2YS9A

Structure of the third homeodomain from the human homeobox and leucine zipper protein, homez
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
GSSGSSGPLPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox and leucine zipper protein Homez
publication title structure of the third Homeodomain from the human homeobox and leucine zipper protein, Homez
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11569 Homez Homeodomain leucine-zipper encoding, Homez
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ys9A00
1WH7A 2I10A 1H88C 4AYBN 2VUMJ 1BW6A 2GBYA 1ZK8A 3Q3SA 4V2GA 1WPKA 1U9NA 5FKLA 3JRFA 3G1OA 2N8GA 2P81A 3BQZA 2XGDA 5GPAA 1X58A 3GTQJ 3S2HJ 2Y0SN 2JA8J 4C3JJ 1IDYA 1JTYA 1JJ8C 1MBEA 3BR1A 5FJ8J 3GTOJ 5FKMA 2LKXA 4XK4A 1P7JA 2O9LA 5K7FA 4D5FA 1R9TJ 5F04A 3GTKJ 5C4XJ 3S1MJ 2DA7A 3Q0VA 3HDDA 4I76A 2X6OA 4RBOA 1XC5A 3TW7A 4GFBA 5HODA 2M8GX 2ID6A 5IP9J 5F08A 3JRCA 1HDDC 5IP7J 2XB0X 1MBHA 2L7FP 4A3GJ 2KT0A 1H8AC 5M5XJ 2LP0A 2GM4A 1MH3A 3QPLA 5C3EJ 3BR6A 5E3OA 5J3LA 5FLVA 3IH4A 1TWCJ 2NS7A 3ZQGA 1RESA 3HGYA 4CYCA 1FJLA 2LY9A 3O8GA 1SFOJ 1ZQ3P 4A3DJ 2ID3A 4DZJA 1O4XA 2CQXA 3BTLA 4MFEA 3QQAA 2DMUA 4C3HJ 2DA5A 2QF7A 1H89C 1MSEC 4UUTA 5EZHA 2JK3A 1TWHJ 3K2AA 1MBGA 1BA5A 3ZQHA 1TWAJ 3BQYA 3SJMA 3C2BA 3M4OJ 4XICA 3BR3A 4I6ZA 1GT0C 1WCMJ 2XB5A 2E2JJ 3LSJA 2RAEA 2LLKA 2DTZA 2XPUA 5DTDA 1FTZA 1RKTA 2XPVA 3TW6A 3JRHA 3HOYJ 4C2MJ 2ELKA 2DJNA 1ETXA 3SDGA 1FIAA 3HOXJ 3HOUJ 2CUFA 1RETA 4W1UA 3HEFA 4DYCA 4BXXJ 2EBIA 2CRGA 2X9DA 5F0CA 1X2NA 1UG2A 2CUEA 4MIMA 3WHBA 4A93J 3RZOJ 1JT6A 2TCTA 2DA6A 2NVTJ 2E19A 4B4CA 4FISA 2MSYA 1POGA 3GTJJ 2LVSA 1F43A 2M0CA 1SANA 1Y1WJ 1ETYA 3A01A 3I4NJ 5FKKA 3BR2A 2OF7A 4B1RA 3IH2A 4A3BJ 1OFCX 2JN6A 2CJJA 3A01B 3JRBA 2R5ZB 1RPWA 3IH3A 2VPRA 1JUMA 4RDUA 3RZDJ 1IG7A 1JJ6C 1W0TA 2R5YA 4A3FJ 1JGGA 1HF0A 2LD5A 2R5YB 3FK6A 2KDZA 2K9QA 4XRSA 5J1RA 3G1MA 3H0GJ 2FD5A 2Y30A 4FE4A 4V2FA 2H1KA 1P7IA 1LE8A 1I3QJ 2K9SA 3LSPA 1OJLA 3RKQA 1RR7A 4X1EA 1BJZA 5M5YJ 1ZGWA 3S17J 4A3LJ 1GDTA 2HXIA 5J1UA 4IEJA 1I50J 1ITYA 2Y9ZA 5GPCA 3PO3J 4IHWA 1IJWC 3W6VA 2HXOA 1JT0A 2YU9J 2FQ4A 5EF6A 2M9HA 2LFBA 2B63J 4M3BA 4JYKA 1GV5A 3HOZJ 2R7ZJ 5E3MA 3CMYA 5FKNA 2M34A 1FTTA 1JKOC 3GTPJ 4QTRA 1ZR2A 3LSRA 1VNDA 2DN0A 1VFCA 3DCFA 3NAUA 3BTJA 1JUSA 4G12A 1I6HJ 2XRLA 3HOVJ 5F27A 1F36A 3B6AA 1Z77A 4X6AJ 4S0HB 2WAQN 3O8HA 3ZQLA 4MO7A 1B8IA 1LFUP 1BW5A 2XGCA 4Y7NJ 3FKIJ 1B8IB 4DZPA 2DA3A 2YUSA 5EDNA 3MKLA 1NTCA 2E2HJ 1HOMA 1GV2A 2L0KA 2MG4A 3BT9A 1T56A 3I4MJ 3MVPA 4JX4A 3S1NJ 2NVYJ 2G0EA 4CYCB 3S14J 2AHQA 2ME6A 4A3MJ 1AHDP 5EYRA 2O8KA 1WH5A 3F0CA 2EZKA 3ZQFA 4MLOA 2LR8A 1ORKA 5EGOA 4XRSG 2DA4A 4B3AA 2OPTA 5C4JJ 1UHSA 2R0QC 1B72A 1HDPA 4BBSJ 5EGOB 2R93J 4DYQA 2IBDA 3B6CA 1QPIA 1B72B 3TP0A 1JKPC 2HYJA 2FJ1A 1VI0A 5FLMJ 2GLOA 1AKHA 5C44J 5IOYA 3L1PA 5E3LA 5K7ZA 4J19A 2DMQA 2QCOA 4ABZA 2D5VA 1WGXA 2VKVA 5K7HA 2O7OA 4AUXA 3BG9A 1X2MA 1ENHA 1CQTA 1JKQC 3SFIA 1GUUA 5IP6A 4EEFG 1NK3P 1HLVA 3S16J 1RKWA 2CU7A 4Y52J 2HOTA 3OSFA 2IEKA 4D7MA 3OOUA 1MBKA 2EQRA 1UMQA 2HOAA 5J1YA 3BR0A 1Y1VJ 1QRYA 3BG5A 1OCPA 3GTMJ 3K7AJ 4BY7J 3JRAA 3ZQCA 3WHCA 1ETWA 3ZQIA 4M3FA 2Y31A 3M3YJ 3NARA 2JA6J 3GBGA 1OCTC 2JWTA 3Q0UA 3HGGA 5EEAA 1G2HA 5DS9A 3Q0WA 4IHVA 1FEXA 1YRNA 4UUSA 4XIDA 4D5CA 4A3CJ 1ETQA 5EG0A 3CCYA 1MBFA 1ZR4A 1YRNB 3FK7A 3HM5A 4UUSB 5E3NA 4A3JJ 1TWFJ 5EG0B 1LE8B 1T33A 5IYDJ 3HOWJ 1IV6A 3FIWA 2HDDA 3UKGA 3RQIA 3JRDA 2JA5J 3G1LA 3BTIA 2X48A 3S1RJ 1LFBA 1VF9A 1ZKGA 1ETVA 3H3VK 1XG1A 3LSGA 4DYRA 2ME0A 5FKOA 4M3GA 5IYBJ 2E1OA 1ZTRA 4IHYA 1K61A 1U9OA 2XGEA 4LOCA 4A3IJ 2CQQA 2EZHA 4A3KJ 4BBRJ 5F1JA 1QVUA 1W0UA 2COBA 4C3IJ 4DW6A 5JLWA 2XPWA 2Y9YA 4QIWN 2DMPA 1IRZA 2DA1A 2FX0A 3HBLA 1NK2P 3LNQA 1U78A 2VI6A 4M3DA 1HCRA 2YS9A 4JX6A 5M3MJ 3TEDA 1U8BA 4NDLA 1IC8A 2W48A 4M6VA 1JUPA 2L7MP 4FCYA 4IHXA 2XSDC 1IGNA 2L9RA 2LK2A 2PMZN 3S1QJ 1TWGJ 1MBJA 2EZIA 2JJ7A 2ZB9A 2ECCA 2EH3A 3D1NI 3DEWA 1EF4A 3OSGA 4MFDA 2IAIA 3OIOA 4A3EJ 2EZLA 1S7EA 1Z0XA 2VKEA 2NVXJ 2JMWA 2JA7J 2DA2A 3PM1A 5F0FA 2M2EA 3QPSA 2TRTA 1JTXA 3BR5A 3TP3A 4W97A 5JLXA 1E3OC 3CDLA 1AU7A 2K9NA 1JKRC 1D5YA 3HB9A 5GP9A 1AKHB 5F0HA 4AC0A 3IV5A 1DU0A 2DMTA 2LTPA 2Y2ZA 3A03A 4JP0A 4D7NA 2HI3A 2MGQA 4BY1J 1DU6A 4FE7A 5IOZA 1A6IA 3S15J 2MW8A 1TC3C 2NS8A 4HNVA 2NVQJ 5M5WJ 3LOCA 4L5EA 2AO9A 1GVDA 5EZGA 2NOGA 4QSHA 1Q1VA 3JR9A 4FTHA 2E2IJ 1MNMC 1IUFA 3BG3A 1A5JA 1BL0A 1WI3A 2L7ZA 5M3FJ 4M3EA 2WB1N 1FIPA 2ECBA 3JREA 3HKZN 3MN2A 2H8RA 1K83J 5IPAA 3JRIA 2R5ZA 1ETKA 1MSFC 2HOSA 2HQ5A 3PO2J 3GTGJ 3BTCA 3ZOBA 1APLC 2R92J 3VPRA 5IYCJ 9ANTA 1XS9A 2K40A 2WV1A 3CQZJ 1ETOA 3S2DJ 4BKXA 4XRMA 4JX5A 3FISA 1PUFA 3E7LA 1PUFB 1MH4A 1IDZA 3A02A 3JRGA 2DMNA 1QVTA 5BNGA 3GTLJ 4A69C
chains in the Genus database with same CATH superfamily
1WH7A 4XLAA 4AYBN 5HDNA 4A6EA 1ZLKA 2VUMJ 1BW6A 4ZYHA 1R5GA 3RQ4A 3CO7C 1FWZA 1W7PB 2N8GA 4L18B 2XGDA 2XF5A 3K70C 3S2HJ 2Y0SN 4H0EA 4XSXF 2LNBA 1G3YA 4G94A 1KYWA 3U2RA 5D5XB 5FJ8J 3GTOJ 4OMZA 2O9LA 1FSEA 1R9TJ 5F04A 3G73A 3HPHA 3S1MJ 3LMMA 3K4MA 3Q0VA 3HDDA 3VEPA 4I76A 3GW2A 1YG2A 2DOFA 5ICCA 4RBOA 1XC5A 1MMGA 1USSA 2KJBA 3HXLA 3S3OA 4ESBA 1HDDC 3B73A 4OINF 1U5TC 5CVIA 2KFDA 2KIFA 3AAFA 4ASNA 2L2OA 1VQLI 1H8AC 5M5XJ 2GM4A 4BHCA 2ETHA 2ELJA 3BR6A 2FA5A 4B3XA 5J3LA 4F55A 1J2XA 3IH4A 2NS7A 2KZVA 1J75A 3HGYA 3S93A 4CYCA 3H9QA 5JI6A 3O8GA 3L2CA 1SFOJ 3ZR8X 2ID3A 2NNYA 1R5HA 4A0XA 3GXOA 3BTLA 3ZMVA 1T38A 3DV8A 1HKQA 1U0JA 4CGZA 2VQGA 3TL4X 3HSEA 2DA5A 1S7OA 2QF7A 5HS7A 5BQTA 1QO0D 2G7HA 2X0LA 1MBGA 3ZQHA 1K6OA 3BPXA 4KYWA 1IV8A 4N9HA 1USTA 2EK5A 2QLZA 3LFUA 1GT0C 2O5RA 2XB5A 2EFQA 3LSJA 4CYDA 3NEUA 3DFGA 2K3PA 4HW0A 2DTZA 2XPUA 2ZMEB 5LFAA 3EDPA 1FTZA 1RKTA 3IAS2 5CVJA 1TW2A 2FNAA 5LHIA 1ACIA 2V1XA 3JAMK 2HYGD 3KP4A 4M71A 3HOUJ 3ISPA 3K6GA 3U9GA 4BXXJ 4W1UA 3ZQQA 2IGNA 1BI2A 4IF4A 3LSHA 5B3SH 1XMXA 2X9DA 2FU4A 5F0CA 2CUEA 4MIMA 3CCLI 3WHBA 2ZXIA 3K70D 2MLKA 4XLCA 2TCTA 5TGTA 2DA6A 2DFIA 2NVTJ 4E7ZA 4HSRA 2E19A 1G8XA 1POGA 4BGDA 3VDXA 2CQ7A 2LVSA 4BL0B 1YW9A 4B48A 2VBYA 1XPXA 2DPDA 2M0CA 1SANA 2R7WA 2VXDA 1Y1WJ 1H0MA 1ETYA 1QPMA 2K5CA 1HW1A 3M8JA 5D5WB 1VQPI 4B1RA 2PX9A 3COAC 2I8DA 2OQRA 2CJJA 3JRBA 4ZYAA 1RPWA 5FD6A 3IH3A 4M6YA 4KUMA 4YIRX 1I3AA 1IG7A 4RGXA 3L2VA 3FF5A 1Y0UA 2KIQA 3ASNH 4OIRF 1WJBA 3O3KA 3ZGKA 2KHMA 1ZARA 2K9QA 2QKMB 3FXLA 3TO7A 5J1RA 1HC8A 2CO5A 1D5VA 2DDAA 3DBLB 2H1KA 1LE8A 2PJRA 5LHGA 1OJLA 3X2QH 2IGOA 5M5YJ 4OIQF 1IN4A 5K5OA 4ESFA 4ESJA 5F6FA 5GPCA 3PO3J 4B09A 4IHWA 1Y6IA 1IJWC 3K4CA 1IZ1A 1Z3YA 1OYYA 3LL7A 3KZIC 2LFBA 4M3BA 2KJCA 3OYFA 3HOZJ 1XGMA 2IPQX 1FTTA 2VJJA 3WGHA 3GTPJ 1ZR2A 3LSRA 3DEEA 2QQAA 2OD5A 4E7HA 1OISA 3BTJA 2B7EA 4EV0A 4G12A 4HV6A 2XRLA 3CJTB 3HOVJ 1F36A 3DTEA 1Y56A 4F52A 3W6JB 1Z77A 3IC7A 2QVOA 3E5XA 3I71A 4FASD 4CO8A 5ICGA 3O8HA 4G7ZF 3ZQLA 1Z6RA 4IVNA 4Y17A 1LPQA 5D5VB 2XGCA 2FEZA 1Z67A 5HOOA 1WQ2A 2IA0A 2GXBA 4DZPA 2UZKA 2DA3A 1QHHD 1WJFA 4FX0A 5KCMA 2HQRA 1IF1A 2Z2SB 4L0YB 1NTCA 5KVRA 4PGHA 3C2HA 4I01A 3BT9A 3L00A 3R6SA 3PJRA 1MJBA 4E70A 3JSPA 5TRDA 3S1NJ 1ZG3A 2NVYJ 2A6TA 1QU3A 4CYCB 1A04A 1BIBA 2DAOA 1XGOA 2O8KA 2P5KA 2E7XA 4U0VA 1WH5A 2UV1A 3GFIA 2PMUA 3ZQFA 4MLOA 2LY2A 1ORKA 1P4AA 4Y15A 5C4JJ 1X4OA 1MJ9A 1HDPA 3A4CA 3WG9A 2GIZA 2R93J 4DYQA 2IBDA 4MEXF 1B72B 2CG4A 2O0YA 4IOAF 3VB2A 4AU7A 3OWTA 2FJ1A 1KA8A 3SQNA 3OL4A 4N4NB 3KX2A 2QKLB 3DU6A 5A2QK 4N4OB 5BOXA 1UB9A 3EPZA 4J19A 3ABKH 2F5VA 1TTYA 2DMQA 3WTXC 2D5VA 1PP7U 1MDMA 3IRQA 5LLQA 4YFKF 2Q0OA 5AONA 2GZWA 3BG9A 2HVSA 1A31A 2KRFA 3OYNA 1KU7A 4L9TA 3TO6A 2PG4A 1CQTA 2STWA 1FMVA 2FUG2 1GUUA 5IP6A 3DPLC 5J4VA 1NK3P 3QRFF 1FP2A 2HQNA 3IP4B 3P7NA 2CU7A 2AS5F 2IEKA 1XX5A 1M1EB 1MBKA 4WXHA 1VZ0A 3MKYB 3I55I 2IGMA 4A5NA 3BR0A 1Y1VJ 2JSPA 3ESWB 4G8XA 1QRYA 1REPC 5L3FA 4OWRB 3GTMJ 4XL9A 3K7AJ 4BY7J 2EIJH 3GVAA 3IL2A 2Z9OA 3CUQA 4A0YA 1D8JA 4HRIA 4HDVA 3M3YJ 2AXLA 1NG7A 2JA2A 1B9NA 3GBGA 4S04A 2HQAA 2HGCA 4D1QA 3Q0UA 2QEXI 1G3SA 1QZYA 1I5ZA 3V4GA 3OL3A 2ZJRF 4IHVA 5HLHA 3MCZA 4YG2F 2QQ8A 1BR4A 5EEHA 4UUSA 3HHGA 4XIDA 2TDXA 3ZMUA 1ETQA 2P7VB 2FE3A 1MBFA 2QM3A 1V5EA 2QQBA 4NC6A 1VQ4I 3HM5A 5E3NA 4JQFA 5L3CA 3ERMA 3D5RC 1LE8B 2PJRB 4KICA 2FBKA 3HOWJ 4I09A 3NQOA 1TQIA 2HEOA 4CCOA 4LIUA 3GLXA 4I99C 3V42A 3S1RJ 3HG9A 4XMYA 1ETVA 4KFCA 3M9AA 1I39A 1XG1A 2P8TA 3S3MA 3VFZA 1K4TA 1TW3A 2CSOA 3WGGA 4NQWA 4M6XA 5F64A 3PFYA 4IRIA 2DQLA 4M3GA 5BMZA 5FFZA 3M07A 3CCSI 3HUGA 2UUZA 4UY8I 2XGEA 3D0SA 4LOCA 2CQQA 5FD5A 5J8FA 4MTDA 4A3KJ 3OV8A 5D8KB 4E7KA 3AG1H 1W0UA 4Y13A 4XSZF 1FMWA 3K4LA 5IT9Z 4I0BA 2DMPA 1IRZA 1ZYRF 1F9NA 3LSKA 2H1LA 1VQ8I 3PNVA 3FDYA 4FQGA 1U78A 2V1DA 1E3HA 4M3DA 3RKXA 2WB1A 4CHUA 1O7FA 3V8LA 3MKZA 3FMQA 3REOA 5CQEA 3ZMDA 4ETSA 4LB5A 4M6VA 