2YT1A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
185
structure length
185
Chain Sequence
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGPSSGIEGRGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 25
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt1A01
1X1GA 3KRWA 3F0WA 2D11A 2D4QA 2OTXA 3TVVA 2DHJA 3SO6A 2Z0OA 1NTYA 4MT7A 2YVCA 2P0DA 1V88A 1DDMA 4MK0A 1GC6A 5CLLB 2DX5A 2UVMA 5J3TA 1XKEA 4HB4B 4F7HA 1FOEA 1DDWA 2NZ8B 2XQNM 2I1JA 4DBBA 1FGZA 1UEFA 5EFXA 3TCAA 4BBKA 1BTNA 5JLJB 1AQCA 4HDQA 3SUZA 4IAPA 1PMSA 4GPTB 4D0NB 1WJ1A 5J3YA 2DFKA 2K2UA 3QWMA 5JP4A 2COCA 2E2XA 1WI1A 2UZRA 2EMSA 5D27A 2Y8FA 1V5UA 1WGUA 2DYNA 2I1KA 2HE7A 1Y19B 1ZC3B 4CHJA 1U27A 1RJ2A 4EMOA 3FM8C 5DHFB 2H7EA 5DIFB 3PG7A 2ELBA 5HE1A 1WVHA 4HB2B 2IYBA 1MPHA 5DHAB 1NU2A 4XWXA 4C0AA 3ULBA 1KZ7A 3HW2B 4ZRIA 2ELAA 1P6SA 5JHHA 1U5DA 2R0DA 1DYNA 2KGXB 1FGYA 1NI2A 1MIZB 1UPRA 2V76A 2CY5A 1OMWA 2DLWA 4GN1A 1EGXA 2BCJA 2AEHA 1P3RA 2DKQA 4A6FB 1FHXA 2UZSA 3KZ1A 5KCVA 2ADZA 2KCJA 4GZUA 1OQNA 3D8FA 4K2OA 3PVLA 5FI0A 4TKNA 3PVUA 1K5DB 4CHMA 3PSCA 2YT1A 4Y94A 1UNRA 3HQCA 1WGQA 1V89A 1J0WA 1U5FA 1SHCA 2VRWB 1XODA 1MAIA 5D3YA 1QQGA 4K2PA 2Z0QA 3FEHA 4P7IA 5LOPB 2PZ1A 3D8DA 4KAXB 3U8ZA 5C79A 4B6HA 4DX90 1U5GA 4HDOA 4HAVB 4YONA 3V5WA 1X05A 1MKEA 4HB3B 5C5BB 4F7GA 2H7DA 4HAXB 4PQ0A 1WJMA 2QKMA 5DH9B 4NSWA 2EMTA 3AJ4A 2D9WA 1J19A 1XR0B 1K5GB 1UPQA 2YT0A 1PLSA 3KRXA 4HHVA 2YRYA 1DDVA 5D3XA 2K00A 4K17A 1DBHA 2LULA 4DXAB 3QIJA 3G9WA 4IFSA 4HAUB 5FI1A 3U7DA 2ROVA 3PEGA 2W2XD 1WG7A 2D10A 2GCJA 5KQ4A 3ODWA 4H8SA 1V61A 1P5TA 2YSZA 4ZRKA 1X1FA 5C16A 2J0KA 5DI9B 2GS0A 2D9XA 3IVFA 1BWNA 4KHOA 2DTCA 1FAOA 1Y5OA 1QC6A 5L81A 3SNHA 1B55A 5D3WA 3OANA 4IOYX 2DA0A 4HB0B 4CYEA 2GJYA 2RSGA 3M1IB 1IRSA 2YS1A 1RRPB 1W1HA 3GYPA 1GG3A 1OY2A 2P0FA 2P8VA 1ISNA 3AU4A 2COAA 2X18A 5GOWB 2GCLA 4KVGB 3PP2A 2LKOA 2Z0PA 1W1GA 1U29A 1W1DA 2M38A 3TFMA 1XD4A 2DX1A 2YS5A 2Y7BA 1ZM0A 1SGHA 2QKLA 3DXEA 1LB1A 3TO1A 1UNQA 4GXBA 4EKUA 1N3HA 2RLOA 4TYZA 4HAZB 2N0YA 4KHBB 2Q13A 5C6RA 4A5KA 4MY6A 3BINA 1ZVRA 2J0JA 5HE0A 2J59M 2DYQA 2I5FA 2N23A 3P6AA 4A6FA 2KUPA 2LOZA 2RVBB 1U2BA 3SV1A 1I7AA 1AWEA 2R09A 1EF1A 3A98B 3WA0A 3D8EA 2L1CA 1MK9B 1GC7A 2DHIA 5LONB 1PFJA 2I5CA 2CODA 1BAKA 3CIKA 3ZVRA 3KSYA 1X11A 2VSZA 2NMBA 1TJ6A 3ML4A 2YF0A 3ZDTA 2MDXA 1ZC4B 5KQ1A 3HK0A 1FHWA 1DROA 1V5PA 2VKIA 1M7EA 1X86A 1KI1B 2LOXA 3ODOA 5J3QA 2HTHB 1TXDA 2LG1A 2D9YA 3ULCA 4DX8A 2MKRA 3QBVB 2ROZB 4YL8A 2Y8GA 1M7RA 2RUKB 1EVHA 2W2WA 4ZRJA 3LJUX 2DKPA 1FB8A 4KHAA 2COFA 2IFSA 2J0MA 3FSSA 3DXCA 5C5BA 1XX0A 4GMXB 2D2QA 3MPXA 4A6KA 1V5MA 2RNRB 2M14A 4WSFA 1MK7B 1I2HA 1Q67A 1ZSQA 3NSUA 3RCPA 1XCGA 3A8PA 2DN6A 2EC1A 3GYOA 4PNKA 2MFQA 4Z2NA 2LYDA 3MDBC 3O96A 2W2XC 1Z87A 4NY0A 2CRFA 3UZTA 2MWNB 5HE2A 5HE3A 2DHKA 2FJLA 5CLQB 3VOQA 2G35A 3N7CA 2JP2A 2CAYA 1TQZA 4GMVA 1KZGA 5JHGA 3X23A 2YS3A 2D9VA 1EAZA 3TW1A 1BTKA 2D9ZA 3SYXA 2L2IA 1UNPA 2ZPYA 4K81A 4L6EA 3P7ZA 3VIAA 1H10A 4HAWB 4HATB 2CY4A 2K2JA 3BJIA 3ODXA 4EJNA 4Z2MB 4A6HA 1E5WA 2RGNB 3F5RA 1NTVA 3PVWA 2EJ8A 3CXBB 1FHOA 4F7UP 3AU5A 1MIXA 4HAYB 2P0HA 4WJ7A 2AL6A 3A8QA 3WYFB 3T06A 1H4RA 3KY9A 1U5EA 3DXDA 4WVFB 2OQBA 3PZDA 1LW3A 5D3VA
