and leucine zipper protein, homez
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
GSSGSSGPLPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title structure of the third Homeodomain from the human homeobox and leucine zipper protein, Homez
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox and leucine zipper protein Homez
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11569 Homez Homeodomain leucine-zipper encoding, Homez
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ys9A00
1AU7A 3JRCA 1BW6A 3G1MA 1WPKA 2O7OA 4V2FA 4B4CA 1JJ6C 3G1OA 1JGGA 2NS7A 1TWFJ 1OJLA 2HOAA 2WAQN 2EZHA 4ABZA 3RQIA 1ITYA 1K83J 2W48A 3ZQGA 2JWTA 1IUFA 4AYBN 4AUXA 4A3BJ 3FIWA 2EH3A 3CQZJ 2LFBA 4MLOA 3JRFA 1W0UA 1GUUA 2R92J 4JX6A 4A3KJ 2DMUA 5FKMA 2COBA 5M5WJ 2MGQA 1GV5A 5C4JJ 2DA1A 5FLVA 4HNVA 2CUFA 4A3JJ 4GFBA 2XB0X 4MIMA 3JRGA 2L9RA 2EBIA 1LFBA 1HF0A 3OOUA 4FE7A 5F0FA 5M5XJ 1S7EA 5FKLA 2DMPA 2CQXA 3JRDA 2JJ7A 5F0HA 1QPIA 4A3DJ 4BKXA 1UG2A 3OIOA 3A01B 1JT0A 3GTGJ 5IOZA 1HLVA 5K7FA 1GVDA 1ENHA 1W0TA 1G2HA 3Q0VA 2ECBA 5FKOA 3TW6A 5BNGA 5JLXA 2EZLA 4W97A 1ETYA 3WHBA 4A3EJ 2PMZN 3I4MJ 2R93J 3HOZJ 2X48A 5EF6A 3IV5A 2ZB9A 3HBLA 3BTJA 2VKVA 5IYBJ 3MN2A 1RPWA 1TC3C 2E2IJ 1F36A 2NS8A 1U8BA 1HCRA 3Q0WA 2XPUA 1LE8B 3MKLA 4XICA 4QIWN 3SFIA 1BW5A 3OSFA 2LK2A 2X6OA 1A6IA 2DA6A 2DA5A 3FISA 2IBDA 4LOCA 4W1UA 3HOVJ 4M6VA 3L1PA 1RKWA 3TP0A 3BR1A 3HEFA 2JA6J 2AO9A 3TP3A 2E2JJ 1IV6A 2MG4A 4S0HB 1Y1WJ 4BXXJ 1HOMA 5DTDA 5E3MA 3Q3SA 4XRSG 1FTTA 2L7MP 5EG0A 1EF4A 4A3IJ 1MH4A 1IC8A 2IAIA 1NK3P 2R0QC 2L7ZA 3FK6A 5J1RA 1U9OA 1JTXA 3ZQHA 1TWCJ 1FJLA 1P7IA 2HYJA 2YS9A 2VPRA 2XB5A 2JA8J 1ETOA 1UHSA 3S1NJ 1JKRC 3NAUA 2HQ5A 2R5YA 2LTPA 2JA5J 2O9LA 2HDDA 4DZJA 5EGOB 3FKIJ 1X58A 2EZKA 1QVTA 1U78A 5EDNA 1AKHB 1H8AC 3DCFA 2KT0A 3GBGA 4QTRA 4IHVA 3HKZN 2VKEA 1ZR4A 2R5ZA 1OFCX 3ZQCA 3F0CA 1MSEC 3S1QJ 1H88C 2DA2A 2B63J 4FTHA 4DZPA 1E3OC 1MBGA 1JUMA 5FLMJ 5EZGA 1I3QJ 3S15J 1I6HJ 3GTPJ 4CYCA 2O8KA 2XGEA 1RR7A 2FD5A 2MSYA 3HOUJ 3O8HA 2ME6A 1HDPA 1X2NA 4V2GA 1ZKGA 2DMTA 2JN6A 4UUTA 5J1UA 2NVXJ 9ANTA 1FEXA 2D5VA 1VF9A 1O4XA 2QF7A 1Y1VJ 3HGGA 2G0EA 5HODA 3JRIA 1X2MA 2EZIA 1I50J 4DYCA 2LP0A 2LVSA 3Q0UA 4I76A 3IH4A 5GPCA 1CQTA 2M8GX 3A03A 2WB1N 4BY7J 2QCOA 5IP6A 2DN0A 3LSRA 1JT6A 5E3NA 3CMYA 1NTCA 4RBOA 1MBFA 2VI6A 3GTQJ 4AC0A 1YRNB 5F1JA 1ORKA 3I4NJ 2M2EA 2CRGA 2H8RA 4X1EA 3S2DJ 2GLOA 3M3YJ 2MW8A 1RETA 1JKPC 3BG5A 1VNDA 1ZTRA 3RZDJ 2L0KA 2TCTA 1ZGWA 3D1NI 1APLC 2CQQA 1Z77A 4JX5A 3S1MJ 3S14J 2DMNA 1YRNA 1GDTA 4XK4A 3JRHA 3OSGA 3LNQA 3BG9A 4IHWA 3LOCA 2R7ZJ 3M4OJ 4A3LJ 1TWGJ 4BBSJ 2TRTA 3G1LA 3PO2J 4M3BA 2YUSA 1OCPA 1B72B 1VFCA 3ZQLA 1ETQA 4FE4A 1ZQ3P 1H89C 2K9QA 2DMQA 2X9DA 2L7FP 4IHXA 4Y52J 4FCYA 3BT9A 1AHDP 3PM1A 1WH5A 1FIAA 2DA4A 4QSHA 1T33A 2XRLA 2FX0A 4FISA 2RAEA 3TW7A 2HXOA 1ETWA 2LD5A 2I10A 2XGDA 1JUPA 5M3FJ 4J19A 1T56A 2ECCA 2K9SA 4Y7NJ 4A3CJ 4RDUA 3BR5A 3GTMJ 2JMWA 3HB9A 4JX4A 1D5YA 2HOTA 2P81A 3IH3A 4C3IJ 3H3VK 4DYRA 1PUFB 2Y9ZA 3GTJJ 1JKOC 2DJNA 1R9TJ 1AKHA 2ID3A 1NK2P 1MBKA 3BQZA 1RESA 3K7AJ 5FKKA 1ETKA 1TWHJ 5FKNA 2XGCA 3VPRA 2HXIA 3BR2A 1FTZA 4D5CA 2H1KA 1HDDC 1VI0A 3MVPA 2NOGA 3FK7A 1B8IA 1JTYA 5IP9J 2DA3A 1IG7A 3HM5A 2LKXA 2M0CA 2WV1A 2Y2ZA 1IDZA 1GT0C 4XRSA 1IGNA 3RKQA 3UKGA 3WHCA 2M34A 3RZOJ 5C44J 1B8IB 3S1RJ 4MFDA 2IEKA 2JK3A 4A69C 1MNMC 2YU9J 3DEWA 5GPAA 5JLWA 2GM4A 2DA7A 4B1RA 1BJZA 5EYRA 4C2MJ 1MBHA 3H0GJ 3K2AA 2XPWA 4I6ZA 2FJ1A 2DTZA 1PUFA 3S16J 1XC5A 4MO7A 3JREA 1GV2A 1IRZA 3ZOBA 2R5YB 1JJ8C 5IYCJ 4CYCB 2NVYJ 3JRBA 3B6CA 2CUEA 2FQ4A 3BQYA 4DYQA 2JA7J 3HOWJ 5GP9A 1B72A 1A5JA 3HOXJ 1QVUA 2OPTA 2Y9YA 1UMQA 1XS9A 5FJ8J 2E2HJ 2R5ZB 3LSGA 5EG0B 1WGXA 4A3GJ 1SANA 3QPLA 1WCMJ 1SFOJ 4D7NA 3W6VA 3B6AA 2Y0SN 1Q1VA 4C3HJ 2Y30A 1MBEA 3NARA 1MH3A 3CDLA 4D5FA 3S2HJ 2E19A 5M5YJ 2EQRA 3BR6A 2M9HA 2LR8A 3ZQIA 5F27A 4A3FJ 3BG3A 2ELKA 5J1YA 2K9NA 4EEFG 1BA5A 4A3MJ 3HDDA 1QRYA 3TEDA 4IEJA 4M3FA 1F43A 1JUSA 3S17J 3SDGA 4X6AJ 2AHQA 3BR3A 4XIDA 1ZK8A 3A02A 1WH7A 1IDYA 1IJWC 1U9NA 4B3AA 5F08A 1ZR2A 4M3EA 5M3MJ 2OF7A 2VUMJ 1K61A 5J3LA 4XRMA 5EGOA 2ID6A 2ME0A 4DW6A 1MSFC 1DU0A 4A93J 5F0CA 2CJJA 1MBJA 1WI3A 2LY9A 1ETVA 2GBYA 1XG1A 2NVTJ 4L5EA 2KDZA 2LLKA 2XPVA 3A01A 2HOSA 3HOYJ 3QQAA 3LSJA 3GTLJ 3IH2A 3BTIA 5K7HA 1LFUP 5EZHA 2Y31A 2HI3A 4M3DA 4NDLA 5EEAA 4BY1J 3C2BA 3JR9A 5C3EJ 2K40A 3JRAA 5IPAA 1OCTC 4G12A 5IYDJ 3E7LA 5IP7J 5F04A 3O8GA 3LSPA 4D7MA 1TWAJ 5E3OA 3BTCA 1FIPA 2NVQJ 3CCYA 4IHYA 1Z0XA 5DS9A 3HGYA 4JP0A 1JKQC 2N8GA 1RKTA 4M3GA 3PO3J 4C3JJ 4UUSA 2E1OA 3GTOJ 1POGA 1ETXA 5E3LA 3GTKJ 3SJMA 3BR0A 3QPSA 4UUSB 1LE8A 2XSDC 1DU6A 4MFEA 5K7ZA 3ZQFA 4JYKA 5C4XJ 1P7JA 1BL0A 4BBRJ 3BTLA 2CU7A 5IOYA
chains in the Genus database with same CATH superfamily
3AL0C 2ZKZA 1AU7A 1HA8A 1LEAA 5D5VB 1FSEA 2EINH 3G1MA 5CPRB 3TDUC 1SD6A 2XC7A 3I56I 3CCQI 1YITI 4B4CA 1WSUA 2NS7A 4IPAA 5H2FC 1QHGA 2EB7A 3HXLA 1IUYA 2P7VB 2FF4A 1FYKA 2F48A 3ZMDA 1OCCH 2UXXA 5E79C 1EA3A 2DFEA 1T39A 2FNAA 3IL2A 2F6CA 4AYBN 4AUXA 2CSOA 1XDUA 1R4NB 2EH3A 2EWNA 4L0YB 4ZH4F 1R71A 2HTSA 5JVTA 1Z91A 5FKMA 1OCZH 2K3PA 2QSGX 4CCKA 1A35A 1YS7A 3VSLA 2YR2A 2EIKH 3KX2A 5H6RA 3ZXSA 4HQMA 2CUFA 3MKWB 2XB0X 4HLYA 4XNFA 4UB6C 3MEXA 3D5RC 2WA0A 2ZFUA 3JRGA 1F4KA 3VFZA 3S3NA 4XLHA 2A5YB 4MEXF 1PP7U 1NG7A 1HF0A 3OOUA 4AIHA 2HKXA 5F0FA 3AG2H 4BGDA 5M5XJ 1JE8A 1S7EA 1XTAA 2BV6A 2CQXA 4KIFA 2IT0A 5F0HA 1ZG1A 4RMNA 2DU9A 1QPIA 4A3DJ 1DGRM 2CUJA 1UG2A 3OIOA 4HEA2 3A01B 3GTGJ 1GVDA 3KE2A 1ACIA 4BAYA 3FXLA 2F5CA 1G2HA 3TW6A 3E6CC 1R5GA 3F8BA 5J8CA 4W97A 1ETYA 3WHBA 1O3TA 1OLTA 2WAEA 5EF6A 3DLLF 1GLNA 4I99C 3FXOA 3CCJI 2ZB9A 3HBLA 4OAZA 2W57A 3EUKL 2BXZA 2F5FA 3MN2A 3L2UA 3KP4A 4XM3A 2STWA 2V1XA 3MKLA 4XICA 4HYEA 4U88A 3T8RA 3GMEA 1TNSA 1BW5A 3OSFA 5FRMA 1MJBA 3CJRB 4D9JA 2LK2A 3OMYA 2V26A 2P7CB 1ON1A 3KEYA 3HOVJ 2BVLA 4M6VA 3HHHA 3TP0A 1K6OA 3BR1A 3J81Z 1EH6A 4I02A 2AXLA 3UNGC 2M3AA 3ZN0A 3HEFA 3GFLA 1HKQA 4ENJA 3PNYA 2E2JJ 1IV6A 3BC8A 4ESJA 5FD6A 1FLIA 5DTDA 1K78B 5EG0A 1VQOI 1EF4A 4NC6A 4A3IJ 1MH4A 4RAGA 3K4KA 3F9KA 3KZIC 3IRRA 2M0MA 2XHKA 2Y48A 5LRRA 1MDMB 1IN5A 5J1RA 1JTXA 2LDUA 3ZQHA 1MNEA 1PDNC 1TWCJ 2DOEA 2V6CA 2P6SA 2YS9A 3KLOA 3I64A 2JA8J 2RNGA 1UHSA 1P9QC 2ELHA 2LKPA 3NAUA 2A5WA 2O9LA 2K02A 1R22A 2XF5A 3FKIJ 1QVTA 1QZEA 3O3KA 4B48A 1SAXA 3T8TA 2VN2A 1FYMA 3J7AY 2ZBKA 1BOAA 1H0MA 1YOVB 2KT0A 3GBGA 4QTRA 3ZQCA 3H1CA 4RLFA 2DFFA 5FLXK 1YW8A 2EIJH 4FTHA 1J2XA 1J09A 1E3OC 1D1CA 1JUMA 2JVHA 5LGNA 4M71A 3V8KA 2O8KA 5GAGJ 1ZREA 3I9V2 2K3FA 4LD5A 3KLNA 2XGEA 3F8FA 2FBIA 3Q9SA 3QPTA 4LLGF 4BYYA 2AS5F 3K1MA 2ME6A 4V2GA 1ZKGA 5LHHA 3FKJA 3G71I 2NVXJ 3H5AA 2PFBA 3SZPA 1LDKB 1W7PD 1X2MA 2IS1A 4OINF 3E1SA 5CQEA 2LVSA 3Q0UA 2V4JC 4I76A 3IH4A 2WB1N 1K4SA 1R1VA 1WJEA 2FE3A 2QCOA 2BZTA 5DYMA 5IP6A 1I1SA 2EV6A 1JT6A 3GWZA 3LSRA 3ZGKA 3HKZA 3HSFA 2NXNB 2DBBA 5CJ9A 5L3BA 3KP5A 2K27A 3WU2C 1YRNB 2O8XA 5F1JA 1RR8C 3F3XA 4F93B 4M74A 1Q1HA 2H8RA 4EJTA 4A0XA 4BDYA 3S2DJ 1RC9A 2FOWA 4BDZA 4CSWA 2Q8KA 1DPRA 3FXMA 3K69A 3BWGA 3BG5A 2DJIA 2CO5A 2M7AA 3ECHA 3D1NI 2GZWA 5D6FA 3I59B 4JX5A 3L7WA 1RZ4A 4HX4A 4ZYEA 2DMNA 4JQFA 4BE1A 3HHGA 1OKRA 3OYCA 5K5RA 1TWGJ 4BBSJ 4EGZA 3GLLA 3MFKA 3CF5F 1V54H 3PO2J 2XAFA 1HQCA 5ERIA 4FE4A 3VEPA 4XRFA 3W6JB 2L7FP 1A6QA 5LHGA 1PYVA 2M30A 3W6KB 1T38A 2VJIA 3PM1A 1WH5A 1L0OC 2OJED 4RB1A 3GEZA 1FIAA 5TGTA 5CKTA 1WKMA 2RAEA 3RCOA 3I54A 1QO0D 3IWFA 4XR6A 2HVQA 2JVGA 4PDKA 3A0BC 2BY0A 1N25A 2WBMA 4PJNA 2RV8A 2V9PA 5HDKA 2K9SA 2RGVA 2G7HA 4WXDA 4MHGA 2AQFA 2KRCA 3B73A 3BR5A 2BOLA 2ZXHA 1I6XA 3C2HA 2YSRA 2X1CA 3K6GA 1VQPI 1YJ9I 4Y3OA 2X6XA 2JMWA 2KZGA 3ABUA 1J7KA 2P81A 3IH3A 4WXCA 4CCNA 3H3VK 2MH2A 2Y9ZA 2PBIA 3OYKA 2HNHA 3RYPA 2ESNA 1AKHA 2ID3A 3BG6A 1YS6A 1XPXA 1D0YA 3BJAA 3DF8A 5K5OA 1ETKA 2ZO4A 4S05A 2HWVA 5AIQA 3ABLH 3PJRA 1O3RA 4HRIA 3E6MA 3RPQA 2PG4A 2IGKA 4Q47A 2A68F 3MVPA 2M1BA 2NOGA 3FK7A 1B8IA 1IRXA 2VIXA 5K5QA 5IP9J 2HZDA 2J5PA 2F4OB 4OIOF 3EDPA 3K70C 2K86A 1OYWA 3CCLI 2JRTA 5JHFA 3EPZA 4EV0A 2KHMA 3B02A 3OYAA 1IGNA 3RKQA 3UKGA 3LQRA 4PUSA 2M34A 3RZOJ 3WGGA 1B8IB 2Z1DA 4MFDA 4WWCA 1R58A 3GXOA 4A69C 3J7AO 3ML6A 2GWRA 1LVKA 4B8XA 4BACA 2LMDA 2UV1A 2Y75A 4XOTA 1E2XA 5GPAA 2GM4A 2P0WA 4UUVA 2B9SA 1BJZA 2UUZA 2M87A 4OMYA 3GCMA 4IL6C 2XPWA 1S29A 2FJ1A 5DM6F 3SFZA 1T0FC 3C2GA 3K4MA 4YFKF 4UVCA 2VB6A 2WTEA 1GV2A 1XMKA 1IRZA 4ESBA 3ZOBA 2IGOA 4I7HA 2L7KA 1G3SA 1BIAA 2MD0A 2BVMA 4D0PA 3DKXA 5KCMA 3ZP5A 2JA7J 2E35A 4Z6YA 3BY6A 2P4WA 4MQ9F 3HOXJ 1U8RA 2NRAC 1BN5A 5HVQC 4DJAA 2DXIA 1XGSA 5B1BH 2HOEA 2LF7A 3AG1H 3QPLA 3BCBA 4ZZLA 4ZZDA 4IXAA 3B6AA 2Y0SN 1BR2A 3RJPA 4C3HJ 4E70A 1MBEA 3HUGB 3NARA 3C7JA 5M5YJ 4E4HA 4XOPA 4AVPA 3GZ5A 2K9NA 4BU2A 3L00A 2VJ4A 