4MHGA 2B9SA 4FCYA 1S6LA 1IGNA 1D1CA 1N75A 2PMZN 4CZZA 1TWGJ 2RKHA 1UG0A 1BC8C 1MBJA 2EZIA 3HTSB 3HPGA 1MNEA 4WCGA 3D1NI 1W4MA 3H9GA 1W1WE 5L3DA 1RUNA 3EQLF 3DEWA 2DXIA 2O6GE 1EF4A 3VSLA 2LBFA 1SVLA 4R79A 3CJRB 2IAIA 4A3EJ 2EZLA 1S7EA 2HVRA 2NVXJ 4I98B 5EEGA 2LKPA 1B6AA 2CUJA 3C3WA 3BP8A 3FXJA 3WTVC 4G7HF 5D6EA 3J81K 3LSIA 2F5EA 1E3PA 1T95A 3CDLA 1E3OC 4AYBA 3HB9A 3HC7A 1ZHFA 4OAZA 1WKMA 1DU0A 2Y2ZA 1KU2A 5B5EC 3CMMA 3FXOA 2OQGA 5AIPA 4Q47A 2HI3A 1DP3A 2Y0SA 5JR3A 3CCEI 4BY1J 6PAXA 3JTGA 1ZAOA 3VYTB 3CD6I 3S15J 5ILVA 1ZRFA 2WY8Q 4A6DA 4HNVA 3HSFA 2PBIA 3H5NA 4FETA 5FB2A 4BE0A 3BOQA 4PUSA 4KIBA 3DKYA 2ZXHA 1T0FC 2NOGA 3JR9A 4FTHA 3WTYC 1FC3A 2F5CA 1IUFA 1X1AA 3K1MA 1A5JA 1BL0A 3EUHA 1MIJA 5E1ZB 3A1YA 3LSMA 1TT5B 3R0JA 3CUQB 5M3FJ 2VBWA 2ECBA 2VB6A 5BPDA 4E7JA 2ZXWH 4I0AA 5JVTA 2BOLA 3H5AA 3RPQA 4R1HA 4N0BA 2VC0A 4S05A 1LB2A 3IHUA 2LG4A 2DK8A 2K9MA 1ETKA 2UWMA 3FXMA 4RGRA 2DYRH 2EB7A 4HX4A 3PO2J 3ZOBA 2MH2A 1R49A 4IKFA 1APLC 1WJCA 2R92J 4XNFA 1XS9A 3L9FA 1MW7A 3OR2C 1QHGA 2O03A 2HR3A 1EV7A 4GYGA 4XRMA 1SVMA 2LMDA 2M7BA 1BI0A 5D8LB 1R36A 4LJZF 4M9XA 2HNHA 1QGPA 3F8BA 4HYEA 4DBRA 1PJRA 3JRGA 2YX7A 1GXPA 5BNGA 2BV6A 1BN5A 2I10A 1H88C 2RVCA 2XROA 4NQWB 3SFZA 3FBIB 2CUZA 1V3FA 3BG6A 2CV0A 3ZMTA 1U9NA 4EM1A 3JRFA 3G1OA 4OIOF 4BH9A 2RQPA 3OS1A 2R3SA 3BQZA 3HUGB 2XKPA 2EWNA 5GPAA 2BVMA 3EYYA 3WTTC 4BNCA 3E6CC 1JJ8C 1EJ9A 1MBEA 1BOAA 3AG2H 4XK4A 4AIKA 3RDIA 1FBUA 2HPIA 4KISA 5C4XJ 1KYZA 3MMYB 3GTKJ 2ZJQF 4YIIA 4ZZDA 1TP4A 1A6QA 2NXNB 4LMYA 2HTSA 1GXQA 2JVGA 3TW7A 2NS0A 5F08A 1DQUA 2ACJA 3J80K 2JUCA 5IP7J 3HRMA 3CCMI 2KT0A 4XONA 4E7IA 3KP2A 4M9ZA 2LP0A 4GGGA 1X19A 4EJOA 4ON0A 3ZMSA 5C3EJ 1I1SA 3HSRA 5E3OA 4IL6C 3VSKA 3OYEA 1TWCJ 2IXSA 2EV5A 1R00A 1FJLA 4OMYA 3KEQA 4A3DJ 2R7XA 2R7OA 2XAQA 2W82A 3S8PA 3KP3A 4DZJA 3ZXSA 2H6BA 1XDUA 1MD0A 5KNLA 2DMUA 4EGZA 4ZDOA 4C3HJ 2GQQA 1KQ9A 3F72A 4UUTA 2OCEA 4LK1F 2JK3A 4BQNA 4U7BA 1TWHJ 4RB1A 5DM7F 4I7HA 1YLFA 1TWAJ 5E1XA 4BS9A 1BOBA 2M87A 4XICA 1ERDA 3BR3A 1MGTA 2LH9A 3F8FA 1U6GA 4I6ZA 2E2JJ 2ZMEA 3FWEA 2LLKA 4XKVA 5LRRA 4UHTA 5DTDA 2O8XA 4GRIA 3JRHA 3TW6A 3TKYA 3M8EA 3UNGC 1STZA 2HVQA 3TGNA 1FIAA 3HOXJ 3PNTA 3O2PE 3ULQB 2K4JA 5HNHA 3AG3H 3TMOA 2Z5UA 3LWFA 2X85A 2K9LA 1WI9A 5LGTA 1X2NA 1UG2A 4AM3A 4LG0A 3RZOJ 4A93J 4K2EA 3GF2A 1BI1A 4RAGA 2KISA 1N77A 4NC7A 3IKVA 3VWBA 5E17F 2DPUA 2JTVA 4NUBA 4F7ZA 2V6EA 3I59B 4HX8A 2X51A 3CDIA 4EVIA 2FMLA 3QOEA 1PDNC 1DPUA 5DEQA 1V55H 2IGKA 4A3BJ 1OFCX 2XUBA 3A01B 1W36C 1YQAA 3H9JA 2BE5F 1ONVA 3TO9A 4PK4A 3VYRB 3OY9A 1VQKI 1YS7A 4IZZA 1X1DA 1W0TA 2Z3YA 2IA2A 3V8KA 4M74A 3H36A 1W5SA 2GA1A 4CUGA 5H6QA 2R5YB 2KDZA 1OQYA 2XASA 2YU3A 5DUIA 2FD5A 4V2FA 1EKEA 4ENMA 2XAGA 1O3RA 1I3QJ 1OCRH 4YELA 3RKQA 2MD5A 1WVRA 2FRHA 2LREA 1BR2A 2XRNA 4XRFA 3PQJA 2D45A 1UCRA 1QQIA 5HNFA 5DUKA 3W6VA 3DPUA 4RAFA 4IOCF 3E3VA 2BBYA 3LA2A 5ICEA 3ELKA 3J7ZI 3OYCA 2L9NA 2GAUA 2CW7A 2M34A 1OCOH 1XSXA 1J9IA 4QWQA 1VNDA 2GWRA 1Y8RB 3I53A 1BR1A 4G6QA 1I6HJ 3I0TA 2KKOA 2WA0A 4CA0A 4A12A 3CLQA 2XAHA 4X6AJ 4S0HB 4L0ZB 3RJPA 5KK1A 1QNTA 2A6EF 4RGSA 4GCVA 4HBLA 5KHDA 2O61A 4MO7A 2OCCH 3WTSC 4PDKA 5IY5H 3BZCA 3OYBA 2W84A 2XF6A 4PJLA 1IRGA 2AQEA 1U2WA 2FSWA 1BC7C 1FYKA 1OR7A 2ESHA 2MD0A 2DDBA 2L7KA 2E2HJ 2CW8A 2MG4A 3H35A 2NNNA 1IXCA 1YJ9I 4FX4A 4UUVA 2G0EA 2COMA 3S14J 2ME6A 5E79C 1YITI 1W36D 5EYRA 1B1BA 3H5RA 3HYIA 3JAMZ 1XSDA 1FBQA 1YJWI 4XRSG 2DA4A 1UHSA 2R0QC 2ZBKA 2X6WA 1B72A 3CC4I 3WE2A 2OUMA 2YR2A 1EH8A 2M8EA 3HTUA 4BQQA 4LB6B 3B6CA 1QPIA 5L3GA 2PMHA 5D6FA 1JKPC 3R4KA 3ZMZA 3D5LA 2PQ8A 3RIRA 2ICWG 4UVBA 4PJMA 4AD9A 1EH7A 2HKXA 4YEJA 1K7AA 1KU9A 4MQVA 2QA4I 3M1CA 3ZP5A 1RR8C 2KDOA 5K7ZA 1S3JA 1WFXA 1TT0A 3NWTA 4BJTA 5GAEJ 4WK8F 1WGXA 3TQNA 4AUXA 3FXKA 4BUPA 1T39A 1S29A 2AXTC 4LG0B 5DDGA 2ADUA 2E7WA 4ZYEA 2H6CA 3S16J 1EH6A 5K1YA 2Q2EB 3WU1B 2Z99A 2F5FA 1GHCA 5DYMA 5E1WA 2EQRA 1PVEA 3FXRA 2VC1A 4Z2YA 2CFOA 2R7DA 3KP6A 3BG5A 4AVZA 3GWZA 1JI8A 3DF8A 3I3LA 2GXAA 4J00A 2PMZA 3ZQIA 3P9KA 1FNNA 4HQMA 3NARA 1YOVB 3M8FA 3QWLA 2JWTA 2EFWA 2ZJ2A 5H2FC 3W3CA 4HSTA 4TV7A 2M3AA 2H27A 2UXXA 1VQNI 3CTAA 4BAYA 1HKTA 3CCYA 1YRNB 3BZKA 4XOTA 2XSJC 4A3JJ 1QZZA 5EG0B 3KP5A 3KYDB 4Q5SF 1Z3XA 3CMEI 3FIWA 1K6YA 4KJZA 2HDDA 3JRDA 1LDJA 2R7SA 5GAHJ 2ISZA 5H20A 5BPIA 3I5UA 4OU0A 4BU2A 1LFBA 1Q1HA 1VF9A 3N05A 1ZKGA 1CF7A 1DGWY 1SMTA 4ZJZA 3H3VK 3ABTA 1LEAA 3LSGA 1LDDA 1P4XA 1LJ9A 1ON1A 5L3BA 4KIFA 1T6SA 1SEUA 3Q9VA 2ISYA 5HS9A 2VONA 1T08B 1U9OA 3ZCOA 3LA7A 4ZTJA 4GO1A 5LEKA 5ILSA 3CF2A 3ZQ7A 5F1JA 1QVUA 5CLSA 3ABMH 3JSOA 3N4MA 2XPWA 1FP1D 1LVKA 2DA1A 2LC2A 4ENJA 5K5QA 3QU6A 2FX0A 3GZ6A 1NK2P 3LNQA 2VI6A 1EA3A 1TQMA 3TEDA 5M3MJ 4XR6A 1SD5A 4DNCA 5FGMA 1U8BA 2BVLA 2X1DA 1AA7A 3I54A 2EA4A 1S7AA 1IC8A 4UXNA 2VQLA 2K7LA 5ILUA 1Y39A 1GVJA 3K4JA 3IKTA 3TOAA 4F92B 4KNYA 2L9RA 3CESA 1SAXA 4HF0A 1G59A 2JJ7A 2XAJA 2ECCA 2EH3A 2O3FA 5DD8A 3ZN1A 5A2QZ 4RB2C 3G6EI 3PSIA 1G4DA 1O7LA 3RPUD 3G71I 1R71A 4XORA 4ANJA 2JA7J 3PM1A 2L01A 4LLGF 3U21A 3MFKA 2OAZA 1YW7A 1JTXA 3K0LA 4RAZA 3BR5A 1WJ5A 3TP3A 1WJEA 5JLXA 1AU7A 1JKRC 4UB6C 3HRUA 1KQ8A 1Z05A 4RLQA 4AC0A 3MAJA 5F0HA 3MZYA 4IHTA 2DMTA 3A03A 3OR1C 4D7NA 3C2GA 3FZVA 3HOSA 2L02A 3E97A 2MGQA 3QPHA 3DKXA 5IOZA 1T2KA 2GIVA 3G2BA 2VPLA 1BIAA 1HSJA 1YX5A 3PQKA 2NVQJ 1SMYF 4L5EA 2E35A 4HA8A 1RNLA 2WAQA 1G3WA 4BDZA 1Z9CA 3F23A 2D1VA 2FBIA 2ZSHB 2E2IJ 2H94A 3DLAA 3BG3A 3BG7A 2LKSA 1R6RA 3U1KA 2MLGA 4CZCA 2BW3B 2DT7B 1S5LC 2F4MB 3F6VA 3FXUA 5CJ9A 4HF1A 4ITVA 3WTZA 2VT2A 4IPAA 2OTLI 5FO5A 1K83J 3TBIA 3DU5A 5IPAA 3H1CA 2R5ZA 2H8RA 2HOSA 4O3MA 2HQ5A 1HSTA 3BTCA 5J4YA 2MH9A 1DDNA 3VPRA 1FPQA 1ZRDA 2M1BA 3M7GA 3S3NA 1T98A 2L3DA 4CH7A 1K79A 2FMYA 3BY6A 1ETOA 3V7CA 4CDGA 3S2DJ 1XMKA 5GADJ 5DCMB 3GFLA 4BKXA 3W2AA 2V1UA 4JX5A 1KGSA 1RC9A 2DFFA 1JE8A 3HRTA 4KT5C 1J5YA 1Y8QB 2MABA 4LLNA 1WSUA 3FKJA 1LUJB 1F1ZA 3A02A 1CF7B 2HKOA 3GO5A 1YO5C 1R58A 3F6OA 3CCVI 1IN8A 1ZK8A 2GBYA 4O6JA 3ZRGA 4V2GA 1WPKA 4R8HA 2QGUA 1HXDA 5K5RA 3SXYA 2P81A 2FOWA 3CLOA 2NOJB 3GTQJ 1WJDA 3BJOA 4PJNA 2DOEA 2XF7A 1JTYA 3BR1A 2ZXJA 5FKMA 3T8TA 2LKXA 3DEUA 1X1CA 2P6TA 2VL8A 3QP6A 1P7JA 2IP2A 3N97A 2F2EA 3V8JA 1U5TA 4IO9F 4G6TB 2DA7A 3H0DA 4EJVA 2R7TA 2X6OA 3G3ZA 1NH3A 1R1VA 1ZELA 5D5UB 4GFBA 3DTIA 1P9QC 5HODA 2VN2A 3JRCA 2RV8A 1FBSA 1Y0NA 2ESNA 2M4KA 2XB0X 4P5OA 1MBHA 2L7FP 3J81Z 2ZJPF 3E0JB 4A3GJ 1P4WA 3PIPF 1SAUA 2M5WA 3QPLA 4KT6A 5HS8A 3AL0B 5FLVA 2IS2A 4KMUX 4QLCU 1R23A 2ZC2A 3ZQGA 2DODA 1K78B 1H9TA 3OYGA 2CGPA 1RESA 4XM3A 2LY9A 2NYXA 3GZNB 5LEJA 4PSXA 2DI3A 2CQXA 4HNTA 2KRCA 3MWMA 3QQAA 4MFEA 3LQRA 2DCEA 3K1PA 1DPRA 3IWFA 3FMRA 1H89C 1MSEC 2HZTA 3K2AA 4RMNA 3OIPA 1BA5A 3CP2A 2NRAC 3R61A 1KONA 1RI7A 1WCMJ 1XGSA 3FX3A 2JUGA 1WJAA 3DWLE 2LRDA 5D4RA 1TNSA 3V7RA 3L2QA 3J7AO 2DT6A 2BGCA 2ZO4A 3VODA 3EUKL 4L5JA 3V7SA 4PJJA 3HOYJ 1V54H 4C2MJ 1O57A 1VQOI 4IRHA 2XV4S 2YSRA 3K4BA 5LGNA 2JQ7A 2CRGA 2OZUA 3WTWC 4FHTA 4XKBA 4DJAA 1JHFA 1B4AA 3HRSA 2L9VA 3I59A 4B4CA 3GTJJ 2MSYA 3F8NA 5DCFA 5LD2C 3L7WA 2DLLA 3A01A 1D3YA 3PUFA 2W4SA 4KIGA 2WC2A 3SYTA 3ZN0A 1E2XA 2VJ4A 2ZCWA 2W57A 2JN6A 2R5ZB 4EGYA 2VPRA 1CGPA 2J5OA 3KLNA 3IRRA 1RIOH 3RTRA 3RZDJ 2ZNZA 2QQ9A 1VQ9I 2R5YA 2EA2A 3PNYA 3MEXA 2F5DA 3KP7A 1JGGA 3KETA 1B59A 3K69A 3FK6A 1TZLA 3G1MA 3H0GJ 4FE4A 4P9FA 1P7IA 4ENNA 1D0YA 2K9SA 4XN0A 3S32A 3LSPA 4KDPA 3SDBA 1ZGWA 4A3LJ 2ZFUA 1GDTA 5J1UA 2OBPA 1I50J 1ITYA 4EJWA 4RM3A 3MD2A 3ABUA 3GMEA 2HXOA 1JT0A 2YU9J 2FQ4A 4IX7A 5EF6A 3OYDA 5H6RA 4U0WA 2M9HA 3QYBA 2B63J 3G4SI 4JYKA 2WY7Q 3J80Z 2R7ZJ 5EJCA 2IS1A 3BJ6A 3LSTA 4E7SA 1L3LA 2DN0A 1VFCA 2IVMA 3DCFA 2DYSH 2EJRA 2JRTA 2RN7A 3C7JA 3NAUA 1JUSA 5F27A 4J01A 1MMSA 1U5TB 1X3WB 3B02A 4UV9A 3P9IA 3B6AA 3C18A 4D9JA 5B66C 1XSVA 2WAQN 3CC2I 1VQ6I 5ED4A 2E1NA 1TNTA 1BW5A 1WWXA 4Y7NJ 1ZGJA 2VJ5A 3FKIJ 4PFPA 1B8IB 2XAFA 3AFHA 4Q4ZF 1U8RA 5EDNA 3R60A 2DFEA 1V5FA 1VTNC 2IW5A 2RNJA 2ELHA 1UELB 1R7JA 3ONQA 2RQQA 1FZPB 3KZYA 5TJJA 3MVPA 5HLTA 5KAIC 3KEYA 3BDDA 3C1DA 2AHQA 4AWXB 4NHJA 4I2OA 3FHNA 1H9GA 5F1RA 2RGVA 3F0CA 3FBNB 1TL8A 4ZYDA 1OPCA 5J6XA 2K4BA 1PP8F 3BC8A 4OOIA 4XLFA 2PFBA 4B3AA 4XLNF 5CQGA 1XTAA 2KIMA 2Y75A 3SZGA 2DW4A 4B44A 5EGOB 1ULYA 2K27A 1SD6A 1PUEE 5AIQA 2PN6A 2HYJA 1VI0A 4NBQA 2W7NA 5FLMJ 3J7AY 2GLOA 1SVOA 4C2TA 3OYLA 5C44J 4HF2A 1IXRC 2F48A 4KN4X 2E5NA 1IRFA 4BJ6C 4RGUA 4AIJA 3I64A 1YHQI 2A61A 4G9YA 3F9KA 4HG2A 2CMPA 2P4WA 5IT3A 1FSHA 3TDUC 1ENHA 3VYSB 1F4KA 3OYIA 1IXSB 2P5VA 1JKQC 3HL2A 2Q2EA 3F21A 4HX7A 3FM5A 3K10A 4EEFG 1HLVA 4XLHA 1D0ZA 1RKWA 4IJAA 1S9HA 3OYMA 2VE9A 1VQMI 1YW8A 2HOTA 4D7MA 4KITB 1D0XA 1UMQA 2HOAA 3RKWA 3TOBA 4IRGA 3K1NA 3PSFA 1OCPA 3LFKA 4HEA2 1QBJA 3ZQCA 3WHCA 3SHFA 1ETWA 4M3FA 1WRJA 2MBFA 2V9VA 2Y31A 1MKMA 