chains in the Genus database with same CATH superfamily
1X1GA 3KRWA 2GUMA 4QJ5B 3F0WA 2D11A 2D4QA 2OTXA 3TVVA 2DHJA 4OSNA 2FJUB 3SO6A 2Z0OA 1NTYA 4MT7A 2K8EA 2YVCA 2P0DA 1V88A 5LG4B 1DDMA 4MK0A 1GC6A 5CLLB 2DX5A 2R2YA 2UVMA 5J3TA 1XKEA 4HB4B 4F7HA 1FOEA 1DDWA 2NZ8B 2XQNM 2I1JA 2KR0A 4DBBA 1FGZA 3A58A 1UEFA 5EFXA 3TCAA 4BBKA 1BTNA 5JLJB 1AQCA 4HDQA 3SUZA 4IAPA 4KHBA 1PMSA 4GPTB 4D0NB 1WJ1A 5J3YA 2DFKA 2K2UA 3QWMA 5JP4A 2COCA 2E2XA 1WI1A 2UZRA 2EMSA 5D27A 2Y8FA 1V5UA 1WGUA 2DYNA 2I1KA 3HSAA 2HE7A 1Y19B 1ZC3B 4CHJA 1U27A 1RJ2A 4EMOA 3FM8C 5DHFB 2H7EA 5DIFB 3PG7A 2ELBA 5HE1A 1WVHA 4HB2B 2IYBA 2Z14A 1MPHA 5DHAB 1NU2A 4XWXA 4C0AA 3ULBA 1KZ7A 3HW2B 4ZRIA 2ELAA 1P6SA 5JHHA 1U5DA 2R0DA 1DYNA 2KGXB 1FGYA 1NI2A 1MIZB 1UPRA 2V76A 2CY5A 1OMWA 2DLWA 4GN1A 1EGXA 2BCJA 2AEHA 1P3RA 2DKQA 4A6FB 1FHXA 2UZSA 5I2MA 3KZ1A 5KCVA 2ADZA 2KCJA 4GZUA 1OQNA 3D8FA 4K2OA 3PVLA 4HSIA 5FI0A 4TKNA 3PVUA 1K5DB 4CHMA 3PSCA 2YT1A 4Y94A 1UNRA 2KIEA 3HQCA 1WGQA 1V89A 1J0WA 1U5FA 1SHCA 2VRWB 1XODA 1MAIA 5D3YA 1QQGA 4K2PA 2Z0QA 3FEHA 4P7IA 5LOPB 2ZKMX 2PZ1A 3D8DA 4KAXB 3U8ZA 5C79A 4B6HA 4DX90 5I2SA 3OHMB 1U5GA 4HDOA 4HAVB 4YONA 3V5WA 1X05A 1MKEA 4HB3B 5C5BB 4F7GA 2H7DA 4HAXB 4PQ0A 1WJMA 2QKMA 5DH9B 3U12A 4NSWA 2EMTA 3AJ4A 2D9WA 1J19A 1XR0B 1K5GB 1UPQA 2YT0A 1PLSA 3NWFA 3KRXA 4HHVA 2K49A 2YRYA 1DDVA 5D3XA 2K00A 4K17A 1DBHA 2LULA 4DXAB 3QIJA 3G9WA 4IFSA 4HAUB 5FI1A 3U7DA 2Z59A 4QXAB 2ROVA 3PEGA 2W2XD 2KIGA 1WG7A 2D10A 1T77A 2GCJA 5KQ4A 3ODWA 4H8SA 1V61A 1P5TA 2YSZA 4ZRKA 1X1FA 5C16A 2J0KA 5DI9B 3NW8A 4OT1A 2GS0A 2D9XA 3IVFA 1BWNA 4DIXA 4KHOA 2DTCA 1FAOA 1Y5OA 3HIEA 1QC6A 5L81A 3SNHA 1B55A 5D3WA 3OANA 4IOYX 2DA0A 4HB0B 5IRSA 4CYEA 2GJYA 2RSGA 3M1IB 1IRSA 2YS1A 1RRPB 1W1HA 3GYPA 1GG3A 1OY2A 2P0FA 2P8VA 1ISNA 3AU4A 2COAA 2X18A 5GOWB 2GCLA 4KVGB 3PP2A 2LKOA 2Z0PA 1W1GA 1U29A 1W1DA 2M38A 3TFMA 1MI1A 4QJ3B 1XD4A 2DX1A 2YS5A 2Y7BA 1ZM0A 1SGHA 3FVCA 2QKLA 3DXEA 1LB1A 3TO1A 1UNQA 4GXBA 4EKUA 1N3HA 2RLOA 4TYZA 4HAZB 4L1RA 2N0YA 4KHBB 2Q13A 5C6RA 4GOUA 4MY6A 4A5KA 3BINA 2Z4DA 1ZVRA 2J0JA 5HE0A 2J59M 2DYQA 2I5FA 2NBVA 2N23A 3P6AA 4A6FA 2KUPA 2LOZA 2RVBB 1U2BA 3SV1A 1I7AA 1AWEA 2R09A 1EF1A 3A98B 3NWDA 3WA0A 3D8EA 2L1CA 4D6WA 1MK9B 1GC7A 2DHIA 5LONB 1PFJA 2I5CA 2CODA 1BAKA 3CIKA 3ZVRA 3KSYA 1X11A 2VSZA 2NMBA 1TJ6A 3ML4A 2YF0A 3ZDTA 2MDXA 1ZC4B 2KUQA 5KQ1A 3HK0A 1FHWA 1DROA 1V5PA 2VKIA 1M7EA 1X86A 1KI1B 2LOXA 3ODOA 5J3QA 2HTHB 1TXDA 2LG1A 2D9YA 3ULCA 4DX8A 2MKRA 3QBVB 4QJ4B 2ROZB 4YL8A 2Y8GA 1M7RA 2RUKB 1EVHA 2W2WA 4ZRJA 3LJUX 2DKPA 1FB8A 4KHAA 2COFA 4GNKB 2IFSA 2J0MA 3FSSA 3DXCA 5C5BA 