1WZ2A 4KNYA 3HDDA 2VONA 1FBSA 4AWXB 4E7SA 1ZRFA 3QPHA 4M3FA 2QZ8A 1F43A 4BXFA 3T0YA 2AHQA 3BR3A 2K9LA 3CUQB 1MMAA 1T98A 2R7VA 2L3DA 3QP6A 2A3SA 3FM5A 4RA2A 3KEOA 1LKXA 4R79A 4RB2C 2O61A 1D1AA 2OZ6A 4M3EA 3SEQA 1J75A 5IT9Z 5CVUA 4UHTA 2PMHA 1SEUA 3K4CA 4A93J 1ZH5A 3RDIA 3BOQA 2HU9A 2GBYA 4U87A 1REPC 4BS9A 1Z6RA 1XSVA 3LFKA 2OBPA 3H92A 2WV0A 3I53A 3TDZC 5J8FA 4UVBA 2VJJA 3HOYJ 3WG7H 4ZTJA 5EEHA 3TMOA 2GA1A 5J4YA 1N75A 2OTLI 4HNUA 5ILUA 1LFUP 4UB8C 2DK8A 3LSHA 3FHZA 1YLFA 4A0ZA 4G94A 2VKHA 2VL8A 3NWTA 4M3DA 1FC3A 3C2BA 4EM0B 3KETA 1ON2A 2O6GE 1ZARA 5J47A 1FWZA 5C3EJ 4HLXA 4RAZA 3JRAA 5IYDJ 5F04A 1USTA 2Q2EB 1MMNA 3NEUA 1OYYA 1Z0XA 5DS9A 4JP0A 3G4SI 3K0LA 3M1EA 4C3JJ 5GADJ 1UB9A 2XKPA 3K4JA 1ETXA 3OY9A 1OMIA 2E7XA 4BEHA 1ZLKA 1STZA 3BR0A 4IF4A 3SJMA 4UUSB 1UFMA 1LE8A 3J7YJ 3R6SA 3ZPLA 1K78A 3ZMVA 3ELKA 4O5VA 2IS2A 1WRJA 1USSA 2ZXJA 4ZTFA 2QYOA 4KFCA 4ZJZA 4XN0A 3ZQQA 4LLNA 1WVRA 3MKYB 4KN4X 3EUAA 4KICA 1JJ6C 2HZTA 3JRCA 1BW6A 3TOBA 5J4VA 5IT9K 2FMLA 1WPKA 2H6BA 1R5ID 1N78A 2ZJQF 4N9HA 2P5LC 1MGTA 5DM7F 1ZAOA 2XF6A 1TNTA 1KYWA 3IAS2 1KQ8A 2L4MA 4C2UA 2EA2A 2HOAA 3T1BA 4HA8A 1BIBA 1ZYRF 2DT5A 4HV5A 3RQIA 3QOEA 1K83J 1IRFA 1TT0A 1VQ6I 2QVOA 3Q5FA 3AKZA 3X2QH 3FIWA 2LH9A 5HS8A 1JGSA 3JRFA 1W0UA 3E97A 2GIVA 1OR7A 4JX6A 3VSKA 1B9NA 4PFOA 3H36A 4EM2A 4XSXF 4HNTA 3RPUA 3FMQA 4PSWA 2IGMA 1QNTA 1GV5A 4GYGA 5C4JJ 4LB6B 3WTTC 1EJ9A 2HVSA 1LUJB 4HNVA 4A3JJ 5GTIC 4BJ5C 4YFNF 1VZ0A 4UY8I 3CZ6A 2W1OA 2Z5UA 3ESWB 2KJCA 2MLKA 2L9RA 5D6EA 2EBIA 3JCUC 1I1GA 2JSCA 4RGUA 2ZXIA 3PUBA 4LK0F 5D4RA 4FE7A 4KA4A 2OA4A 5DCMB 5E18F 5FKLA 2DMPA 1HXDA 5FROA 3CDIA 4Y4RA 3D5SC 3OYGA 4CO8A 4OIRF 1BI3A 2BEOA 3CLQA 3WTWC 1X1BA 1JT0A 2DT7B 4Q4ZF 5K7FA 3FF5A 5FFZA 3HPGA 3G3ZA 4CDGA 3CESA 4YIRX 1W0TA 4GO1A 5K1YA 1X4OA 3Q0VA 2ECBA 5LGTA 1HSTA 2EZLA 4A3EJ 4AIJA 5A2QZ 1YE9A 2XGXA 2IA1A 3LA2A 4L18B 2X48A 3GF2A 3SYTA 5ED4A 1F1ZA 3OV8A 5IYBJ 4HSTA 1NG6A 2E2IJ 3I4PA 3LQQA 2XPUA 1Z9CA 3IRQA 1XDSA 4B3XA 2NVUB 3SFIA 1T95A 2RQPA 2NAZA 1J59A 2X6OA 2M45A 2DA6A 3FISA 1TW2A 2L54A 1FYLA 2JT1A 4DBQA 4XBFA 1QA6A 2KJBA 4Y13A 3IP4B 2UZKA 1X4PA 1TQIA 1YTYA 1Z3YA 2AO9A 3H0DA 4S0HB 1P4WA 3N05A 3WTZA 4KIGA 3Q3SA 3QWLA 1SD4A 3H5RA 2L7MP 3KPHA 2BHYA 5ILVA 1YQAA 2WC2A 4Q48A 5E1WA 3J80Z 4E7IA 1NK3P 2Z16A 2X6YA 2YPRA 2E1MC 2FOKA 3FK6A 3DPTA 5CVIA 3K70D 1FPQA 2FA5A 1FJLA 4IHTA 2HYJA 3U21A 3BPXA 2Z99A 5KNLA 1CF7B 4WCGA 2ZJ2A 3PIOF 3BPVA 2HQ5A 2R5YA 3CUQC 5A2QK 2HDDA 5EGOB 2EZKA 2LC2A 1U78A 2LREA 5EDNA 2PQ8A 4XMYA 1SFEA 2BY2A 2ISYA 5FFXA 2JPBA 4IHVA 1ZR4A 2LG4A 3E6BA 2XVCA 1MSEC 4LG0B 2DA2A 2FBHA 2HGCA 1B4AA 3V42A 2P5KA 4DZPA 2DPUA 2QUFA 5H6QA 1ZRDA 4XKBA 5EZGA 1I3QJ 4M73A 3PSIA 2DQLA 4KJZA 3ZMUA 2CV0A 4FASD 2KFDA 1IN6A 4IZZA 1R00A 1R1TA 1HDPA 1X2NA 2V9KA 2BW3B 1J9IA 5AONA 1A04A 2DMTA 4C30A 1XD7A 9ANTA 4ZYAA 1VF9A 2IVMA 3AAFA 3JAMZ 1I50J 2LP0A 2MABA 2M8GX 1FP2A 1SFKA 4BY7J 3U2RA 4EJUA 2VJ5A 4YIIA 4J00A 5DUKA 3DEUA 3BZ6A 5KVRA 4IQ4A 3F8CA 4CXFA 2L9SA 2UWMA 1LVAA 4RBOA 2LF8A 4CICA 4BEHB 4UXNA 1VQ8I 5FO5A 2X1DA 5JI6A 1DUXC 3EQLF 3I4NJ 4XQFA 2M2EA 1MMGA 1KQ9A 2PJRA 2F2EA 1SFXA 2GLOA 1B9MA 2RVCA 3PUFA 4C2TA 4F92B 1RETA 3MZ8A 4P96A 4N4OB 2L0KA 2TCTA 1ZGWA 2F5VA 2LBFA 1VQ7I 3S14J 4U0WA 1YO5C 3S3MA 3M8EA 4UV8A 1GDTA 4N4NB 1U3EM 3OSGA 2ZSIB 2VQLA 4BUPA 2OCEA 5L3EA 3LOCA 1D8JA 3M4OJ 1BBYA 4A3LJ 1YX3A 1W5TA 4UV9A 3RKXA 3DV8A 4M3BA 1EKEA 4HDVA 2EIMH 3WTSC 3RYRA 1VFCA 5F64A 1ETQA 5DD8A 2DMQA 3K4LA 1YI2I 5TISC 1RI7A 2XDVA 2H94A 2L02A 3BT9A 4HF1A 3ROUA 2HYGD 1DP3A 3LSMA 5KK1A 3KP3A 3CMEI 3DP7A 4RS8A 2ELJA 2HS5A 4FISA 1G4DA 3TW7A 2HXOA 2LD5A 2GA2A 3TOAA 1SD7A 2GOMA 2I10A 2TDXA 5M3FJ 1R4MB 1T56A 4E7LA 4LITA 2IS4A 3IWZA 1FBUA 1D0XA 2EV5A 2F4IA 4Y7NJ 2ZMEC 3SZTA 1KGSA 3JSOA 2VOOA 2IXSA 2A61A 1NHAA 3HB9A 1D5YA 2X0LA 2D45A 1UAAA 2ADUA 2IRFG 4NNJA 2OD5A 4DYRA 3CCUI 1YX5A 3WGIA 3GX4X 2HPIA 1NK2P 1MBKA 1RESA 2A69F 2XGCA 3VPRA 4IRHA 2HXIA 3RKWA 4L9TA 2QEXI 1CF7A 4RM3A 1FTZA 2VQCA 3TKYA 4BXUA 1HDDC 2XAUA 5ICGA 2IJLA 1Y8QB 1B59A 1V3FA 2DA3A 3V7CA 3HM5A 2LKXA 4ENKA 1J5YA 1KYZA 2M0CA 2WV1A 1EH8A 2Y2ZA 2ICWG 2YU3A 1R7JA 2KIQA 3RSNA 2CW0F 3WHCA 1GXPA 5C44J 2X1EA 5FD5A 5B1AH 1T0FA 3SEZA 3F8MA 3CMAI 2YU9J 3DEWA 3HTUA 1W36C 4CCMA 3N4MA 4MTEA 3DBRB 2QQ8A 4BQQA 4C2MJ 3H0GJ 3J81K 3H9QA 3SZGA 3TO9A 4I6ZA 2YX4A 1SFUA 2PI0A 2O03A 2Z33A 5IT3A 1PUEE 1XC5A 3JREA 2CYYA 3NWSA 2ZMEA 3LAJA 4CA0A 4FETA 2STTA 4CYCB 2NS0A 3DEEA 3B6CA 2W24A 2FQ4A 2RREA 2NNNA 4DYQA 2BE5F 2XKOA 1IN4A 4NQWA 5GP9A 2OPTA 3WTXC 1UMQA 2JSPA 4ITVA 1XS9A 2HPMA 2KKOA 4HOBA 1Z67A 2R5ZB 2VKDA 5EG0B 1WGXA 3I5UA 3TBIA 1IXCA 4KMUX 1SANA 2DDBA 1FNNA 5KHDA 1UHWA 2CV2A 2R4GA 2Y30A 1NH3A 4DNCA 4WF2A 4ZC3A 5B5EC 4XKWA 3K4BA 3M9AA 5F27A 3BLYA 2E5ZA 2CW8A 1LQ1A 2BW3A 2DO7A 4WX9A 3CCRI 3ZRGA 1HBXG 2PJRB 2XF7A 1QRYA 2QQBA 2MC4A 5HS7A 2WY7Q 2G9WA 4RB0A 2QKMB 2XRNA 2HQAA 1ZK8A 3ZR8X 1YHQI 2DDAA 2Y0MA 1E17A 2X6WA 4F7ZA 4B3AA 4G6TB 5F08A 2LBFB 5M3MJ 2KIUA 3VYRB 4BL0B 2QWWA 3HZJA 2VXDA 3PL8A 3K4NA 5E17F 3ULQB 3O6BB 1MSFC 5F0CA 2IPQX 2CJJA 2L9VA 4QPOA 4RAYA 1FBQA 2ZC2A 2BHZA 2CWEA 3GUDA 1BI0A 3W3CA 2WAQA 1HW2A 5GAEJ 2KDZA 1LJ9A 4PJLA 1ZELA 3LSJA 3CMMA 3J80K 3BTIA 5K7HA 5EZHA 2XAGA 2Y31A 3FMSA 3AG3H 2WAFA 1YYVA 3VWBA 2VOPA 3FZVA 3V7RA 4MGRA 4GRIA 3OYLA 2E5NA 4GYIA 3COAC 2HEOA 2O0YA 2K40A 5IPAA 4G12A 3E7LA 5IP7J 2HYFA 3O8GA 2OTJI 4EJWA 3KP6A 1TWAJ 1X1AA 4BHPA 4OMZA 2KIFA 4IHYA 4YFXF 2OV7A 1Z7LA 4HF2A 3HGYA 1JKQC 1VQLI 2VASA 4M3GA 3PO3J 1T08B 3HSRA 2E1OA 4UUSA 4NHJA 2GIZA 4IOAF 1FOYA 3WU1B 3KYLA 5D8KB 2M4GA 3FXRA 1U5TC 5K7ZA 4JYKA 5C4XJ 3U9GA 3OYDA 2KLOA 1SVOA 3SQNA 3G6EI 3BTLA 2DFIA 1UHMA 4PJ0C 3ABTA 1ERDA 1TT5B 3IKVA 1O3QA 3E5UA 2E1CA 2M4KA 3PNTA 5CYVA 4BQAA 1G8XA 2DYSH 1G3WA 4PK4A 3MCZA 1PP8F 2O7OA 4V2FA 2R7TA 3DTIA 1P6RA 4H0EA 2PLYA 2DI3A 5JHUA 3M8FA 4Y15A 3DU6A 1BJAA 3OYHA 2VODA 2WAQN 4LIVA 5D5WB 3G2BA 5FB2A 2OCCH 2VQHA 4KITB 2H1LA 1W36D 1ITYA 4Y33A 3HJEA 2W48A 4ZDOA 3O2PE 3ZQGA 3L2VA 3FWEA 3GW2A 1SMTA 2R7UA 2MH9A 1ZHFA 3CQZJ 4NC7A 2LFBA 4MLOA 2BGCA 1UG0A 4A3KJ 2V79A 2DMUA 4IVNA 2FEZA 3QP5A 4LB5A 2COBA 3L9FA 1BI2A 2FRHA 5FLVA 3ASOH 4XLNF 4BNCA 3S3OA 2NYXA 3RQ4A 3H3UA 3CCEI 4LG3A 3VB2A 2DT6A 1K79A 3QYBA 2IGNA 2LNBA 4IQJA 1LFBA 3WODF 2EPFA 1VQMI 1LB2A 4A6DA 4RAFA 4F3QA 2R7FA 2JJ7A 1S7AA 4XSZF 1D5VA 2COMA 4BKXA 5IOZA 3OYBA 5HS9A 1HLVA 1ENHA 3GLXA 4X0GA 2VE8A 4B47A 1WJFA 3GFIA 1LDJA 1GHCA 2PMZN 1T8IA 1X3UA 3HOZJ 5DCMA 3IV5A 4BQNA 2V7FA 3P9CA 3HRSA 1X1DA 3BTJA 2VPLA 4B09A 2XIGA 1RPWA 1TC3C 3CJNA 4JK1X 4G6DA 5HDNA 1U8BA 1HCRA 2K85A 2EFQA 1LNWA 3Q0WA 1LE8B 1Y6IA 4JOMA 4RLQA 1XGMA 3K1NA 1HW5A 1Y39A 2XV4S 3BROA 1WQ2A 1IN8A 1QHHD 2IBDA 4GXOA 1IXSB 1O7LA 4YRVA 3L1PA 2BY3A 1RKWA 3TO7A 2JQ7A 1FX7A 1W5CC 1XMAA 3P9IA 4BH9A 1A31A 4E7JA 2MG4A 2XAQA 1U0JA 2KIMA 1K6YA 3DBHB 3HTSB 4BXXJ 1HOMA 3QODA 4DGWB 4XRSG 3WGHA 2VBWA 2L2OA 1IC8A 2OQRA 2IAIA 5JVGF 4LK1F 1UZCA 3OL4A 2L7ZA 2JA2A 1OISA 3LL7A 3PSFA 5HLGA 1U9OA 4HG2A 4EM1A 5D5UB 2EK5A 2H09A 4OIQF 2VPRA 1ETOA 3S1NJ 2ZXWH 3ERED 4C9YA 1HC8A 2RKHA 3GO5A 1KU9A 1QU3A 2JA5J 3PQKA 1D0ZA 2G7UA 2HTJA 2EFWA 4L5JA 3F21A 1AKHB 5DDGA 3DCFA 4R1HA 2R7QA 4I01A 1PJRA 2DODA 2PJPA 2R5ZA 5L3FA 1JI8A 3F0CA 1ZN2A 1MW7A 2WY8Q 4ON0A 3S1QJ 3KZYA 2B63J 2DOAA 3CC4I 4A0YA 3HPHA 3A4CA 1XN7A 5FLMJ 4G8XA 4NC8A 1O3SA 1E3HA 4NB5A 1I6HJ 3OS1A 3GTPJ 4CYCA 3NQOA 1MMSA 2ZJRF 2DOFA 2ZMEB 5BPDA 5ICEA 2QQ9A 4MEYF 4MTDA 2Q1ZB 2FMYA 3T5XA 3DQVC 4KN7X 2W7NA 3OR2C 4BHCA 2EA4A 1VQ9I 2JN6A 4UUTA 3G73A 1FEXA 4P5OA 4ENMA 2E1MB 3HG9A 2QF7A 5JR3A 5E1ZB 3IC7A 3AL0B 4E7KA 1XCVA 5GAHJ 3CJTB 1QZZA 5GPCA 3ISPA 1CQTA 2OU2A 5LLQA 3ABKH 4PJMA 2A05A 2DN0A 4OIPF 5CLSA 3CMYA 1IRGA 1KONA 1NTCA 2MBFA 4M6YA 1S72I 2QENA 1E0EA 2VI6A 4AVZA 2AXTC 3H5NA 3HRUA 5AIPA 1ORKA 4F55A 5GTHC 2E34A 1KZHA 3M3YJ 1R5HA 4CZZA 3WTVC 1TW3A 2MW8A 3OOPA 1JKPC 5E20A 3BJOA 3RZDJ 4L0ZB 1ZTRA 3ZMZA 4HQEA 3F22A 2L01A 3HUGA 3S1MJ 4F91B 3TQNA 1W5SA 1WJ5A 3HOTA 4XLPF 1YRNA 2LY1A 4FHTA 4XK4A 1VQ4I 4HV6A 3ZCOA 1TQPA 4QWQA 1YIOA 1RNLA 4P9FA 4JBAA 4PCQA 1Y56A 4CH7A 2K4BA 4J01A 2YUSA 5TJJA 1FY7A 1QZYA 4V19K 1ZQ3P 1H89C 2K9QA 5JFRA 4I0BA 3LWFA 1F9NA 1I3AA 2A6HF 1BOBA 3DPLC 3MQ0A 3WE3A 1FOKA 3FDYA 2XRLA 1HSJA 2OZUA 4ZYGA 1YG2A 1ETWA 1ZLJA 4ASNA 5HNHA 2XGDA 3BCAA 2D1VA 2I8DA 4HBLA 4CUGA 3IKTA 2B0LA 2ECCA 2V1UA 2EFPA 1D3YA 4PGHA 3EYYA 3FHNA 4M72A 5ILSA 2IA2A 1WJAA 1KU7A 2HVRA 2XAJA 4U0VA 3ZQ7A 4JX4A 1FMWA 2HOTA 2CW7A 2VBXA 3H9JA 4II2A 3DPUA 2DPDA 1LFPA 1Z21A 1JKOC 4XONA 3FBNB 1S8NA 2XASA 3VDXA 3DKYA 5D8LB 1R9TJ 1XSDA 4AM3A 3SXYA 1XSXA 1TWHJ 2EFNA 4M6XA 1BM9A 3BR2A 4RB3C 4RGSA 1VI0A 2XUBA 1U6GA 2D1HA 2CMPA 3W2AA 1LDDA 3I55I 4I0AA 4LGWA 3F72A 1GT0C 1IDZA 3DLAA 1TQMA 1G59A 1W4MA 