1S72I 2JA6J 1GLNA 2R7RA 1OCTC 2HZDA 3DXJF 3K4NA 3HGGA 2XAUA 5LHHA 1G2HA 3Q0WA 2M0MA 1NHAA 4NNJA 3J7YJ 2RC4A 1FEXA 1X1PA 1YRNA 5D4SA 4D5CA 2M45A 3CUQC 5EG0A 2HFHA 3FK7A 1R22A 4CICA 2IJLA 3E5UA 1T33A 3QYFA 3OYKA 5IYDJ 5GTHC 2LOOA 4L5IA 2KZGA 3E6MA 3UKGA 3RQIA 2JA5J 3G1LA 3BTIA 3U1DA 3PIOF 2X48A 2EILH 4I02A 4P55A 4X0GA 3E6BA 1PYVA 2CFXA 4E7LA 3NRVA 2BEOA 3WGIA 2D1HA 2ZFWA 5J40A 1J0RA 5FKOA 4XBFA 2L54A 2YPRA 5IYBJ 1IO2A 5B1BH 1QZEA 2E1OA 3CP8A 3BPVA 1RZ4A 1ZRCA 2STTA 1V4RA 3DQVC 1K61A 4MTEA 2F6CA 1UZCA 2Y48A 1FOKA 4BBRJ 1SC7A 2COBA 2HPMA 4BEHB 2X1EA 4DW6A 5JLWA 3E5QA 4WX9A 2VODA 3EYIA 4Y3OA 2HOEA 1HCRA 2CYYA 4JX6A 2NVUB 2JRMA 5J47A 1UJ8A 3CUOA 1SFXA 2KIUA 2QZ8A 5E8IA 4HQEA 4L9VA 5CKTA 1LKXA 1JUPA 2L7MP 4IHXA 2XSDC 4AVPA 4LK0F 3SEQA 3L2UA 2KLOA 3S1QJ 2Z33A 4II3A 1MJAA 2V9KA 3KZZA 4M73A 4RLFA 4PJ0C 1NG6A 3OYHA 3OSGA 2OTJI 2MA3A 3GZ5A 4XN3A 4MFDA 3OIOA 5JVGF 1Z0XA 3D5SC 2JMWA 2RDPA 3TDZC 5HLIA 4EATA 3GX4X 2DA2A 4AIDA 1UHWA 1IUYA 4CXFA 4XLPF 2M2EA 2FQ3A 3QPSA 3E1SA 2UXNA 4O5VA 3RCOA 2K3FA 3WG7H 2W1OA 4ZYGA 4W97A 1YYVA 3W2WA 2VXZA 2CV2A 2K9NA 2XIGA 3MZ8A 2E1CA 1D5YA 5GP9A 1R4NB 2LTPA 2P6SA 4F91B 1G3TA 4JP0A 1I6XA 2H09A 1OCZH 5L3EA 4BQAA 4JBAA 1T0FA 1DU6A 5FLXZ 3H3UA 2XVCA 4OIPF 3ECHA 1FOYA 1A6IA 3ASOH 2MW8A 2QSHX 2JZYA 1TC3C 2NS8A 2EIMH 3M1EA 2CV1A 1ZLJA 4L9NA 2VBXA 4YIFA 2IT0A 2HDWA 2E1MC 5M5WJ 3DLLF 4EQQA 1XCBA 1GVDA 1ZN2A 3AKZA 2HU9A 3H92A 1J7KA 5EZGA 2P0WA 4CCJA 2EFOA 3MQ0A 2CH0A 1TQPA 1YFHA 3H3ZA 2BW3A 1AOYA 3LA3A 2QSGX 3SZTA 5FLXK 3IUOA 1SD4A 2BZTA 4UNOA 1WI3A 3BCAA 2L7ZA 4M3EA 2IA1A 1IN6A 3KYCB 1FIPA 3WODF 3SEZA 3JREA 3HKZN 4RB3C 2X6YA 3MN2A 4LFUA 1XMAA 3GFJA 4DGWB 4GDFA 2E60A 3GEZA 3BLYA 3EUHC 3LAPA 3I58A 5IYCJ 9ANTA 5DCMA 2Z16A 1BBYA 2WV1A 3O6BB 4JOMA 1Z91A 1JXSA 1LFPA 1YJNI 2MC4A 2BHYA 2RREA 2OU2A 2WV0A 3Q5FA 3FXQA 4WXCA 2LF8A 2W24A 2KP6A 3DBRB 4PFOA 4EM0B 1IAWA 3CCQI 3ERED 3E7LA 4BHPA 3BJAA 1PUFB 5FRNA 2VKHA 1IDZA 4U7DA 4KA4A 2LF7A 2DMNA 2A05A 4ENKA 1QVTA 3GTLJ 2KPMA 4A69C 2MC3A 1YTYA 2FF4A 2J5PA 5CYVA 4Z6YA 5JFRA 3QU3A 3Q3SA 4U0YA 4L9JA 2M4GA 5FKLA 1LQ1A 2VLAA 3CO6C 1DGRM 2KRHA 4CCKA 5HLGA 2EIKH 3P5JA 1D1BA 1JHHA 1X58A 3K2ZA 2P7CB 4RAYA 4C3JJ 1IDYA 2JPCA 2JA8J 4KN7X 3Q9SA 4E6KG 1S8NA 3BZ6A 2CWEA 2CQKA 4D5FA 4YFXF 5K7FA 4MNUA 1FYMA 1D1AA 2WAFA 3FMSA 1MMNA 1SFEA 1MZBA 2HS5A 2M8GX 2ID6A 2DFHA 5IP9J 2WWYA 2JPBA 2OC6A 4HAMA 1FYLA 2DBBA 1OKRA 4C9YA 1MMDA 5JHUA 5LRSA 1K4SA 3QP5A 2WADA 1Z6TA 1MH3A 1K78A 3FHZA 2VIXA 1WZ2A 1AWCA 1D8KA 5ERIA 2FNPA 3HJEA 4P9UA 2X1CA 3OMYA 1ZQ3P 1Z7UA 3BROA 2LY1A 2ZNYA 1J59A 3HIFA 1O4XA 4ZH4F 3F3XA 3E6DA 5CVVA 5EZHA 3EETA 2DTRA 4II2A 2Y0MA 1P92A 3BQYA 4E4HA 3SJMA 4EMSA 1XN7A 3C2BA 2V1NA 3M4OJ 1MMAA 1OLTA 2BY3A 2F4IA 2EPFA 2A69F 1R1UA 2A3SA 2PJPA 2KQRA 2QYOA 3A0HC 1A35A 1KZHA 2XGXA 2RAEA 3I56I 2K86A 4C2UA 3DPTA 3CZ6A 4P96A 4Y4RA 1I27A 2XPVA 2Z1DA 1T8IA 3QYEA 1A36A 2ELKA 2KMUA 4QPQA 2DJNA 1ETXA 3SDGA 1YS6A 4FT8A 2CUFA 2ZMEC 3VOEA 1RETA 2FXAA 3HEFA 2FBHA 4DYCA 3IWZA 4BE1A 1YI2I 2EBIA 3ECOA 4IHSA 4BYYA 5E18F 4ZTFA 2X6XA 4A0ZA 2EFNA 3ML6A 3HHHA 2W25A 2A6HF 1JT6A 3KE2A 4DBQA 2CS3A 2M30A 4HV5A 1W7PD 1ZH5A 4FISA 3WU0A 3RYPA 3I9V2 1F43A 2QUFA 5E20A 3I4NJ 5FKKA 3BR2A 3W6KB 2OF7A 2EV6A 2VJIA 4GXOA 4ZC3A 3IH2A 3MKWB 1SFUA 1Z1DA 3PFIA 2QSFX 2VKDA 3KEOA 1BM9A 4YFNF 3FM3A 1JUMA 3BCBA 5KAFC 4RDUA 1JJ6C 5BS6A 1Z21A 4A3FJ 2A07F 3GCMA 1YE9A 2VASA 2VQCA 1HF0A 2E5ZA 2LD5A 2V9PA 2HWVA 4XRSA 4DOZA 1XB4A 2VT3A 2V26A 3IAM2 1XGNA 2Y30A 3CJNA 5LGUA 2E71A 4G6DA 2HYFA 4H4KC 1E17A 1RR7A 4X1EA 1BJZA 5HDKA 3S17J 2HXIA 1V5GA 4IEJA 1TLHB 2Y9ZA 1N78A 1L0OC 3OIQA 2LYCA 2RNGA 1FOWA 3CCJI 5B1AH 1ZGAA 1GV5A 2VOOA 5E3MA 4M9SA 3CCUI 3CMYA 5FKNA 1JKOC 4QTRA 1RRJA 2IS6A 1SFKA 5FFXA 4HDUA 1OYWA 4IQJA 2G9WA 1LDKB 4F3QA 3OYJA 2V6CA 1B8IA 1HW5A 1LFUP 1HW2A 1IN7A 1HA8A 2OA4A 1BJAA 4HOBA 4RS8A 2XHKA 4HNUA 1YIJI 4XKCA 2W00A 2EV0A 3DTKA 2E34A 4CCNA 4A5MA 2VE8A 2YUSA 3K4KA 1YIOA 4PCQA 5CVRA 5E8GA 2XKOA 1RUOA 3ZPLA 1R4MB 3MKLA 4XKWA 4CCLA 1HOMA 4MQ9F 5CPRB 3BWGA 1GV2A 4M72A 2BXZA 2L0KA 4PGGA 3GYHX 4LLLA 3A2KA 1T56A 3I4MJ 1J09A 1X3ZB 4JX4A 1KQ0A 1FX7A 2HTJA 2WBMA 3RSNA 5HDGA 2GOXB 5IT9K 2QWWA 4JK1X 4A3MJ 3CDHA 1AHDP 1U3EM 2DQRA 1IW7F 4GYIA 1OR7C 4C30A 2H8WA 4XQFA 5GTIC 2EZKA 4UV8A 2BXYA 2LR8A 2L4AA 4LITA 3DBHB 1TBXA 5EGOA 1X1BA 2OPTA 2WTEA 3QAHA 4BXUA 3KYLA 4BBSJ 2PEXA 3TP0A 2L4MA 3LAJA 3KIOA 1VQ7I 1VQ5I 2CW0F 4CSWA 3W2VA 1AKHA 2OZ6A 1ON2A 1DP7P 3JTHA 5IOYA 3L1PA 2R7UA 5E3LA 4BACA 2DO7A 4WF2A 5CVUA 2QCOA 4ABZA 3DKWA 2DK5A 1E0EA 2VKVA 3GFMA 5K7HA 2O7OA 1X2MA 1MDMB 2R7FA 3VYUB 5DV5A 4QPOA 3SFIA 4U87A 1G6NA 3KCCA 2P5LC 1I1GA 2XC7A 4B43A 4U88A 1W5CC 2MFZA 3RPUA 4Y52J 3OSFA 3OOUA 2BY1A 3CCRI 1YX3A 1KU3A 2I5UA 3EUAA 3KLOA 5J1YA 2DOAA 4PZJA 4EM2A 4ZDPA 4KMFA 5ICFA 3WU2C 2L9SA 3JRAA 3F8CA 4XLEA 5DM6F 1F5TA 2V79A 2G7UA 4UB8C 1R5ID 4YRVA 2QBYA 3DP7A 2M7AA 5EEAA 5DS9A 2R7VA 1ODDA 4G7OF 4MGRA 1XD7A 3NWSA 2JVHA 4B47A 1UHMA 2EINH 4A3CJ 4AIHA 1O3QA 1ZR4A 4UUSB 4DQ2A 1TWFJ 3KFWX 4EJTA 3K9TA 3GLLA 4BE2A 3I4PA 4EJUA 1MNDA 1IV6A 4IXAA 3T8RA 3PUBA 4NB5A 5GAGJ 2VQHA 4PSWA 3T1BA 1XCVA 1OMIA 2FOKA 2YX4A 1N25A 1X4PA 2E36A 4RM2A 3L09A 4DYRA 2BHZA 4BXFA 1P6RA 1P2FA 2ZSIB 4HLXA 2ME0A 3RKYA 1OCCH 1W7PA 1ZTRA 4IHYA 4A3IJ 2EZHA 4BEHA 4N9IA 3JCUC 5FRMA 2AQFA 1FT9A 2OV7A 3RYRA 4C3IJ 2Y9YA 2D2WA 2GA2A 4QIWN 2GOMA 1FOXA 3HBLA 1OYIA 3ABLH 1HKSA 2L5QA 3QOPA 3A0BC 2YS9A 3OYAA 1ZG5A 4ZDLA 3T0YA 2A5YB 3HKZA 4ZZLA 2ZKZA 1DUXC 1O3TA 3QODA 2K02A 4NDLA 2JSCA 4BDYA 3OOPA 2DJIA 2W48A 4UVAA 4XOPA 4CCMA 2LK2A 1IN5A 2C6YA 2EFPA 3CC7I 2CQNA 3HOTA 2ZB9A 2BY0A 3KPHA 2LDUA 1X3UA 4HPQA 4WXDA 4WWCA 2OJED 2X4HA 1WHUA 3GUDA 3ROUA 4OAYA 2VKEA 1IRXA 3WTUC 2LBFB 4IQ4A 2XDVA 2IS4A 3QPTA 5F0FA 4D0PA 2TRTA 2WAEA 1HQCA 3JW4A 3AL0C 3CF5F 3RI4A 3S2WA 1XDSA 4LGWA 4LD5A 1AKHB 1BI3A 3IV5A 1C0WA 2MYSA 3WE3A 1FY7A 5FROA 4A2UA 3CMAI 1SD7A 2VOPA 2E1MB 3OS0A 3PL8A 2V7FA 4FE7A 5DD4A 3CJQB 1LNWA 2Q8KA 4DIQA 5LBQA 4V19K 2Q1ZB 2KL4A 2BYVE 2K85A 4BQOA 3R0AA 2B0LA 3LOCA 1UFMA 2AO9A 1LVAA 5J8CA 2NAZA 2QENA 4RA2A 4QSHA 1Q1VA 2JT1A 4F93B 3UR3C 1MNMC 4MEYF 4NC8A 1O3SA 3SZPA 3L2RA 1W5TA 2DU9A 3AG4H 2R7QA 4LG3A 2A5WA 4Y33A 2R4GA 4Q48A 1B9MA 3LQQA 2WB1N 4BHBA 3OS2A 3L2WA 2PI0A 4HZFA 2VBZA 2Y69H 2W85A 2V4JC 4RB0A 2QBYB 4LIVA 2A68F 2PLYA 3JRIA 2F4OB 3P9CA 4UVCA 3HZJA 1MSFC 4P1WA 3MZHA 3GTGJ 3F22A 4B8XA 1ZREA 5TISC 2K40A 2HDCA 3CQZJ 1FLIA 1Z7LA 1LEBA 4BJ5C 3T5XA 2DT5A 3FISA 1JGSA 2GXGA 1PUFA 1R1TA 2IRFG 1UAAA 2LSOA 1QA6A 4HLYA 5HVQC 1MH4A 1ZG1A 5JHFA 2BY2A 3F8MA 1HBXG
chains in the Genus database with same CATH topology
1WH7A 2I10A 1H88C 4AYBN 2VUMJ 1BW6A 2GBYA 1ZK8A 3Q3SA 4V2GA 1WPKA 1U9NA 5FKLA 3JRFA 3G1OA 2N8GA 2P81A 3BQZA 2XGDA 5GPAA 1X58A 3GTQJ 3S2HJ 2Y0SN 2JA8J 4C3JJ 1IDYA 1JTYA 1JJ8C 1MBEA 3BR1A 5FJ8J 3GTOJ 5FKMA 2LKXA 4XK4A 1P7JA 2O9LA 5K7FA 4D5FA 1R9TJ 5F04A 3GTKJ 5C4XJ 3S1MJ 2DA7A 3Q0VA 3HDDA 4I76A 2X6OA 4RBOA 1XC5A 3TW7A 4GFBA 5HODA 2M8GX 2ID6A 5IP9J 5F08A 3JRCA 1HDDC 5IP7J 2XB0X 1MBHA 2L7FP 4A3GJ 2KT0A 1H8AC 5M5XJ 2LP0A 2GM4A 1MH3A 3QPLA 5C3EJ 3BR6A 5E3OA 5J3LA 5FLVA 3IH4A 1TWCJ 2NS7A 3ZQGA 1RESA 3HGYA 4CYCA 1FJLA 2LY9A 3O8GA 1SFOJ 1ZQ3P 4A3DJ 2ID3A 4DZJA 1O4XA 2CQXA 3BTLA 4MFEA 3QQAA 2DMUA 4C3HJ 2DA5A 2QF7A 1H89C 1MSEC 4UUTA 5EZHA 2JK3A 1TWHJ 3K2AA 1MBGA 1BA5A 3ZQHA 1TWAJ 3BQYA 3SJMA 3C2BA 3M4OJ 4XICA 3BR3A 4I6ZA 1GT0C 1WCMJ 2XB5A 2E2JJ 3LSJA 2RAEA 2LLKA 2DTZA 2XPUA 5DTDA 1FTZA 1RKTA 2XPVA 3TW6A 3JRHA 3HOYJ 4C2MJ 2ELKA 2DJNA 1ETXA 3SDGA 1FIAA 3HOXJ 3HOUJ 2CUFA 1RETA 4W1UA 3HEFA 4DYCA 4BXXJ 2EBIA 2CRGA 2X9DA 5F0CA 1X2NA 1UG2A 2CUEA 4MIMA 3WHBA 4A93J 3RZOJ 1JT6A 2TCTA 2DA6A 2NVTJ 2E19A 4B4CA 4FISA 2MSYA 1POGA 3GTJJ 2LVSA 1F43A 2M0CA 1SANA 1Y1WJ 1ETYA 3A01A 3I4NJ 5FKKA 3BR2A 2OF7A 4B1RA 3IH2A 4A3BJ 1OFCX 2JN6A 2CJJA 3A01B 3JRBA 2R5ZB 1RPWA 3IH3A 2VPRA 1JUMA 4RDUA 3RZDJ 1IG7A 1JJ6C 1W0TA 2R5YA 4A3FJ 1JGGA 1HF0A 2LD5A 2R5YB 3FK6A 2KDZA 2K9QA 4XRSA 5J1RA 3G1MA 3H0GJ 2FD5A 2Y30A 4FE4A 4V2FA 2H1KA 1P7IA 1LE8A 1I3QJ 2K9SA 3LSPA 1OJLA 3RKQA 1RR7A 4X1EA 1BJZA 5M5YJ 1ZGWA 3S17J 4A3LJ 1GDTA 2HXIA 5J1UA 4IEJA 1I50J 1ITYA 2Y9ZA 5GPCA 3PO3J 4IHWA 1IJWC 3W6VA 2HXOA 1JT0A 2YU9J 2FQ4A 5EF6A 2M9HA 2LFBA 2B63J 4M3BA 4JYKA 1GV5A 3HOZJ 2R7ZJ 5E3MA 3CMYA 5FKNA 2M34A 1FTTA 1JKOC 3GTPJ 4QTRA 1ZR2A 3LSRA 1VNDA 2DN0A 1VFCA 3DCFA 3NAUA 3BTJA 1JUSA 4G12A 1I6HJ 2XRLA 3HOVJ 5F27A 1F36A 3B6AA 1Z77A 4X6AJ 4S0HB 2WAQN 3O8HA 3ZQLA 4MO7A 1B8IA 1LFUP 1BW5A 2XGCA 4Y7NJ 3FKIJ 1B8IB 4DZPA 2DA3A 2YUSA 5EDNA 3MKLA 1NTCA 2E2HJ 1HOMA 1GV2A 2L0KA 2MG4A 3BT9A 1T56A 3I4MJ 3MVPA 4JX4A 3S1NJ 2NVYJ 2G0EA 4CYCB 3S14J 2AHQA 2ME6A 4A3MJ 1AHDP 5EYRA 2O8KA 1WH5A 3F0CA 2EZKA 3ZQFA 4MLOA 2LR8A 1ORKA 