2YT1A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
185
structure length
185
Chain Sequence
b'GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGPSSGIEGRGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 25
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt1A01
1DDVA 1WG7A 2I1KA 3G9WA 2MWNB 3PP2A 1WGUA 4GXBA 1FHWA 5J3YA 1XKEA 1UNQA 2DLWA 3UZTA 3X23A 3M1IB 1E5WA 1KZGA 2J0KA 1V5PA 1PFJA 3D8FA 4HAZB 2Z0OA 1PMSA 4K2OA 4HATB 3V5WA 3SYXA 4HAWB 5D3XA 4HHVA 1FHOA 2CODA 1FGZA 2Q13A 2X18A 1UEFA 2P0HA 2DN6A 4KHBB 5JLJB 3VOQA 4HAYB 2E2XA 2YS3A 1DDMA 4HDQA 1RRPB 3BINA 3MPXA 2AEHA 4B6HA 4KAXB 1KZ7A 5DIFB 2LOXA 5J3TA 2P8VA 4YL8A 5HE1A 2D2QA 4Z2NA 3PEGA 1MK7B 1GC7A 4HB2B 3VIAA 1WVHA 3WA0A 2RLOA 3GYOA 2MFQA 4PQ0A 3TFMA 4CHMA 4EJNA 4ZRKA 2ELAA 5GOWB 1MK9B 1P6SA 1XX0A 1Y19B 1ZVRA 2DA0A 1UPRA 4A6KA 2ROZB 2VRWB 4HAVB 2W2XD 2DFKA 1XD4A 3O96A 4K81A 1SHCA 5DH9B 1ZC4B 2IYBA 2N23A 4Z2MB 2K2JA 1EVHA 4K2PA 1MIXA 1AWEA 1H4RA 2UZRA 2I1JA 2YT0A 1RJ2A 5DI9B 1TQZA 1AQCA 2W2WA 5DHFB 1WJ1A 3KRWA 1M7RA 3SO6A 1ZC3B 1V5MA 2M38A 2CY4A 2DHIA 2W2XC 2BCJA 1BTKA 2DKPA 1DROA 1V89A 5C6RA 1FOEA 3F5RA 3U8ZA 4GMXB 4HDOA 1OY2A 5LOPB 2QKLA 4GZUA 3SNHA 2XQNM 3FSSA 4DXAB 2D9XA 4YONA 5C5BB 1UPQA 2UZSA 2ZPYA 5J3QA 1J0WA 1NI2A 1TJ6A 2J0JA 2J59M 2GS0A 2KCJA 2Z0PA 3PSCA 4DX90 2DTCA 1GG3A 3D8DA 3GYPA 2DX1A 3AU5A 1SGHA 3A8QA 1MPHA 5JHGA 1KI1B 2COFA 5JHHA 1EF1A 3ODOA 3U7DA 4CYEA 3BJIA 4KHOA 3QWMA 4F7UP 4DX8A 2MDXA 4IAPA 4GPTB 1U2BA 1U5DA 4HAXB 4MT7A 3FEHA 2EMTA 1W1GA 2OTXA 1OQNA 1LW3A 1X05A 2GJYA 1BWNA 1DBHA 2D9YA 1UNRA 1U5EA 2K00A 4HAUB 3KSYA 3T06A 2MKRA 4HB0B 3PZDA 5HE3A 3DXEA 5C16A 1WGQA 2D9ZA 2Y8GA 4EKUA 4GN1A 2ADZA 2JP2A 1NTYA 4D0NB 3N7CA 3KZ1A 2CAYA 3TVVA 2D10A 2YF0A 3HK0A 1U5FA 5HE2A 5FI0A 1NTVA 3HQCA 4MK0A 3IVFA 5KQ1A 1U27A 2I5CA 2KUPA 5CLQB 4A5KA 2LG1A 4GMVA 5L81A 1V5UA 5FI1A 3DXDA 3ODXA 5LONB 3P7ZA 5C79A 2COAA 2CY5A 2D9WA 1K5GB 2EC1A 2HE7A 3KRXA 1X11A 1DYNA 2Z0QA 5D27A 4Y94A 2P0DA 2YRYA 3QIJA 3SV1A 3TW1A 2VKIA 3D8EA 3LJUX 2OQBA 2QKMA 4TKNA 5KQ4A 2J0MA 1XCGA 2LOZA 3HW2B 4F7GA 1MIZB 5EFXA 2V76A 2PZ1A 2CRFA 3A98B 4HB3B 2YT1A 1DDWA 2NMBA 4HB4B 1K5DB 2UVMA 2GCLA 4CHJA 2DYNA 4IOYX 5JP4A 3NSUA 1WI1A 2RUKB 3PVWA 1GC6A 1FGYA 2L2IA 3A8PA 2KGXB 1ZM0A 4F7HA 1Q67A 2RVBB 2P0FA 1H10A 3ZVRA 1XR0B 4TYZA 1X1GA 4P7IA 2AL6A 3KY9A 3PVLA 1U5GA 3ULBA 1V88A 1PLSA 1EAZA 2DHKA 1XODA 1ISNA 1LB1A 1M7EA 1FAOA 2DX5A 3CXBB 3CIKA 1UNPA 2R0DA 