1OR7C 1XB4A 1DDNA 3CC2I 4OOIA 5LBQA 3S1RJ 2IEKA 1AWCA 4G7ZF 2A07F 4EQQA 1HKSA 4HDUA 1FOWA 5JLWA 2DA7A 3P9KA 4B1RA 5EYRA 3MD2A 3W2WA 1I5ZA 3FXKA 3I59A 3K2AA 2DCEA 2R7WA 3S16J 4MO7A 4P9UA 4D1QA 2R5YB 5IYCJ 2QLZA 4ZYDA 4YEJA 3JRBA 4G6QA 2CUEA 2IS6A 3GZ6A 4PSXA 3EUHA 3LSKA 1A5JA 5FLXZ 1AA7A 1QVUA 4LG0A 4H4KC 2Y9YA 1V55H 3S32A 2VT2A 2QBYB 3N97A 5FJ8J 3MAJA 2CUZA 3LSGA 3VYSB 5FRNA 1UCRA 1MIJA 2K9MA 4R8HA 4XN3A 5HLIA 3E3VA 4KUMA 3WTYC 4A3GJ 1YIJI 1WCMJ 3RIRA 4D7NA 2VQGA 3KIOA 3CDLA 5F6FA 4D5FA 1S7OA 5J40A 2FU4A 2EQRA 3ZQIA 1R36A 2ZJPF 1EH7A 2CFXA 2DTRA 2L5QA 3ABMH 4EATA 2W00A 2ELKA 4XORA 5CVRA 2W85A 1YJWI 1BA5A 2M5WA 3A0HC 3FMRA 3VOEA 1SAUA 3BDDA 1JUSA 2DLLA 3S17J 4IJAA 3SDGA 2RC4A 4ETSA 4HAMA 4XIDA 4FX4A 4L9VA 1H9GA 1JXSA 3A02A 4DBRA 2M8EA 1WH7A 2A6EF 2LY2A 2O5RA 3DFGA 4CHUA 4KISA 4BQOA 2VC0A 1OQYA 4QLCU 2JTVA 1O57A 1UELB 5J3LA 3LFUA 4XRMA 5EGOA 1LEBA 2PMUA 2ID6A 1P2FA 2ME0A 4E6KG 3LMMA 4XLCA 2DQRA 3C3WA 5J6XA 5LGUA 1DU0A 2WB1A 5L3CA 1WI3A 1ETVA 4CZCA 2ACJA 1XG1A 2HQRA 4ZYHA 5EEGA 2XROA 4IX7A 2JZYA 2XPVA 3M7GA 3QQAA 3IUOA 1WFXA 2RDPA 2OAZA 3IH2A 1K4TA 5H20A 3DTEA 2LOOA 2H27A 2CFOA 2HI3A 3CCVI 3LSTA 3FM3A 5EEAA 4BY1J 2C6YA 1U2WA 2GXBA 1V5EA 1BC8C 2QM3A 4MQVA 5F1RA 4I98B 1SC7A 1IW7F 1C0WA 4BE2A 1D1BA 1OCTC 3JTHA 1GXQA 4B43A 2FNPA 4TV7A 4Z2YA 4YIFA 3LSPA 1YFHA 5CVVA 3MZYA 3BTCA 3EETA 1YW7A 3QYEA 2H6CA 5LEJA 2NVQJ 4ZDPA 1OCRH 3VODA 5BQTA 1CGPA 5BMZA 2B7EA 2LSOA 2N8GA 1RKTA 1F5TA 3FX3A 2GQQA 4BJTA 4DIQA 1BC7C 4WK8F 1XX5A 4O3MA 1H9TA 3GTKJ 3QPSA 3ZN1A 2E60A 3VYUB 1S6LA 3A2KA 2XSDC 4XLEA 2XSJC 4MNUA 1DU6A 3H3ZA 1DPUA 4PFPA 2V9VA 1P7JA 1RRJA 4BBRJ 2L9NA 5IY5H 2LYCA 5IOYA 5DUIA 1R1UA 2HFHA 4ANJA 4I09A 1T2KA 4A5MA 2HQNA 5LEKA 3VYTB 1Z7UA 1ULYA 2MA3A 2ZNZA 3KP7A 5E1XA 3QRFF 4K2EA 3E0JB 4B44A 3GFJA 3G1OA 1JGGA 4IRIA 1TWFJ 1QPMA 1P4AA 1OJLA 4ABZA 2EZHA 1X1PA 2KQRA 1ZG5A 1X3ZB 3OYFA 1VQNI 4A12A 3CC7I 2JWTA 2D2WA 1IUFA 3QOPA 4M9ZA 4A3BJ 3HRTA 4FQGA 1VTNC 1DP7P 1FP1D 4WXHA 1L3LA 1GUUA 2R92J 2KRHA 1I27A 3F6OA 5B66C 4LJZF 5M5WJ 1XGNA 1WJBA 2MGQA 2DA1A 5D5XB 1BR4A 3OIQA 3SDBA 2V1DA 1ZGAA 4GFBA 4CCJA 1IXRC 4BJ6C 2P8TA 3GYHX 2MLGA 1TTYA 2EJRA 2Y0SA 4MIMA 1DQUA 2R7DA 4E7ZA 1X19A 2HR3A 3TL4X 4KIBA 2VE9A 1X1CA 4XL9A 3C1DA 2ETHA 2OUMA 2PMZA 3DXJF 3HYIA 4YELA 1VQKI 3JRDA 3BP8A 3CO6C 4KT6A 1V4RA 4KDPA 2QA4I 1ODDA 3H9GA 5DEQA 1W1WE 4AIKA 3M8JA 1KQ0A 1QQIA 5FKOA 5BNGA 5JLXA 4AU7A 2FXAA 2KZVA 3I4MJ 2Z2SB 1BI1A 3U1DA 2R93J 5CVJA 1WJCA 3C18A 2ZCWA 4ENNA 3CO7C 3QU6A 2VKVA 3CJQB 4EJOA 4U0YA 5L3GA 2O3FA 1OYIA 1F36A 1HW1A 2NS8A 3K1PA 2VBYA 2EV0A 4DQ2A 4QIWN 2PEXA 3L2WA 2KDOA 1B6AA 1TP4A 1HKTA 3D5LA 1A6IA 2P6TA 3HL2A 1MJ9A 2WADA 2DA5A 1B1BA 2Y69H 5HDGA 4ESFA 2CV1A 2BBYA 2FBKA 2PN6A 4LOCA 4PZJA 4W1UA 1SVLA 1MZBA 3V4GA 1DGWY 1G3YA 3PIPF 2JRMA 1Y8RB 5CQGA 2JA6J 3ECOA 3TP3A 1PVEA 3OYMA 1UJ8A 2K4JA 3P5JA 2PX9A 4O6JA 4UVAA 1Y1WJ 5E3MA 1FTTA 3V8LA 3LA7A 1QBJA 1JHFA 3CCSI 2R0QC 2K5CA 2V1NA 3K10A 1K7AA 1P7IA 2MFZA 3OYJA 1V5GA 2QKLB 5LHIA 2XB5A 4XKCA 2WWYA 1JKRC 3IAM2 3QU3A 2LTPA 4G7HF 5ICCA 2KP6A 4DZJA 3NRVA 3RPUD 4KMFA 1X58A 4HPQA 2CGPA 5D4SA 1TL8A 3OYIA 3IHUA 1H8AC 4BHBA 3I71A 2F4MB 2VKEA 3HKZN 1OFCX 3L09A 2VT3A 3S93A 2Z3YA 4EMSA 3CUQA 2MC3A 2KISA 1M1EB 5LFAA 1H88C 1X3WB 1YJNI 1MBGA 3S15J 3ONQA 2UXNA 3ZMTA 3RTRA 1GVJA 3W2VA 3CTAA 4QPQA 1FZPB 5LD2C 1RR7A 2FD5A 2MSYA 3CP2A 1J0RA 1Z05A 3O8HA 3HOUJ 3Q9VA 3MMYB 3HRMA 4F52A 2I5UA 5J1UA 2D5VA 1O4XA 3TGNA 2QSFX 3I3LA 1W7PB 1Y1VJ 3HGGA 4KT5C 2G0EA 3SHFA 2VXZA 2GXAA 5HODA 4S04A 2ZSHB 2M7BA 4A5NA 3J7ZI 3JRIA 3RI4A 2EZIA 2X51A 3CUOA 4OAYA 2VLAA 3D0SA 1OCOH 4DYCA 3A03A 2CQKA 4G7OF 3KCCA 6PAXA 4GCVA 2ZFWA 1G3TA 4I2OA 2FQ3A 1IZ1A 5E3NA 4KYWA 4L9JA 2CQNA 2Z9OA 1MBFA 3GTQJ 1SMYF 1MNDA 1TBXA 4AC0A 2L4AA 3CF2A 2Q0OA 2E36A 4NQWB 3TO6A 3AG4H 2W82A 3OR1C 2CRGA 4X1EA 2ZNYA 3ERMA 1AOYA 1U5TA 4U7DA 4RGXA 2IW5A 3JSPA 1VNDA 2Q2EA 3FBIB 3R0AA 1XCBA 3CD6I 1APLC 2A6TA 2CQQA 4PJJA 1Z77A 4CCOA 1TLHB 3WU0A 2E7WA 1Z6TA 2KPMA 2K7LA 3DBLB 1IO2A 1R6RA 4DOZA 3JRHA 3LNQA 3BG9A 3RKYA 4IHWA 3FXJA 5DV5A 5FGMA 2R7ZJ 3F23A 3F6VA 4NBQA 2R7XA 2TRTA 3OS0A 3G1LA 2HDWA 4LMYA 1OCPA 3EUHC 5BOXA 2JUGA 1B72B 3GFMA 4HF0A 4XKVA 2CH0A 3ZQLA 1VQ5I 2X9DA 1QGPA 2ISZA 1XGOA 1T6SA 3CP8A 4FT8A 5TRDA 4IHXA 1XMXA 4CYDA 4FCYA 4Y52J 1AHDP 4A6EA 3M07A 1D8KA 3AFHA 1Y0NA 3FXUA 3QAHA 2DA4A 4U7BA 3ZMSA 4QSHA 1T33A 4HZFA 2FX0A 3JAMK 3K9TA 3DU5A 2IA0A 2CQ7A 1R23A 4II3A 4IRGA 3S8PA 3EYIA 1JUPA 2FSWA 3KYDB 2RQQA 4J19A 2XAHA 4HX8A 3FXQA 4GDFA 2MD5A 1FSHA 3KFWX 4A3CJ 4RDUA 2DK5A 2IP2A 3JW4A 3E5QA 4UNOA 3P7NA 1IF1A 3GTMJ 1ZGJA 2X85A 3KEQA 4IKFA 4EVIA 5L3DA 2VBZA 4C3IJ 4YG2F 3LSIA 4IHSA 1PUFB 1RIOH 1EV7A 3GTJJ 3WE2A 2DJNA 3BJ6A 2R7SA 2E71A 2DW4A 3BQZA 3DTKA 3K7AJ 5FKKA 3CCMI 5FKNA 1ONVA 1G6NA 3K2ZA 3CLOA 2AQEA 3LAPA 2GXGA 4D5CA 4M9SA 2H1KA 2NOJB 1OPCA 2H8WA 5HNFA 1JTYA 4L9NA 3QYFA 1IG7A 1Z3XA 1S9HA 5E8GA 4OU0A 4HW0A 2MYSA 2QBYA 4XRSA 3MWMA 3BZKA 4EJVA 3LA3A 2QSHX 4PGGA 3KZZA 1E3PA 1TZLA 2JK3A 3E5XA 2OQGA 1MNMC 4IO9F 3DKWA 4Y17A 1FT9A 4CGZA 1MBHA 3HOSA 2DTZA 3L2CA 5ICFA 3OWTA 1PUFA 5BS6A 4LLLA 4L5IA 5KAIC 1RUNA 2X4HA 4HSRA 2BYVE 1JJ8C 2NVYJ 2NNYA 1SVMA 3BG7A 3BQYA 1KA8A 2KRFA 3R4KA 4NUBA 3HOWJ 2R3SA 2DFHA 3V8JA 1B72A 3A1YA 1FMVA 3PNVA 2HKOA 2OC6A 5EJCA 4ZDLA 2E2HJ 3S2WA 2LRDA 1MJAA 4M9XA 1MKMA 2EILH 2HDCA 4CCLA 1SFOJ 2JPCA 3OYEA 3W6VA 1JHHA 1BR1A 3I58A 1Q1VA 2R7RA 1LPQA 3R61A 2F5DA 1MH3A 3S2HJ 2E19A 1IV8A 2QGUA 3BR6A 2EFOA 2M9HA 2LR8A 1WJDA 2YX7A 5HLHA 1W7PA 3I0TA 3KYCB 3BG3A 3H35A 5HLTA 4A3FJ 4RM2A 3L2QA 3CDHA 1U5TB 3JTGA 4XLAA 5J1YA 4EEFG 2W25A 4A3MJ 4P1WA 1KU2A 1IN7A 5HOOA 3TEDA 3KP2A 4IEJA 2R7OA 1A36A 4LIUA 4XLFA 2BXYA 4X6AJ 3DWLE 3WG9A 1ZG3A 3ASNH 1SD5A 1IDYA 3M1CA 1U9NA 4N9IA 3OYNA 1IJWC 3R60A 1S5LC 1ZRCA 1ZR2A 2OF7A 2VUMJ 1K61A 3L2RA 2DYRH 1MD0A 1Y0UA 2QQAA 2GAUA 4DW6A 4RGRA 1V5FA 1P92A 5BPIA 2F5EA 2DAOA 5DCFA 2ESHA 3MZHA 2P5VA 1MBJA 1WWXA 2LY9A 3MKZA 2VC1A 1S3JA 2NVTJ 3OS2A 4EGYA 4L5EA 1MDMA 4GGGA 2LLKA 4OWRB 3A01A 2HOSA 4AD9A 4FX0A 3OL3A 1R49A 4LFUA 3F8NA 3GTLJ 3GZNB 3U1KA 2GOXB 4IOCF 4HX7A 3PFYA 4NDLA 3HIFA 1IAWA 1I39A 2RN7A 1MMDA 4N0BA 1RUOA 2LKSA 4Q5SF 2BY1A 3JR9A 4G9YA 1O7FA 3REOA 2V6EA 2J5OA 2W84A 3R0JA 1YW9A 4AIDA 1WI9A 4D7MA 4E7HA 5E3OA 4BE0A 2KL4A 3UR3C 1FIPA 3CCYA 1P4XA 2KMUA 1KU3A 2RNJA 1Z1DA 2E1NA 4P55A 5KAFC 3GTOJ 1POGA 3OIPA 2FUG2 5E3LA 5DD4A 3E6DA 5LRSA 3GVAA 4AYBA 3PQJA 2JUCA 1WHUA 1FOXA 4MFEA 3BZCA 3ZQFA 2CG4A 2CS3A 4A2UA 1BL0A 3HC7A 3PFIA 5B3SH 3WTUC 2W4SA 3HSEA 5E8IA 2CU7A 1N77A 3V7SA
chains in the Genus database with same CATH topology
1AU7A 3JRCA 1BW6A 3G1MA 1WPKA 2O7OA 4V2FA 4B4CA 1JJ6C 3G1OA 1JGGA 2NS7A 1TWFJ 1OJLA 2HOAA 2WAQN 2EZHA 4ABZA 3RQIA 1ITYA 1K83J 2W48A 3ZQGA 2JWTA 1IUFA 4AYBN 4AUXA 4A3BJ 3FIWA 2EH3A 3CQZJ 2LFBA 4MLOA 3JRFA 1W0UA 1GUUA 2R92J 4JX6A 4A3KJ 2DMUA 5FKMA 2COBA 5M5WJ 2MGQA 1GV5A 5C4JJ 2DA1A 5FLVA 4HNVA 2CUFA 4A3JJ 4GFBA 2XB0X 4MIMA 3JRGA 2L9RA 2EBIA 1LFBA 1HF0A 3OOUA 4FE7A 5F0FA 5M5XJ 1S7EA 5FKLA 2DMPA 2CQXA 3JRDA 2JJ7A 5F0HA 1QPIA 4A3DJ 4BKXA 1UG2A 3OIOA 3A01B 1JT0A 3GTGJ 5IOZA 1HLVA 5K7FA 1GVDA 1ENHA 1W0TA 1G2HA 3Q0VA 2ECBA 5FKOA 3TW6A 5BNGA 5JLXA 2EZLA 4W97A 1ETYA 3WHBA 4A3EJ 2PMZN 3I4MJ 2R93J 3HOZJ 2X48A 5EF6A 3IV5A 2ZB9A 3HBLA 3BTJA 2VKVA 5IYBJ 3MN2A 1RPWA 1TC3C 2E2IJ 1F36A 2NS8A 1U8BA 1HCRA 3Q0WA 2XPUA 1LE8B 3MKLA 4XICA 4QIWN 3SFIA 1BW5A 3OSFA 2LK2A 2X6OA 1A6IA 2DA6A 2DA5A 3FISA 2IBDA 4LOCA 4W1UA 3HOVJ 4M6VA 3L1PA 1RKWA 3TP0A 3BR1A 3HEFA 2JA6J 2AO9A 3TP3A 2E2JJ 1IV6A 2MG4A 4S0HB 1Y1WJ 4BXXJ 1HOMA 5DTDA 5E3MA 3Q3SA 4XRSG 1FTTA 2L7MP 5EG0A 1EF4A 4A3IJ 1MH4A 1IC8A 2IAIA 1NK3P 2R0QC 2L7ZA 3FK6A 5J1RA 1U9OA 1JTXA 3ZQHA 1TWCJ 1FJLA 1P7IA 2HYJA 2YS9A 2VPRA 2XB5A 2JA8J 1ETOA 1UHSA 3S1NJ 1JKRC 3NAUA 2HQ5A 2R5YA 2LTPA 2JA5J 2O9LA 2HDDA 4DZJA 5EGOB 3FKIJ 1X58A 2EZKA 1QVTA 1U78A 5EDNA 1AKHB 1H8AC 3DCFA 2KT0A 3GBGA 4QTRA 4IHVA 3HKZN 2VKEA 1ZR4A 2R5ZA 1OFCX 3ZQCA 3F0CA 1MSEC 3S1QJ 1H88C 2DA2A 2B63J 4FTHA 4DZPA 1E3OC 1MBGA 1JUMA 5FLMJ 5EZGA 1I3QJ 3S15J 1I6HJ 3GTPJ 4CYCA 2O8KA 2XGEA 1RR7A 2FD5A 2MSYA 3HOUJ 3O8HA 2ME6A 1HDPA 1X2NA 4V2GA 1ZKGA 2DMTA 2JN6A 4UUTA 5J1UA 2NVXJ 9ANTA 1FEXA 2D5VA 1VF9A 1O4XA 2QF7A 1Y1VJ 3HGGA 2G0EA 5HODA 3JRIA 1X2MA 2EZIA 1I50J 4DYCA 2LP0A 2LVSA 3Q0UA 4I76A 3IH4A 5GPCA 1CQTA 2M8GX 3A03A 2WB1N 4BY7J 2QCOA 5IP6A 2DN0A 3LSRA 1JT6A 5E3NA 3CMYA 1NTCA 4RBOA 1MBFA 2VI6A 3GTQJ 4AC0A 1YRNB 5F1JA 1ORKA 3I4NJ 2M2EA 2CRGA 2H8RA 4X1EA 3S2DJ 2GLOA 3M3YJ 2MW8A 1RETA 1JKPC 3BG5A 1VNDA 1ZTRA 3RZDJ 2L0KA 2TCTA 1ZGWA 3D1NI 1APLC 2CQQA 1Z77A 4JX5A 3S1MJ 3S14J 2DMNA 1YRNA 1GDTA 4XK4A 3JRHA 3OSGA 3LNQA 3BG9A 4IHWA 3LOCA 2R7ZJ 3M4OJ 4A3LJ 1TWGJ 4BBSJ 2TRTA 3G1LA 3PO2J 4M3BA 