5EGOA 4XRSG 2DA4A 4B3AA 2OPTA 5C4JJ 1UHSA 2R0QC 1B72A 1HDPA 4BBSJ 5EGOB 2R93J 4DYQA 2IBDA 3B6CA 1QPIA 1B72B 3TP0A 1JKPC 2HYJA 2FJ1A 1VI0A 5FLMJ 2GLOA 1AKHA 5C44J 5IOYA 3L1PA 5E3LA 5K7ZA 4J19A 2DMQA 2QCOA 4ABZA 2D5VA 1WGXA 2VKVA 5K7HA 2O7OA 4AUXA 3BG9A 1X2MA 1ENHA 1CQTA 1JKQC 3SFIA 1GUUA 5IP6A 4EEFG 1NK3P 1HLVA 3S16J 1RKWA 2CU7A 4Y52J 2HOTA 3OSFA 2IEKA 4D7MA 3OOUA 1MBKA 2EQRA 1UMQA 2HOAA 5J1YA 3BR0A 1Y1VJ 1QRYA 3BG5A 1OCPA 3GTMJ 3K7AJ 4BY7J 3JRAA 3ZQCA 3WHCA 1ETWA 3ZQIA 4M3FA 2Y31A 3M3YJ 3NARA 2JA6J 3GBGA 1OCTC 2JWTA 3Q0UA 3HGGA 5EEAA 1G2HA 5DS9A 3Q0WA 4IHVA 1FEXA 1YRNA 4UUSA 4XIDA 4D5CA 4A3CJ 1ETQA 5EG0A 3CCYA 1MBFA 1ZR4A 1YRNB 3FK7A 3HM5A 4UUSB 5E3NA 4A3JJ 1TWFJ 5EG0B 1LE8B 1T33A 5IYDJ 3HOWJ 1IV6A 3FIWA 2HDDA 3UKGA 3RQIA 3JRDA 2JA5J 3G1LA 3BTIA 2X48A 3S1RJ 1LFBA 1VF9A 1ZKGA 1ETVA 3H3VK 1XG1A 3LSGA 4DYRA 2ME0A 5FKOA 4M3GA 5IYBJ 2E1OA 1ZTRA 4IHYA 1K61A 1U9OA 2XGEA 4LOCA 4A3IJ 2CQQA 2EZHA 4A3KJ 4BBRJ 5F1JA 1QVUA 1W0UA 2COBA 4C3IJ 4DW6A 5JLWA 2XPWA 2Y9YA 4QIWN 2DMPA 1IRZA 2DA1A 2FX0A 3HBLA 1NK2P 3LNQA 1U78A 2VI6A 4M3DA 1HCRA 2YS9A 4JX6A 5M3MJ 3TEDA 1U8BA 4NDLA 1IC8A 2W48A 4M6VA 1JUPA 2L7MP 4FCYA 4IHXA 2XSDC 1IGNA 2L9RA 2LK2A 2PMZN 3S1QJ 1TWGJ 1MBJA 2EZIA 2JJ7A 2ZB9A 2ECCA 2EH3A 3D1NI 3DEWA 1EF4A 3OSGA 4MFDA 2IAIA 3OIOA 4A3EJ 2EZLA 1S7EA 1Z0XA 2VKEA 2NVXJ 2JMWA 2JA7J 2DA2A 3PM1A 5F0FA 2M2EA 3QPSA 2TRTA 1JTXA 3BR5A 3TP3A 4W97A 5JLXA 1E3OC 3CDLA 1AU7A 2K9NA 1JKRC 1D5YA 3HB9A 5GP9A 1AKHB 5F0HA 4AC0A 3IV5A 1DU0A 2DMTA 2LTPA 2Y2ZA 3A03A 4JP0A 4D7NA 2HI3A 2MGQA 4BY1J 1DU6A 4FE7A 5IOZA 1A6IA 3S15J 2MW8A 1TC3C 2NS8A 4HNVA 2NVQJ 5M5WJ 3LOCA 4L5EA 2AO9A 1GVDA 5EZGA 2NOGA 4QSHA 1Q1VA 3JR9A 4FTHA 2E2IJ 1MNMC 1IUFA 3BG3A 1A5JA 1BL0A 1WI3A 2L7ZA 5M3FJ 4M3EA 2WB1N 1FIPA 2ECBA 3JREA 3HKZN 3MN2A 2H8RA 1K83J 5IPAA 3JRIA 2R5ZA 1ETKA 1MSFC 2HOSA 2HQ5A 3PO2J 3GTGJ 3BTCA 3ZOBA 1APLC 2R92J 3VPRA 5IYCJ 9ANTA 1XS9A 2K40A 2WV1A 3CQZJ 1ETOA 3S2DJ 4BKXA 4XRMA 4JX5A 3FISA 1PUFA 3E7LA 1PUFB 1MH4A 1IDZA 3A02A 3JRGA 2DMNA 1QVTA 5BNGA 3GTLJ 4A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH7 A;  2I10 A;  1H88 C;  4AYB N;  2VUM J;  1BW6 A;  2GBY A;  1ZK8 A;  3Q3S A;  4V2G A;  1WPK A;  1U9N A;  5FKL A;  3JRF A;  3G1O A;  2N8G A;  2P81 A;  3BQZ A;  2XGD A;  5GPA A;  1X58 A;  3GTQ J;  3S2H J;  2Y0S N;  2JA8 J;  4C3J J;  1IDY A;  1JTY A;  1JJ8 C;  1MBE A;  3BR1 A;  5FJ8 J;  3GTO J;  5FKM A;  2LKX A;  4XK4 A;  1P7J A;  2O9L A;  5K7F A;  4D5F A;  1R9T J;  5F04 A;  3GTK J;  5C4X J;  3S1M J;  2DA7 A;  3Q0V A;  3HDD A;  4I76 A;  2X6O A;  4RBO A;  1XC5 A;  3TW7 A;  4GFB A;  5HOD A;  2M8G X;  2ID6 A;  5IP9 J;  5F08 A;  3JRC A;  1HDD C;  5IP7 J;  2XB0 X;  1MBH A;  2L7F P;  4A3G J;  2KT0 A;  1H8A C;  5M5X J;  2LP0 A;  2GM4 A;  1MH3 A;  3QPL A;  5C3E J;  3BR6 A;  5E3O A;  5J3L A;  5FLV A;  3IH4 A;  1TWC J;  2NS7 A;  3ZQG A;  1RES A;  3HGY A;  4CYC A;  1FJL A;  2LY9 A;  3O8G A;  1SFO J;  1ZQ3 P;  4A3D J;  2ID3 A;  4DZJ A;  1O4X A;  2CQX A;  3BTL A;  4MFE A;  3QQA A;  2DMU A;  4C3H J;  2DA5 A;  2QF7 A;  1H89 C;  1MSE C;  4UUT A;  5EZH A;  2JK3 A;  1TWH J;  3K2A A;  1MBG A;  1BA5 A;  3ZQH A;  1TWA J;  3BQY A;  3SJM A;  3C2B A;  3M4O J;  4XIC A;  3BR3 A;  4I6Z A;  1GT0 C;  1WCM J;  2XB5 A;  2E2J J;  3LSJ A;  2RAE A;  2LLK A;  2DTZ A;  2XPU A;  5DTD A;  1FTZ A;  1RKT A;  2XPV A;  3TW6 A;  3JRH A;  3HOY J;  4C2M J;  2ELK A;  2DJN A;  1ETX A;  3SDG A;  1FIA A;  3HOX J;  3HOU J;  2CUF A;  1RET A;  4W1U A;  3HEF A;  4DYC A;  4BXX J;  2EBI A;  2CRG A;  2X9D A;  5F0C A;  1X2N A;  1UG2 A;  2CUE A;  4MIM A;  3WHB A;  4A93 J;  3RZO J;  1JT6 A;  2TCT A;  2DA6 A;  2NVT J;  2E19 A;  4B4C A;  4FIS A;  2MSY A;  1POG A;  3GTJ J;  2LVS A;  1F43 A;  2M0C A;  1SAN A;  1Y1W J;  1ETY A;  3A01 A;  3I4N J;  5FKK A;  3BR2 A;  2OF7 A;  4B1R A;  3IH2 A;  4A3B J;  1OFC X;  2JN6 A;  2CJJ A;  3A01 B;  3JRB A;  2R5Z B;  1RPW A;  3IH3 A;  2VPR A;  1JUM A;  4RDU A;  3RZD J;  1IG7 A;  1JJ6 C;  1W0T A;  2R5Y A;  4A3F J;  1JGG A;  1HF0 A;  2LD5 A;  2R5Y B;  3FK6 A;  2KDZ A;  2K9Q A;  4XRS A;  5J1R A;  3G1M A;  3H0G J;  2FD5 A;  2Y30 A;  4FE4 A;  4V2F A;  2H1K A;  1P7I A;  1LE8 A;  1I3Q J;  2K9S A;  3LSP A;  1OJL A;  3RKQ A;  1RR7 A;  4X1E A;  1BJZ A;  5M5Y J;  1ZGW A;  3S17 J;  4A3L J;  1GDT A;  2HXI A;  5J1U A;  4IEJ A;  1I50 J;  1ITY A;  2Y9Z A;  5GPC A;  3PO3 J;  4IHW A;  1IJW C;  3W6V A;  2HXO A;  1JT0 A;  2YU9 J;  2FQ4 A;  5EF6 A;  2M9H A;  2LFB A;  2B63 J;  4M3B A;  4JYK A;  1GV5 A;  3HOZ J;  2R7Z J;  5E3M A;  3CMY A;  5FKN A;  2M34 A;  1FTT A;  1JKO C;  3GTP J;  4QTR A;  1ZR2 A;  3LSR A;  1VND A;  2DN0 A;  1VFC A;  3DCF A;  3NAU A;  3BTJ A;  1JUS A;  4G12 A;  1I6H J;  2XRL A;  3HOV J;  5F27 A;  1F36 A;  3B6A A;  1Z77 A;  4X6A J;  4S0H B;  2WAQ N;  3O8H A;  3ZQL A;  4MO7 A;  1B8I A;  1LFU P;  1BW5 A;  2XGC A;  4Y7N J;  3FKI J;  1B8I B;  4DZP A;  2DA3 A;  2YUS A;  5EDN A;  3MKL A;  1NTC A;  2E2H J;  1HOM A;  1GV2 A;  2L0K A;  2MG4 A;  3BT9 A;  1T56 A;  3I4M J;  3MVP A;  4JX4 A;  3S1N J;  2NVY J;  2G0E A;  4CYC B;  3S14 J;  2AHQ A;  2ME6 A;  4A3M J;  1AHD P;  5EYR A;  2O8K A;  1WH5 A;  3F0C A;  2EZK A;  3ZQF A;  4MLO A;  2LR8 A;  1ORK A;  5EGO A;  4XRS G;  2DA4 A;  4B3A A;  2OPT A;  5C4J J;  1UHS A;  2R0Q C;  1B72 A;  1HDP A;  4BBS J;  5EGO B;  2R93 J;  4DYQ A;  2IBD A;  3B6C A;  1QPI A;  1B72 B;  3TP0 A;  1JKP C;  2HYJ A;  2FJ1 A;  1VI0 A;  5FLM J;  2GLO A;  1AKH A;  5C44 J;  5IOY A;  3L1P A;  5E3L A;  5K7Z A;  4J19 A;  2DMQ A;  2QCO A;  4ABZ A;  2D5V A;  1WGX A;  2VKV A;  5K7H A;  2O7O A;  4AUX A;  3BG9 A;  1X2M A;  1ENH A;  1CQT A;  1JKQ C;  3SFI A;  1GUU A;  5IP6 A;  4EEF G;  1NK3 P;  1HLV A;  3S16 J;  1RKW A;  2CU7 A;  4Y52 J;  2HOT A;  3OSF A;  2IEK A;  4D7M A;  3OOU A;  1MBK A;  2EQR A;  1UMQ A;  2HOA A;  5J1Y A;  3BR0 A;  1Y1V J;  1QRY A;  3BG5 A;  1OCP A;  3GTM J;  3K7A J;  4BY7 J;  3JRA A;  3ZQC A;  3WHC A;  1ETW A;  3ZQI A;  4M3F A;  2Y31 A;  3M3Y J;  3NAR A;  2JA6 J;  3GBG A;  1OCT C;  2JWT A;  3Q0U A;  3HGG A;  5EEA A;  1G2H A;  5DS9 A;  3Q0W A;  4IHV A;  1FEX A;  1YRN A;  4UUS A;  4XID A;  4D5C A;  4A3C J;  1ETQ A;  5EG0 A;  3CCY A;  1MBF A;  1ZR4 A;  1YRN B;  3FK7 A;  3HM5 A;  4UUS B;  5E3N A;  4A3J J;  1TWF J;  5EG0 B;  1LE8 B;  1T33 A;  5IYD J;  3HOW J;  1IV6 A;  3FIW A;  2HDD A;  3UKG A;  3RQI A;  3JRD A;  2JA5 J;  3G1L A;  3BTI A;  2X48 A;  3S1R J;  1LFB A;  1VF9 A;  1ZKG A;  1ETV A;  3H3V K;  1XG1 A;  3LSG A;  4DYR A;  2ME0 A;  5FKO A;  4M3G A;  5IYB J;  2E1O A;  1ZTR A;  4IHY A;  1K61 A;  1U9O A;  2XGE A;  4LOC A;  4A3I J;  2CQQ A;  2EZH A;  4A3K J;  4BBR J;  5F1J A;  1QVU A;  1W0U A;  2COB A;  4C3I J;  4DW6 A;  5JLW A;  2XPW A;  2Y9Y A;  4QIW N;  2DMP A;  1IRZ A;  2DA1 A;  2FX0 A;  3HBL A;  1NK2 P;  3LNQ A;  1U78 A;  2VI6 A;  4M3D A;  1HCR A;  2YS9 A;  4JX6 A;  5M3M J;  3TED A;  1U8B A;  4NDL A;  1IC8 A;  2W48 A;  4M6V A;  1JUP A;  2L7M P;  4FCY A;  4IHX A;  2XSD C;  1IGN A;  2L9R A;  2LK2 A;  2PMZ N;  3S1Q J;  1TWG J;  1MBJ A;  2EZI A;  2JJ7 A;  2ZB9 A;  2ECC A;  2EH3 A;  3D1N I;  3DEW A;  1EF4 A;  3OSG A;  4MFD A;  2IAI A;  3OIO A;  4A3E J;  2EZL A;  1S7E A;  1Z0X A;  2VKE A;  2NVX J;  2JMW A;  2JA7 J;  2DA2 A;  3PM1 A;  5F0F A;  2M2E A;  3QPS A;  2TRT A;  1JTX A;  3BR5 A;  3TP3 A;  4W97 A;  5JLX A;  1E3O C;  3CDL A;  1AU7 A;  2K9N A;  1JKR C;  1D5Y A;  3HB9 A;  5GP9 A;  1AKH B;  5F0H A;  4AC0 A;  3IV5 A;  1DU0 A;  2DMT A;  2LTP A;  2Y2Z A;  3A03 A;  4JP0 A;  4D7N A;  2HI3 A;  2MGQ A;  4BY1 J;  1DU6 A;  4FE7 A;  5IOZ A;  1A6I A;  3S15 J;  2MW8 A;  1TC3 C;  2NS8 A;  4HNV A;  2NVQ J;  5M5W J;  3LOC A;  4L5E A;  2AO9 A;  1GVD A;  5EZG A;  2NOG A;  4QSH A;  1Q1V A;  3JR9 A;  4FTH A;  2E2I J;  1MNM C;  1IUF A;  3BG3 A;  1A5J A;  1BL0 A;  1WI3 A;  2L7Z A;  5M3F J;  4M3E A;  2WB1 N;  1FIP A;  2ECB A;  3JRE A;  3HKZ N;  3MN2 A;  2H8R A;  1K83 J;  5IPA A;  3JRI A;  2R5Z A;  1ETK A;  1MSF C;  2HOS A;  2HQ5 A;  3PO2 J;  3GTG J;  3BTC A;  3ZOB A;  1APL C;  2R92 J;  3VPR A;  5IYC J;  9ANT A;  1XS9 A;  2K40 A;  2WV1 A;  3CQZ J;  1ETO A;  3S2D J;  4BKX A;  4XRM A;  4JX5 A;  3FIS A;  1PUF A;  3E7L A;  1PUF B;  1MH4 A;  1IDZ A;  3A02 A;  3JRG A;  2DMN A;  1QVT A;  5BNG A;  3GTL J;  4A69 C; 
#chains in the Genus database with same CATH topology