1XX0A 4GMXB 2D2QA 3MPXA 4A6KA 1V5MA 2RNRB 2M14A 4WSFA 3NWAA 1MK7B 1I2HA 1Q67A 1ZSQA 3NSUA 3RCPA 2YT2A 1XCGA 3A8PA 2DN6A 2EC1A 3GYOA 4PNKA 2MFQA 5M4YB 4Z2NA 2LYDA 3MDBC 3O96A 2W2XC 1Z87A 4NY0A 2CRFA 3UZTA 2MWNB 5HE2A 5HE3A 2DHKA 2FJLA 5CLQB 3VOQA 2G35A 3N7CA 2JP2A 2CAYA 1TQZA 4GMVA 1KZGA 5JHGA 3X23A 2YS3A 2D9VA 1EAZA 3TW1A 1BTKA 2D9ZA 3SYXA 2L2IA 3B77A 1UNPA 2ZPYA 4K81A 4L6EA 3P7ZA 3VIAA 1H10A 4HAWB 4HATB 2CY4A 2K2JA 3BJIA 3ODXA 4CSQA 4EJNA 3DCXA 1ZYIA 4Z2MB 4A6HA 1E5WA 2RGNB 2Z13A 3F5RA 1NTVA 3PVWA 2EJ8A 3CXBB 1FHOA 4F7UP 3AU5A 1MIXA 4HAYB 2RRFA 2P0HA 4WJ7A 2AL6A 3A8QA 3WYFB 3T06A 1H4RA 3KY9A 1U5EA 3DXDA 4WVFB 2OQBA 3PZDA 1LW3A 5D3VA
chains in the Genus database with same CATH topology
1X1GA 3KRWA 3F0WA 2D11A 2D4QA 2OTXA 3TVVA 2DHJA 3SO6A 2Z0OA 1NTYA 4MT7A 2YVCA 2P0DA 1V88A 1DDMA 4MK0A 1GC6A 5CLLB 2DX5A 2UVMA 5J3TA 1XKEA 4HB4B 4F7HA 1FOEA 1DDWA 2NZ8B 2XQNM 2I1JA 4DBBA 1FGZA 1UEFA 5EFXA 3TCAA 4BBKA 1BTNA 5JLJB 1AQCA 4HDQA 3SUZA 4IAPA 1PMSA 4GPTB 4D0NB 1WJ1A 5J3YA 2DFKA 2K2UA 3QWMA 5JP4A 2COCA 2E2XA 1WI1A 2UZRA 2EMSA 5D27A 2Y8FA 1V5UA 1WGUA 2DYNA 2I1KA 2HE7A 1Y19B 1ZC3B 4CHJA 1U27A 1RJ2A 4EMOA 3FM8C 5DHFB 2H7EA 5DIFB 3PG7A 2ELBA 5HE1A 1WVHA 4HB2B 2IYBA 1MPHA 5DHAB 1NU2A 4XWXA 4C0AA 3ULBA 1KZ7A 3HW2B 4ZRIA 2ELAA 1P6SA 5JHHA 1U5DA 2R0DA 1DYNA 2KGXB 1FGYA 1NI2A 1MIZB 1UPRA 2V76A 2CY5A 1OMWA 2DLWA 4GN1A 1EGXA 2BCJA 2AEHA 1P3RA 2DKQA 4A6FB 1FHXA 2UZSA 3KZ1A 5KCVA 2ADZA 2KCJA 4GZUA 1OQNA 3D8FA 4K2OA 3PVLA 5FI0A 4TKNA 3PVUA 1K5DB 4CHMA 3PSCA 2YT1A 4Y94A 1UNRA 3HQCA 1WGQA 1V89A 1J0WA 1U5FA 1SHCA 2VRWB 1XODA 1MAIA 5D3YA 1QQGA 4K2PA 2Z0QA 3FEHA 4P7IA 5LOPB 2PZ1A 3D8DA 4KAXB 3U8ZA 5C79A 4B6HA 4DX90 1U5GA 4HDOA 4HAVB 4YONA 3V5WA 1X05A 1MKEA 4HB3B 5C5BB 4F7GA 2H7DA 4HAXB 4PQ0A 1WJMA 2QKMA 5DH9B 4NSWA 2EMTA 3AJ4A 2D9WA 1J19A 1XR0B 1K5GB 1UPQA 2YT0A 1PLSA 3KRXA 4HHVA 2YRYA 1DDVA 5D3XA 2K00A 4K17A 1DBHA 2LULA 4DXAB 3QIJA 3G9WA 4IFSA 4HAUB 5FI1A 3U7DA 2ROVA 3PEGA 2W2XD 1WG7A 2D10A 2GCJA 5KQ4A 3ODWA 4H8SA 1V61A 1P5TA 2YSZA 4ZRKA 1X1FA 5C16A 2J0KA 5DI9B 2GS0A 2D9XA 3IVFA 1BWNA 4KHOA 2DTCA 1FAOA 1Y5OA 1QC6A 5L81A 3SNHA 1B55A 5D3WA 3OANA 4IOYX 2DA0A 4HB0B 4CYEA 2GJYA 2RSGA 3M1IB 1IRSA 2YS1A 1RRPB 1W1HA 3GYPA 1GG3A 1OY2A 2P0FA 2P8VA 1ISNA 3AU4A 2COAA 2X18A 5GOWB 2GCLA 4KVGB 3PP2A 2LKOA 2Z0PA 1W1GA 1U29A 1W1DA 2M38A 3TFMA 1XD4A 2DX1A 2YS5A 2Y7BA 1ZM0A 1SGHA 2QKLA 3DXEA 1LB1A 3TO1A 1UNQA 4GXBA 4EKUA 1N3HA 2RLOA 4TYZA 4HAZB 2N0YA 4KHBB 2Q13A 5C6RA 4A5KA 4MY6A 3BINA 1ZVRA 2J0JA 5HE0A 2J59M 2DYQA 2I5FA 2N23A 3P6AA 4A6FA 2KUPA 2LOZA 2RVBB 1U2BA 3SV1A 1I7AA 1AWEA 2R09A 1EF1A 3A98B 3WA0A 3D8EA 2L1CA 1MK9B 1GC7A 2DHIA 5LONB 1PFJA 2I5CA 2CODA 1BAKA 3CIKA 3ZVRA 3KSYA 1X11A 2VSZA 2NMBA 1TJ6A 3ML4A 2YF0A 3ZDTA 2MDXA 1ZC4B 5KQ1A 3HK0A 1FHWA 1DROA 1V5PA 2VKIA 1M7EA 1X86A 1KI1B 2LOXA 3ODOA 5J3QA 2HTHB 1TXDA 2LG1A 2D9YA 3ULCA 4DX8A 2MKRA 