2YUSA 1OCPA 1B72B 1VFCA 3ZQLA 1ETQA 4FE4A 1ZQ3P 1H89C 2K9QA 2DMQA 2X9DA 2L7FP 4IHXA 4Y52J 4FCYA 3BT9A 1AHDP 3PM1A 1WH5A 1FIAA 2DA4A 4QSHA 1T33A 2XRLA 2FX0A 4FISA 2RAEA 3TW7A 2HXOA 1ETWA 2LD5A 2I10A 2XGDA 1JUPA 5M3FJ 4J19A 1T56A 2ECCA 2K9SA 4Y7NJ 4A3CJ 4RDUA 3BR5A 3GTMJ 2JMWA 3HB9A 4JX4A 1D5YA 2HOTA 2P81A 3IH3A 4C3IJ 3H3VK 4DYRA 1PUFB 2Y9ZA 3GTJJ 1JKOC 2DJNA 1R9TJ 1AKHA 2ID3A 1NK2P 1MBKA 3BQZA 1RESA 3K7AJ 5FKKA 1ETKA 1TWHJ 5FKNA 2XGCA 3VPRA 2HXIA 3BR2A 1FTZA 4D5CA 2H1KA 1HDDC 1VI0A 3MVPA 2NOGA 3FK7A 1B8IA 1JTYA 5IP9J 2DA3A 1IG7A 3HM5A 2LKXA 2M0CA 2WV1A 2Y2ZA 1IDZA 1GT0C 4XRSA 1IGNA 3RKQA 3UKGA 3WHCA 2M34A 3RZOJ 5C44J 1B8IB 3S1RJ 4MFDA 2IEKA 2JK3A 4A69C 1MNMC 2YU9J 3DEWA 5GPAA 5JLWA 2GM4A 2DA7A 4B1RA 1BJZA 5EYRA 4C2MJ 1MBHA 3H0GJ 3K2AA 2XPWA 4I6ZA 2FJ1A 2DTZA 1PUFA 3S16J 1XC5A 4MO7A 3JREA 1GV2A 1IRZA 3ZOBA 2R5YB 1JJ8C 5IYCJ 4CYCB 2NVYJ 3JRBA 3B6CA 2CUEA 2FQ4A 3BQYA 4DYQA 2JA7J 3HOWJ 5GP9A 1B72A 1A5JA 3HOXJ 1QVUA 2OPTA 2Y9YA 1UMQA 1XS9A 5FJ8J 2E2HJ 2R5ZB 3LSGA 5EG0B 1WGXA 4A3GJ 1SANA 3QPLA 1WCMJ 1SFOJ 4D7NA 3W6VA 3B6AA 2Y0SN 1Q1VA 4C3HJ 2Y30A 1MBEA 3NARA 1MH3A 3CDLA 4D5FA 3S2HJ 2E19A 5M5YJ 2EQRA 3BR6A 2M9HA 2LR8A 3ZQIA 5F27A 4A3FJ 3BG3A 2ELKA 5J1YA 2K9NA 4EEFG 1BA5A 4A3MJ 3HDDA 1QRYA 3TEDA 4IEJA 4M3FA 1F43A 1JUSA 3S17J 3SDGA 4X6AJ 2AHQA 3BR3A 4XIDA 1ZK8A 3A02A 1WH7A 1IDYA 1IJWC 1U9NA 4B3AA 5F08A 1ZR2A 4M3EA 5M3MJ 2OF7A 2VUMJ 1K61A 5J3LA 4XRMA 5EGOA 2ID6A 2ME0A 4DW6A 1MSFC 1DU0A 4A93J 5F0CA 2CJJA 1MBJA 1WI3A 2LY9A 1ETVA 2GBYA 1XG1A 2NVTJ 4L5EA 2KDZA 2LLKA 2XPVA 3A01A 2HOSA 3HOYJ 3QQAA 3LSJA 3GTLJ 3IH2A 3BTIA 5K7HA 1LFUP 5EZHA 2Y31A 2HI3A 4M3DA 4NDLA 5EEAA 4BY1J 3C2BA 3JR9A 5C3EJ 2K40A 3JRAA 5IPAA 1OCTC 4G12A 5IYDJ 3E7LA 5IP7J 5F04A 3O8GA 3LSPA 4D7MA 1TWAJ 5E3OA 3BTCA 1FIPA 2NVQJ 3CCYA 4IHYA 1Z0XA 5DS9A 3HGYA 4JP0A 1JKQC 2N8GA 1RKTA 4M3GA 3PO3J 4C3JJ 4UUSA 2E1OA 3GTOJ 1POGA 1ETXA 5E3LA 3GTKJ 3SJMA 3BR0A 3QPSA 4UUSB 1LE8A 2XSDC 1DU6A 4MFEA 5K7ZA 3ZQFA 4JYKA 5C4XJ 1P7JA 1BL0A 4BBRJ 3BTLA 2CU7A 5IOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AU7 A;  3JRC A;  1BW6 A;  3G1M A;  1WPK A;  2O7O A;  4V2F A;  4B4C A;  1JJ6 C;  3G1O A;  1JGG A;  2NS7 A;  1TWF J;  1OJL A;  2HOA A;  2WAQ N;  2EZH A;  4ABZ A;  3RQI A;  1ITY A;  1K83 J;  2W48 A;  3ZQG A;  2JWT A;  1IUF A;  4AYB N;  4AUX A;  4A3B J;  3FIW A;  2EH3 A;  3CQZ J;  2LFB A;  4MLO A;  3JRF A;  1W0U A;  1GUU A;  2R92 J;  4JX6 A;  4A3K J;  2DMU A;  5FKM A;  2COB A;  5M5W J;  2MGQ A;  1GV5 A;  5C4J J;  2DA1 A;  5FLV A;  4HNV A;  2CUF A;  4A3J J;  4GFB A;  2XB0 X;  4MIM A;  3JRG A;  2L9R A;  2EBI A;  1LFB A;  1HF0 A;  3OOU A;  4FE7 A;  5F0F A;  5M5X J;  1S7E A;  5FKL A;  2DMP A;  2CQX A;  3JRD A;  2JJ7 A;  5F0H A;  1QPI A;  4A3D J;  4BKX A;  1UG2 A;  3OIO A;  3A01 B;  1JT0 A;  3GTG J;  5IOZ A;  1HLV A;  5K7F A;  1GVD A;  1ENH A;  1W0T A;  1G2H A;  3Q0V A;  2ECB A;  5FKO A;  3TW6 A;  5BNG A;  5JLX A;  2EZL A;  4W97 A;  1ETY A;  3WHB A;  4A3E J;  2PMZ N;  3I4M J;  2R93 J;  3HOZ J;  2X48 A;  5EF6 A;  3IV5 A;  2ZB9 A;  3HBL A;  3BTJ A;  2VKV A;  5IYB J;  3MN2 A;  1RPW A;  1TC3 C;  2E2I J;  1F36 A;  2NS8 A;  1U8B A;  1HCR A;  3Q0W A;  2XPU A;  1LE8 B;  3MKL A;  4XIC A;  4QIW N;  3SFI A;  1BW5 A;  3OSF A;  2LK2 A;  2X6O A;  1A6I A;  2DA6 A;  2DA5 A;  3FIS A;  2IBD A;  4LOC A;  4W1U A;  3HOV J;  4M6V A;  3L1P A;  1RKW A;  3TP0 A;  3BR1 A;  3HEF A;  2JA6 J;  2AO9 A;  3TP3 A;  2E2J J;  1IV6 A;  2MG4 A;  4S0H B;  1Y1W J;  4BXX J;  1HOM A;  5DTD A;  5E3M A;  3Q3S A;  4XRS G;  1FTT A;  2L7M P;  5EG0 A;  1EF4 A;  4A3I J;  1MH4 A;  1IC8 A;  2IAI A;  1NK3 P;  2R0Q C;  2L7Z A;  3FK6 A;  5J1R A;  1U9O A;  1JTX A;  3ZQH A;  1TWC J;  1FJL A;  1P7I A;  2HYJ A;  2YS9 A;  2VPR A;  2XB5 A;  2JA8 J;  1ETO A;  1UHS A;  3S1N J;  1JKR C;  3NAU A;  2HQ5 A;  2R5Y A;  2LTP A;  2JA5 J;  2O9L A;  2HDD A;  4DZJ A;  5EGO B;  3FKI J;  1X58 A;  2EZK A;  1QVT A;  1U78 A;  5EDN A;  1AKH B;  1H8A C;  3DCF A;  2KT0 A;  3GBG A;  4QTR A;  4IHV A;  3HKZ N;  2VKE A;  1ZR4 A;  2R5Z A;  1OFC X;  3ZQC A;  3F0C A;  1MSE C;  3S1Q J;  1H88 C;  2DA2 A;  2B63 J;  4FTH A;  4DZP A;  1E3O C;  1MBG A;  1JUM A;  5FLM J;  5EZG A;  1I3Q J;  3S15 J;  1I6H J;  3GTP J;  4CYC A;  2O8K A;  2XGE A;  1RR7 A;  2FD5 A;  2MSY A;  3HOU J;  3O8H A;  2ME6 A;  1HDP A;  1X2N A;  4V2G A;  1ZKG A;  2DMT A;  2JN6 A;  4UUT A;  5J1U A;  2NVX J;  9ANT A;  1FEX A;  2D5V A;  1VF9 A;  1O4X A;  2QF7 A;  1Y1V J;  3HGG A;  2G0E A;  5HOD A;  3JRI A;  1X2M A;  2EZI A;  1I50 J;  4DYC A;  2LP0 A;  2LVS A;  3Q0U A;  4I76 A;  3IH4 A;  5GPC A;  1CQT A;  2M8G X;  3A03 A;  2WB1 N;  4BY7 J;  2QCO A;  5IP6 A;  2DN0 A;  3LSR A;  1JT6 A;  5E3N A;  3CMY A;  1NTC A;  4RBO A;  1MBF A;  2VI6 A;  3GTQ J;  4AC0 A;  1YRN B;  5F1J A;  1ORK A;  3I4N J;  2M2E A;  2CRG A;  2H8R A;  4X1E A;  3S2D J;  2GLO A;  3M3Y J;  2MW8 A;  1RET A;  1JKP C;  3BG5 A;  1VND A;  1ZTR A;  3RZD J;  2L0K A;  2TCT A;  1ZGW A;  3D1N I;  1APL C;  2CQQ A;  1Z77 A;  4JX5 A;  3S1M J;  3S14 J;  2DMN A;  1YRN A;  1GDT A;  4XK4 A;  3JRH A;  3OSG A;  3LNQ A;  3BG9 A;  4IHW A;  3LOC A;  2R7Z J;  3M4O J;  4A3L J;  1TWG J;  4BBS J;  2TRT A;  3G1L A;  3PO2 J;  4M3B A;  2YUS A;  1OCP A;  1B72 B;  1VFC A;  3ZQL A;  1ETQ A;  4FE4 A;  1ZQ3 P;  1H89 C;  2K9Q A;  2DMQ A;  2X9D A;  2L7F P;  4IHX A;  4Y52 J;  4FCY A;  3BT9 A;  1AHD P;  3PM1 A;  1WH5 A;  1FIA A;  2DA4 A;  4QSH A;  1T33 A;  2XRL A;  2FX0 A;  4FIS A;  2RAE A;  3TW7 A;  2HXO A;  1ETW A;  2LD5 A;  2I10 A;  2XGD A;  1JUP A;  5M3F J;  4J19 A;  1T56 A;  2ECC A;  2K9S A;  4Y7N J;  4A3C J;  4RDU A;  3BR5 A;  3GTM J;  2JMW A;  3HB9 A;  4JX4 A;  1D5Y A;  2HOT A;  2P81 A;  3IH3 A;  4C3I J;  3H3V K;  4DYR A;  1PUF B;  2Y9Z A;  3GTJ J;  1JKO C;  2DJN A;  1R9T J;  1AKH A;  2ID3 A;  1NK2 P;  1MBK A;  3BQZ A;  1RES A;  3K7A J;  5FKK A;  1ETK A;  1TWH J;  5FKN A;  2XGC A;  3VPR A;  2HXI A;  3BR2 A;  1FTZ A;  4D5C A;  2H1K A;  1HDD C;  1VI0 A;  3MVP A;  2NOG A;  3FK7 A;  1B8I A;  1JTY A;  5IP9 J;  2DA3 A;  1IG7 A;  3HM5 A;  2LKX A;  2M0C A;  2WV1 A;  2Y2Z A;  1IDZ A;  1GT0 C;  4XRS A;  1IGN A;  3RKQ A;  3UKG A;  3WHC A;  2M34 A;  3RZO J;  5C44 J;  1B8I B;  3S1R J;  4MFD A;  2IEK A;  2JK3 A;  4A69 C;  1MNM C;  2YU9 J;  3DEW A;  5GPA A;  5JLW A;  2GM4 A;  2DA7 A;  4B1R A;  1BJZ A;  5EYR A;  4C2M J;  1MBH A;  3H0G J;  3K2A A;  2XPW A;  4I6Z A;  2FJ1 A;  2DTZ A;  1PUF A;  3S16 J;  1XC5 A;  4MO7 A;  3JRE A;  1GV2 A;  1IRZ A;  3ZOB A;  2R5Y B;  1JJ8 C;  5IYC J;  4CYC B;  2NVY J;  3JRB A;  3B6C A;  2CUE A;  2FQ4 A;  3BQY A;  4DYQ A;  2JA7 J;  3HOW J;  5GP9 A;  1B72 A;  1A5J A;  3HOX J;  1QVU A;  2OPT A;  2Y9Y A;  1UMQ A;  1XS9 A;  5FJ8 J;  2E2H J;  2R5Z B;  3LSG A;  5EG0 B;  1WGX A;  4A3G J;  1SAN A;  3QPL A;  1WCM J;  1SFO J;  4D7N A;  3W6V A;  3B6A A;  2Y0S N;  1Q1V A;  4C3H J;  2Y30 A;  1MBE A;  3NAR A;  1MH3 A;  3CDL A;  4D5F A;  3S2H J;  2E19 A;  5M5Y J;  2EQR A;  3BR6 A;  2M9H A;  2LR8 A;  3ZQI A;  5F27 A;  4A3F J;  3BG3 A;  2ELK A;  5J1Y A;  2K9N A;  4EEF G;  1BA5 A;  4A3M J;  3HDD A;  1QRY A;  3TED A;  4IEJ A;  4M3F A;  1F43 A;  1JUS A;  3S17 J;  3SDG A;  4X6A J;  2AHQ A;  3BR3 A;  4XID A;  1ZK8 A;  3A02 A;  1WH7 A;  1IDY A;  1IJW C;  1U9N A;  4B3A A;  5F08 A;  1ZR2 A;  4M3E A;  5M3M J;  2OF7 A;  2VUM J;  1K61 A;  5J3L A;  4XRM A;  5EGO A;  2ID6 A;  2ME0 A;  4DW6 A;  1MSF C;  1DU0 A;  4A93 J;  5F0C A;  2CJJ A;  1MBJ A;  1WI3 A;  2LY9 A;  1ETV A;  2GBY A;  1XG1 A;  2NVT J;  4L5E A;  2KDZ A;  2LLK A;  2XPV A;  3A01 A;  2HOS A;  3HOY J;  3QQA A;  3LSJ A;  3GTL J;  3IH2 A;  3BTI A;  5K7H A;  1LFU P;  5EZH A;  2Y31 A;  2HI3 A;  4M3D A;  4NDL A;  5EEA A;  4BY1 J;  3C2B A;  3JR9 A;  5C3E J;  2K40 A;  3JRA A;  5IPA A;  1OCT C;  4G12 A;  5IYD J;  3E7L A;  5IP7 J;  5F04 A;  3O8G A;  3LSP A;  4D7M A;  1TWA J;  5E3O A;  3BTC A;  1FIP A;  2NVQ J;  3CCY A;  4IHY A;  1Z0X A;  5DS9 A;  3HGY A;  4JP0 A;  1JKQ C;  2N8G A;  1RKT A;  4M3G A;  3PO3 J;  4C3J J;  4UUS A;  2E1O A;  3GTO J;  1POG A;  1ETX A;  5E3L A;  3GTK J;  3SJM A;  3BR0 A;  3QPS A;  4UUS B;  1LE8 A;  2XSD C;  1DU6 A;  4MFE A;  5K7Z A;  3ZQF A;  4JYK A;  5C4X J;  1P7J A;  1BL0 A;  4BBR J;  3BTL A;  2CU7 A;  5IOY A; 
#chains in the Genus database with same CATH topology