 1WH7 A;  4XLA A;  4AYB N;  5HDN A;  4A6E A;  1ZLK A;  2VUM J;  1BW6 A;  4ZYH A;  1R5G A;  3RQ4 A;  3CO7 C;  1FWZ A;  1W7P B;  2N8G A;  4L18 B;  2XGD A;  2XF5 A;  3K70 C;  3S2H J;  2Y0S N;  4H0E A;  4XSX F;  2LNB A;  1G3Y A;  4G94 A;  1KYW A;  3U2R A;  5D5X B;  5FJ8 J;  3GTO J;  4OMZ A;  2O9L A;  1FSE A;  1R9T J;  5F04 A;  3G73 A;  3HPH A;  3S1M J;  3LMM A;  3K4M A;  3Q0V A;  3HDD A;  3VEP A;  4I76 A;  3GW2 A;  1YG2 A;  2DOF A;  5ICC A;  4RBO A;  1XC5 A;  1MMG A;  1USS A;  2KJB A;  3HXL A;  3S3O A;  4ESB A;  1HDD C;  3B73 A;  4OIN F;  1U5T C;  5CVI A;  2KFD A;  2KIF A;  3AAF A;  4ASN A;  2L2O A;  1VQL I;  1H8A C;  5M5X J;  2GM4 A;  4BHC A;  2ETH A;  2ELJ A;  3BR6 A;  2FA5 A;  4B3X A;  5J3L A;  4F55 A;  1J2X A;  3IH4 A;  2NS7 A;  2KZV A;  1J75 A;  3HGY A;  3S93 A;  4CYC A;  3H9Q A;  5JI6 A;  3O8G A;  3L2C A;  1SFO J;  3ZR8 X;  2ID3 A;  2NNY A;  1R5H A;  4A0X A;  3GXO A;  3BTL A;  3ZMV A;  1T38 A;  3DV8 A;  1HKQ A;  1U0J A;  4CGZ A;  2VQG A;  3TL4 X;  3HSE A;  2DA5 A;  1S7O A;  2QF7 A;  5HS7 A;  5BQT A;  1QO0 D;  2G7H A;  2X0L A;  1MBG A;  3ZQH A;  1K6O A;  3BPX A;  4KYW A;  1IV8 A;  4N9H A;  1UST A;  2EK5 A;  2QLZ A;  3LFU A;  1GT0 C;  2O5R A;  2XB5 A;  2EFQ A;  3LSJ A;  4CYD A;  3NEU A;  3DFG A;  2K3P A;  4HW0 A;  2DTZ A;  2XPU A;  2ZME B;  5LFA A;  3EDP A;  1FTZ A;  1RKT A;  3IAS 2;  5CVJ A;  1TW2 A;  2FNA A;  5LHI A;  1ACI A;  2V1X A;  3JAM K;  2HYG D;  3KP4 A;  4M71 A;  3HOU J;  3ISP A;  3K6G A;  3U9G A;  4BXX J;  4W1U A;  3ZQQ A;  2IGN A;  1BI2 A;  4IF4 A;  3LSH A;  5B3S H;  1XMX A;  2X9D A;  2FU4 A;  5F0C A;  2CUE A;  4MIM A;  3CCL I;  3WHB A;  2ZXI A;  3K70 D;  2MLK A;  4XLC A;  2TCT A;  5TGT A;  2DA6 A;  2DFI A;  2NVT J;  4E7Z A;  4HSR A;  2E19 A;  1G8X A;  1POG A;  4BGD A;  3VDX A;  2CQ7 A;  2LVS A;  4BL0 B;  1YW9 A;  4B48 A;  2VBY A;  1XPX A;  2DPD A;  2M0C A;  1SAN A;  2R7W A;  2VXD A;  1Y1W J;  1H0M A;  1ETY A;  1QPM A;  2K5C A;  1HW1 A;  3M8J A;  5D5W B;  1VQP I;  4B1R A;  2PX9 A;  3COA C;  2I8D A;  2OQR A;  2CJJ A;  3JRB A;  4ZYA A;  1RPW A;  5FD6 A;  3IH3 A;  4M6Y A;  4KUM A;  4YIR X;  1I3A A;  1IG7 A;  4RGX A;  3L2V A;  3FF5 A;  1Y0U A;  2KIQ A;  3ASN H;  4OIR F;  1WJB A;  3O3K A;  3ZGK A;  2KHM A;  1ZAR A;  2K9Q A;  2QKM B;  3FXL A;  3TO7 A;  5J1R A;  1HC8 A;  2CO5 A;  1D5V A;  2DDA A;  3DBL B;  2H1K A;  1LE8 A;  2PJR A;  5LHG A;  1OJL A;  3X2Q H;  2IGO A;  5M5Y J;  4OIQ F;  1IN4 A;  5K5O A;  4ESF A;  4ESJ A;  5F6F A;  5GPC A;  3PO3 J;  4B09 A;  4IHW A;  1Y6I A;  1IJW C;  3K4C A;  1IZ1 A;  1Z3Y A;  1OYY A;  3LL7 A;  3KZI C;  2LFB A;  4M3B A;  2KJC A;  3OYF A;  3HOZ J;  1XGM A;  2IPQ X;  1FTT A;  2VJJ A;  3WGH A;  3GTP J;  1ZR2 A;  3LSR A;  3DEE A;  2QQA A;  2OD5 A;  4E7H A;  1OIS A;  3BTJ A;  2B7E A;  4EV0 A;  4G12 A;  4HV6 A;  2XRL A;  3CJT B;  3HOV J;  1F36 A;  3DTE A;  1Y56 A;  4F52 A;  3W6J B;  1Z77 A;  3IC7 A;  2QVO A;  3E5X A;  3I71 A;  4FAS D;  4CO8 A;  5ICG A;  3O8H A;  4G7Z F;  3ZQL A;  1Z6R A;  4IVN A;  4Y17 A;  1LPQ A;  5D5V B;  2XGC A;  2FEZ A;  1Z67 A;  5HOO A;  1WQ2 A;  2IA0 A;  2GXB A;  4DZP A;  2UZK A;  2DA3 A;  1QHH D;  1WJF A;  4FX0 A;  5KCM A;  2HQR A;  1IF1 A;  2Z2S B;  4L0Y B;  1NTC A;  5KVR A;  4PGH A;  3C2H A;  4I01 A;  3BT9 A;  3L00 A;  3R6S A;  3PJR A;  1MJB A;  4E70 A;  3JSP A;  5TRD A;  3S1N J;  1ZG3 A;  2NVY J;  2A6T A;  1QU3 A;  4CYC B;  1A04 A;  1BIB A;  2DAO A;  1XGO A;  2O8K A;  2P5K A;  2E7X A;  4U0V A;  1WH5 A;  2UV1 A;  3GFI A;  2PMU A;  3ZQF A;  4MLO A;  2LY2 A;  1ORK A;  1P4A A;  4Y15 A;  5C4J J;  1X4O A;  1MJ9 A;  1HDP A;  3A4C A;  3WG9 A;  2GIZ A;  2R93 J;  4DYQ A;  2IBD A;  4MEX F;  1B72 B;  2CG4 A;  2O0Y A;  4IOA F;  3VB2 A;  4AU7 A;  3OWT A;  2FJ1 A;  1KA8 A;  3SQN A;  3OL4 A;  4N4N B;  3KX2 A;  2QKL B;  3DU6 A;  5A2Q K;  4N4O B;  5BOX A;  1UB9 A;  3EPZ A;  4J19 A;  3ABK H;  2F5V A;  1TTY A;  2DMQ A;  3WTX C;  2D5V A;  1PP7 U;  1MDM A;  3IRQ A;  5LLQ A;  4YFK F;  2Q0O A;  5AON A;  2GZW A;  3BG9 A;  2HVS A;  1A31 A;  2KRF A;  3OYN A;  1KU7 A;  4L9T A;  3TO6 A;  2PG4 A;  1CQT A;  2STW A;  1FMV A;  2FUG 2;  1GUU A;  5IP6 A;  3DPL C;  5J4V A;  1NK3 P;  3QRF F;  1FP2 A;  2HQN A;  3IP4 B;  3P7N A;  2CU7 A;  2AS5 F;  2IEK A;  1XX5 A;  1M1E B;  1MBK A;  4WXH A;  1VZ0 A;  3MKY B;  3I55 I;  2IGM A;  4A5N A;  3BR0 A;  1Y1V J;  2JSP A;  3ESW B;  4G8X A;  1QRY A;  1REP C;  5L3F A;  4OWR B;  3GTM J;  4XL9 A;  3K7A J;  4BY7 J;  2EIJ H;  3GVA A;  3IL2 A;  2Z9O A;  3CUQ A;  4A0Y A;  1D8J A;  4HRI A;  4HDV A;  3M3Y J;  2AXL A;  1NG7 A;  2JA2 A;  1B9N A;  3GBG A;  4S04 A;  2HQA A;  2HGC A;  4D1Q A;  3Q0U A;  2QEX I;  1G3S A;  1QZY A;  1I5Z A;  3V4G A;  3OL3 A;  2ZJR F;  4IHV A;  5HLH A;  3MCZ A;  4YG2 F;  2QQ8 A;  1BR4 A;  5EEH A;  4UUS A;  3HHG A;  4XID A;  2TDX A;  3ZMU A;  1ETQ A;  2P7V B;  2FE3 A;  1MBF A;  2QM3 A;  1V5E A;  2QQB A;  4NC6 A;  1VQ4 I;  3HM5 A;  5E3N A;  4JQF A;  5L3C A;  3ERM A;  3D5R C;  1LE8 B;  2PJR B;  4KIC A;  2FBK A;  3HOW J;  4I09 A;  3NQO A;  1TQI A;  2HEO A;  4CCO A;  4LIU A;  3GLX A;  4I99 C;  3V42 A;  3S1R J;  3HG9 A;  4XMY A;  1ETV A;  4KFC A;  3M9A A;  1I39 A;  1XG1 A;  2P8T A;  3S3M A;  3VFZ A;  1K4T A;  1TW3 A;  2CSO A;  3WGG A;  4NQW A;  4M6X A;  5F64 A;  3PFY A;  4IRI A;  2DQL A;  4M3G A;  5BMZ A;  5FFZ A;  3M07 A;  3CCS I;  3HUG A;  2UUZ A;  4UY8 I;  2XGE A;  3D0S A;  4LOC A;  2CQQ A;  5FD5 A;  5J8F A;  4MTD A;  4A3K J;  3OV8 A;  5D8K B;  4E7K A;  3AG1 H;  1W0U A;  4Y13 A;  4XSZ F;  1FMW A;  3K4L A;  5IT9 Z;  4I0B A;  2DMP A;  1IRZ A;  1ZYR F;  1F9N A;  3LSK A;  2H1L A;  1VQ8 I;  3PNV A;  3FDY A;  4FQG A;  1U78 A;  2V1D A;  1E3H A;  4M3D A;  3RKX A;  2WB1 A;  4CHU A;  1O7F A;  3V8L A;  3MKZ A;  3FMQ A;  3REO A;  5CQE A;  3ZMD A;  4ETS A;  4LB5 A;  4M6V A;  4MHG A;  2B9S A;  4FCY A;  1S6L A;  1IGN A;  1D1C A;  1N75 A;  2PMZ N;  4CZZ A;  1TWG J;  2RKH A;  1UG0 A;  1BC8 C;  1MBJ A;  2EZI A;  3HTS B;  3HPG A;  1MNE A;  4WCG A;  3D1N I;  1W4M A;  3H9G A;  1W1W E;  5L3D A;  1RUN A;  3EQL F;  3DEW A;  2DXI A;  2O6G E;  1EF4 A;  3VSL A;  2LBF A;  1SVL A;  4R79 A;  3CJR B;  2IAI A;  4A3E J;  2EZL A;  1S7E A;  2HVR A;  2NVX J;  4I98 B;  5EEG A;  2LKP A;  1B6A A;  2CUJ A;  3C3W A;  3BP8 A;  3FXJ A;  3WTV C;  4G7H F;  5D6E A;  3J81 K;  3LSI A;  2F5E A;  1E3P A;  1T95 A;  3CDL A;  1E3O C;  4AYB A;  3HB9 A;  3HC7 A;  1ZHF A;  4OAZ A;  1WKM A;  1DU0 A;  2Y2Z A;  1KU2 A;  5B5E C;  3CMM A;  3FXO A;  2OQG A;  5AIP A;  4Q47 A;  2HI3 A;  1DP3 A;  2Y0S A;  5JR3 A;  3CCE I;  4BY1 J;  6PAX A;  3JTG A;  1ZAO A;  3VYT B;  3CD6 I;  3S15 J;  5ILV A;  1ZRF A;  2WY8 Q;  4A6D A;  4HNV A;  3HSF A;  2PBI A;  3H5N A;  4FET A;  5FB2 A;  4BE0 A;  3BOQ A;  4PUS A;  4KIB A;  3DKY A;  2ZXH A;  1T0F C;  2NOG A;  3JR9 A;  4FTH A;  3WTY C;  1FC3 A;  2F5C A;  1IUF A;  1X1A A;  3K1M A;  1A5J A;  1BL0 A;  3EUH A;  1MIJ A;  5E1Z B;  3A1Y A;  3LSM A;  1TT5 B;  3R0J A;  3CUQ B;  5M3F J;  2VBW A;  2ECB A;  2VB6 A;  5BPD A;  4E7J A;  2ZXW H;  4I0A A;  5JVT A;  2BOL A;  3H5A A;  3RPQ A;  4R1H A;  4N0B A;  2VC0 A;  4S05 A;  1LB2 A;  3IHU A;  2LG4 A;  2DK8 A;  2K9M A;  1ETK A;  2UWM A;  3FXM A;  4RGR A;  2DYR H;  2EB7 A;  4HX4 A;  3PO2 J;  3ZOB A;  2MH2 A;  1R49 A;  4IKF A;  1APL C;  1WJC A;  2R92 J;  4XNF A;  1XS9 A;  3L9F A;  1MW7 A;  3OR2 C;  1QHG A;  2O03 A;  2HR3 A;  1EV7 A;  4GYG A;  4XRM A;  1SVM A;  2LMD A;  2M7B A;  1BI0 A;  5D8L B;  1R36 A;  4LJZ F;  4M9X A;  2HNH A;  1QGP A;  3F8B A;  4HYE A;  4DBR A;  1PJR A;  3JRG A;  2YX7 A;  1GXP A;  5BNG A;  2BV6 A;  1BN5 A;  2I10 A;  1H88 C;  2RVC A;  2XRO A;  4NQW B;  3SFZ A;  3FBI B;  2CUZ A;  1V3F A;  3BG6 A;  2CV0 A;  3ZMT A;  1U9N A;  4EM1 A;  3JRF A;  3G1O A;  4OIO F;  4BH9 A;  2RQP A;  3OS1 A;  2R3S A;  3BQZ A;  3HUG B;  2XKP A;  2EWN A;  5GPA A;  2BVM A;  3EYY A;  3WTT C;  4BNC A;  3E6C C;  1JJ8 C;  1EJ9 A;  1MBE A;  1BOA A;  3AG2 H;  4XK4 A;  4AIK A;  3RDI A;  1FBU A;  2HPI A;  4KIS A;  5C4X J;  1KYZ A;  3MMY B;  3GTK J;  2ZJQ F;  4YII A;  4ZZD A;  1TP4 A;  1A6Q A;  2NXN B;  4LMY A;  2HTS A;  1GXQ A;  2JVG A;  3TW7 A;  2NS0 A;  5F08 A;  1DQU A;  2ACJ A;  3J80 K;  2JUC A;  5IP7 J;  3HRM A;  3CCM I;  2KT0 A;  4XON A;  4E7I A;  3KP2 A;  4M9Z A;  2LP0 A;  4GGG A;  1X19 A;  4EJO A;  4ON0 A;  3ZMS A;  5C3E J;  1I1S A;  3HSR A;  5E3O A;  4IL6 C;  3VSK A;  3OYE A;  1TWC J;  2IXS A;  2EV5 A;  1R00 A;  1FJL A;  4OMY A;  3KEQ A;  4A3D J;  2R7X A;  2R7O A;  2XAQ A;  2W82 A;  3S8P A;  3KP3 A;  4DZJ A;  3ZXS A;  2H6B A;  1XDU A;  1MD0 A;  5KNL A;  2DMU A;  4EGZ A;  4ZDO A;  4C3H J;  2GQQ A;  1KQ9 A;  3F72 A;  4UUT A;  2OCE A;  4LK1 F;  2JK3 A;  4BQN A;  4U7B A;  1TWH J;  4RB1 A;  5DM7 F;  4I7H A;  1YLF A;  1TWA J;  5E1X A;  4BS9 A;  1BOB A;  2M87 A;  4XIC A;  1ERD A;  3BR3 A;  1MGT A;  2LH9 A;  3F8F A;  1U6G A;  4I6Z A;  2E2J J;  2ZME A;  3FWE