3QBVB 2ROZB 4YL8A 2Y8GA 1M7RA 2RUKB 1EVHA 2W2WA 4ZRJA 3LJUX 2DKPA 1FB8A 4KHAA 2COFA 2IFSA 2J0MA 3FSSA 3DXCA 5C5BA 1XX0A 4GMXB 2D2QA 3MPXA 4A6KA 1V5MA 2RNRB 2M14A 4WSFA 1MK7B 1I2HA 1Q67A 1ZSQA 3NSUA 3RCPA 1XCGA 3A8PA 2DN6A 2EC1A 3GYOA 4PNKA 2MFQA 4Z2NA 2LYDA 3MDBC 3O96A 2W2XC 1Z87A 4NY0A 2CRFA 3UZTA 2MWNB 5HE2A 5HE3A 2DHKA 2FJLA 5CLQB 3VOQA 2G35A 3N7CA 2JP2A 2CAYA 1TQZA 4GMVA 1KZGA 5JHGA 3X23A 2YS3A 2D9VA 1EAZA 3TW1A 1BTKA 2D9ZA 3SYXA 2L2IA 1UNPA 2ZPYA 4K81A 4L6EA 3P7ZA 3VIAA 1H10A 4HAWB 4HATB 2CY4A 2K2JA 3BJIA 3ODXA 4EJNA 4Z2MB 4A6HA 1E5WA 2RGNB 3F5RA 1NTVA 3PVWA 2EJ8A 3CXBB 1FHOA 4F7UP 3AU5A 1MIXA 4HAYB 2P0HA 4WJ7A 2AL6A 3A8QA 3WYFB 3T06A 1H4RA 3KY9A 1U5EA 3DXDA 4WVFB 2OQBA 3PZDA 1LW3A 5D3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1G A;  3KRW A;  3F0W A;  2D11 A;  2D4Q A;  2OTX A;  3TVV A;  2DHJ A;  3SO6 A;  2Z0O A;  1NTY A;  4MT7 A;  2YVC A;  2P0D A;  1V88 A;  1DDM A;  4MK0 A;  1GC6 A;  5CLL B;  2DX5 A;  2UVM A;  5J3T A;  1XKE A;  4HB4 B;  4F7H A;  1FOE A;  1DDW A;  2NZ8 B;  2XQN M;  2I1J A;  4DBB A;  1FGZ A;  1UEF A;  5EFX A;  3TCA A;  4BBK A;  1BTN A;  5JLJ B;  1AQC A;  4HDQ A;  3SUZ A;  4IAP A;  1PMS A;  4GPT B;  4D0N B;  1WJ1 A;  5J3Y A;  2DFK A;  2K2U A;  3QWM A;  5JP4 A;  2COC A;  2E2X A;  1WI1 A;  2UZR A;  2EMS A;  5D27 A;  2Y8F A;  1V5U A;  1WGU A;  2DYN A;  2I1K A;  2HE7 A;  1Y19 B;  1ZC3 B;  4CHJ A;  1U27 A;  1RJ2 A;  4EMO A;  3FM8 C;  5DHF B;  2H7E A;  5DIF B;  3PG7 A;  2ELB A;  5HE1 A;  1WVH A;  4HB2 B;  2IYB A;  1MPH A;  5DHA B;  1NU2 A;  4XWX A;  4C0A A;  3ULB A;  1KZ7 A;  3HW2 B;  4ZRI A;  2ELA A;  1P6S A;  5JHH A;  1U5D A;  2R0D A;  1DYN A;  2KGX B;  1FGY A;  1NI2 A;  1MIZ B;  1UPR A;  2V76 A;  2CY5 A;  1OMW A;  2DLW A;  4GN1 A;  1EGX A;  2BCJ A;  2AEH A;  1P3R A;  2DKQ A;  4A6F B;  1FHX A;  2UZS A;  3KZ1 A;  5KCV A;  2ADZ A;  2KCJ A;  4GZU A;  1OQN A;  3D8F A;  4K2O A;  3PVL A;  5FI0 A;  4TKN A;  3PVU A;  1K5D B;  4CHM A;  3PSC A;  2YT1 A;  4Y94 A;  1UNR A;  3HQC A;  1WGQ A;  1V89 A;  1J0W A;  1U5F A;  1SHC A;  2VRW B;  1XOD A;  1MAI A;  5D3Y A;  1QQG A;  4K2P A;  2Z0Q A;  3FEH A;  4P7I A;  5LOP B;  2PZ1 A;  3D8D A;  4KAX B;  3U8Z A;  5C79 A;  4B6H A;  4DX9 0;  1U5G A;  4HDO A;  4HAV B;  4YON A;  3V5W A;  1X05 A;  1MKE A;  4HB3 B;  5C5B B;  4F7G A;  2H7D A;  4HAX B;  4PQ0 A;  1WJM A;  2QKM A;  5DH9 B;  4NSW A;  2EMT A;  3AJ4 A;  2D9W A;  1J19 A;  1XR0 B;  1K5G B;  1UPQ A;  2YT0 A;  1PLS A;  3KRX A;  4HHV A;  2YRY A;  1DDV A;  5D3X A;  2K00 A;  4K17 A;  1DBH A;  2LUL A;  4DXA B;  3QIJ A;  3G9W A;  4IFS A;  4HAU B;  5FI1 A;  3U7D A;  2ROV A;  3PEG A;  2W2X D;  1WG7 A;  2D10 A;  2GCJ A;  5KQ4 A;  3ODW A;  4H8S A;  1V61 A;  1P5T A;  2YSZ A;  4ZRK A;  1X1F A;  5C16 A;  2J0K A;  5DI9 B;  2GS0 A;  2D9X A;  3IVF A;  1BWN A;  4KHO A;  2DTC A;  1FAO A;  1Y5O A;  1QC6 A;  5L81 A;  3SNH