 3AL0 C;  2ZKZ A;  1AU7 A;  1HA8 A;  1LEA A;  5D5V B;  1FSE A;  2EIN H;  3G1M A;  5CPR B;  3TDU C;  1SD6 A;  2XC7 A;  3I56 I;  3CCQ I;  1YIT I;  4B4C A;  1WSU A;  2NS7 A;  4IPA A;  5H2F C;  1QHG A;  2EB7 A;  3HXL A;  1IUY A;  2P7V B;  2FF4 A;  1FYK A;  2F48 A;  3ZMD A;  1OCC H;  2UXX A;  5E79 C;  1EA3 A;  2DFE A;  1T39 A;  2FNA A;  3IL2 A;  2F6C A;  4AYB N;  4AUX A;  2CSO A;  1XDU A;  1R4N B;  2EH3 A;  2EWN A;  4L0Y B;  4ZH4 F;  1R71 A;  2HTS A;  5JVT A;  1Z91 A;  5FKM A;  1OCZ H;  2K3P A;  2QSG X;  4CCK A;  1A35 A;  1YS7 A;  3VSL A;  2YR2 A;  2EIK H;  3KX2 A;  5H6R A;  3ZXS A;  4HQM A;  2CUF A;  3MKW B;  2XB0 X;  4HLY A;  4XNF A;  4UB6 C;  3MEX A;  3D5R C;  2WA0 A;  2ZFU A;  3JRG A;  1F4K A;  3VFZ A;  3S3N A;  4XLH A;  2A5Y B;  4MEX F;  1PP7 U;  1NG7 A;  1HF0 A;  3OOU A;  4AIH A;  2HKX A;  5F0F A;  3AG2 H;  4BGD A;  5M5X J;  1JE8 A;  1S7E A;  1XTA A;  2BV6 A;  2CQX A;  4KIF A;  2IT0 A;  5F0H A;  1ZG1 A;  4RMN A;  2DU9 A;  1QPI A;  4A3D J;  1DGR M;  2CUJ A;  1UG2 A;  3OIO A;  4HEA 2;  3A01 B;  3GTG J;  1GVD A;  3KE2 A;  1ACI A;  4BAY A;  3FXL A;  2F5C A;  1G2H A;  3TW6 A;  3E6C C;  1R5G A;  3F8B A;  5J8C A;  4W97 A;  1ETY A;  3WHB A;  1O3T A;  1OLT A;  2WAE A;  5EF6 A;  3DLL F;  1GLN A;  4I99 C;  3FXO A;  3CCJ I;  2ZB9 A;  3HBL A;  4OAZ A;  2W57 A;  3EUK L;  2BXZ A;  2F5F A;  3MN2 A;  3L2U A;  3KP4 A;  4XM3 A;  2STW A;  2V1X A;  3MKL A;  4XIC A;  4HYE A;  4U88 A;  3T8R A;  3GME A;  1TNS A;  1BW5 A;  3OSF A;  5FRM A;  1MJB A;  3CJR B;  4D9J A;  2LK2 A;  3OMY A;  2V26 A;  2P7C B;  1ON1 A;  3KEY A;  3HOV J;  2BVL A;  4M6V A;  3HHH A;  3TP0 A;  1K6O A;  3BR1 A;  3J81 Z;  1EH6 A;  4I02 A;  2AXL A;  3UNG C;  2M3A A;  3ZN0 A;  3HEF A;  3GFL A;  1HKQ A;  4ENJ A;  3PNY A;  2E2J J;  1IV6 A;  3BC8 A;  4ESJ A;  5FD6 A;  1FLI A;  5DTD A;  1K78 B;  5EG0 A;  1VQO I;  1EF4 A;  4NC6 A;  4A3I J;  1MH4 A;  4RAG A;  3K4K A;  3F9K A;  3KZI C;  3IRR A;  2M0M A;  2XHK A;  2Y48 A;  5LRR A;  1MDM B;  1IN5 A;  5J1R A;  1JTX A;  2LDU A;  3ZQH A;  1MNE A;  1PDN C;  1TWC J;  2DOE A;  2V6C A;  2P6S A;  2YS9 A;  3KLO A;  3I64 A;  2JA8 J;  2RNG A;  1UHS A;  1P9Q C;  2ELH A;  2LKP A;  3NAU A;  2A5W A;  2O9L A;  2K02 A;  1R22 A;  2XF5 A;  3FKI J;  1QVT A;  1QZE A;  3O3K A;  4B48 A;  1SAX A;  3T8T A;  2VN2 A;  1FYM A;  3J7A Y;  2ZBK A;  1BOA A;  1H0M A;  1YOV B;  2KT0 A;  3GBG A;  4QTR A;  3ZQC A;  3H1C A;  4RLF A;  2DFF A;  5FLX K;  1YW8 A;  2EIJ H;  4FTH A;  1J2X A;  1J09 A;  1E3O C;  1D1C A;  1JUM A;  2JVH A;  5LGN A;  4M71 A;  3V8K A;  2O8K A;  5GAG J;  1ZRE A;  3I9V 2;  2K3F A;  4LD5 A;  3KLN A;  2XGE A;  3F8F A;  2FBI A;  3Q9S A;  3QPT A;  4LLG F;  4BYY A;  2AS5 F;  3K1M A;  2ME6 A;  4V2G A;  1ZKG A;  5LHH A;  3FKJ A;  3G71 I;  2NVX J;  3H5A A;  2PFB A;  3SZP A;  1LDK B;  1W7P D;  1X2M A;  2IS1 A;  4OIN F;  3E1S A;  5CQE A;  2LVS A;  3Q0U A;  2V4J C;  4I76 A;  3IH4 A;  2WB1 N;  1K4S A;  1R1V A;  1WJE A;  2FE3 A;  2QCO A;  2BZT A;  5DYM A;  5IP6 A;  1I1S A;  2EV6 A;  1JT6 A;  3GWZ A;  3LSR A;  3ZGK A;  3HKZ A;  3HSF A;  2NXN B;  2DBB A;  5CJ9 A;  5L3B A;  3KP5 A;  2K27 A;  3WU2 C;  1YRN B;  2O8X A;  5F1J A;  1RR8 C;  3F3X A;  4F93 B;  4M74 A;  1Q1H A;  2H8R A;  4EJT A;  4A0X A;  4BDY A;  3S2D J;  1RC9 A;  2FOW A;  4BDZ A;  4CSW A;  2Q8K A;  1DPR A;  3FXM A;  3K69 A;  3BWG A;  3BG5 A;  2DJI A;  2CO5 A;  2M7A A;  3ECH A;  3D1N I;  2GZW A;  5D6F A;  3I59 B;  4JX5 A;  3L7W A;  1RZ4 A;  4HX4 A;  4ZYE A;  2DMN A;  4JQF A;  4BE1 A;  3HHG A;  1OKR A;  3OYC A;  5K5R A;  1TWG J;  4BBS J;  4EGZ A;  3GLL A;  3MFK A;  3CF5 F;  1V54 H;  3PO2 J;  2XAF A;  1HQC A;  5ERI A;  4FE4 A;  3VEP A;  4XRF A;  3W6J B;  2L7F P;  1A6Q A;  5LHG A;  1PYV A;  2M30 A;  3W6K B;  1T38 A;  2VJI A;  3PM1 A;  1WH5 A;  1L0O C;  2OJE D;  4RB1 A;  3GEZ A;  1FIA A;  5TGT A;  5CKT A;  1WKM A;  2RAE A;  3RCO A;  3I54 A;  1QO0 D;  3IWF A;  4XR6 A;  2HVQ A;  2JVG A;  4PDK A;  3A0B C;  2BY0 A;  1N25 A;  2WBM A;  4PJN A;  2RV8 A;  2V9P A;  5HDK A;  2K9S A;  2RGV A;  2G7H A;  4WXD A;  4MHG A;  2AQF A;  2KRC A;  3B73 A;  3BR5 A;  2BOL A;  2ZXH A;  1I6X A;  3C2H A;  2YSR A;  2X1C A;  3K6G A;  1VQP I;  1YJ9 I;  4Y3O A;  2X6X A;  2JMW A;  2KZG A;  3ABU A;  1J7K A;  2P81 A;  3IH3 A;  4WXC A;  4CCN A;  3H3V K;  2MH2 A;  2Y9Z A;  2PBI A;  3OYK A;  2HNH A;  3RYP A;  2ESN A;  1AKH A;  2ID3 A;  3BG6 A;  1YS6 A;  1XPX A;  1D0Y A;  3BJA A;  3DF8 A;  5K5O A;  1ETK A;  2ZO4 A;  4S05 A;  2HWV A;  5AIQ A;  3ABL H;  3PJR A;  1O3R A;  4HRI A;  3E6M A;  3RPQ A;  2PG4 A;  2IGK A;  4Q47 A;  2A68 F;  3MVP A;  2M1B A;  2NOG A;  3FK7 A;  1B8I A;  1IRX A;  2VIX A;  5K5Q A;  5IP9 J;  2HZD A;  2J5P A;  2F4O B;  4OIO F;  3EDP A;  3K70 C;  2K86 A;  1OYW A;  3CCL I;  2JRT A;  5JHF A;  3EPZ A;  4EV0 A;  2KHM A;  3B02 A;  3OYA A;  1IGN A;  3RKQ A;  3UKG A;  3LQR A;  4PUS A;  2M34 A;  3RZO J;  3WGG A;  1B8I B;  2Z1D A;  4MFD A;  4WWC A;  1R58 A;  3GXO A;  4A69 C;  3J7A O;  3ML6 A;  2GWR A;  1LVK A;  4B8X A;  4BAC A;  2LMD A;  2UV1 A;  2Y75 A;  4XOT A;  1E2X A;  5GPA A;  2GM4 A;  2P0W A;  4UUV A;  2B9S A;  1BJZ A;  2UUZ A;  2M87 A;  4OMY A;  3GCM A;  4IL6 C;  2XPW A;  1S29 A;  2FJ1 A;  5DM6 F;  3SFZ A;  1T0F C;  3C2G A;  3K4M A;  4YFK F;  4UVC A;  2VB6 A;  2WTE A;  1GV2 A;  1XMK A;  1IRZ A;  4ESB A;  3ZOB A;  2IGO A;  4I7H A;  2L7K A;  1G3S A;  1BIA A;  2MD0 A;  2BVM A;  4D0P A;  3DKX A;  5KCM A;  3ZP5 A;  2JA7 J;  2E35 A;  4Z6Y A;  3BY6 A;  2P4W A;  4MQ9 F;  3HOX J;  1U8R A;  2NRA C;  1BN5 A;  5HVQ C;  4DJA A;  2DXI A;  1XGS A;  5B1B H;  2HOE A;  2LF7 A;  3AG1 H;  3QPL A;  3BCB A;  4ZZL A;  4ZZD A;  4IXA A;  3B6A A;  2Y0S N;  1BR2 A;  3RJP A;  4C3H J;  4E70 A;  1MBE A;  3HUG B;  3NAR A;  3C7J A;  5M5Y J;  4E4H A;  4XOP A;  4AVP A;  3GZ5 A;  2K9N A;  4BU2 A;  3L00 A;  2VJ4 A;  1WZ2 A;  4KNY A;  3HDD A;  2VON A;  1FBS A;  4AWX B;  4E7S A;  1ZRF A;  3QPH A;  4M3F A;  2QZ8 A;  1F43 A;  4BXF A;  3T0Y A;  2AHQ A;  3BR3 A;  2K9L A;  3CUQ B;  1MMA A;  1T98 A;  2R7V A;  2L3D A;  3QP6 A;  2A3S A;  3FM5 A;  4RA2 A;  3KEO A;  1LKX A;  4R79 A;  4RB2 C;  2O61 A;  1D1A A;  2OZ6 A;  4M3E A;  3SEQ A;  1J75 A;  5IT9 Z;  5CVU A;  4UHT A;  2PMH A;  1SEU A;  3K4C A;  4A93 J;  1ZH5 A;  3RDI A;  3BOQ A;  2HU9 A;  2GBY A;  4U87 A;  1REP C;  4BS9 A;  1Z6R A;  1XSV A;  3LFK A;  2OBP A;  3H92 A;  2WV0 A;  3I53 A;  3TDZ C;  5J8F A;  4UVB A;  2VJJ A;  3HOY J;  3WG7 H;  4ZTJ A;  5EEH A;  3TMO A;  2GA1 A;  5J4Y A;  1N75 A;  2OTL I;  4HNU A;  5ILU A;  1LFU P;  4UB8 C;  2DK8 A;  3LSH A;  3FHZ A;  1YLF A;  4A0Z A;  4G94 A;  2VKH A;  2VL8 A;  3NWT A;  4M3D A;  1FC3 A;  3C2B A;  4EM0 B;  3KET A;  1ON2 A;  2O6G E;  1ZAR A;  5J47 A;  1FWZ A;  5C3E J;  4HLX A;  4RAZ A;  3JRA A;  5IYD J;  5F04 A;  1UST A;  2Q2E B;  1MMN A;  3NEU A;  1OYY A;  1Z0X A;  5DS9 A;  4JP0 A;  3G4S I;  3K0L A;  3M1E A;  4C3J J;  5GAD J;  1UB9 A;  2XKP A;  3K4J A;  1ETX A;  3OY9 A;  1OMI A;  2E7X A;  4BEH A;  1ZLK A;  1STZ A;  3BR0 A;  4IF4 A;  3SJM A;  4UUS B;  1UFM A;  1LE8 A;  3J7Y J;  3R6S A;  3ZPL A;  1K78 A;  3ZMV A;  3ELK A;  4O5V A;  2IS2 A;  1WRJ A;  1USS A;  2ZXJ A;  4ZTF A;  2QYO A;  4KFC A;  4ZJZ A;  4XN0 A;  3ZQQ A;  4LLN A;  1WVR A;  3MKY B;  4KN4 X;  3EUA A;  4KIC A;  1JJ6 C;  2HZT A;  3JRC A;  1BW6 A;  3TOB A;  5J4V A;  5IT9 K;  2FML A;  1WPK A;  2H6B A;  1R5I D;  1N78 A;  2ZJQ F;  4N9H A;  2P5L C;  1MGT A;  5DM7 F;  1ZAO A;  2XF6 A;  1TNT A;  1KYW A;  3IAS 2;  1KQ8 A;  2L4M A;  4C2U A;  2EA2 A;  2HOA A;  3T1B A;  4HA8 A;  1BIB A;  1ZYR F;  2DT5 A;  4HV5 A;  3RQI A;  3QOE A;  1K83 J;  1IRF A;  1TT0 A;  1VQ6 I;  2QVO A;  3Q5F A;  3AKZ A;  3X2Q H;  3FIW A;  2LH9 A;  5HS8 A;  1JGS A;  3JRF A;  1W0U A;  3E97 A;  2GIV A;  1OR7 A;  4JX6 A;  3VSK A;  1B9N A;  4PFO A;  3H36 A;  4EM2 A;  4XSX F;  4HNT A;  3RPU A;  3FMQ A;  4PSW A;  2IGM A;  1QNT A;  1GV5 A;  4GYG A;  5C4J J;  4LB6 B;  3WTT C;  1EJ9 A;  2HVS A;  1LUJ B;  4HNV A;  4A3J J;  5GTI C;  4BJ5 C;  4YFN F;  1VZ0 A;  4UY8 I;  3CZ6 A;  2W1O A;  2Z5U A;  3ESW B;  2KJC A;  2MLK A;  2L9R A;  5D6E A;  2EBI A;  3JCU C;  1I1G A;  2JSC A;  4RGU A;  2ZXI A;  3PUB A;  4LK0 F;  5D4R A;  4FE7 A;  4KA4 A;  2OA4 A;  5DCM B;  5E18 F;  5FKL A;  2DMP A;  1HXD A;  5FRO A;  3CDI A;  4Y4R A;  3D5S C;  3OYG A;  4CO8 A;  4OIR F;  1BI3 A;  2BEO A;  3CLQ A;  3WTW C;  1X1B A;  1JT0 A;  2DT7 B;  4Q4Z F;  5K7F A;  3FF5 A;  5FFZ A;  3HPG A;  3G3Z A;  4CDG A;  3CES A;  4YIR X;  1W0T A;  4GO1 A;  5K1Y A;  1X4O A;  3Q0V A;  2ECB A;  5LGT A;  1HST A;  2EZL A;  4A3E J;  4AIJ A;  5A2Q Z;  1YE9 A;  2XGX A;  2IA1 A;  3LA2 A;  4L18 B;  2X48 A;  3GF2 A;  3SYT A;  5ED4 A;  1F1Z A;  3OV8 A;  5IYB J;  4HST A;  1NG6 A;  2E2I J;  3I4P A;  3LQQ A;  2XPU A;  1Z9C A;  3IRQ A;  1XDS A;  4B3X A;  2NVU B;  3SFI A;  1T95 A;  2RQP A;  2NAZ A;  1J59 A;  2X6O A;  2M45 A;  2DA6 A;  3FIS