2G35A 3P6AA 2EMSA 1P3RA 3ODWA 2HTHB 2YS5A 3ML4A 3WYFB 1IRSA 1QQGA 2H7EA 2IFSA 4NY0A 2DYQA 1ZSQA 2LULA 5KCVA 2M14A 5D3YA 1MAIA 1W1HA 3OANA 5D3VA 2I5FA 2YSZA 1N3HA 3AU4A 4KHAA 1I2HA 2DKQA 2Y7BA 1FHXA 2RGNB 3F0WA 4XWXA 4IFSA 2L1CA 2LKOA 3ZDTA 4ZRJA 2VSZA 1W1DA 1U29A 1FB8A 4WJ7A 1OMWA 2ROVA 4H8SA 2ELBA 1TXDA 4EMOA 5DHAB 1X1FA 4A6HA 2Y8FA 4C0AA 2NZ8B 5D3WA 4A6FA 3FM8C 4KVGB 1QC6A 2K2UA 1NU2A 2N0YA 3SUZA 1J19A 4K17A 4WVFB 3TO1A 4A6FB 1X86A 4WSFA 3ULCA 1P5TA 4ZRIA 2COCA 2D4QA 4BBKA 2D11A 1I7AA 2EJ8A 3QBVB 3TCAA 2GCJA 2RSGA 4NSWA 1WJMA 3AJ4A 2H7DA 4PNKA 5HE0A 5CLLB 2RNRB 3DXCA 5C5BA 3PG7A 2R09A 1MKEA 1B55A 1V61A 4L6EA 2FJLA 2LYDA 4DBBA 2YS1A 1BTNA 1Z87A 1BAKA 4MY6A 3RCPA 1EGXA 2D9VA 2YVCA 3MDBC 1Y5OA 3PVUA 2DHJA
chains in the Genus database with same CATH superfamily
1DDVA 1WG7A 2I1KA 3G9WA 2MWNB 3PP2A 1WGUA 4GXBA 1FHWA 5J3YA 1XKEA 1UNQA 2K49A 2DLWA 3UZTA 3X23A 3M1IB 1E5WA 1KZGA 2J0KA 1V5PA 1PFJA 2Z59A 3D8FA 4HAZB 2Z0OA 4KHBA 1PMSA 4K2OA 4HATB 3V5WA 3SYXA 4HAWB 5D3XA 4HHVA 1FHOA 2CODA 1FGZA 2Q13A 2X18A 1UEFA 2P0HA 2DN6A 3NWFA 4KHBB 5JLJB 3VOQA 4HAYB 2E2XA 2YS3A 1DDMA 4HDQA 1RRPB 3BINA 3MPXA 2AEHA 4B6HA 4KAXB 1KZ7A 5DIFB 2LOXA 5J3TA 2P8VA 4YL8A 5HE1A 2D2QA 4Z2NA 3PEGA 2K8EA 4GNKB 1MK7B 1GC7A 4HB2B 3VIAA 1WVHA 3WA0A 2RLOA 3GYOA 2MFQA 4OT1A 4PQ0A 3TFMA 4CHMA 4EJNA 4ZRKA 2ELAA 5GOWB 1MK9B 1P6SA 1XX0A 1Y19B 1ZVRA 2DA0A 1UPRA 4A6KA 2ROZB 2VRWB 4HAVB 2W2XD 1ZYIA 2DFKA 1XD4A 3O96A 4K81A 1SHCA 5DH9B 1ZC4B 2IYBA 2N23A 4Z2MB 2K2JA 1EVHA 4K2PA 1MIXA 1AWEA 1H4RA 2UZRA 2I1JA 2YT0A 1RJ2A 5DI9B 1TQZA 1AQCA 2W2WA 5DHFB 1WJ1A 3KRWA 1M7RA 3SO6A 1ZC3B 1V5MA 2M38A 2CY4A 2DHIA 2W2XC 2BCJA 5IRSA 1BTKA 2DKPA 1DROA 1V89A 5C6RA 1FOEA 3F5RA 3U8ZA 4GMXB 4HDOA 1OY2A 2RRFA 5LOPB 2QKLA 4GZUA 3SNHA 2XQNM 3FSSA 4DXAB 2KUQA 2D9XA 4YONA 5C5BB 1UPQA 2UZSA 2ZPYA 5J3QA 1J0WA 1NI2A 1TJ6A 2J0JA 2J59M 2KIGA 2GS0A 2KCJA 2Z0PA 3PSCA 4DX90 2DTCA 1GG3A 3D8DA 3GYPA 2DX1A 3AU5A 1SGHA 3A8QA 1MPHA 5M4YB 5JHGA 1KI1B 2COFA 5JHHA 1EF1A 3ODOA 3U7DA 4CYEA 3BJIA 4KHOA 1MI1A 3QWMA 4F7UP 4DX8A 2MDXA 3HSAA 4IAPA 4GPTB 1U2BA 1U5DA 4HAXB 5LG4B 4MT7A 3FEHA 2EMTA 1W1GA 2OTXA 3A58A 1OQNA 3NWAA 1LW3A 3U12A 1X05A 2GJYA 1BWNA 4CSQA 1DBHA 2D9YA 2KR0A 5I2SA 2Z14A 1UNRA 1U5EA 2K00A 4HAUB 3KSYA 3T06A 2MKRA 4HB0B 3PZDA 5HE3A 3DXEA 5C16A 1WGQA 3HIEA 4QXAB 2D9ZA 2Y8GA 4EKUA 4GN1A 2ADZA 2JP2A 1NTYA 4D0NB 3N7CA 3KZ1A 2CAYA 3TVVA 2D10A 2YF0A 3HK0A 1U5FA 3B77A 5I2MA 