A;  1B55 A;  5D3W A;  3OAN A;  4IOY X;  2DA0 A;  4HB0 B;  4CYE A;  2GJY A;  2RSG A;  3M1I B;  1IRS A;  2YS1 A;  1RRP B;  1W1H A;  3GYP A;  1GG3 A;  1OY2 A;  2P0F A;  2P8V A;  1ISN A;  3AU4 A;  2COA A;  2X18 A;  5GOW B;  2GCL A;  4KVG B;  3PP2 A;  2LKO A;  2Z0P A;  1W1G A;  1U29 A;  1W1D A;  2M38 A;  3TFM A;  1XD4 A;  2DX1 A;  2YS5 A;  2Y7B A;  1ZM0 A;  1SGH A;  2QKL A;  3DXE A;  1LB1 A;  3TO1 A;  1UNQ A;  4GXB A;  4EKU A;  1N3H A;  2RLO A;  4TYZ A;  4HAZ B;  2N0Y A;  4KHB B;  2Q13 A;  5C6R A;  4A5K A;  4MY6 A;  3BIN A;  1ZVR A;  2J0J A;  5HE0 A;  2J59 M;  2DYQ A;  2I5F A;  2N23 A;  3P6A A;  4A6F A;  2KUP A;  2LOZ A;  2RVB B;  1U2B A;  3SV1 A;  1I7A A;  1AWE A;  2R09 A;  1EF1 A;  3A98 B;  3WA0 A;  3D8E A;  2L1C A;  1MK9 B;  1GC7 A;  2DHI A;  5LON B;  1PFJ A;  2I5C A;  2COD A;  1BAK A;  3CIK A;  3ZVR A;  3KSY A;  1X11 A;  2VSZ A;  2NMB A;  1TJ6 A;  3ML4 A;  2YF0 A;  3ZDT A;  2MDX A;  1ZC4 B;  5KQ1 A;  3HK0 A;  1FHW A;  1DRO A;  1V5P A;  2VKI A;  1M7E A;  1X86 A;  1KI1 B;  2LOX A;  3ODO A;  5J3Q A;  2HTH B;  1TXD A;  2LG1 A;  2D9Y A;  3ULC A;  4DX8 A;  2MKR A;  3QBV B;  2ROZ B;  4YL8 A;  2Y8G A;  1M7R A;  2RUK B;  1EVH A;  2W2W A;  4ZRJ A;  3LJU X;  2DKP A;  1FB8 A;  4KHA A;  2COF A;  2IFS A;  2J0M A;  3FSS A;  3DXC A;  5C5B A;  1XX0 A;  4GMX B;  2D2Q A;  3MPX A;  4A6K A;  1V5M A;  2RNR B;  2M14 A;  4WSF A;  1MK7 B;  1I2H A;  1Q67 A;  1ZSQ A;  3NSU A;  3RCP A;  1XCG A;  3A8P A;  2DN6 A;  2EC1 A;  3GYO A;  4PNK A;  2MFQ A;  4Z2N A;  2LYD A;  3MDB C;  3O96 A;  2W2X C;  1Z87 A;  4NY0 A;  2CRF A;  3UZT A;  2MWN B;  5HE2 A;  5HE3 A;  2DHK A;  2FJL A;  5CLQ B;  3VOQ A;  2G35 A;  3N7C A;  2JP2 A;  2CAY A;  1TQZ A;  4GMV A;  1KZG A;  5JHG A;  3X23 A;  2YS3 A;  2D9V A;  1EAZ A;  3TW1 A;  1BTK A;  2D9Z A;  3SYX A;  2L2I A;  1UNP A;  2ZPY A;  4K81 A;  4L6E A;  3P7Z A;  3VIA A;  1H10 A;  4HAW B;  4HAT B;  2CY4 A;  2K2J A;  3BJI A;  3ODX A;  4EJN A;  4Z2M B;  4A6H A;  1E5W A;  2RGN B;  3F5R A;  1NTV A;  3PVW A;  2EJ8 A;  3CXB B;  1FHO A;  4F7U P;  3AU5 A;  1MIX A;  4HAY B;  2P0H A;  4WJ7 A;  2AL6 A;  3A8Q A;  3WYF B;  3T06 A;  1H4R A;  3KY9 A;  1U5E A;  3DXD A;  4WVF B;  2OQB A;  3PZD A;  1LW3 A;  5D3V A; 
#chains in the Genus database with same CATH topology
 1X1G A;  3KRW A;  2GUM A;  4QJ5 B;  3F0W A;  2D11 A;  2D4Q A;  2OTX A;  3TVV A;  2DHJ A;  4OSN A;  2FJU B;  3SO6 A;  2Z0O A;  1NTY A;  4MT7 A;  2K8E A;  2YVC A;  2P0D A;  1V88 A;  5LG4 B;  1DDM A;  4MK0 A;  1GC6 A;  5CLL B;  2DX5 A;  2R2Y A;  2UVM A;  5J3T A;  1XKE A;  4HB4 B;  4F7H A;  1FOE A;  1DDW A;  2NZ8 B;  2XQN M;  2I1J A;  2KR0 A;  4DBB A;  1FGZ A;  3A58 A;  1UEF A;  5EFX A;  3TCA A;  4BBK A;  1BTN A;  5JLJ B;  1AQC A;  4HDQ A;  3SUZ A;  4IAP A;  4KHB A;  1PMS A;  4GPT B;  4D0N B;  1WJ1 A;  5J3Y A;  2DFK A;  2K2U A;  3QWM A;  5JP4 A;  2COC A;  2E2X A;  1WI1 