A;  2LLK A;  4XKV A;  5LRR A;  4UHT A;  5DTD A;  2O8X A;  4GRI A;  3JRH A;  3TW6 A;  3TKY A;  3M8E A;  3UNG C;  1STZ A;  2HVQ A;  3TGN A;  1FIA A;  3HOX J;  3PNT A;  3O2P E;  3ULQ B;  2K4J A;  5HNH A;  3AG3 H;  3TMO A;  2Z5U A;  3LWF A;  2X85 A;  2K9L A;  1WI9 A;  5LGT A;  1X2N A;  1UG2 A;  4AM3 A;  4LG0 A;  3RZO J;  4A93 J;  4K2E A;  3GF2 A;  1BI1 A;  4RAG A;  2KIS A;  1N77 A;  4NC7 A;  3IKV A;  3VWB A;  5E17 F;  2DPU A;  2JTV A;  4NUB A;  4F7Z A;  2V6E A;  3I59 B;  4HX8 A;  2X51 A;  3CDI A;  4EVI A;  2FML A;  3QOE A;  1PDN C;  1DPU A;  5DEQ A;  1V55 H;  2IGK A;  4A3B J;  1OFC X;  2XUB A;  3A01 B;  1W36 C;  1YQA A;  3H9J A;  2BE5 F;  1ONV A;  3TO9 A;  4PK4 A;  3VYR B;  3OY9 A;  1VQK I;  1YS7 A;  4IZZ A;  1X1D A;  1W0T A;  2Z3Y A;  2IA2 A;  3V8K A;  4M74 A;  3H36 A;  1W5S A;  2GA1 A;  4CUG A;  5H6Q A;  2R5Y B;  2KDZ A;  1OQY A;  2XAS A;  2YU3 A;  5DUI A;  2FD5 A;  4V2F A;  1EKE A;  4ENM A;  2XAG A;  1O3R A;  1I3Q J;  1OCR H;  4YEL A;  3RKQ A;  2MD5 A;  1WVR A;  2FRH A;  2LRE A;  1BR2 A;  2XRN A;  4XRF A;  3PQJ A;  2D45 A;  1UCR A;  1QQI A;  5HNF A;  5DUK A;  3W6V A;  3DPU A;  4RAF A;  4IOC F;  3E3V A;  2BBY A;  3LA2 A;  5ICE A;  3ELK A;  3J7Z I;  3OYC A;  2L9N A;  2GAU A;  2CW7 A;  2M34 A;  1OCO H;  1XSX A;  1J9I A;  4QWQ A;  1VND A;  2GWR A;  1Y8R B;  3I53 A;  1BR1 A;  4G6Q A;  1I6H J;  3I0T A;  2KKO A;  2WA0 A;  4CA0 A;  4A12 A;  3CLQ A;  2XAH A;  4X6A J;  4S0H B;  4L0Z B;  3RJP A;  5KK1 A;  1QNT A;  2A6E F;  4RGS A;  4GCV A;  4HBL A;  5KHD A;  2O61 A;  4MO7 A;  2OCC H;  3WTS C;  4PDK A;  5IY5 H;  3BZC A;  3OYB A;  2W84 A;  2XF6 A;  4PJL A;  1IRG A;  2AQE A;  1U2W A;  2FSW A;  1BC7 C;  1FYK A;  1OR7 A;  2ESH A;  2MD0 A;  2DDB A;  2L7K A;  2E2H J;  2CW8 A;  2MG4 A;  3H35 A;  2NNN A;  1IXC A;  1YJ9 I;  4FX4 A;  4UUV A;  2G0E A;  2COM A;  3S14 J;  2ME6 A;  5E79 C;  1YIT I;  1W36 D;  5EYR A;  1B1B A;  3H5R A;  3HYI A;  3JAM Z;  1XSD A;  1FBQ A;  1YJW I;  4XRS G;  2DA4 A;  1UHS A;  2R0Q C;  2ZBK A;  2X6W A;  1B72 A;  3CC4 I;  3WE2 A;  2OUM A;  2YR2 A;  1EH8 A;  2M8E A;  3HTU A;  4BQQ A;  4LB6 B;  3B6C A;  1QPI A;  5L3G A;  2PMH A;  5D6F A;  1JKP C;  3R4K A;  3ZMZ A;  3D5L A;  2PQ8 A;  3RIR A;  2ICW G;  4UVB A;  4PJM A;  4AD9 A;  1EH7 A;  2HKX A;  4YEJ A;  1K7A A;  1KU9 A;  4MQV A;  2QA4 I;  3M1C A;  3ZP5 A;  1RR8 C;  2KDO A;  5K7Z A;  1S3J A;  1WFX A;  1TT0 A;  3NWT A;  4BJT A;  5GAE J;  4WK8 F;  1WGX A;  3TQN A;  4AUX A;  3FXK A;  4BUP A;  1T39 A;  1S29 A;  2AXT C;  4LG0 B;  5DDG A;  2ADU A;  2E7W A;  4ZYE A;  2H6C A;  3S16 J;  1EH6 A;  5K1Y A;  2Q2E B;  3WU1 B;  2Z99 A;  2F5F A;  1GHC A;  5DYM A;  5E1W A;  2EQR A;  1PVE A;  3FXR A;  2VC1 A;  4Z2Y A;  2CFO A;  2R7D A;  3KP6 A;  3BG5 A;  4AVZ A;  3GWZ A;  1JI8 A;  3DF8 A;  3I3L A;  2GXA A;  4J00 A;  2PMZ A;  3ZQI A;  3P9K A;  1FNN A;  4HQM A;  3NAR A;  1YOV B;  3M8F A;  3QWL A;  2JWT A;  2EFW A;  2ZJ2 A;  5H2F C;  3W3C A;  4HST A;  4TV7 A;  2M3A A;  2H27 A;  2UXX A;  1VQN I;  3CTA A;  4BAY A;  1HKT A;  3CCY A;  1YRN B;  3BZK A;  4XOT A;  2XSJ C;  4A3J J;  1QZZ A;  5EG0 B;  3KP5 A;  3KYD B;  4Q5S F;  1Z3X A;  3CME I;  3FIW A;  1K6Y A;  4KJZ A;  2HDD A;  3JRD A;  1LDJ A;  2R7S A;  5GAH J;  2ISZ A;  5H20 A;  5BPI A;  3I5U A;  4OU0 A;  4BU2 A;  1LFB A;  1Q1H A;  1VF9 A;  3N05 A;  1ZKG A;  1CF7 A;  1DGW Y;  1SMT A;  4ZJZ A;  3H3V K;  3ABT A;  1LEA A;  3LSG A;  1LDD A;  1P4X A;  1LJ9 A;  1ON1 A;  5L3B A;  4KIF A;  1T6S A;  1SEU A;  3Q9V A;  2ISY A;  5HS9 A;  2VON A;  1T08 B;  1U9O A;  3ZCO A;  3LA7 A;  4ZTJ A;  4GO1 A;  5LEK A;  5ILS A;  3CF2 A;  3ZQ7 A;  5F1J A;  1QVU A;  5CLS A;  3ABM H;  3JSO A;  3N4M A;  2XPW A;  1FP1 D;  1LVK A;  2DA1 A;  2LC2 A;  4ENJ A;  5K5Q A;  3QU6 A;  2FX0 A;  3GZ6 A;  1NK2 P;  3LNQ A;  2VI6 A;  1EA3 A;  1TQM A;  3TED A;  5M3M J;  4XR6 A;  1SD5 A;  4DNC A;  5FGM A;  1U8B A;  2BVL A;  2X1D A;  1AA7 A;  3I54 A;  2EA4 A;  1S7A A;  1IC8 A;  4UXN A;  2VQL A;  2K7L A;  5ILU A;  1Y39 A;  1GVJ A;  3K4J A;  3IKT A;  3TOA A;  4F92 B;  4KNY A;  2L9R A;  3CES A;  1SAX A;  4HF0 A;  1G59 A;  2JJ7 A;  2XAJ A;  2ECC A;  2EH3 A;  2O3F A;  5DD8 A;  3ZN1 A;  5A2Q Z;  4RB2 C;  3G6E I;  3PSI A;  1G4D A;  1O7L A;  3RPU D;  3G71 I;  1R71 A;  4XOR A;  4ANJ A;  2JA7 J;  3PM1 A;  2L01 A;  4LLG F;  3U21 A;  3MFK A;  2OAZ A;  1YW7 A;  1JTX A;  3K0L A;  4RAZ A;  3BR5 A;  1WJ5 A;  3TP3 A;  1WJE A;  5JLX A;  1AU7 A;  1JKR C;  4UB6 C;  3HRU A;  1KQ8 A;  1Z05 A;  4RLQ A;  4AC0 A;  3MAJ A;  5F0H A;  3MZY A;  4IHT A;  2DMT A;  3A03 A;  3OR1 C;  4D7N A;  3C2G A;  3FZV A;  3HOS A;  2L02 A;  3E97 A;  2MGQ A;  3QPH A;  3DKX A;  5IOZ A;  1T2K A;  2GIV A;  3G2B A;  2VPL A;  1BIA A;  1HSJ A;  1YX5 A;  3PQK A;  2NVQ J;  1SMY F;  4L5E A;  2E35 A;  4HA8 A;  1RNL A;  2WAQ A;  1G3W A;  4BDZ A;  1Z9C A;  3F23 A;  2D1V A;  2FBI A;  2ZSH B;  2E2I J;  2H94 A;  3DLA A;  3BG3 A;  3BG7 A;  2LKS A;  1R6R A;  3U1K A;  2MLG A;  4CZC A;  2BW3 B;  2DT7 B;  1S5L C;  2F4M B;  3F6V A;  3FXU A;  5CJ9 A;  4HF1 A;  4ITV A;  3WTZ A;  2VT2 A;  4IPA A;  2OTL I;  5FO5 A;  1K83 J;  3TBI A;  3DU5 A;  5IPA A;  3H1C A;  2R5Z A;  2H8R A;  2HOS A;  4O3M A;  2HQ5 A;  1HST A;  3BTC A;  5J4Y A;  2MH9 A;  1DDN A;  3VPR A;  1FPQ A;  1ZRD A;  2M1B A;  3M7G A;  3S3N A;  1T98 A;  2L3D A;  4CH7 A;  1K79 A;  2FMY A;  3BY6 A;  1ETO A;  3V7C A;  4CDG A;  3S2D J;  1XMK A;  5GAD J;  5DCM B;  3GFL A;  4BKX A;  3W2A A;  2V1U A;  4JX5 A;  1KGS A;  1RC9 A;  2DFF A;  1JE8 A;  3HRT A;  4KT5 C;  1J5Y A;  1Y8Q B;  2MAB A;  4LLN A;  1WSU A;  3FKJ A;  1LUJ B;  1F1Z A;  3A02 A;  1CF7 B;  2HKO A;  3GO5 A;  1YO5 C;  1R58 A;  3F6O A;  3CCV I;  1IN8 A;  1ZK8 A;  2GBY A;  4O6J A;  3ZRG A;  4V2G A;  1WPK A;  4R8H A;  2QGU A;  1HXD A;  5K5R A;  3SXY A;  2P81 A;  2FOW A;  3CLO A;  2NOJ B;  3GTQ J;  1WJD A;  3BJO A;  4PJN A;  2DOE A;  2XF7 A;  1JTY A;  3BR1 A;  2ZXJ A;  5FKM A;  3T8T A;  2LKX A;  3DEU A;  1X1C A;  2P6T A;  2VL8 A;  3QP6 A;  1P7J A;  2IP2 A;  3N97 A;  2F2E A;  3V8J A;  1U5T A;  4IO9 F;  4G6T B;  2DA7 A;  3H0D A;  4EJV A;  2R7T A;  2X6O A;  3G3Z A;  1NH3 A;  1R1V A;  1ZEL A;  5D5U B;  4GFB A;  3DTI A;  1P9Q C;  5HOD A;  2VN2 A;  3JRC A;  2RV8 A;  1FBS A;  1Y0N A;  2ESN A;  2M4K A;  2XB0 X;  4P5O A;  1MBH A;  2L7F P;  3J81 Z;  2ZJP F;  3E0J B;  4A3G J;  1P4W A;  3PIP F;  1SAU A;  2M5W A;  3QPL A;  4KT6 A;  5HS8 A;  3AL0 B;  5FLV A;  2IS2 A;  4KMU X;  4QLC U;  1R23 A;  2ZC2 A;  3ZQG A;  2DOD A;  1K78 B;  1H9T A;  3OYG A;  2CGP A;  1RES A;  4XM3 A;  2LY9 A;  2NYX A;  3GZN B;  5LEJ A;  4PSX A;  2DI3 A;  2CQX A;  4HNT A;  2KRC A;  3MWM A;  3QQA A;  4MFE A;  3LQR A;  2DCE A;  3K1P A;  1DPR A;  3IWF A;  3FMR A;  1H89 C;  1MSE C;  2HZT A;  3K2A A;  4RMN A;  3OIP A;  1BA5 A;  3CP2 A;  2NRA C;  3R61 A;  1KON A;  1RI7 A;  1WCM J;  1XGS A;  3FX3 A;  2JUG A;  1WJA A;  3DWL E;  2LRD A;  5D4R A;  1TNS A;  3V7R A;  3L2Q A;  3J7A O;  2DT6 A;  2BGC A;  2ZO4 A;  3VOD A;  3EUK L;  4L5J A;  3V7S A;  4PJJ A;  3HOY J;  1V54 H;  4C2M J;  1O57 A;  1VQO I;  4IRH A;  2XV4 S;  2YSR A;  3K4B A;  5LGN A;  2JQ7 A;  2CRG A;  2OZU A;  3WTW C;  4FHT A;  4XKB A;  4DJA A;  1JHF A;  1B4A A;  3HRS A;  2L9V A;  3I59 A;  4B4C A;  3GTJ J;  2MSY A;  3F8N A;  5DCF A;  5LD2 C;  3L7W A;  2DLL A;  3A01 A;  1D3Y A;  3PUF A;  2W4S A;  4KIG A;  2WC2 A;  3SYT A;  3ZN0 A;  1E2X A;  2VJ4 A;  2ZCW A;  2W57 A;  2JN6 A;  2R5Z B;  4EGY A;  2VPR A;  1CGP A;  2J5O A;  3KLN A;  3IRR A;  1RIO H;  3RTR A;  3RZD J;  2ZNZ A;  2QQ9 A;  1VQ9 I;  2R5Y A;  2EA2 A;  3PNY A;  3MEX A;  2F5D A;  3KP7 A;  1JGG A;  3KET A;  1B59 A;  3K69 A;  3FK6 A;  1TZL A;  3G1M A;  3H0G J;  4FE4 A;  4P9F A;  1P7I A;  4ENN A;  1D0Y A;  2K9S A;  4XN0 A;  3S32 A;  3LSP A;  4KDP A;  3SDB A;  1ZGW A;  4A3L J;  2ZFU A;  1GDT A;  5J1U A;  2OBP A;  1I50 J;  1ITY A;  4EJW A;  4RM3 A;  3MD2 A;  3ABU A;  3GME A;  2HXO A;  1JT0 A;  2YU9 J;  2FQ4 A;  4IX7 A;  5EF6 A;  3OYD A;  5H6R A;  4U0W A;  2M9H A;  3QYB A;  2B63 J;  3G4S I;  4JYK A;  2WY7 Q;  3J80 Z;  2R7Z J;  5EJC A;  2IS1 A;  3BJ6 A;  3LST A;  4E7S A;  1L3L A;  2DN0 A;  1VFC A;  2IVM A;  3DCF A;  2DYS H;  2EJR A;  2JRT A;  2RN7 A;  3C7J A;  3NAU A;  1JUS A;  5F27 A;  4J01 A;  1MMS A;  1U5T B;  1X3W B;  3B02 A;  4UV9 A;  3P9I A;  3B6A A;  3C18 A;  4D9J A;  5B66 C;  1XSV A;  2WAQ N;  3CC2 I;  1VQ6 I;  5ED4 A;  2E1N A;  1TNT A;  1BW5 A;  1WWX A;  4Y7N J;  1ZGJ A;  2VJ5 A;  3FKI J;  4PFP A;  1B8I B;  2XAF A;  3AFH A;  4Q4Z F;  1U8R A;  5EDN A;  3R60 A;  2DFE A;  1V5F A;  1VTN C;  2IW5 A;  2RNJ A;  2ELH A;  