5HE2A 5FI0A 1NTVA 3HQCA 4MK0A 3IVFA 5KQ1A 1U27A 2YT2A 2I5CA 2KUPA 5CLQB 2Z13A 4A5KA 2LG1A 4GMVA 5L81A 1V5UA 5FI1A 3DXDA 3ODXA 5LONB 3P7ZA 3NWDA 5C79A 2COAA 2CY5A 2D9WA 4HSIA 1K5GB 2EC1A 2HE7A 3KRXA 1X11A 1DYNA 4QJ3B 2Z0QA 5D27A 4Y94A 2P0DA 2YRYA 3NW8A 3QIJA 3SV1A 3TW1A 2VKIA 3D8EA 4L1RA 3LJUX 2OQBA 2QKMA 4TKNA 4D6WA 5KQ4A 1T77A 2J0MA 1XCGA 2LOZA 3HW2B 4F7GA 1MIZB 5EFXA 2V76A 2PZ1A 2CRFA 3A98B 4HB3B 2YT1A 1DDWA 2NMBA 4HB4B 1K5DB 2UVMA 2R2YA 2GCLA 4CHJA 2DYNA 4IOYX 5JP4A 3NSUA 1WI1A 2RUKB 3PVWA 1GC6A 1FGYA 2L2IA 3A8PA 2KGXB 1ZM0A 4F7HA 1Q67A 4QJ4B 2RVBB 2P0FA 1H10A 3ZVRA 1XR0B 4TYZA 3FVCA 1X1GA 2KIEA 4P7IA 2AL6A 3KY9A 3PVLA 2GUMA 1U5GA 3ULBA 1V88A 1PLSA 1EAZA 2DHKA 1XODA 1ISNA 4QJ5B 1LB1A 1M7EA 1FAOA 2DX5A 3CXBB 3CIKA 1UNPA 2R0DA 2G35A 3P6AA 2EMSA 1P3RA 3ODWA 2HTHB 2YS5A 3ML4A 3WYFB 3DCXA 1IRSA 1QQGA 2H7EA 2IFSA 4NY0A 2DYQA 1ZSQA 2LULA 4DIXA 2M14A 5KCVA 5D3YA 1MAIA 1W1HA 3OANA 5D3VA 2I5FA 2YSZA 1N3HA 3AU4A 4OSNA 4KHAA 1I2HA 2DKQA 2Y7BA 1FHXA 2RGNB 3F0WA 4XWXA 4IFSA 2L1CA 2LKOA 3ZDTA 4ZRJA 2ZKMX 2VSZA 1W1DA 1U29A 1FB8A 4WJ7A 1OMWA 2ROVA 4H8SA 2ELBA 1TXDA 2FJUB 4EMOA 5DHAB 1X1FA 4A6HA 2Y8FA 4C0AA 2NZ8B 5D3WA 4A6FA 3FM8C 4KVGB 1QC6A 2NBVA 2K2UA 1NU2A 2N0YA 3SUZA 1J19A 2Z4DA 4K17A 4WVFB 3TO1A 4A6FB 3OHMB 1X86A 4WSFA 3ULCA 1P5TA 4ZRIA 2COCA 2D4QA 4BBKA 2D11A 1I7AA 2EJ8A 3QBVB 3TCAA 2GCJA 2RSGA 4NSWA 1WJMA 3AJ4A 2H7DA 4PNKA 5HE0A 4GOUA 5CLLB 2RNRB 3DXCA 5C5BA 2R09A 3PG7A 1MKEA 1B55A 1V61A 4L6EA 2FJLA 2LYDA 4DBBA 2YS1A 1BTNA 1Z87A 1BAKA 4MY6A 3RCPA 1EGXA 2D9VA 2YVCA 3MDBC 1Y5OA 3PVUA 2DHJA
chains in the Genus database with same CATH topology
1DDVA 1WG7A 2I1KA 3G9WA 2MWNB 3PP2A 1WGUA 4GXBA 1FHWA 5J3YA 1XKEA 1UNQA 2DLWA 3UZTA 3X23A 3M1IB 1E5WA 1KZGA 2J0KA 1V5PA 1PFJA 3D8FA 4HAZB 2Z0OA 1PMSA 4K2OA 4HATB 3V5WA 3SYXA 4HAWB 5D3XA 4HHVA 1FHOA 2CODA 1FGZA 2Q13A 2X18A 1UEFA 2P0HA 2DN6A 4KHBB 5JLJB 3VOQA 4HAYB 2E2XA 2YS3A 1DDMA 4HDQA 1RRPB 3BINA 3MPXA 2AEHA 4B6HA 4KAXB 1KZ7A 5DIFB 2LOXA 5J3TA 2P8VA 4YL8A 5HE1A 2D2QA 4Z2NA 3PEGA 1MK7B 1GC7A 4HB2B 3VIAA 1WVHA 3WA0A 2RLOA 3GYOA 2MFQA 4PQ0A 3TFMA 4CHMA 4EJNA 4ZRKA 2ELAA 5GOWB 1MK9B 1P6SA 1XX0A 1Y19B 1ZVRA 2DA0A 1UPRA 4A6KA 2ROZB 2VRWB 4HAVB 2W2XD 2DFKA 1XD4A 3O96A 4K81A 1SHCA 5DH9B 1ZC4B 2IYBA 2N23A 4Z2MB 2K2JA 1EVHA 4K2PA 1MIXA 1AWEA 1H4RA 2UZRA 2I1JA 2YT0A 1RJ2A 5DI9B 1TQZA 1AQCA 2W2WA 5DHFB 1WJ1A 3KRWA 1M7RA 3SO6A 1ZC3B 1V5MA 2M38A 2CY4A 2DHIA 2W2XC 2BCJA 