A;  2UZR A;  2EMS A;  5D27 A;  2Y8F A;  1V5U A;  1WGU A;  2DYN A;  2I1K A;  3HSA A;  2HE7 A;  1Y19 B;  1ZC3 B;  4CHJ A;  1U27 A;  1RJ2 A;  4EMO A;  3FM8 C;  5DHF B;  2H7E A;  5DIF B;  3PG7 A;  2ELB A;  5HE1 A;  1WVH A;  4HB2 B;  2IYB A;  2Z14 A;  1MPH A;  5DHA B;  1NU2 A;  4XWX A;  4C0A A;  3ULB A;  1KZ7 A;  3HW2 B;  4ZRI A;  2ELA A;  1P6S A;  5JHH A;  1U5D A;  2R0D A;  1DYN A;  2KGX B;  1FGY A;  1NI2 A;  1MIZ B;  1UPR A;  2V76 A;  2CY5 A;  1OMW A;  2DLW A;  4GN1 A;  1EGX A;  2BCJ A;  2AEH A;  1P3R A;  2DKQ A;  4A6F B;  1FHX A;  2UZS A;  5I2M A;  3KZ1 A;  5KCV A;  2ADZ A;  2KCJ A;  4GZU A;  1OQN A;  3D8F A;  4K2O A;  3PVL A;  4HSI A;  5FI0 A;  4TKN A;  3PVU A;  1K5D B;  4CHM A;  3PSC A;  2YT1 A;  4Y94 A;  1UNR A;  2KIE A;  3HQC A;  1WGQ A;  1V89 A;  1J0W A;  1U5F A;  1SHC A;  2VRW B;  1XOD A;  1MAI A;  5D3Y A;  1QQG A;  4K2P A;  2Z0Q A;  3FEH A;  4P7I A;  5LOP B;  2ZKM X;  2PZ1 A;  3D8D A;  4KAX B;  3U8Z A;  5C79 A;  4B6H A;  4DX9 0;  5I2S A;  3OHM B;  1U5G A;  4HDO A;  4HAV B;  4YON A;  3V5W A;  1X05 A;  1MKE A;  4HB3 B;  5C5B B;  4F7G A;  2H7D A;  4HAX B;  4PQ0 A;  1WJM A;  2QKM A;  5DH9 B;  3U12 A;  4NSW A;  2EMT A;  3AJ4 A;  2D9W A;  1J19 A;  1XR0 B;  1K5G B;  1UPQ A;  2YT0 A;  1PLS A;  3NWF A;  3KRX A;  4HHV A;  2K49 A;  2YRY A;  1DDV A;  5D3X A;  2K00 A;  4K17 A;  1DBH A;  2LUL A;  4DXA B;  3QIJ A;  3G9W A;  4IFS A;  4HAU B;  5FI1 A;  3U7D A;  2Z59 A;  4QXA B;  2ROV A;  3PEG A;  2W2X D;  2KIG A;  1WG7 A;  2D10 A;  1T77 A;  2GCJ A;  5KQ4 A;  3ODW A;  4H8S A;  1V61 A;  1P5T A;  2YSZ A;  4ZRK A;  1X1F A;  5C16 A;  2J0K A;  5DI9 B;  3NW8 A;  4OT1 A;  2GS0 A;  2D9X A;  3IVF A;  1BWN A;  4DIX A;  4KHO A;  2DTC A;  1FAO A;  1Y5O A;  3HIE A;  1QC6 A;  5L81 A;  3SNH A;  1B55 A;  5D3W A;  3OAN A;  4IOY X;  2DA0 A;  4HB0 B;  5IRS A;  4CYE A;  2GJY A;  2RSG A;  3M1I B;  1IRS A;  2YS1 A;  1RRP B;  1W1H A;  3GYP A;  1GG3 A;  1OY2 A;  2P0F A;  2P8V A;  1ISN A;  3AU4 A;  2COA A;  2X18 A;  5GOW B;  2GCL A;  4KVG B;  3PP2 A;  2LKO A;  2Z0P A;  1W1G A;  1U29 A;  1W1D A;  2M38 A;  3TFM A;  1MI1 A;  4QJ3 B;  1XD4 A;  2DX1 A;  2YS5 A;  2Y7B A;  1ZM0 A;  1SGH A;  3FVC A;  2QKL A;  3DXE A;  1LB1 A;  3TO1 A;  1UNQ A;  4GXB A;  4EKU A;  1N3H A;  2RLO A;  4TYZ A;  4HAZ B;  4L1R A;  2N0Y A;  4KHB B;  2Q13 A;  5C6R A;  4GOU A;  4MY6 A;  4A5K A;  3BIN A;  2Z4D A;  1ZVR A;  2J0J A;  5HE0 A;  2J59 M;  2DYQ A;  2I5F A;  2NBV A;  2N23 A;  3P6A A;  4A6F A;  2KUP A;  2LOZ A;  2RVB B;  1U2B A;  3SV1 A;  1I7A A;  1AWE A;  2R09 A;  1EF1 A;  3A98 B;  3NWD A;  3WA0 A;  3D8E A;  2L1C A;  4D6W A;  1MK9 B;  1GC7 A;  2DHI A;  5LON B;  1PFJ A;  2I5C A;  2COD A;  1BAK A;  3CIK A;  3ZVR A;  3KSY A;  1X11 A;  2VSZ A;  2NMB A;  1TJ6 A;  3ML4 A;  2YF0 A;  3ZDT A;  2MDX A;  1ZC4 B;  2KUQ A;  5KQ1 A;  3HK0 A;  1FHW A;  1DRO A;  1V5P A;  2VKI A;  