A;  1TW2 A;  2L54 A;  1FYL A;  2JT1 A;  4DBQ A;  4XBF A;  1QA6 A;  2KJB A;  4Y13 A;  3IP4 B;  2UZK A;  1X4P A;  1TQI A;  1YTY A;  1Z3Y A;  2AO9 A;  3H0D A;  4S0H B;  1P4W A;  3N05 A;  3WTZ A;  4KIG A;  3Q3S A;  3QWL A;  1SD4 A;  3H5R A;  2L7M P;  3KPH A;  2BHY A;  5ILV A;  1YQA A;  2WC2 A;  4Q48 A;  5E1W A;  3J80 Z;  4E7I A;  1NK3 P;  2Z16 A;  2X6Y A;  2YPR A;  2E1M C;  2FOK A;  3FK6 A;  3DPT A;  5CVI A;  3K70 D;  1FPQ A;  2FA5 A;  1FJL A;  4IHT A;  2HYJ A;  3U21 A;  3BPX A;  2Z99 A;  5KNL A;  1CF7 B;  4WCG A;  2ZJ2 A;  3PIO F;  3BPV A;  2HQ5 A;  2R5Y A;  3CUQ C;  5A2Q K;  2HDD A;  5EGO B;  2EZK A;  2LC2 A;  1U78 A;  2LRE A;  5EDN A;  2PQ8 A;  4XMY A;  1SFE A;  2BY2 A;  2ISY A;  5FFX A;  2JPB A;  4IHV A;  1ZR4 A;  2LG4 A;  3E6B A;  2XVC A;  1MSE C;  4LG0 B;  2DA2 A;  2FBH A;  2HGC A;  1B4A A;  3V42 A;  2P5K A;  4DZP A;  2DPU A;  2QUF A;  5H6Q A;  1ZRD A;  4XKB A;  5EZG A;  1I3Q J;  4M73 A;  3PSI A;  2DQL A;  4KJZ A;  3ZMU A;  2CV0 A;  4FAS D;  2KFD A;  1IN6 A;  4IZZ A;  1R00 A;  1R1T A;  1HDP A;  1X2N A;  2V9K A;  2BW3 B;  1J9I A;  5AON A;  1A04 A;  2DMT A;  4C30 A;  1XD7 A;  9ANT A;  4ZYA A;  1VF9 A;  2IVM A;  3AAF A;  3JAM Z;  1I50 J;  2LP0 A;  2MAB A;  2M8G X;  1FP2 A;  1SFK A;  4BY7 J;  3U2R A;  4EJU A;  2VJ5 A;  4YII A;  4J00 A;  5DUK A;  3DEU A;  3BZ6 A;  5KVR A;  4IQ4 A;  3F8C A;  4CXF A;  2L9S A;  2UWM A;  1LVA A;  4RBO A;  2LF8 A;  4CIC A;  4BEH B;  4UXN A;  1VQ8 I;  5FO5 A;  2X1D A;  5JI6 A;  1DUX C;  3EQL F;  3I4N J;  4XQF A;  2M2E A;  1MMG A;  1KQ9 A;  2PJR A;  2F2E A;  1SFX A;  2GLO A;  1B9M A;  2RVC A;  3PUF A;  4C2T A;  4F92 B;  1RET A;  3MZ8 A;  4P96 A;  4N4O B;  2L0K A;  2TCT A;  1ZGW A;  2F5V A;  2LBF A;  1VQ7 I;  3S14 J;  4U0W A;  1YO5 C;  3S3M A;  3M8E A;  4UV8 A;  1GDT A;  4N4N B;  1U3E M;  3OSG A;  2ZSI B;  2VQL A;  4BUP A;  2OCE A;  5L3E A;  3LOC A;  1D8J A;  3M4O J;  1BBY A;  4A3L J;  1YX3 A;  1W5T A;  4UV9 A;  3RKX A;  3DV8 A;  4M3B A;  1EKE A;  4HDV A;  2EIM H;  3WTS C;  3RYR A;  1VFC A;  5F64 A;  1ETQ A;  5DD8 A;  2DMQ A;  3K4L A;  1YI2 I;  5TIS C;  1RI7 A;  2XDV A;  2H94 A;  2L02 A;  3BT9 A;  4HF1 A;  3ROU A;  2HYG D;  1DP3 A;  3LSM A;  5KK1 A;  3KP3 A;  3CME I;  3DP7 A;  4RS8 A;  2ELJ A;  2HS5 A;  4FIS A;  1G4D A;  3TW7 A;  2HXO A;  2LD5 A;  2GA2 A;  3TOA A;  1SD7 A;  2GOM A;  2I10 A;  2TDX A;  5M3F J;  1R4M B;  1T56 A;  4E7L A;  4LIT A;  2IS4 A;  3IWZ A;  1FBU A;  1D0X A;  2EV5 A;  2F4I A;  4Y7N J;  2ZME C;  3SZT A;  1KGS A;  3JSO A;  2VOO A;  2IXS A;  2A61 A;  1NHA A;  3HB9 A;  1D5Y A;  2X0L A;  2D45 A;  1UAA A;  2ADU A;  2IRF G;  4NNJ A;  2OD5 A;  4DYR A;  3CCU I;  1YX5 A;  3WGI A;  3GX4 X;  2HPI A;  1NK2 P;  1MBK A;  1RES A;  2A69 F;  2XGC A;  3VPR A;  4IRH A;  2HXI A;  3RKW A;  4L9T A;  2QEX I;  1CF7 A;  4RM3 A;  1FTZ A;  2VQC A;  3TKY A;  4BXU A;  1HDD C;  2XAU A;  5ICG A;  2IJL A;  1Y8Q B;  1B59 A;  1V3F A;  2DA3 A;  3V7C A;  3HM5 A;  2LKX A;  4ENK A;  1J5Y A;  1KYZ A;  2M0C A;  2WV1 A;  1EH8 A;  2Y2Z A;  2ICW G;  2YU3 A;  1R7J A;  2KIQ A;  3RSN A;  2CW0 F;  3WHC A;  1GXP A;  5C44 J;  2X1E A;  5FD5 A;  5B1A H;  1T0F A;  3SEZ A;  3F8M A;  3CMA I;  2YU9 J;  3DEW A;  3HTU A;  1W36 C;  4CCM A;  3N4M A;  4MTE A;  3DBR B;  2QQ8 A;  4BQQ A;  4C2M J;  3H0G J;  3J81 K;  3H9Q A;  3SZG A;  3TO9 A;  4I6Z A;  2YX4 A;  1SFU A;  2PI0 A;  2O03 A;  2Z33 A;  5IT3 A;  1PUE E;  1XC5 A;  3JRE A;  2CYY A;  3NWS A;  2ZME A;  3LAJ A;  4CA0 A;  4FET A;  2STT A;  4CYC B;  2NS0 A;  3DEE A;  3B6C A;  2W24 A;  2FQ4 A;  2RRE A;  2NNN A;  4DYQ A;  2BE5 F;  2XKO A;  1IN4 A;  4NQW A;  5GP9 A;  2OPT A;  3WTX C;  1UMQ A;  2JSP A;  4ITV A;  1XS9 A;  2HPM A;  2KKO A;  4HOB A;  1Z67 A;  2R5Z B;  2VKD A;  5EG0 B;  1WGX A;  3I5U A;  3TBI A;  1IXC A;  4KMU X;  1SAN A;  2DDB A;  1FNN A;  5KHD A;  1UHW A;  2CV2 A;  2R4G A;  2Y30 A;  1NH3 A;  4DNC A;  4WF2 A;  4ZC3 A;  5B5E C;  4XKW A;  3K4B A;  3M9A A;  5F27 A;  3BLY A;  2E5Z A;  2CW8 A;  1LQ1 A;  2BW3 A;  2DO7 A;  4WX9 A;  3CCR I;  3ZRG A;  1HBX G;  2PJR B;  2XF7 A;  1QRY A;  2QQB A;  2MC4 A;  5HS7 A;  2WY7 Q;  2G9W A;  4RB0 A;  2QKM B;  2XRN A;  2HQA A;  1ZK8 A;  3ZR8 X;  1YHQ I;  2DDA A;  2Y0M A;  1E17 A;  2X6W A;  4F7Z A;  4B3A A;  4G6T B;  5F08 A;  2LBF B;  5M3M J;  2KIU A;  3VYR B;  4BL0 B;  2QWW A;  3HZJ A;  2VXD A;  3PL8 A;  3K4N A;  5E17 F;  3ULQ B;  3O6B B;  1MSF C;  5F0C A;  2IPQ X;  2CJJ A;  2L9V A;  4QPO A;  4RAY A;  1FBQ A;  2ZC2 A;  2BHZ A;  2CWE A;  3GUD A;  1BI0 A;  3W3C A;  2WAQ A;  1HW2 A;  5GAE J;  2KDZ A;  1LJ9 A;  4PJL A;  1ZEL A;  3LSJ A;  3CMM A;  3J80 K;  3BTI A;  5K7H A;  5EZH A;  2XAG A;  2Y31 A;  3FMS A;  3AG3 H;  2WAF A;  1YYV A;  3VWB A;  2VOP A;  3FZV A;  3V7R A;  4MGR A;  4GRI A;  3OYL A;  2E5N A;  4GYI A;  3COA C;  2HEO A;  2O0Y A;  2K40 A;  5IPA A;  4G12 A;  3E7L A;  5IP7 J;  2HYF A;  3O8G A;  2OTJ I;  4EJW A;  3KP6 A;  1TWA J;  1X1A A;  4BHP A;  4OMZ A;  2KIF A;  4IHY A;  4YFX F;  2OV7 A;  1Z7L A;  4HF2 A;  3HGY A;  1JKQ C;  1VQL I;  2VAS A;  4M3G A;  3PO3 J;  1T08 B;  3HSR A;  2E1O A;  4UUS A;  4NHJ A;  2GIZ A;  4IOA F;  1FOY A;  3WU1 B;  3KYL A;  5D8K B;  2M4G A;  3FXR A;  1U5T C;  5K7Z A;  4JYK A;  5C4X J;  3U9G A;  3OYD A;  2KLO A;  1SVO A;  3SQN A;  3G6E I;  3BTL A;  2DFI A;  1UHM A;  4PJ0 C;  3ABT A;  1ERD A;  1TT5 B;  3IKV A;  1O3Q A;  3E5U A;  2E1C A;  2M4K A;  3PNT A;  5CYV A;  4BQA A;  1G8X A;  2DYS H;  1G3W A;  4PK4 A;  3MCZ A;  1PP8 F;  2O7O A;  4V2F A;  2R7T A;  3DTI A;  1P6R A;  4H0E A;  2PLY A;  2DI3 A;  5JHU A;  3M8F A;  4Y15 A;  3DU6 A;  1BJA A;  3OYH A;  2VOD A;  2WAQ N;  4LIV A;  5D5W B;  3G2B A;  5FB2 A;  2OCC H;  2VQH A;  4KIT B;  2H1L A;  1W36 D;  1ITY A;  4Y33 A;  3HJE A;  2W48 A;  4ZDO A;  3O2P E;  3ZQG A;  3L2V A;  3FWE A;  3GW2 A;  1SMT A;  2R7U A;  2MH9 A;  1ZHF A;  3CQZ J;  4NC7 A;  2LFB A;  4MLO A;  2BGC A;  1UG0 A;  4A3K J;  2V79 A;  2DMU A;  4IVN A;  2FEZ A;  3QP5 A;  4LB5 A;  2COB A;  3L9F A;  1BI2 A;  2FRH A;  5FLV A;  3ASO H;  4XLN F;  4BNC A;  3S3O A;  2NYX A;  3RQ4 A;  3H3U A;  3CCE I;  4LG3 A;  3VB2 A;  2DT6 A;  1K79 A;  3QYB A;  2IGN A;  2LNB A;  4IQJ A;  1LFB A;  3WOD F;  2EPF A;  1VQM I;  1LB2 A;  4A6D A;  4RAF A;  4F3Q A;  2R7F A;  2JJ7 A;  1S7A A;  4XSZ F;  1D5V A;  2COM A;  4BKX A;  5IOZ A;  3OYB A;  5HS9 A;  1HLV A;  1ENH A;  3GLX A;  4X0G A;  2VE8 A;  4B47 A;  1WJF A;  3GFI A;  1LDJ A;  1GHC A;  2PMZ N;  1T8I A;  1X3U A;  3HOZ J;  5DCM A;  3IV5 A;  4BQN A;  2V7F A;  3P9C A;  3HRS A;  1X1D A;  3BTJ A;  2VPL A;  4B09 A;  2XIG A;  1RPW A;  1TC3 C;  3CJN A;  4JK1 X;  4G6D A;  5HDN A;  1U8B A;  1HCR A;  2K85 A;  2EFQ A;  1LNW A;  3Q0W A;  1LE8 B;  1Y6I A;  4JOM A;  4RLQ A;  1XGM A;  3K1N A;  1HW5 A;  1Y39 A;  2XV4 S;  3BRO A;  1WQ2 A;  1IN8 A;  1QHH D;  2IBD A;  4GXO A;  1IXS B;  1O7L A;  4YRV A;  3L1P A;  2BY3 A;  1RKW A;  3TO7 A;  2JQ7 A;  1FX7 A;  1W5C C;  1XMA A;  3P9I A;  4BH9 A;  1A31 A;  4E7J A;  2MG4 A;  2XAQ A;  1U0J A;  2KIM A;  1K6Y A;  3DBH B;  3HTS B;  4BXX J;  1HOM A;  3QOD A;  4DGW B;  4XRS G;  3WGH A;  2VBW A;  2L2O A;  1IC8 A;  2OQR A;  2IAI A;  5JVG F;  4LK1 F;  1UZC A;  3OL4 A;  2L7Z A;  2JA2 A;  1OIS A;  3LL7 A;  3PSF A;  5HLG A;  1U9O A;  4HG2 A;  4EM1 A;  5D5U B;  2EK5 A;  2H09 A;  4OIQ F;  2VPR A;  1ETO A;  3S1N J;  2ZXW H;  3ERE D;  4C9Y A;  1HC8 A;  2RKH A;  3GO5 A;  1KU9 A;  1QU3 A;  2JA5 J;  3PQK A;  1D0Z A;  2G7U A;  2HTJ A;  2EFW A;  4L5J A;  3F21 A;  1AKH B;  5DDG A;  3DCF A;  4R1H A;  2R7Q A;  4I01 A;  1PJR A;  2DOD A;  2PJP A;  2R5Z A;  5L3F A;  1JI8 A;  3F0C A;  1ZN2 A;  1MW7 A;  2WY8 Q;  4ON0 A;  3S1Q J;  3KZY A;  2B63 J;  2DOA A;  3CC4 I;  4A0Y A;  3HPH A;  3A4C A;  1XN7 A;  5FLM J;  4G8X A;  4NC8 A;  1O3S A;  1E3H A;  4NB5 A;  1I6H J;  3OS1 A;  3GTP J;  4CYC A;  3NQO A;  1MMS A;  2ZJR F;  2DOF A;  2ZME B;  5BPD A;  5ICE A;  2QQ9 A;  4MEY F;  4MTD A;  2Q1Z B;  2FMY A;  3T5X A;  3DQV C;  4KN7 X;  2W7N A;  3OR2 C;  4BHC A;  2EA4 A;  1VQ9 I;  2JN6 A;  4UUT A;  3G73 A;  1FEX A;  4P5O A;  4ENM A;  2E1M B;  3HG9 A;  2QF7 A;  5JR3 A;  5E1Z B;  3IC7 A;  3AL0 B;  4E7K A;  1XCV A;  5GAH J;  3CJT B;  1QZZ A;  5GPC A;  3ISP A;  1CQT A;  2OU2 A;  5LLQ A;  3ABK H;  4PJM A;  2A05 A;  2DN0 A;  4OIP F;  5CLS A;  3CMY A;  1IRG A;  1KON A;  1NTC A;  2MBF A;  4M6Y A;  1S72 I;  2QEN A;  1E0E A;  2VI6 A;  4AVZ A;  2AXT C;  3H5N A;  3HRU A;  5AIP A;  1ORK A;  4F55 A;  5GTH C;  2E34 A;  1KZH A;  3M3Y J;  1R5H A;  4CZZ A;  3WTV C;  1TW3 A;  2MW8 A;  3OOP A;  1JKP C;  5E20 A;  3BJO A;  3RZD J;  4L0Z B;  1ZTR A;  