1BTKA 2DKPA 1DROA 1V89A 5C6RA 1FOEA 3F5RA 3U8ZA 4GMXB 4HDOA 1OY2A 5LOPB 2QKLA 4GZUA 3SNHA 2XQNM 3FSSA 4DXAB 2D9XA 4YONA 5C5BB 1UPQA 2UZSA 2ZPYA 5J3QA 1J0WA 1NI2A 1TJ6A 2J0JA 2J59M 2GS0A 2KCJA 2Z0PA 3PSCA 4DX90 2DTCA 1GG3A 3D8DA 3GYPA 2DX1A 3AU5A 1SGHA 3A8QA 1MPHA 5JHGA 1KI1B 2COFA 5JHHA 1EF1A 3ODOA 3U7DA 4CYEA 3BJIA 4KHOA 3QWMA 4F7UP 4DX8A 2MDXA 4IAPA 4GPTB 1U2BA 1U5DA 4HAXB 4MT7A 3FEHA 2EMTA 1W1GA 2OTXA 1OQNA 1LW3A 1X05A 2GJYA 1BWNA 1DBHA 2D9YA 1UNRA 1U5EA 2K00A 4HAUB 3KSYA 3T06A 2MKRA 4HB0B 3PZDA 5HE3A 3DXEA 5C16A 1WGQA 2D9ZA 2Y8GA 4EKUA 4GN1A 2ADZA 2JP2A 1NTYA 4D0NB 3N7CA 3KZ1A 2CAYA 3TVVA 2D10A 2YF0A 3HK0A 1U5FA 5HE2A 5FI0A 1NTVA 3HQCA 4MK0A 3IVFA 5KQ1A 1U27A 2I5CA 2KUPA 5CLQB 4A5KA 2LG1A 4GMVA 5L81A 1V5UA 5FI1A 3DXDA 3ODXA 5LONB 3P7ZA 5C79A 2COAA 2CY5A 2D9WA 1K5GB 2EC1A 2HE7A 3KRXA 1X11A 1DYNA 2Z0QA 5D27A 4Y94A 2P0DA 2YRYA 3QIJA 3SV1A 3TW1A 2VKIA 3D8EA 3LJUX 2OQBA 2QKMA 4TKNA 5KQ4A 2J0MA 1XCGA 2LOZA 3HW2B 4F7GA 1MIZB 5EFXA 2V76A 2PZ1A 2CRFA 3A98B 4HB3B 2YT1A 1DDWA 2NMBA 4HB4B 1K5DB 2UVMA 2GCLA 4CHJA 2DYNA 4IOYX 5JP4A 3NSUA 1WI1A 2RUKB 3PVWA 1GC6A 1FGYA 2L2IA 3A8PA 2KGXB 1ZM0A 4F7HA 1Q67A 2RVBB 2P0FA 1H10A 3ZVRA 1XR0B 4TYZA 1X1GA 4P7IA 2AL6A 3KY9A 3PVLA 1U5GA 3ULBA 1V88A 1PLSA 1EAZA 2DHKA 1XODA 1ISNA 1LB1A 1M7EA 1FAOA 2DX5A 3CXBB 3CIKA 1UNPA 2R0DA 2G35A 3P6AA 2EMSA 1P3RA 3ODWA 2HTHB 2YS5A 3ML4A 3WYFB 1IRSA 1QQGA 2H7EA 2IFSA 4NY0A 2DYQA 1ZSQA 2LULA 5KCVA 2M14A 5D3YA 1MAIA 1W1HA 3OANA 5D3VA 2I5FA 2YSZA 1N3HA 3AU4A 4KHAA 1I2HA 2DKQA 2Y7BA 1FHXA 2RGNB 3F0WA 4XWXA 4IFSA 2L1CA 2LKOA 3ZDTA 4ZRJA 2VSZA 1W1DA 1U29A 1FB8A 4WJ7A 1OMWA 2ROVA 4H8SA 2ELBA 1TXDA 4EMOA 5DHAB 1X1FA 4A6HA 2Y8FA 4C0AA 2NZ8B 5D3WA 4A6FA 3FM8C 4KVGB 1QC6A 2K2UA 1NU2A 2N0YA 3SUZA 1J19A 4K17A 4WVFB 3TO1A 4A6FB 1X86A 4WSFA 3ULCA 1P5TA 4ZRIA 2COCA 2D4QA 4BBKA 2D11A 1I7AA 2EJ8A 3QBVB 3TCAA 2GCJA 2RSGA 4NSWA 1WJMA 3AJ4A 2H7DA 4PNKA 5HE0A 5CLLB 2RNRB 3DXCA 5C5BA 3PG7A 2R09A 1MKEA 1B55A 1V61A 4L6EA 2FJLA 2LYDA 4DBBA 2YS1A 1BTNA 1Z87A 1BAKA 4MY6A 3RCPA 1EGXA 2D9VA 2YVCA 3MDBC 1Y5OA 3PVUA 2DHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDV A;  1WG7 A;  2I1K A;  3G9W A;  2MWN B;  3PP2 A;  1WGU A;  4GXB A;  1FHW A;  5J3Y A;  1XKE A;  1UNQ A;  2DLW A;  3UZT A;  3X23 A;  3M1I B;  1E5W A;  1KZG A;  2J0K A;  1V5P A;  1PFJ A;  3D8F A;  4HAZ B;  2Z0O A;  1PMS A;  4K2O A;  4HAT B;  3V5W A;  3SYX A;  4HAW B;  5D3X A;  4HHV A;  