1UEL B;  1R7J A;  3ONQ A;  2RQQ A;  1FZP B;  3KZY A;  5TJJ A;  3MVP A;  5HLT A;  5KAI C;  3KEY A;  3BDD A;  3C1D A;  2AHQ A;  4AWX B;  4NHJ A;  4I2O A;  3FHN A;  1H9G A;  5F1R A;  2RGV A;  3F0C A;  3FBN B;  1TL8 A;  4ZYD A;  1OPC A;  5J6X A;  2K4B A;  1PP8 F;  3BC8 A;  4OOI A;  4XLF A;  2PFB A;  4B3A A;  4XLN F;  5CQG A;  1XTA A;  2KIM A;  2Y75 A;  3SZG A;  2DW4 A;  4B44 A;  5EGO B;  1ULY A;  2K27 A;  1SD6 A;  1PUE E;  5AIQ A;  2PN6 A;  2HYJ A;  1VI0 A;  4NBQ A;  2W7N A;  5FLM J;  3J7A Y;  2GLO A;  1SVO A;  4C2T A;  3OYL A;  5C44 J;  4HF2 A;  1IXR C;  2F48 A;  4KN4 X;  2E5N A;  1IRF A;  4BJ6 C;  4RGU A;  4AIJ A;  3I64 A;  1YHQ I;  2A61 A;  4G9Y A;  3F9K A;  4HG2 A;  2CMP A;  2P4W A;  5IT3 A;  1FSH A;  3TDU C;  1ENH A;  3VYS B;  1F4K A;  3OYI A;  1IXS B;  2P5V A;  1JKQ C;  3HL2 A;  2Q2E A;  3F21 A;  4HX7 A;  3FM5 A;  3K10 A;  4EEF G;  1HLV A;  4XLH A;  1D0Z A;  1RKW A;  4IJA A;  1S9H A;  3OYM A;  2VE9 A;  1VQM I;  1YW8 A;  2HOT A;  4D7M A;  4KIT B;  1D0X A;  1UMQ A;  2HOA A;  3RKW A;  3TOB A;  4IRG A;  3K1N A;  3PSF A;  1OCP A;  3LFK A;  4HEA 2;  1QBJ A;  3ZQC A;  3WHC A;  3SHF A;  1ETW A;  4M3F A;  1WRJ A;  2MBF A;  2V9V A;  2Y31 A;  1MKM A;  1S72 I;  2JA6 J;  1GLN A;  2R7R A;  1OCT C;  2HZD A;  3DXJ F;  3K4N A;  3HGG A;  2XAU A;  5LHH A;  1G2H A;  3Q0W A;  2M0M A;  1NHA A;  4NNJ A;  3J7Y J;  2RC4 A;  1FEX A;  1X1P A;  1YRN A;  5D4S A;  4D5C A;  2M45 A;  3CUQ C;  5EG0 A;  2HFH A;  3FK7 A;  1R22 A;  4CIC A;  2IJL A;  3E5U A;  1T33 A;  3QYF A;  3OYK A;  5IYD J;  5GTH C;  2LOO A;  4L5I A;  2KZG A;  3E6M A;  3UKG A;  3RQI A;  2JA5 J;  3G1L A;  3BTI A;  3U1D A;  3PIO F;  2X48 A;  2EIL H;  4I02 A;  4P55 A;  4X0G A;  3E6B A;  1PYV A;  2CFX A;  4E7L A;  3NRV A;  2BEO A;  3WGI A;  2D1H A;  2ZFW A;  5J40 A;  1J0R A;  5FKO A;  4XBF A;  2L54 A;  2YPR A;  5IYB J;  1IO2 A;  5B1B H;  1QZE A;  2E1O A;  3CP8 A;  3BPV A;  1RZ4 A;  1ZRC A;  2STT A;  1V4R A;  3DQV C;  1K61 A;  4MTE A;  2F6C A;  1UZC A;  2Y48 A;  1FOK A;  4BBR J;  1SC7 A;  2COB A;  2HPM A;  4BEH B;  2X1E A;  4DW6 A;  5JLW A;  3E5Q A;  4WX9 A;  2VOD A;  3EYI A;  4Y3O A;  2HOE A;  1HCR A;  2CYY A;  4JX6 A;  2NVU B;  2JRM A;  5J47 A;  1UJ8 A;  3CUO A;  1SFX A;  2KIU A;  2QZ8 A;  5E8I A;  4HQE A;  4L9V A;  5CKT A;  1LKX A;  1JUP A;  2L7M P;  4IHX A;  2XSD C;  4AVP A;  4LK0 F;  3SEQ A;  3L2U A;  2KLO A;  3S1Q J;  2Z33 A;  4II3 A;  1MJA A;  2V9K A;  3KZZ A;  4M73 A;  4RLF A;  4PJ0 C;  1NG6 A;  3OYH A;  3OSG A;  2OTJ I;  2MA3 A;  3GZ5 A;  4XN3 A;  4MFD A;  3OIO A;  5JVG F;  1Z0X A;  3D5S C;  2JMW A;  2RDP A;  3TDZ C;  5HLI A;  4EAT A;  3GX4 X;  2DA2 A;  4AID A;  1UHW A;  1IUY A;  4CXF A;  4XLP F;  2M2E A;  2FQ3 A;  3QPS A;  3E1S A;  2UXN A;  4O5V A;  3RCO A;  2K3F A;  3WG7 H;  2W1O A;  4ZYG A;  4W97 A;  1YYV A;  3W2W A;  2VXZ A;  2CV2 A;  2K9N A;  2XIG A;  3MZ8 A;  2E1C A;  1D5Y A;  5GP9 A;  1R4N B;  2LTP A;  2P6S A;  4F91 B;  1G3T A;  4JP0 A;  1I6X A;  2H09 A;  1OCZ H;  5L3E A;  4BQA A;  4JBA A;  1T0F A;  1DU6 A;  5FLX Z;  3H3U A;  2XVC A;  4OIP F;  3ECH A;  1FOY A;  1A6I A;  3ASO H;  2MW8 A;  2QSH X;  2JZY A;  1TC3 C;  2NS8 A;  2EIM H;  3M1E A;  2CV1 A;  1ZLJ A;  4L9N A;  2VBX A;  4YIF A;  2IT0 A;  2HDW A;  2E1M C;  5M5W J;  3DLL F;  4EQQ A;  1XCB A;  1GVD A;  1ZN2 A;  3AKZ A;  2HU9 A;  3H92 A;  1J7K A;  5EZG A;  2P0W A;  4CCJ A;  2EFO A;  3MQ0 A;  2CH0 A;  1TQP A;  1YFH A;  3H3Z A;  2BW3 A;  1AOY A;  3LA3 A;  2QSG X;  3SZT A;  5FLX K;  3IUO A;  1SD4 A;  2BZT A;  4UNO A;  1WI3 A;  3BCA A;  2L7Z A;  4M3E A;  2IA1 A;  1IN6 A;  3KYC B;  1FIP A;  3WOD F;  3SEZ A;  3JRE A;  3HKZ N;  4RB3 C;  2X6Y A;  3MN2 A;  4LFU A;  1XMA A;  3GFJ A;  4DGW B;  4GDF A;  2E60 A;  3GEZ A;  3BLY A;  3EUH C;  3LAP A;  3I58 A;  5IYC J;  9ANT A;  5DCM A;  2Z16 A;  1BBY A;  2WV1 A;  3O6B B;  4JOM A;  1Z91 A;  1JXS A;  1LFP A;  1YJN I;  2MC4 A;  2BHY A;  2RRE A;  2OU2 A;  2WV0 A;  3Q5F A;  3FXQ A;  4WXC A;  2LF8 A;  2W24 A;  2KP6 A;  3DBR B;  4PFO A;  4EM0 B;  1IAW A;  3CCQ I;  3ERE D;  3E7L A;  4BHP A;  3BJA A;  1PUF B;  5FRN A;  2VKH A;  1IDZ A;  4U7D A;  4KA4 A;  2LF7 A;  2DMN A;  2A05 A;  4ENK A;  1QVT A;  3GTL J;  2KPM A;  4A69 C;  2MC3 A;  1YTY A;  2FF4 A;  2J5P A;  5CYV A;  4Z6Y A;  5JFR A;  3QU3 A;  3Q3S A;  4U0Y A;  4L9J A;  2M4G A;  5FKL A;  1LQ1 A;  2VLA A;  3CO6 C;  1DGR M;  2KRH A;  4CCK A;  5HLG A;  2EIK H;  3P5J A;  1D1B A;  1JHH A;  1X58 A;  3K2Z A;  2P7C B;  4RAY A;  4C3J J;  1IDY A;  2JPC A;  2JA8 J;  4KN7 X;  3Q9S A;  4E6K G;  1S8N A;  3BZ6 A;  2CWE A;  2CQK A;  4D5F A;  4YFX F;  5K7F A;  4MNU A;  1FYM A;  1D1A A;  2WAF A;  3FMS A;  1MMN A;  1SFE A;  1MZB A;  2HS5 A;  2M8G X;  2ID6 A;  2DFH A;  5IP9 J;  2WWY A;  2JPB A;  2OC6 A;  4HAM A;  1FYL A;  2DBB A;  1OKR A;  4C9Y A;  1MMD A;  5JHU A;  5LRS A;  1K4S A;  3QP5 A;  2WAD A;  1Z6T A;  1MH3 A;  1K78 A;  3FHZ A;  2VIX A;  1WZ2 A;  1AWC A;  1D8K A;  5ERI A;  2FNP A;  3HJE A;  4P9U A;  2X1C A;  3OMY A;  1ZQ3 P;  1Z7U A;  3BRO A;  2LY1 A;  2ZNY A;  1J59 A;  3HIF A;  1O4X A;  4ZH4 F;  3F3X A;  3E6D A;  5CVV A;  5EZH A;  3EET A;  2DTR A;  4II2 A;  2Y0M A;  1P92 A;  3BQY A;  4E4H A;  3SJM A;  4EMS A;  1XN7 A;  3C2B A;  2V1N A;  3M4O J;  1MMA A;  1OLT A;  2BY3 A;  2F4I A;  2EPF A;  2A69 F;  1R1U A;  2A3S A;  2PJP A;  2KQR A;  2QYO A;  3A0H C;  1A35 A;  1KZH A;  2XGX A;  2RAE A;  3I56 I;  2K86 A;  4C2U A;  3DPT A;  3CZ6 A;  4P96 A;  4Y4R A;  1I27 A;  2XPV A;  2Z1D A;  1T8I A;  3QYE A;  1A36 A;  2ELK A;  2KMU A;  4QPQ A;  2DJN A;  1ETX A;  3SDG A;  1YS6 A;  4FT8 A;  2CUF A;  2ZME C;  3VOE A;  1RET A;  2FXA A;  3HEF A;  2FBH A;  4DYC A;  3IWZ A;  4BE1 A;  1YI2 I;  2EBI A;  3ECO A;  4IHS A;  4BYY A;  5E18 F;  4ZTF A;  2X6X A;  4A0Z A;  2EFN A;  3ML6 A;  3HHH A;  2W25 A;  2A6H F;  1JT6 A;  3KE2 A;  4DBQ A;  2CS3 A;  2M30 A;  4HV5 A;  1W7P D;  1ZH5 A;  4FIS A;  3WU0 A;  3RYP A;  3I9V 2;  1F43 A;  2QUF A;  5E20 A;  3I4N J;  5FKK A;  3BR2 A;  3W6K B;  2OF7 A;  2EV6 A;  2VJI A;  4GXO A;  4ZC3 A;  3IH2 A;  3MKW B;  1SFU A;  1Z1D A;  3PFI A;  2QSF X;  2VKD A;  3KEO A;  1BM9 A;  4YFN F;  3FM3 A;  1JUM A;  3BCB A;  5KAF C;  4RDU A;  1JJ6 C;  5BS6 A;  1Z21 A;  4A3F J;  2A07 F;  3GCM A;  1YE9 A;  2VAS A;  2VQC A;  1HF0 A;  2E5Z A;  2LD5 A;  2V9P A;  2HWV A;  4XRS A;  4DOZ A;  1XB4 A;  2VT3 A;  2V26 A;  3IAM 2;  1XGN A;  2Y30 A;  3CJN A;  5LGU A;  2E71 A;  4G6D A;  2HYF A;  4H4K C;  1E17 A;  1RR7 A;  4X1E A;  1BJZ A;  5HDK A;  3S17 J;  2HXI A;  1V5G A;  4IEJ A;  1TLH B;  2Y9Z A;  1N78 A;  1L0O C;  3OIQ A;  2LYC A;  2RNG A;  1FOW A;  3CCJ I;  5B1A H;  1ZGA A;  1GV5 A;  2VOO A;  5E3M A;  4M9S A;  3CCU I;  3CMY A;  5FKN A;  1JKO C;  4QTR A;  1RRJ A;  2IS6 A;  1SFK A;  5FFX A;  4HDU A;  1OYW A;  4IQJ A;  2G9W A;  1LDK B;  4F3Q A;  3OYJ A;  2V6C A;  1B8I A;  1HW5 A;  1LFU P;  1HW2 A;  1IN7 A;  1HA8 A;  2OA4 A;  1BJA A;  4HOB A;  4RS8 A;  2XHK A;  4HNU A;  1YIJ I;  4XKC A;  2W00 A;  2EV0 A;  3DTK A;  2E34 A;  4CCN A;  4A5M A;  2VE8 A;  2YUS A;  3K4K A;  1YIO A;  4PCQ A;  5CVR A;  5E8G A;  2XKO A;  1RUO A;  3ZPL A;  1R4M B;  3MKL A;  4XKW A;  4CCL A;  1HOM A;  4MQ9 F;  5CPR B;  3BWG A;  1GV2 A;  4M72 A;  2BXZ A;  2L0K A;  4PGG A;  3GYH X;  4LLL A;  3A2K A;  1T56 A;  3I4M J;  1J09 A;  1X3Z B;  4JX4 A;  1KQ0 A;  1FX7 A;  2HTJ A;  2WBM A;  3RSN A;  5HDG A;  2GOX B;  5IT9 K;  2QWW A;  4JK1 X;  4A3M J;  3CDH A;  1AHD P;  1U3E M;  2DQR A;  1IW7 F;  4GYI A;  1OR7 C;  4C30 A;  2H8W A;  4XQF A;  5GTI C;  2EZK A;  4UV8 A;  2BXY A;  2LR8 A;  2L4A A;  4LIT A;  3DBH B;  1TBX A;  5EGO A;  1X1B A;  2OPT A;  2WTE A;  3QAH A;  4BXU A;  3KYL A;  4BBS J;  2PEX A;  3TP0 A;  2L4M A;  3LAJ A;  3KIO A;  1VQ7 I;  1VQ5 I;  2CW0 F;  4CSW A;  3W2V A;  1AKH A;  2OZ6 A;  1ON2 A;  1DP7 P;  3JTH A;  5IOY A;  3L1P A;  2R7U A;  5E3L A;  4BAC A;  2DO7 A;  4WF2 A;  5CVU A;  2QCO A;  4ABZ A;  3DKW A;  2DK5 A;  1E0E A;  2VKV A;  3GFM A;  5K7H A;  2O7O A;  1X2M A;  1MDM B;  2R7F A;  3VYU B;  5DV5 A;  4QPO A;  3SFI A;  4U87 A;  1G6N A;  3KCC A;  2P5L C;  1I1G A;  2XC7 A;  4B43 A;  4U88 A;  1W5C C;  2MFZ A;  3RPU A;  4Y52 J;  3OSF A;  3OOU A;  2BY1 A;  3CCR I;  1YX3 A;  1KU3 A;  2I5U A;  3EUA A;  3KLO A;  5J1Y A;  2DOA A;  4PZJ A;  4EM2 A;  4ZDP A;  4KMF A;  5ICF A;  3WU2 C;  2L9S A;  3JRA A;  3F8C A;  4XLE A;  5DM6 F;  1F5T A;  2V79 A;  2G7U A;  4UB8 C;  1R5I D;  4YRV A;  2QBY A;  3DP7 A;  2M7A A;  5EEA A;  5DS9 A;  2R7V A;  1ODD A;  4G7O F;  4MGR A;  1XD7 A;  3NWS A;  2JVH A;  4B47 A;  1UHM A;  2EIN H;  4A3C J;  4AIH A;  1O3Q A;  