3ZMZ A;  4HQE A;  3F22 A;  2L01 A;  3HUG A;  3S1M J;  4F91 B;  3TQN A;  1W5S A;  1WJ5 A;  3HOT A;  4XLP F;  1YRN A;  2LY1 A;  4FHT A;  4XK4 A;  1VQ4 I;  4HV6 A;  3ZCO A;  1TQP A;  4QWQ A;  1YIO A;  1RNL A;  4P9F A;  4JBA A;  4PCQ A;  1Y56 A;  4CH7 A;  2K4B A;  4J01 A;  2YUS A;  5TJJ A;  1FY7 A;  1QZY A;  4V19 K;  1ZQ3 P;  1H89 C;  2K9Q A;  5JFR A;  4I0B A;  3LWF A;  1F9N A;  1I3A A;  2A6H F;  1BOB A;  3DPL C;  3MQ0 A;  3WE3 A;  1FOK A;  3FDY A;  2XRL A;  1HSJ A;  2OZU A;  4ZYG A;  1YG2 A;  1ETW A;  1ZLJ A;  4ASN A;  5HNH A;  2XGD A;  3BCA A;  2D1V A;  2I8D A;  4HBL A;  4CUG A;  3IKT A;  2B0L A;  2ECC A;  2V1U A;  2EFP A;  1D3Y A;  4PGH A;  3EYY A;  3FHN A;  4M72 A;  5ILS A;  2IA2 A;  1WJA A;  1KU7 A;  2HVR A;  2XAJ A;  4U0V A;  3ZQ7 A;  4JX4 A;  1FMW A;  2HOT A;  2CW7 A;  2VBX A;  3H9J A;  4II2 A;  3DPU A;  2DPD A;  1LFP A;  1Z21 A;  1JKO C;  4XON A;  3FBN B;  1S8N A;  2XAS A;  3VDX A;  3DKY A;  5D8L B;  1R9T J;  1XSD A;  4AM3 A;  3SXY A;  1XSX A;  1TWH J;  2EFN A;  4M6X A;  1BM9 A;  3BR2 A;  4RB3 C;  4RGS A;  1VI0 A;  2XUB A;  1U6G A;  2D1H A;  2CMP A;  3W2A A;  1LDD A;  3I55 I;  4I0A A;  4LGW A;  3F72 A;  1GT0 C;  1IDZ A;  3DLA A;  1TQM A;  1G59 A;  1W4M A;  1OR7 C;  1XB4 A;  1DDN A;  3CC2 I;  4OOI A;  5LBQ A;  3S1R J;  2IEK A;  1AWC A;  4G7Z F;  2A07 F;  4EQQ A;  1HKS A;  4HDU A;  1FOW A;  5JLW A;  2DA7 A;  3P9K A;  4B1R A;  5EYR A;  3MD2 A;  3W2W A;  1I5Z A;  3FXK A;  3I59 A;  3K2A A;  2DCE A;  2R7W A;  3S16 J;  4MO7 A;  4P9U A;  4D1Q A;  2R5Y B;  5IYC J;  2QLZ A;  4ZYD A;  4YEJ A;  3JRB A;  4G6Q A;  2CUE A;  2IS6 A;  3GZ6 A;  4PSX A;  3EUH A;  3LSK A;  1A5J A;  5FLX Z;  1AA7 A;  1QVU A;  4LG0 A;  4H4K C;  2Y9Y A;  1V55 H;  3S32 A;  2VT2 A;  2QBY B;  3N97 A;  5FJ8 J;  3MAJ A;  2CUZ A;  3LSG A;  3VYS B;  5FRN A;  1UCR A;  1MIJ A;  2K9M A;  4R8H A;  4XN3 A;  5HLI A;  3E3V A;  4KUM A;  3WTY C;  4A3G J;  1YIJ I;  1WCM J;  3RIR A;  4D7N A;  2VQG A;  3KIO A;  3CDL A;  5F6F A;  4D5F A;  1S7O A;  5J40 A;  2FU4 A;  2EQR A;  3ZQI A;  1R36 A;  2ZJP F;  1EH7 A;  2CFX A;  2DTR A;  2L5Q A;  3ABM H;  4EAT A;  2W00 A;  2ELK A;  4XOR A;  5CVR A;  2W85 A;  1YJW I;  1BA5 A;  2M5W A;  3A0H C;  3FMR A;  3VOE A;  1SAU A;  3BDD A;  1JUS A;  2DLL A;  3S17 J;  4IJA A;  3SDG A;  2RC4 A;  4ETS A;  4HAM A;  4XID A;  4FX4 A;  4L9V A;  1H9G A;  1JXS A;  3A02 A;  4DBR A;  2M8E A;  1WH7 A;  2A6E F;  2LY2 A;  2O5R A;  3DFG A;  4CHU A;  4KIS A;  4BQO A;  2VC0 A;  1OQY A;  4QLC U;  2JTV A;  1O57 A;  1UEL B;  5J3L A;  3LFU A;  4XRM A;  5EGO A;  1LEB A;  2PMU A;  2ID6 A;  1P2F A;  2ME0 A;  4E6K G;  3LMM A;  4XLC A;  2DQR A;  3C3W A;  5J6X A;  5LGU A;  1DU0 A;  2WB1 A;  5L3C A;  1WI3 A;  1ETV A;  4CZC A;  2ACJ A;  1XG1 A;  2HQR A;  4ZYH A;  5EEG A;  2XRO A;  4IX7 A;  2JZY A;  2XPV A;  3M7G A;  3QQA A;  3IUO A;  1WFX A;  2RDP A;  2OAZ A;  3IH2 A;  1K4T A;  5H20 A;  3DTE A;  2LOO A;  2H27 A;  2CFO A;  2HI3 A;  3CCV I;  3LST A;  3FM3 A;  5EEA A;  4BY1 J;  2C6Y A;  1U2W A;  2GXB A;  1V5E A;  1BC8 C;  2QM3 A;  4MQV A;  5F1R A;  4I98 B;  1SC7 A;  1IW7 F;  1C0W A;  4BE2 A;  1D1B A;  1OCT C;  3JTH A;  1GXQ A;  4B43 A;  2FNP A;  4TV7 A;  4Z2Y A;  4YIF A;  3LSP A;  1YFH A;  5CVV A;  3MZY A;  3BTC A;  3EET A;  1YW7 A;  3QYE A;  2H6C A;  5LEJ A;  2NVQ J;  4ZDP A;  1OCR H;  3VOD A;  5BQT A;  1CGP A;  5BMZ A;  2B7E A;  2LSO A;  2N8G A;  1RKT A;  1F5T A;  3FX3 A;  2GQQ A;  4BJT A;  4DIQ A;  1BC7 C;  4WK8 F;  1XX5 A;  4O3M A;  1H9T A;  3GTK J;  3QPS A;  3ZN1 A;  2E60 A;  3VYU B;  1S6L A;  3A2K A;  2XSD C;  4XLE A;  2XSJ C;  4MNU A;  1DU6 A;  3H3Z A;  1DPU A;  4PFP A;  2V9V A;  1P7J A;  1RRJ A;  4BBR J;  2L9N A;  5IY5 H;  2LYC A;  5IOY A;  5DUI A;  1R1U A;  2HFH A;  4ANJ A;  4I09 A;  1T2K A;  4A5M A;  2HQN A;  5LEK A;  3VYT B;  1Z7U A;  1ULY A;  2MA3 A;  2ZNZ A;  3KP7 A;  5E1X A;  3QRF F;  4K2E A;  3E0J B;  4B44 A;  3GFJ A;  3G1O A;  1JGG A;  4IRI A;  1TWF J;  1QPM A;  1P4A A;  1OJL A;  4ABZ A;  2EZH A;  1X1P A;  2KQR A;  1ZG5 A;  1X3Z B;  3OYF A;  1VQN I;  4A12 A;  3CC7 I;  2JWT A;  2D2W A;  1IUF A;  3QOP A;  4M9Z A;  4A3B J;  3HRT A;  4FQG A;  1VTN C;  1DP7 P;  1FP1 D;  4WXH A;  1L3L A;  1GUU A;  2R92 J;  2KRH A;  1I27 A;  3F6O A;  5B66 C;  4LJZ F;  5M5W J;  1XGN A;  1WJB A;  2MGQ A;  2DA1 A;  5D5X B;  1BR4 A;  3OIQ A;  3SDB A;  2V1D A;  1ZGA A;  4GFB A;  4CCJ A;  1IXR C;  4BJ6 C;  2P8T A;  3GYH X;  2MLG A;  1TTY A;  2EJR A;  2Y0S A;  4MIM A;  1DQU A;  2R7D A;  4E7Z A;  1X19 A;  2HR3 A;  3TL4 X;  4KIB A;  2VE9 A;  1X1C A;  4XL9 A;  3C1D A;  2ETH A;  2OUM A;  2PMZ A;  3DXJ F;  3HYI A;  4YEL A;  1VQK I;  3JRD A;  3BP8 A;  3CO6 C;  4KT6 A;  1V4R A;  4KDP A;  2QA4 I;  1ODD A;  3H9G A;  5DEQ A;  1W1W E;  4AIK A;  3M8J A;  1KQ0 A;  1QQI A;  5FKO A;  5BNG A;  5JLX A;  4AU7 A;  2FXA A;  2KZV A;  3I4M J;  2Z2S B;  1BI1 A;  3U1D A;  2R93 J;  5CVJ A;  1WJC A;  3C18 A;  2ZCW A;  4ENN A;  3CO7 C;  3QU6 A;  2VKV A;  3CJQ B;  4EJO A;  4U0Y A;  5L3G A;  2O3F A;  1OYI A;  1F36 A;  1HW1 A;  2NS8 A;  3K1P A;  2VBY A;  2EV0 A;  4DQ2 A;  4QIW N;  2PEX A;  3L2W A;  2KDO A;  1B6A A;  1TP4 A;  1HKT A;  3D5L A;  1A6I A;  2P6T A;  3HL2 A;  1MJ9 A;  2WAD A;  2DA5 A;  1B1B A;  2Y69 H;  5HDG A;  4ESF A;  2CV1 A;  2BBY A;  2FBK A;  2PN6 A;  4LOC A;  4PZJ A;  4W1U A;  1SVL A;  1MZB A;  3V4G A;  1DGW Y;  1G3Y A;  3PIP F;  2JRM A;  1Y8R B;  5CQG A;  2JA6 J;  3ECO A;  3TP3 A;  1PVE A;  3OYM A;  1UJ8 A;  2K4J A;  3P5J A;  2PX9 A;  4O6J A;  4UVA A;  1Y1W J;  5E3M A;  1FTT A;  3V8L A;  3LA7 A;  1QBJ A;  1JHF A;  3CCS I;  2R0Q C;  2K5C A;  2V1N A;  3K10 A;  1K7A A;  1P7I A;  2MFZ A;  3OYJ A;  1V5G A;  2QKL B;  5LHI A;  2XB5 A;  4XKC A;  2WWY A;  1JKR C;  3IAM 2;  3QU3 A;  2LTP A;  4G7H F;  5ICC A;  2KP6 A;  4DZJ A;  3NRV A;  3RPU D;  4KMF A;  1X58 A;  4HPQ A;  2CGP A;  5D4S A;  1TL8 A;  3OYI A;  3IHU A;  1H8A C;  4BHB A;  3I71 A;  2F4M B;  2VKE A;  3HKZ N;  1OFC X;  3L09 A;  2VT3 A;  3S93 A;  2Z3Y A;  4EMS A;  3CUQ A;  2MC3 A;  2KIS A;  1M1E B;  5LFA A;  1H88 C;  1X3W B;  1YJN I;  1MBG A;  3S15 J;  3ONQ A;  2UXN A;  3ZMT A;  3RTR A;  1GVJ A;  3W2V A;  3CTA A;  4QPQ A;  1FZP B;  5LD2 C;  1RR7 A;  2FD5 A;  2MSY A;  3CP2 A;  1J0R A;  1Z05 A;  3O8H A;  3HOU J;  3Q9V A;  3MMY B;  3HRM A;  4F52 A;  2I5U A;  5J1U A;  2D5V A;  1O4X A;  3TGN A;  2QSF X;  3I3L A;  1W7P B;  1Y1V J;  3HGG A;  4KT5 C;  2G0E A;  3SHF A;  2VXZ A;  2GXA A;  5HOD A;  4S04 A;  2ZSH B;  2M7B A;  4A5N A;  3J7Z I;  3JRI A;  3RI4 A;  2EZI A;  2X51 A;  3CUO A;  4OAY A;  2VLA A;  3D0S A;  1OCO H;  4DYC A;  3A03 A;  2CQK A;  4G7O F;  3KCC A;  6PAX A;  4GCV A;  2ZFW A;  1G3T A;  4I2O A;  2FQ3 A;  1IZ1 A;  5E3N A;  4KYW A;  4L9J A;  2CQN A;  2Z9O A;  1MBF A;  3GTQ J;  1SMY F;  1MND A;  1TBX A;  4AC0 A;  2L4A A;  3CF2 A;  2Q0O A;  2E36 A;  4NQW B;  3TO6 A;  3AG4 H;  2W82 A;  3OR1 C;  2CRG A;  4X1E A;  2ZNY A;  3ERM A;  1AOY A;  1U5T A;  4U7D A;  4RGX A;  2IW5 A;  3JSP A;  1VND A;  2Q2E A;  3FBI B;  3R0A A;  1XCB A;  3CD6 I;  1APL C;  2A6T A;  2CQQ A;  4PJJ A;  1Z77 A;  4CCO A;  1TLH B;  3WU0 A;  2E7W A;  1Z6T A;  2KPM A;  2K7L A;  3DBL B;  1IO2 A;  1R6R A;  4DOZ A;  3JRH A;  3LNQ A;  3BG9 A;  3RKY A;  4IHW A;  3FXJ A;  5DV5 A;  5FGM A;  2R7Z J;  3F23 A;  3F6V A;  4NBQ A;  2R7X A;  2TRT A;  3OS0 A;  3G1L A;  2HDW A;  4LMY A;  1OCP A;  3EUH C;  5BOX A;  2JUG A;  1B72 B;  3GFM A;  4HF0 A;  4XKV A;  2CH0 A;  3ZQL A;  1VQ5 I;  2X9D A;  1QGP A;  2ISZ A;  1XGO A;  1T6S A;  3CP8 A;  4FT8 A;  5TRD A;  4IHX A;  1XMX A;  4CYD A;  4FCY A;  4Y52 J;  1AHD P;  4A6E A;  3M07 A;  1D8K A;  3AFH A;  1Y0N A;  3FXU A;  3QAH A;  2DA4 A;  4U7B A;  3ZMS A;  4QSH A;  1T33 A;  4HZF A;  2FX0 A;  3JAM K;  3K9T A;  3DU5 A;  2IA0 A;  2CQ7 A;  1R23 A;  4II3 A;  4IRG A;  3S8P A;  3EYI A;  1JUP A;  2FSW A;  3KYD B;  2RQQ A;  4J19 A;  2XAH A;  4HX8 A;  3FXQ A;  4GDF A;  2MD5 A;  1FSH A;  3KFW X;  4A3C J;  4RDU A;  2DK5 A;  2IP2 A;  3JW4 A;  3E5Q A;  4UNO A;  3P7N A;  1IF1 A;  3GTM J;  1ZGJ A;  2X85 A;  3KEQ A;  4IKF A;  4EVI A;  5L3D A;  2VBZ A;  4C3I J;  4YG2 F;  3LSI A;  4IHS A;  1PUF B;  1RIO H;  1EV7 A;  3GTJ J;  3WE2 A;  2DJN A;  3BJ6 A;  2R7S A;  2E71 A;  2DW4 A;  3BQZ A;  3DTK A;  3K7A J;  5FKK A;  3CCM I;  5FKN A;  1ONV A;  1G6N A;  3K2Z A;  3CLO A;  2AQE A;  3LAP A;  2GXG A;  4D5C A;  4M9S A;  2H1K A;  2NOJ B;  1OPC A;  2H8W A;  5HNF A;  1JTY A;  4L9N A;  3QYF A;  1IG7 A;  1Z3X A;  1S9H A;  5E8G A;  4OU0 A;  4HW0 A;  2MYS A;  2QBY A;  4XRS A;  3MWM A;  3BZK A;  4EJV A;  3LA3 A;  2QSH X;  