1FHO A;  2COD A;  1FGZ A;  2Q13 A;  2X18 A;  1UEF A;  2P0H A;  2DN6 A;  4KHB B;  5JLJ B;  3VOQ A;  4HAY B;  2E2X A;  2YS3 A;  1DDM A;  4HDQ A;  1RRP B;  3BIN A;  3MPX A;  2AEH A;  4B6H A;  4KAX B;  1KZ7 A;  5DIF B;  2LOX A;  5J3T A;  2P8V A;  4YL8 A;  5HE1 A;  2D2Q A;  4Z2N A;  3PEG A;  1MK7 B;  1GC7 A;  4HB2 B;  3VIA A;  1WVH A;  3WA0 A;  2RLO A;  3GYO A;  2MFQ A;  4PQ0 A;  3TFM A;  4CHM A;  4EJN A;  4ZRK A;  2ELA A;  5GOW B;  1MK9 B;  1P6S A;  1XX0 A;  1Y19 B;  1ZVR A;  2DA0 A;  1UPR A;  4A6K A;  2ROZ B;  2VRW B;  4HAV B;  2W2X D;  2DFK A;  1XD4 A;  3O96 A;  4K81 A;  1SHC A;  5DH9 B;  1ZC4 B;  2IYB A;  2N23 A;  4Z2M B;  2K2J A;  1EVH A;  4K2P A;  1MIX A;  1AWE A;  1H4R A;  2UZR A;  2I1J A;  2YT0 A;  1RJ2 A;  5DI9 B;  1TQZ A;  1AQC A;  2W2W A;  5DHF B;  1WJ1 A;  3KRW A;  1M7R A;  3SO6 A;  1ZC3 B;  1V5M A;  2M38 A;  2CY4 A;  2DHI A;  2W2X C;  2BCJ A;  1BTK A;  2DKP A;  1DRO A;  1V89 A;  5C6R A;  1FOE A;  3F5R A;  3U8Z A;  4GMX B;  4HDO A;  1OY2 A;  5LOP B;  2QKL A;  4GZU A;  3SNH A;  2XQN M;  3FSS A;  4DXA B;  2D9X A;  4YON A;  5C5B B;  1UPQ A;  2UZS A;  2ZPY A;  5J3Q A;  1J0W A;  1NI2 A;  1TJ6 A;  2J0J A;  2J59 M;  2GS0 A;  2KCJ A;  2Z0P A;  3PSC A;  4DX9 0;  2DTC A;  1GG3 A;  3D8D A;  3GYP A;  2DX1 A;  3AU5 A;  1SGH A;  3A8Q A;  1MPH A;  5JHG A;  1KI1 B;  2COF A;  5JHH A;  1EF1 A;  3ODO A;  3U7D A;  4CYE A;  3BJI A;  4KHO A;  3QWM A;  4F7U P;  4DX8 A;  2MDX A;  4IAP A;  4GPT B;  1U2B A;  1U5D A;  4HAX B;  4MT7 A;  3FEH A;  2EMT A;  1W1G A;  2OTX A;  1OQN A;  1LW3 A;  1X05 A;  2GJY A;  1BWN A;  1DBH A;  2D9Y A;  1UNR A;  1U5E A;  2K00 A;  4HAU B;  3KSY A;  3T06 A;  2MKR A;  4HB0 B;  3PZD A;  5HE3 A;  3DXE A;  5C16 A;  1WGQ A;  2D9Z A;  2Y8G A;  4EKU A;  4GN1 A;  2ADZ A;  2JP2 A;  1NTY A;  4D0N B;  3N7C A;  3KZ1 A;  2CAY A;  3TVV A;  2D10 A;  2YF0 A;  3HK0 A;  1U5F A;  5HE2 A;  5FI0 A;  1NTV A;  3HQC A;  4MK0 A;  3IVF A;  5KQ1 A;  1U27 A;  2I5C A;  2KUP A;  5CLQ B;  4A5K A;  2LG1 A;  4GMV A;  5L81 A;  1V5U A;  5FI1 A;  3DXD A;  3ODX A;  5LON B;  3P7Z A;  5C79 A;  2COA A;  2CY5 A;  2D9W A;  1K5G B;  2EC1 A;  2HE7 A;  3KRX A;  1X11 A;  1DYN A;  2Z0Q A;  5D27 A;  4Y94 A;  2P0D A;  2YRY A;  3QIJ A;  3SV1 A;  3TW1 A;  2VKI A;  3D8E A;  3LJU X;  2OQB A;  2QKM A;  4TKN A;  5KQ4 A;  2J0M A;  1XCG A;  2LOZ A;  3HW2 B;  4F7G A;  1MIZ B;  5EFX A;  2V76 A;  2PZ1 A;  2CRF A;  3A98 B;  4HB3 B;  