1ZR4 A;  4UUS B;  4DQ2 A;  1TWF J;  3KFW X;  4EJT A;  3K9T A;  3GLL A;  4BE2 A;  3I4P A;  4EJU A;  1MND A;  1IV6 A;  4IXA A;  3T8R A;  3PUB A;  4NB5 A;  5GAG J;  2VQH A;  4PSW A;  3T1B A;  1XCV A;  1OMI A;  2FOK A;  2YX4 A;  1N25 A;  1X4P A;  2E36 A;  4RM2 A;  3L09 A;  4DYR A;  2BHZ A;  4BXF A;  1P6R A;  1P2F A;  2ZSI B;  4HLX A;  2ME0 A;  3RKY A;  1OCC H;  1W7P A;  1ZTR A;  4IHY A;  4A3I J;  2EZH A;  4BEH A;  4N9I A;  3JCU C;  5FRM A;  2AQF A;  1FT9 A;  2OV7 A;  3RYR A;  4C3I J;  2Y9Y A;  2D2W A;  2GA2 A;  4QIW N;  2GOM A;  1FOX A;  3HBL A;  1OYI A;  3ABL H;  1HKS A;  2L5Q A;  3QOP A;  3A0B C;  2YS9 A;  3OYA A;  1ZG5 A;  4ZDL A;  3T0Y A;  2A5Y B;  3HKZ A;  4ZZL A;  2ZKZ A;  1DUX C;  1O3T A;  3QOD A;  2K02 A;  4NDL A;  2JSC A;  4BDY A;  3OOP A;  2DJI A;  2W48 A;  4UVA A;  4XOP A;  4CCM A;  2LK2 A;  1IN5 A;  2C6Y A;  2EFP A;  3CC7 I;  2CQN A;  3HOT A;  2ZB9 A;  2BY0 A;  3KPH A;  2LDU A;  1X3U A;  4HPQ A;  4WXD A;  4WWC A;  2OJE D;  2X4H A;  1WHU A;  3GUD A;  3ROU A;  4OAY A;  2VKE A;  1IRX A;  3WTU C;  2LBF B;  4IQ4 A;  2XDV A;  2IS4 A;  3QPT A;  5F0F A;  4D0P A;  2TRT A;  2WAE A;  1HQC A;  3JW4 A;  3AL0 C;  3CF5 F;  3RI4 A;  3S2W A;  1XDS A;  4LGW A;  4LD5 A;  1AKH B;  1BI3 A;  3IV5 A;  1C0W A;  2MYS A;  3WE3 A;  1FY7 A;  5FRO A;  4A2U A;  3CMA I;  1SD7 A;  2VOP A;  2E1M B;  3OS0 A;  3PL8 A;  2V7F A;  4FE7 A;  5DD4 A;  3CJQ B;  1LNW A;  2Q8K A;  4DIQ A;  5LBQ A;  4V19 K;  2Q1Z B;  2KL4 A;  2BYV E;  2K85 A;  4BQO A;  3R0A A;  2B0L A;  3LOC A;  1UFM A;  2AO9 A;  1LVA A;  5J8C A;  2NAZ A;  2QEN A;  4RA2 A;  4QSH A;  1Q1V A;  2JT1 A;  4F93 B;  3UR3 C;  1MNM C;  4MEY F;  4NC8 A;  1O3S A;  3SZP A;  3L2R A;  1W5T A;  2DU9 A;  3AG4 H;  2R7Q A;  4LG3 A;  2A5W A;  4Y33 A;  2R4G A;  4Q48 A;  1B9M A;  3LQQ A;  2WB1 N;  4BHB A;  3OS2 A;  3L2W A;  2PI0 A;  4HZF A;  2VBZ A;  2Y69 H;  2W85 A;  2V4J C;  4RB0 A;  2QBY B;  4LIV A;  2A68 F;  2PLY A;  3JRI A;  2F4O B;  3P9C A;  4UVC A;  3HZJ A;  1MSF C;  4P1W A;  3MZH A;  3GTG J;  3F22 A;  4B8X A;  1ZRE A;  5TIS C;  2K40 A;  2HDC A;  3CQZ J;  1FLI A;  1Z7L A;  1LEB A;  4BJ5 C;  3T5X A;  2DT5 A;  3FIS A;  1JGS A;  2GXG A;  1PUF A;  1R1T A;  2IRF G;  1UAA A;  2LSO A;  1QA6 A;  4HLY A;  5HVQ C;  1MH4 A;  1ZG1 A;  5JHF A;  2BY2 A;  3F8M A;  1HBX G; 
#chains in the Genus database with same CATH homology
 1WH7 A;  2I10 A;  1H88 C;  4AYB N;  2VUM J;  1BW6 A;  2GBY A;  1ZK8 A;  3Q3S A;  4V2G A;  1WPK A;  1U9N A;  5FKL A;  3JRF A;  3G1O A;  2N8G A;  2P81 A;  3BQZ A;  2XGD A;  5GPA A;  1X58 A;  3GTQ J;  3S2H J;  2Y0S N;  2JA8 J;  4C3J J;  1IDY A;  1JTY A;  1JJ8 C;  1MBE A;  3BR1 A;  5FJ8 J;  3GTO J;  5FKM A;  2LKX A;  4XK4 A;  1P7J A;  2O9L A;  5K7F A;  4D5F A;  1R9T J;  5F04 A;  3GTK J;  5C4X J;  3S1M J;  2DA7 A;  3Q0V A;  3HDD A;  4I76 A;  2X6O A;  4RBO A;  1XC5 A;  3TW7 A;  4GFB A;  5HOD A;  2M8G X;  2ID6 A;  5IP9 J;  5F08 A;  3JRC A;  1HDD C;  5IP7 J;  2XB0 X;  1MBH A;  2L7F P;  4A3G J;  2KT0 A;  1H8A C;  5M5X J;  2LP0 A;  2GM4 A;  1MH3 A;  3QPL A;  5C3E J;  3BR6 A;  5E3O A;  5J3L A;  5FLV A;  3IH4 A;  1TWC J;  2NS7 A;  3ZQG A;  1RES A;  3HGY A;  4CYC A;  1FJL A;  2LY9 A;  3O8G A;  1SFO J;  1ZQ3 P;  4A3D J;  2ID3 A;  4DZJ A;  1O4X A;  2CQX A;  3BTL A;  4MFE A;  3QQA A;  2DMU A;  4C3H J;  2DA5 A;  2QF7 A;  1H89 C;  1MSE C;  4UUT A;  5EZH A;  2JK3 A;  1TWH J;  3K2A A;  1MBG A;  1BA5 A;  3ZQH A;  1TWA J;  3BQY A;  3SJM A;  3C2B A;  3M4O J;  4XIC A;  3BR3 A;  4I6Z A;  1GT0 C;  1WCM J;  2XB5 A;  2E2J J;  3LSJ A;  2RAE A;  2LLK A;  2DTZ A;  2XPU A;  5DTD A;  1FTZ A;  1RKT A;  2XPV A;  3TW6 A;  3JRH A;  3HOY J;  4C2M J;  2ELK A;  2DJN A;  1ETX A;  3SDG A;  1FIA A;  3HOX J;  3HOU J;  2CUF A;  1RET A;  4W1U A;  3HEF A;  4DYC A;  4BXX J;  2EBI A;  2CRG A;  2X9D A;  5F0C A;  1X2N A;  1UG2 A;  2CUE A;  4MIM A;  3WHB A;  4A93 J;  3RZO J;  1JT6 A;  2TCT A;  2DA6 A;  2NVT J;  2E19 A;  4B4C A;  4FIS A;  2MSY A;  1POG A;  3GTJ J;  2LVS A;  1F43 A;  2M0C A;  1SAN A;  1Y1W J;  1ETY A;  3A01 A;  3I4N J;  5FKK A;  3BR2 A;  2OF7 A;  4B1R A;  3IH2 A;  4A3B J;  1OFC X;  2JN6 A;  2CJJ A;  3A01 B;  3JRB A;  2R5Z B;  1RPW A;  3IH3 A;  2VPR A;  1JUM A;  4RDU A;  3RZD J;  1IG7 A;  1JJ6 C;  1W0T A;  2R5Y A;  4A3F J;  1JGG A;  1HF0 A;  2LD5 A;  2R5Y B;  3FK6 A;  2KDZ A;  2K9Q A;  4XRS A;  5J1R A;  3G1M A;  3H0G J;  2FD5 A;  2Y30 A;  4FE4 A;  4V2F A;  2H1K A;  1P7I A;  1LE8 A;  1I3Q J;  2K9S A;  3LSP A;  1OJL A;  3RKQ A;  1RR7 A;  4X1E A;  1BJZ A;  5M5Y J;  1ZGW A;  3S17 J;  4A3L J;  1GDT A;  2HXI A;  5J1U A;  4IEJ A;  1I50 J;  1ITY A;  2Y9Z A;  5GPC A;  3PO3 J;  4IHW A;  1IJW C;  3W6V A;  2HXO A;  1JT0 A;  2YU9 J;  2FQ4 A;  5EF6 A;  2M9H A;  2LFB A;  2B63 J;  4M3B A;  4JYK A;  1GV5 A;  3HOZ J;  2R7Z J;  5E3M A;  3CMY A;  5FKN A;  2M34 A;  1FTT A;  1JKO C;  3GTP J;  4QTR A;  1ZR2 A;  3LSR A;  1VND A;  2DN0 A;  1VFC A;  3DCF A;  3NAU A;  3BTJ A;  1JUS A;  4G12 A;  1I6H J;  2XRL A;  3HOV J;  5F27 A;  1F36 A;  3B6A A;  1Z77 A;  4X6A J;  4S0H B;  2WAQ N;  3O8H A;  3ZQL A;  4MO7 A;  1B8I A;  1LFU P;  1BW5 A;  2XGC A;  4Y7N J;  3FKI J;  1B8I B;  4DZP A;  2DA3 A;  2YUS A;  5EDN A;  3MKL A;  1NTC A;  2E2H J;  1HOM A;  1GV2 A;  2L0K A;  2MG4 A;  3BT9 A;  1T56 A;  3I4M J;  3MVP A;  4JX4 A;  3S1N J;  2NVY J;  2G0E A;  4CYC B;  3S14 J;  2AHQ A;  2ME6 A;  4A3M J;  1AHD P;  5EYR A;  2O8K A;  1WH5 A;  3F0C A;  2EZK A;  3ZQF A;  4MLO A;  2LR8 A;  1ORK A;  5EGO A;  4XRS G;  2DA4 A;  4B3A A;  2OPT A;  5C4J J;  1UHS A;  2R0Q C;  1B72 A;  1HDP A;  4BBS J;  5EGO B;  2R93 J;  4DYQ A;  2IBD A;  3B6C A;  1QPI A;  1B72 B;  3TP0 A;  1JKP C;  2HYJ A;  2FJ1 A;  1VI0 A;  5FLM J;  2GLO A;  1AKH A;  5C44 J;  5IOY A;  3L1P A;  5E3L A;  5K7Z A;  4J19 A;  2DMQ A;  2QCO A;  4ABZ A;  2D5V A;  1WGX A;  2VKV A;  5K7H A;  2O7O A;  4AUX A;  3BG9 A;  1X2M A;  1ENH A;  1CQT A;  1JKQ C;  3SFI A;  1GUU A;  5IP6 A;  4EEF G;  1NK3 P;  1HLV A;  3S16 J;  1RKW A;  2CU7 A;  4Y52 J;  2HOT A;  3OSF A;  2IEK A;  4D7M A;  3OOU A;  1MBK A;  2EQR A;  1UMQ A;  2HOA A;  5J1Y A;  3BR0 A;  1Y1V J;  1QRY A;  3BG5 A;  1OCP A;  3GTM J;  3K7A J;  4BY7 J;  3JRA A;  3ZQC A;  3WHC A;  1ETW A;  3ZQI A;  4M3F A;  2Y31 A;  3M3Y J;  3NAR A;  2JA6 J;  3GBG A;  1OCT C;  2JWT A;  3Q0U A;  3HGG A;  5EEA A;  1G2H A;  5DS9 A;  3Q0W A;  4IHV A;  1FEX A;  1YRN A;  4UUS A;  4XID A;  4D5C A;  4A3C J;  1ETQ A;  5EG0 A;  3CCY A;  1MBF A;  1ZR4 A;  1YRN B;  3FK7 A;  3HM5 A;  4UUS B;  5E3N A;  4A3J J;  1TWF J;  5EG0 B;  1LE8 B;  1T33 A;  5IYD J;  3HOW J;  1IV6 A;  3FIW A;  2HDD A;  3UKG A;  3RQI A;  3JRD A;  2JA5 J;  3G1L A;  3BTI A;  2X48 A;  3S1R J;  1LFB A;  1VF9 A;  1ZKG A;  1ETV A;  3H3V K;  1XG1 A;  3LSG A;  4DYR A;  2ME0 A;  5FKO A;  4M3G A;  5IYB J;  2E1O A;  1ZTR A;  4IHY A;  1K61 A;  1U9O A;  2XGE A;  4LOC A;  4A3I J;  2CQQ A;  2EZH A;  4A3K J;  4BBR J;  5F1J A;  1QVU A;  1W0U A;  2COB A;  4C3I J;  4DW6 A;  5JLW A;  2XPW A;  2Y9Y A;  4QIW N;  2DMP A;  1IRZ A;  2DA1 A;  2FX0 A;  3HBL A;  1NK2 P;  3LNQ A;  1U78 A;  2VI6 A;  4M3D A;  1HCR A;  2YS9 A;  4JX6 A;  5M3M J;  3TED A;  1U8B A;  4NDL A;  1IC8 A;  2W48 A;  4M6V A;  1JUP A;  2L7M P;  4FCY A;  4IHX A;  2XSD C;  1IGN A;  2L9R A;  2LK2 A;  2PMZ N;  3S1Q J;  1TWG J;  1MBJ A;  2EZI A;  2JJ7 A;  2ZB9 A;  2ECC A;  2EH3 A;  3D1N I;  3DEW A;  1EF4 A;  3OSG A;  4MFD A;  2IAI A;  3OIO A;  4A3E J;  2EZL A;  1S7E A;  1Z0X A;  2VKE A;  2NVX J;  2JMW A;  2JA7 J;  2DA2 A;  3PM1 A;  5F0F A;  2M2E A;  3QPS A;  2TRT A;  1JTX A;  3BR5 A;  3TP3 A;  4W97 A;  5JLX A;  1E3O C;  3CDL A;  1AU7 A;  2K9N A;  1JKR C;  1D5Y A;  3HB9 A;  5GP9 A;  1AKH B;  5F0H A;  4AC0 A;  3IV5 A;  1DU0 A;  2DMT A;  2LTP A;  2Y2Z A;  3A03 A;  4JP0 A;  4D7N A;  2HI3 A;  2MGQ A;  4BY1 J;  1DU6 A;  4FE7 A;  5IOZ A;  1A6I A;  3S15 J;  2MW8 A;  1TC3 C;  2NS8 A;  4HNV A;  2NVQ J;  5M5W J;  3LOC A;  4L5E A;  2AO9 A;  1GVD A;  5EZG A;  2NOG A;  4QSH A;  1Q1V A;  3JR9 A;  4FTH A;  2E2I J;  1MNM C;  1IUF A;  3BG3 A;  1A5J A;  1BL0 A;  1WI3 A;  2L7Z A;  5M3F J;  4M3E A;  2WB1 N;  1FIP A;  2ECB A;  3JRE A;  3HKZ N;  3MN2 A;  2H8R A;  1K83 J;  5IPA A;  3JRI A;  2R5Z A;  1ETK A;  1MSF C;  2HOS A;  2HQ5 A;  3PO2 J;  3GTG J;  3BTC A;  3ZOB A;  1APL C;  2R92 J;  3VPR A;  5IYC J;  9ANT A;  1XS9 A;  2K40 A;  2WV1 A;  3CQZ J;  1ETO A;  3S2D J;  4BKX A;  4XRM A;  4JX5 A;  3FIS A;  1PUF A;  3E7L A;  1PUF B;  1MH4 A;  1IDZ A;  3A02 A;  3JRG A;  2DMN A;  1QVT A;  5BNG A;  3GTL J;  4A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...