4PGG A;  3KZZ A;  1E3P A;  1TZL A;  2JK3 A;  3E5X A;  2OQG A;  1MNM C;  4IO9 F;  3DKW A;  4Y17 A;  1FT9 A;  4CGZ A;  1MBH A;  3HOS A;  2DTZ A;  3L2C A;  5ICF A;  3OWT A;  1PUF A;  5BS6 A;  4LLL A;  4L5I A;  5KAI C;  1RUN A;  2X4H A;  4HSR A;  2BYV E;  1JJ8 C;  2NVY J;  2NNY A;  1SVM A;  3BG7 A;  3BQY A;  1KA8 A;  2KRF A;  3R4K A;  4NUB A;  3HOW J;  2R3S A;  2DFH A;  3V8J A;  1B72 A;  3A1Y A;  1FMV A;  3PNV A;  2HKO A;  2OC6 A;  5EJC A;  4ZDL A;  2E2H J;  3S2W A;  2LRD A;  1MJA A;  4M9X A;  1MKM A;  2EIL H;  2HDC A;  4CCL A;  1SFO J;  2JPC A;  3OYE A;  3W6V A;  1JHH A;  1BR1 A;  3I58 A;  1Q1V A;  2R7R A;  1LPQ A;  3R61 A;  2F5D A;  1MH3 A;  3S2H J;  2E19 A;  1IV8 A;  2QGU A;  3BR6 A;  2EFO A;  2M9H A;  2LR8 A;  1WJD A;  2YX7 A;  5HLH A;  1W7P A;  3I0T A;  3KYC B;  3BG3 A;  3H35 A;  5HLT A;  4A3F J;  4RM2 A;  3L2Q A;  3CDH A;  1U5T B;  3JTG A;  4XLA A;  5J1Y A;  4EEF G;  2W25 A;  4A3M J;  4P1W A;  1KU2 A;  1IN7 A;  5HOO A;  3TED A;  3KP2 A;  4IEJ A;  2R7O A;  1A36 A;  4LIU A;  4XLF A;  2BXY A;  4X6A J;  3DWL E;  3WG9 A;  1ZG3 A;  3ASN H;  1SD5 A;  1IDY A;  3M1C A;  1U9N A;  4N9I A;  3OYN A;  1IJW C;  3R60 A;  1S5L C;  1ZRC A;  1ZR2 A;  2OF7 A;  2VUM J;  1K61 A;  3L2R A;  2DYR H;  1MD0 A;  1Y0U A;  2QQA A;  2GAU A;  4DW6 A;  4RGR A;  1V5F A;  1P92 A;  5BPI A;  2F5E A;  2DAO A;  5DCF A;  2ESH A;  3MZH A;  2P5V A;  1MBJ A;  1WWX A;  2LY9 A;  3MKZ A;  2VC1 A;  1S3J A;  2NVT J;  3OS2 A;  4EGY A;  4L5E A;  1MDM A;  4GGG A;  2LLK A;  4OWR B;  3A01 A;  2HOS A;  4AD9 A;  4FX0 A;  3OL3 A;  1R49 A;  4LFU A;  3F8N A;  3GTL J;  3GZN B;  3U1K A;  2GOX B;  4IOC F;  4HX7 A;  3PFY A;  4NDL A;  3HIF A;  1IAW A;  1I39 A;  2RN7 A;  1MMD A;  4N0B A;  1RUO A;  2LKS A;  4Q5S F;  2BY1 A;  3JR9 A;  4G9Y A;  1O7F A;  3REO A;  2V6E A;  2J5O A;  2W84 A;  3R0J A;  1YW9 A;  4AID A;  1WI9 A;  4D7M A;  4E7H A;  5E3O A;  4BE0 A;  2KL4 A;  3UR3 C;  1FIP A;  3CCY A;  1P4X A;  2KMU A;  1KU3 A;  2RNJ A;  1Z1D A;  2E1N A;  4P55 A;  5KAF C;  3GTO J;  1POG A;  3OIP A;  2FUG 2;  5E3L A;  5DD4 A;  3E6D A;  5LRS A;  3GVA A;  4AYB A;  3PQJ A;  2JUC A;  1WHU A;  1FOX A;  4MFE A;  3BZC A;  3ZQF A;  2CG4 A;  2CS3 A;  4A2U A;  1BL0 A;  3HC7 A;  3PFI A;  5B3S H;  3WTU C;  2W4S A;  3HSE A;  5E8I A;  2CU7 A;  1N77 A;  3V7S A; 
#chains in the Genus database with same CATH homology
 1AU7 A;  3JRC A;  1BW6 A;  3G1M A;  1WPK A;  2O7O A;  4V2F A;  4B4C A;  1JJ6 C;  3G1O A;  1JGG A;  2NS7 A;  1TWF J;  1OJL A;  2HOA A;  2WAQ N;  2EZH A;  4ABZ A;  3RQI A;  1ITY A;  1K83 J;  2W48 A;  3ZQG A;  2JWT A;  1IUF A;  4AYB N;  4AUX A;  4A3B J;  3FIW A;  2EH3 A;  3CQZ J;  2LFB A;  4MLO A;  3JRF A;  1W0U A;  1GUU A;  2R92 J;  4JX6 A;  4A3K J;  2DMU A;  5FKM A;  2COB A;  5M5W J;  2MGQ A;  1GV5 A;  5C4J J;  2DA1 A;  5FLV A;  4HNV A;  2CUF A;  4A3J J;  4GFB A;  2XB0 X;  4MIM A;  3JRG A;  2L9R A;  2EBI A;  1LFB A;  1HF0 A;  3OOU A;  4FE7 A;  5F0F A;  5M5X J;  1S7E A;  5FKL A;  2DMP A;  2CQX A;  3JRD A;  2JJ7 A;  5F0H A;  1QPI A;  4A3D J;  4BKX A;  1UG2 A;  3OIO A;  3A01 B;  1JT0 A;  3GTG J;  5IOZ A;  1HLV A;  5K7F A;  1GVD A;  1ENH A;  1W0T A;  1G2H A;  3Q0V A;  2ECB A;  5FKO A;  3TW6 A;  5BNG A;  5JLX A;  2EZL A;  4W97 A;  1ETY A;  3WHB A;  4A3E J;  2PMZ N;  3I4M J;  2R93 J;  3HOZ J;  2X48 A;  5EF6 A;  3IV5 A;  2ZB9 A;  3HBL A;  3BTJ A;  2VKV A;  5IYB J;  3MN2 A;  1RPW A;  1TC3 C;  2E2I J;  1F36 A;  2NS8 A;  1U8B A;  1HCR A;  3Q0W A;  2XPU A;  1LE8 B;  3MKL A;  4XIC A;  4QIW N;  3SFI A;  1BW5 A;  3OSF A;  2LK2 A;  2X6O A;  1A6I A;  2DA6 A;  2DA5 A;  3FIS A;  2IBD A;  4LOC A;  4W1U A;  3HOV J;  4M6V A;  3L1P A;  1RKW A;  3TP0 A;  3BR1 A;  3HEF A;  2JA6 J;  2AO9 A;  3TP3 A;  2E2J J;  1IV6 A;  2MG4 A;  4S0H B;  1Y1W J;  4BXX J;  1HOM A;  5DTD A;  5E3M A;  3Q3S A;  4XRS G;  1FTT A;  2L7M P;  5EG0 A;  1EF4 A;  4A3I J;  1MH4 A;  1IC8 A;  2IAI A;  1NK3 P;  2R0Q C;  2L7Z A;  3FK6 A;  5J1R A;  1U9O A;  1JTX A;  3ZQH A;  1TWC J;  1FJL A;  1P7I A;  2HYJ A;  2YS9 A;  2VPR A;  2XB5 A;  2JA8 J;  1ETO A;  1UHS A;  3S1N J;  1JKR C;  3NAU A;  2HQ5 A;  2R5Y A;  2LTP A;  2JA5 J;  2O9L A;  2HDD A;  4DZJ A;  5EGO B;  3FKI J;  1X58 A;  2EZK A;  1QVT A;  1U78 A;  5EDN A;  1AKH B;  1H8A C;  3DCF A;  2KT0 A;  3GBG A;  4QTR A;  4IHV A;  3HKZ N;  2VKE A;  1ZR4 A;  2R5Z A;  1OFC X;  3ZQC A;  3F0C A;  1MSE C;  3S1Q J;  1H88 C;  2DA2 A;  2B63 J;  4FTH A;  4DZP A;  1E3O C;  1MBG A;  1JUM A;  5FLM J;  5EZG A;  1I3Q J;  3S15 J;  1I6H J;  3GTP J;  4CYC A;  2O8K A;  2XGE A;  1RR7 A;  2FD5 A;  2MSY A;  3HOU J;  3O8H A;  2ME6 A;  1HDP A;  1X2N A;  4V2G A;  1ZKG A;  2DMT A;  2JN6 A;  4UUT A;  5J1U A;  2NVX J;  9ANT A;  1FEX A;  2D5V A;  1VF9 A;  1O4X A;  2QF7 A;  1Y1V J;  3HGG A;  2G0E A;  5HOD A;  3JRI A;  1X2M A;  2EZI A;  1I50 J;  4DYC A;  2LP0 A;  2LVS A;  3Q0U A;  4I76 A;  3IH4 A;  5GPC A;  1CQT A;  2M8G X;  3A03 A;  2WB1 N;  4BY7 J;  2QCO A;  5IP6 A;  2DN0 A;  3LSR A;  1JT6 A;  5E3N A;  3CMY A;  1NTC A;  4RBO A;  1MBF A;  2VI6 A;  3GTQ J;  4AC0 A;  1YRN B;  5F1J A;  1ORK A;  3I4N J;  2M2E A;  2CRG A;  2H8R A;  4X1E A;  3S2D J;  2GLO A;  3M3Y J;  2MW8 A;  1RET A;  1JKP C;  3BG5 A;  1VND A;  1ZTR A;  3RZD J;  2L0K A;  2TCT A;  1ZGW A;  3D1N I;  1APL C;  2CQQ A;  1Z77 A;  4JX5 A;  3S1M J;  3S14 J;  2DMN A;  1YRN A;  1GDT A;  4XK4 A;  3JRH A;  3OSG A;  3LNQ A;  3BG9 A;  4IHW A;  3LOC A;  2R7Z J;  3M4O J;  4A3L J;  1TWG J;  4BBS J;  2TRT A;  3G1L A;  3PO2 J;  4M3B A;  2YUS A;  1OCP A;  1B72 B;  1VFC A;  3ZQL A;  1ETQ A;  4FE4 A;  1ZQ3 P;  1H89 C;  2K9Q A;  2DMQ A;  2X9D A;  2L7F P;  4IHX A;  4Y52 J;  4FCY A;  3BT9 A;  1AHD P;  3PM1 A;  1WH5 A;  1FIA A;  2DA4 A;  4QSH A;  1T33 A;  2XRL A;  2FX0 A;  4FIS A;  2RAE A;  3TW7 A;  2HXO A;  1ETW A;  2LD5 A;  2I10 A;  2XGD A;  1JUP A;  5M3F J;  4J19 A;  1T56 A;  2ECC A;  2K9S A;  4Y7N J;  4A3C J;  4RDU A;  3BR5 A;  3GTM J;  2JMW A;  3HB9 A;  4JX4 A;  1D5Y A;  2HOT A;  2P81 A;  3IH3 A;  4C3I J;  3H3V K;  4DYR A;  1PUF B;  2Y9Z A;  3GTJ J;  1JKO C;  2DJN A;  1R9T J;  1AKH A;  2ID3 A;  1NK2 P;  1MBK A;  3BQZ A;  1RES A;  3K7A J;  5FKK A;  1ETK A;  1TWH J;  5FKN A;  2XGC A;  3VPR A;  2HXI A;  3BR2 A;  1FTZ A;  4D5C A;  2H1K A;  1HDD C;  1VI0 A;  3MVP A;  2NOG A;  3FK7 A;  1B8I A;  1JTY A;  5IP9 J;  2DA3 A;  1IG7 A;  3HM5 A;  2LKX A;  2M0C A;  2WV1 A;  2Y2Z A;  1IDZ A;  1GT0 C;  4XRS A;  1IGN A;  3RKQ A;  3UKG A;  3WHC A;  2M34 A;  3RZO J;  5C44 J;  1B8I B;  3S1R J;  4MFD A;  2IEK A;  2JK3 A;  4A69 C;  1MNM C;  2YU9 J;  3DEW A;  5GPA A;  5JLW A;  2GM4 A;  2DA7 A;  4B1R A;  1BJZ A;  5EYR A;  4C2M J;  1MBH A;  3H0G J;  3K2A A;  2XPW A;  4I6Z A;  2FJ1 A;  2DTZ A;  1PUF A;  3S16 J;  1XC5 A;  4MO7 A;  3JRE A;  1GV2 A;  1IRZ A;  3ZOB A;  2R5Y B;  1JJ8 C;  5IYC J;  4CYC B;  2NVY J;  3JRB A;  3B6C A;  2CUE A;  2FQ4 A;  3BQY A;  4DYQ A;  2JA7 J;  3HOW J;  5GP9 A;  1B72 A;  1A5J A;  3HOX J;  1QVU A;  2OPT A;  2Y9Y A;  1UMQ A;  1XS9 A;  5FJ8 J;  2E2H J;  2R5Z B;  3LSG A;  5EG0 B;  1WGX A;  4A3G J;  1SAN A;  3QPL A;  1WCM J;  1SFO J;  4D7N A;  3W6V A;  3B6A A;  2Y0S N;  1Q1V A;  4C3H J;  2Y30 A;  1MBE A;  3NAR A;  1MH3 A;  3CDL A;  4D5F A;  3S2H J;  2E19 A;  5M5Y J;  2EQR A;  3BR6 A;  2M9H A;  2LR8 A;  3ZQI A;  5F27 A;  4A3F J;  3BG3 A;  2ELK A;  5J1Y A;  2K9N A;  4EEF G;  1BA5 A;  4A3M J;  3HDD A;  1QRY A;  3TED A;  4IEJ A;  4M3F A;  1F43 A;  1JUS A;  3S17 J;  3SDG A;  4X6A J;  2AHQ A;  3BR3 A;  4XID A;  1ZK8 A;  3A02 A;  1WH7 A;  1IDY A;  1IJW C;  1U9N A;  4B3A A;  5F08 A;  1ZR2 A;  4M3E A;  5M3M J;  2OF7 A;  2VUM J;  1K61 A;  5J3L A;  4XRM A;  5EGO A;  2ID6 A;  2ME0 A;  4DW6 A;  1MSF C;  1DU0 A;  4A93 J;  5F0C A;  2CJJ A;  1MBJ A;  1WI3 A;  2LY9 A;  1ETV A;  2GBY A;  1XG1 A;  2NVT J;  4L5E A;  2KDZ A;  2LLK A;  2XPV A;  3A01 A;  2HOS A;  3HOY J;  3QQA A;  3LSJ A;  3GTL J;  3IH2 A;  3BTI A;  5K7H A;  1LFU P;  5EZH A;  2Y31 A;  2HI3 A;  4M3D A;  4NDL A;  5EEA A;  4BY1 J;  3C2B A;  3JR9 A;  5C3E J;  2K40 A;  3JRA A;  5IPA A;  1OCT C;  4G12 A;  5IYD J;  3E7L A;  5IP7 J;  5F04 A;  3O8G A;  3LSP A;  4D7M A;  1TWA J;  5E3O A;  3BTC A;  1FIP A;  2NVQ J;  3CCY A;  4IHY A;  1Z0X A;  5DS9 A;  3HGY A;  4JP0 A;  1JKQ C;  2N8G A;  1RKT A;  4M3G A;  3PO3 J;  4C3J J;  4UUS A;  2E1O A;  3GTO J;  1POG A;  1ETX A;  5E3L A;  3GTK J;  3SJM A;  3BR0 A;  3QPS A;  4UUS B;  1LE8 A;  2XSD C;  1DU6 A;  4MFE A;  5K7Z A;  3ZQF A;  4JYK A;  5C4X J;  1P7J A;  1BL0 A;  4BBR J;  3BTL A;  2CU7 A;  5IOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...