2YT1 A;  1DDW A;  2NMB A;  4HB4 B;  1K5D B;  2UVM A;  2GCL A;  4CHJ A;  2DYN A;  4IOY X;  5JP4 A;  3NSU A;  1WI1 A;  2RUK B;  3PVW A;  1GC6 A;  1FGY A;  2L2I A;  3A8P A;  2KGX B;  1ZM0 A;  4F7H A;  1Q67 A;  2RVB B;  2P0F A;  1H10 A;  3ZVR A;  1XR0 B;  4TYZ A;  1X1G A;  4P7I A;  2AL6 A;  3KY9 A;  3PVL A;  1U5G A;  3ULB A;  1V88 A;  1PLS A;  1EAZ A;  2DHK A;  1XOD A;  1ISN A;  1LB1 A;  1M7E A;  1FAO A;  2DX5 A;  3CXB B;  3CIK A;  1UNP A;  2R0D A;  2G35 A;  3P6A A;  2EMS A;  1P3R A;  3ODW A;  2HTH B;  2YS5 A;  3ML4 A;  3WYF B;  1IRS A;  1QQG A;  2H7E A;  2IFS A;  4NY0 A;  2DYQ A;  1ZSQ A;  2LUL A;  5KCV A;  2M14 A;  5D3Y A;  1MAI A;  1W1H A;  3OAN A;  5D3V A;  2I5F A;  2YSZ A;  1N3H A;  3AU4 A;  4KHA A;  1I2H A;  2DKQ A;  2Y7B A;  1FHX A;  2RGN B;  3F0W A;  4XWX A;  4IFS A;  2L1C A;  2LKO A;  3ZDT A;  4ZRJ A;  2VSZ A;  1W1D A;  1U29 A;  1FB8 A;  4WJ7 A;  1OMW A;  2ROV A;  4H8S A;  2ELB A;  1TXD A;  4EMO A;  5DHA B;  1X1F A;  4A6H A;  2Y8F A;  4C0A A;  2NZ8 B;  5D3W A;  4A6F A;  3FM8 C;  4KVG B;  1QC6 A;  2K2U A;  1NU2 A;  2N0Y A;  3SUZ A;  1J19 A;  4K17 A;  4WVF B;  3TO1 A;  4A6F B;  1X86 A;  4WSF A;  3ULC A;  1P5T A;  4ZRI A;  2COC A;  2D4Q A;  4BBK A;  2D11 A;  1I7A A;  2EJ8 A;  3QBV B;  3TCA A;  2GCJ A;  2RSG A;  4NSW A;  1WJM A;  3AJ4 A;  2H7D A;  4PNK A;  5HE0 A;  5CLL B;  2RNR B;  3DXC A;  5C5B A;  3PG7 A;  2R09 A;  1MKE A;  1B55 A;  1V61 A;  4L6E A;  2FJL A;  2LYD A;  4DBB A;  2YS1 A;  1BTN A;  1Z87 A;  1BAK A;  4MY6 A;  3RCP A;  1EGX A;  2D9V A;  2YVC A;  3MDB C;  1Y5O A;  3PVU A;  2DHJ A; 
#chains in the Genus database with same CATH topology
 1DDV A;  1WG7 A;  2I1K A;  3G9W A;  2MWN B;  3PP2 A;  1WGU A;  4GXB A;  1FHW A;  5J3Y A;  1XKE A;  1UNQ A;  2K49 A;  2DLW A;  3UZT A;  3X23 A;  3M1I B;  1E5W A;  1KZG A;  2J0K A;  1V5P A;  1PFJ A;  2Z59 A;  3D8F A;  4HAZ B;  2Z0O A;  4KHB A;  1PMS A;  4K2O A;  4HAT B;  3V5W A;  3SYX A;  4HAW B;  5D3X A;  4HHV A;  1FHO A;  2COD A;  1FGZ A;  2Q13 A;  2X18 A;  1UEF A;  2P0H A;  2DN6 A;  3NWF A;  4KHB B;  5JLJ B;  3VOQ A;  4HAY B;  2E2X A;  2YS3 A;  1DDM A;  4HDQ A;  1RRP B;  3BIN A;  3MPX A;  2AEH A;  4B6H A;  4KAX B;  1KZ7 A;  5DIF B;  2LOX A;  5J3T A;  2P8V A;  4YL8 A;  5HE1 A;  2D2Q A;  4Z2N A;  3PEG A;  2K8E A;  4GNK B;  1MK7 B;  1GC7 A;  4HB2 B;  3VIA A;  1WVH A;  3WA0 A;  2RLO A;  3GYO A;  2MFQ A;  4OT1 A;  4PQ0 A;  3TFM A;  4CHM A;  