1M7E A;  1X86 A;  1KI1 B;  2LOX A;  3ODO A;  5J3Q A;  2HTH B;  1TXD A;  2LG1 A;  2D9Y A;  3ULC A;  4DX8 A;  2MKR A;  3QBV B;  4QJ4 B;  2ROZ B;  4YL8 A;  2Y8G A;  1M7R A;  2RUK B;  1EVH A;  2W2W A;  4ZRJ A;  3LJU X;  2DKP A;  1FB8 A;  4KHA A;  2COF A;  4GNK B;  2IFS A;  2J0M A;  3FSS A;  3DXC A;  5C5B A;  1XX0 A;  4GMX B;  2D2Q A;  3MPX A;  4A6K A;  1V5M A;  2RNR B;  2M14 A;  4WSF A;  3NWA A;  1MK7 B;  1I2H A;  1Q67 A;  1ZSQ A;  3NSU A;  3RCP A;  2YT2 A;  1XCG A;  3A8P A;  2DN6 A;  2EC1 A;  3GYO A;  4PNK A;  2MFQ A;  5M4Y B;  4Z2N A;  2LYD A;  3MDB C;  3O96 A;  2W2X C;  1Z87 A;  4NY0 A;  2CRF A;  3UZT A;  2MWN B;  5HE2 A;  5HE3 A;  2DHK A;  2FJL A;  5CLQ B;  3VOQ A;  2G35 A;  3N7C A;  2JP2 A;  2CAY A;  1TQZ A;  4GMV A;  1KZG A;  5JHG A;  3X23 A;  2YS3 A;  2D9V A;  1EAZ A;  3TW1 A;  1BTK A;  2D9Z A;  3SYX A;  2L2I A;  3B77 A;  1UNP A;  2ZPY A;  4K81 A;  4L6E A;  3P7Z A;  3VIA A;  1H10 A;  4HAW B;  4HAT B;  2CY4 A;  2K2J A;  3BJI A;  3ODX A;  4CSQ A;  4EJN A;  3DCX A;  1ZYI A;  4Z2M B;  4A6H A;  1E5W A;  2RGN B;  2Z13 A;  3F5R A;  1NTV A;  3PVW A;  2EJ8 A;  3CXB B;  1FHO A;  4F7U P;  3AU5 A;  1MIX A;  4HAY B;  2RRF A;  2P0H A;  4WJ7 A;  2AL6 A;  3A8Q A;  3WYF B;  3T06 A;  1H4R A;  3KY9 A;  1U5E A;  3DXD A;  4WVF B;  2OQB A;  3PZD A;  1LW3 A;  5D3V A; 
#chains in the Genus database with same CATH homology
 1X1G A;  3KRW A;  3F0W A;  2D11 A;  2D4Q A;  2OTX A;  3TVV A;  2DHJ A;  3SO6 A;  2Z0O A;  1NTY A;  4MT7 A;  2YVC A;  2P0D A;  1V88 A;  1DDM A;  4MK0 A;  1GC6 A;  5CLL B;  2DX5 A;  2UVM A;  5J3T A;  1XKE A;  4HB4 B;  4F7H A;  1FOE A;  1DDW A;  2NZ8 B;  2XQN M;  2I1J A;  4DBB A;  1FGZ A;  1UEF A;  5EFX A;  3TCA A;  4BBK A;  1BTN A;  5JLJ B;  1AQC A;  4HDQ A;  3SUZ A;  4IAP A;  1PMS A;  4GPT B;  4D0N B;  1WJ1 A;  5J3Y A;  2DFK A;  2K2U A;  3QWM A;  5JP4 A;  2COC A;  2E2X A;  1WI1 A;  2UZR A;  2EMS A;  5D27 A;  2Y8F A;  1V5U A;  1WGU A;  2DYN A;  2I1K A;  2HE7 A;  1Y19 B;  1ZC3 B;  4CHJ A;  1U27 A;  1RJ2 A;  4EMO A;  3FM8 C;  5DHF B;  2H7E A;  5DIF B;  3PG7 A;  2ELB A;  5HE1 A;  1WVH A;  4HB2 B;  2IYB A;  1MPH A;  5DHA B;  1NU2 A;  4XWX A;  4C0A A;  3ULB A;  1KZ7 A;  3HW2 B;  4ZRI A;  2ELA A;  1P6S A;  5JHH A;  1U5D A;  2R0D A;  1DYN A;  2KGX B;  1FGY A;  1NI2 A;  1MIZ B;  1UPR A;  2V76 A;  2CY5 A;  1OMW A;  2DLW A;  4GN1 A;  1EGX A;  2BCJ A;  2AEH A;  1P3R A;  2DKQ A;  4A6F B;  1FHX A;  2UZS A;  3KZ1 A;  5KCV A;  2ADZ A;  2KCJ A;  4GZU A;  1OQN A;  3D8F A;  4K2O A;  3PVL A;  5FI0 A;  4TKN A;  3PVU A;  1K5D B;  4CHM A;  3PSC A;  2YT1 A;  4Y94 A;  1UNR A;  3HQC A;  1WGQ A;  1V89 A;  1J0W A;  1U5F A;  1SHC A;  2VRW B;  1XOD A;  1MAI A;  5D3Y A;  1QQG A;  4K2P A;  2Z0Q A;  3FEH A;  4P7I A;  5LOP B;  2PZ1 A;  3D8D A;  4KAX B;  3U8Z A;  5C79 A;  4B6H A;  4DX9 0;  1U5G A;  4HDO A;  4HAV B;  4YON A;  3V5W A;  1X05 A;  