4EJN A;  4ZRK A;  2ELA A;  5GOW B;  1MK9 B;  1P6S A;  1XX0 A;  1Y19 B;  1ZVR A;  2DA0 A;  1UPR A;  4A6K A;  2ROZ B;  2VRW B;  4HAV B;  2W2X D;  1ZYI A;  2DFK A;  1XD4 A;  3O96 A;  4K81 A;  1SHC A;  5DH9 B;  1ZC4 B;  2IYB A;  2N23 A;  4Z2M B;  2K2J A;  1EVH A;  4K2P A;  1MIX A;  1AWE A;  1H4R A;  2UZR A;  2I1J A;  2YT0 A;  1RJ2 A;  5DI9 B;  1TQZ A;  1AQC A;  2W2W A;  5DHF B;  1WJ1 A;  3KRW A;  1M7R A;  3SO6 A;  1ZC3 B;  1V5M A;  2M38 A;  2CY4 A;  2DHI A;  2W2X C;  2BCJ A;  5IRS A;  1BTK A;  2DKP A;  1DRO A;  1V89 A;  5C6R A;  1FOE A;  3F5R A;  3U8Z A;  4GMX B;  4HDO A;  1OY2 A;  2RRF A;  5LOP B;  2QKL A;  4GZU A;  3SNH A;  2XQN M;  3FSS A;  4DXA B;  2KUQ A;  2D9X A;  4YON A;  5C5B B;  1UPQ A;  2UZS A;  2ZPY A;  5J3Q A;  1J0W A;  1NI2 A;  1TJ6 A;  2J0J A;  2J59 M;  2KIG A;  2GS0 A;  2KCJ A;  2Z0P A;  3PSC A;  4DX9 0;  2DTC A;  1GG3 A;  3D8D A;  3GYP A;  2DX1 A;  3AU5 A;  1SGH A;  3A8Q A;  1MPH A;  5M4Y B;  5JHG A;  1KI1 B;  2COF A;  5JHH A;  1EF1 A;  3ODO A;  3U7D A;  4CYE A;  3BJI A;  4KHO A;  1MI1 A;  3QWM A;  4F7U P;  4DX8 A;  2MDX A;  3HSA A;  4IAP A;  4GPT B;  1U2B A;  1U5D A;  4HAX B;  5LG4 B;  4MT7 A;  3FEH A;  2EMT A;  1W1G A;  2OTX A;  3A58 A;  1OQN A;  3NWA A;  1LW3 A;  3U12 A;  1X05 A;  2GJY A;  1BWN A;  4CSQ A;  1DBH A;  2D9Y A;  2KR0 A;  5I2S A;  2Z14 A;  1UNR A;  1U5E A;  2K00 A;  4HAU B;  3KSY A;  3T06 A;  2MKR A;  4HB0 B;  3PZD A;  5HE3 A;  3DXE A;  5C16 A;  1WGQ A;  3HIE A;  4QXA B;  2D9Z A;  2Y8G A;  4EKU A;  4GN1 A;  2ADZ A;  2JP2 A;  1NTY A;  4D0N B;  3N7C A;  3KZ1 A;  2CAY A;  3TVV A;  2D10 A;  2YF0 A;  3HK0 A;  1U5F A;  3B77 A;  5I2M A;  5HE2 A;  5FI0 A;  1NTV A;  3HQC A;  4MK0 A;  3IVF A;  5KQ1 A;  1U27 A;  2YT2 A;  2I5C A;  2KUP A;  5CLQ B;  2Z13 A;  4A5K A;  2LG1 A;  4GMV A;  5L81 A;  1V5U A;  5FI1 A;  3DXD A;  3ODX A;  5LON B;  3P7Z A;  3NWD A;  5C79 A;  2COA A;  2CY5 A;  2D9W A;  4HSI A;  1K5G B;  2EC1 A;  2HE7 A;  3KRX A;  1X11 A;  1DYN A;  4QJ3 B;  2Z0Q A;  5D27 A;  4Y94 A;  2P0D A;  2YRY A;  3NW8 A;  3QIJ A;  3SV1 A;  3TW1 A;  2VKI A;  3D8E A;  4L1R A;  3LJU X;  2OQB A;  2QKM A;  4TKN A;  4D6W A;  5KQ4 A;  1T77 A;  2J0M A;  1XCG A;  2LOZ A;  3HW2 B;  4F7G A;  1MIZ B;  5EFX A;  2V76 A;  2PZ1 A;  2CRF A;  3A98 B;  4HB3 B;  2YT1 A;  1DDW A;  2NMB A;  4HB4 B;  1K5D B;  2UVM A;  2R2Y A;  2GCL A;  4CHJ A;  2DYN A;  4IOY X;  5JP4 A;  3NSU A;  1WI1 A;  2RUK B;  