1MKE A;  4HB3 B;  5C5B B;  4F7G A;  2H7D A;  4HAX B;  4PQ0 A;  1WJM A;  2QKM A;  5DH9 B;  4NSW A;  2EMT A;  3AJ4 A;  2D9W A;  1J19 A;  1XR0 B;  1K5G B;  1UPQ A;  2YT0 A;  1PLS A;  3KRX A;  4HHV A;  2YRY A;  1DDV A;  5D3X A;  2K00 A;  4K17 A;  1DBH A;  2LUL A;  4DXA B;  3QIJ A;  3G9W A;  4IFS A;  4HAU B;  5FI1 A;  3U7D A;  2ROV A;  3PEG A;  2W2X D;  1WG7 A;  2D10 A;  2GCJ A;  5KQ4 A;  3ODW A;  4H8S A;  1V61 A;  1P5T A;  2YSZ A;  4ZRK A;  1X1F A;  5C16 A;  2J0K A;  5DI9 B;  2GS0 A;  2D9X A;  3IVF A;  1BWN A;  4KHO A;  2DTC A;  1FAO A;  1Y5O A;  1QC6 A;  5L81 A;  3SNH A;  1B55 A;  5D3W A;  3OAN A;  4IOY X;  2DA0 A;  4HB0 B;  4CYE A;  2GJY A;  2RSG A;  3M1I B;  1IRS A;  2YS1 A;  1RRP B;  1W1H A;  3GYP A;  1GG3 A;  1OY2 A;  2P0F A;  2P8V A;  1ISN A;  3AU4 A;  2COA A;  2X18 A;  5GOW B;  2GCL A;  4KVG B;  3PP2 A;  2LKO A;  2Z0P A;  1W1G A;  1U29 A;  1W1D A;  2M38 A;  3TFM A;  1XD4 A;  2DX1 A;  2YS5 A;  2Y7B A;  1ZM0 A;  1SGH A;  2QKL A;  3DXE A;  1LB1 A;  3TO1 A;  1UNQ A;  4GXB A;  4EKU A;  1N3H A;  2RLO A;  4TYZ A;  4HAZ B;  2N0Y A;  4KHB B;  2Q13 A;  5C6R A;  4A5K A;  4MY6 A;  3BIN A;  1ZVR A;  2J0J A;  5HE0 A;  2J59 M;  2DYQ A;  2I5F A;  2N23 A;  3P6A A;  4A6F A;  2KUP A;  2LOZ A;  2RVB B;  1U2B A;  3SV1 A;  1I7A A;  1AWE A;  2R09 A;  1EF1 A;  3A98 B;  3WA0 A;  3D8E A;  2L1C A;  1MK9 B;  1GC7 A;  2DHI A;  5LON B;  1PFJ A;  2I5C A;  2COD A;  1BAK A;  3CIK A;  3ZVR A;  3KSY A;  1X11 A;  2VSZ A;  2NMB A;  1TJ6 A;  3ML4 A;  2YF0 A;  3ZDT A;  2MDX A;  1ZC4 B;  5KQ1 A;  3HK0 A;  1FHW A;  1DRO A;  1V5P A;  2VKI A;  1M7E A;  1X86 A;  1KI1 B;  2LOX A;  3ODO A;  5J3Q A;  2HTH B;  1TXD A;  2LG1 A;  2D9Y A;  3ULC A;  4DX8 A;  2MKR A;  3QBV B;  2ROZ B;  4YL8 A;  2Y8G A;  1M7R A;  2RUK B;  1EVH A;  2W2W A;  4ZRJ A;  3LJU X;  2DKP A;  1FB8 A;  4KHA A;  2COF A;  2IFS A;  2J0M A;  3FSS A;  3DXC A;  5C5B A;  1XX0 A;  4GMX B;  2D2Q A;  3MPX A;  4A6K A;  1V5M A;  2RNR B;  2M14 A;  4WSF A;  1MK7 B;  1I2H A;  1Q67 A;  1ZSQ A;  3NSU A;  3RCP A;  1XCG A;  3A8P A;  2DN6 A;  2EC1 A;  3GYO A;  4PNK A;  2MFQ A;  4Z2N A;  2LYD A;  3MDB C;  3O96 A;  2W2X C;  1Z87 A;  4NY0 A;  2CRF A;  3UZT A;  2MWN B;  5HE2 A;  5HE3 A;  2DHK A;  2FJL A;  5CLQ B;  3VOQ A;  2G35 A;  3N7C A;  2JP2 A;  2CAY A;  1TQZ A;  4GMV A;  1KZG A;  5JHG A;  3X23 A;  2YS3 A;  2D9V A;  1EAZ A;  3TW1 A;  1BTK A;  2D9Z A;  3SYX A;  2L2I A;  1UNP A;  2ZPY A;  4K81 A;  4L6E A;  3P7Z A;  3VIA A;  1H10 A;  4HAW B;  4HAT B;  2CY4 A;  2K2J A;  3BJI A;  3ODX A;  4EJN A;  4Z2M B;  4A6H A;  1E5W A;  2RGN B;  3F5R A;  1NTV A;  3PVW A;  2EJ8 A;  3CXB B;  1FHO A;  4F7U P;  3AU5 A;  1MIX A;  4HAY B;  2P0H A;  4WJ7 A;  2AL6 A;  3A8Q A;  3WYF B;  3T06 A;  1H4R A;  3KY9 A;  1U5E A;  3DXD A;  4WVF B;  2OQB A;  3PZD A;  1LW3 A;  5D3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...