3PVW A;  1GC6 A;  1FGY A;  2L2I A;  3A8P A;  2KGX B;  1ZM0 A;  4F7H A;  1Q67 A;  4QJ4 B;  2RVB B;  2P0F A;  1H10 A;  3ZVR A;  1XR0 B;  4TYZ A;  3FVC A;  1X1G A;  2KIE A;  4P7I A;  2AL6 A;  3KY9 A;  3PVL A;  2GUM A;  1U5G A;  3ULB A;  1V88 A;  1PLS A;  1EAZ A;  2DHK A;  1XOD A;  1ISN A;  4QJ5 B;  1LB1 A;  1M7E A;  1FAO A;  2DX5 A;  3CXB B;  3CIK A;  1UNP A;  2R0D A;  2G35 A;  3P6A A;  2EMS A;  1P3R A;  3ODW A;  2HTH B;  2YS5 A;  3ML4 A;  3WYF B;  3DCX A;  1IRS A;  1QQG A;  2H7E A;  2IFS A;  4NY0 A;  2DYQ A;  1ZSQ A;  2LUL A;  4DIX A;  2M14 A;  5KCV A;  5D3Y A;  1MAI A;  1W1H A;  3OAN A;  5D3V A;  2I5F A;  2YSZ A;  1N3H A;  3AU4 A;  4OSN A;  4KHA A;  1I2H A;  2DKQ A;  2Y7B A;  1FHX A;  2RGN B;  3F0W A;  4XWX A;  4IFS A;  2L1C A;  2LKO A;  3ZDT A;  4ZRJ A;  2ZKM X;  2VSZ A;  1W1D A;  1U29 A;  1FB8 A;  4WJ7 A;  1OMW A;  2ROV A;  4H8S A;  2ELB A;  1TXD A;  2FJU B;  4EMO A;  5DHA B;  1X1F A;  4A6H A;  2Y8F A;  4C0A A;  2NZ8 B;  5D3W A;  4A6F A;  3FM8 C;  4KVG B;  1QC6 A;  2NBV A;  2K2U A;  1NU2 A;  2N0Y A;  3SUZ A;  1J19 A;  2Z4D A;  4K17 A;  4WVF B;  3TO1 A;  4A6F B;  3OHM B;  1X86 A;  4WSF A;  3ULC A;  1P5T A;  4ZRI A;  2COC A;  2D4Q A;  4BBK A;  2D11 A;  1I7A A;  2EJ8 A;  3QBV B;  3TCA A;  2GCJ A;  2RSG A;  4NSW A;  1WJM A;  3AJ4 A;  2H7D A;  4PNK A;  5HE0 A;  4GOU A;  5CLL B;  2RNR B;  3DXC A;  5C5B A;  2R09 A;  3PG7 A;  1MKE A;  1B55 A;  1V61 A;  4L6E A;  2FJL A;  2LYD A;  4DBB A;  2YS1 A;  1BTN A;  1Z87 A;  1BAK A;  4MY6 A;  3RCP A;  1EGX A;  2D9V A;  2YVC A;  3MDB C;  1Y5O A;  3PVU A;  2DHJ A; 
#chains in the Genus database with same CATH homology
 1DDV A;  1WG7 A;  2I1K A;  3G9W A;  2MWN B;  3PP2 A;  1WGU A;  4GXB A;  1FHW A;  5J3Y A;  1XKE A;  1UNQ A;  2DLW A;  3UZT A;  3X23 A;  3M1I B;  1E5W A;  1KZG A;  2J0K A;  1V5P A;  1PFJ A;  3D8F A;  4HAZ B;  2Z0O A;  1PMS A;  4K2O A;  4HAT B;  3V5W A;  3SYX A;  4HAW B;  5D3X A;  4HHV A;  1FHO A;  2COD A;  1FGZ A;  2Q13 A;  2X18 A;  1UEF A;  2P0H A;  2DN6 A;  4KHB B;  5JLJ B;  3VOQ A;  4HAY B;  2E2X A;  2YS3 A;  1DDM A;  4HDQ A;  1RRP B;  3BIN A;  3MPX A;  2AEH A;  4B6H A;  4KAX B;  1KZ7 A;  5DIF B;  2LOX A;  5J3T A;  2P8V A;  4YL8 A;  5HE1 A;  2D2Q A;  4Z2N A;  3PEG A;  1MK7 B;  1GC7 A;  4HB2 B;  3VIA A;  1WVH A;  3WA0 A;  2RLO A;  3GYO A;  2MFQ A;  4PQ0 A;  3TFM A;  4CHM A;  4EJN A;  4ZRK A;  2ELA A;  5GOW B;  1MK9 B;  1P6S A;  1XX0 A;  1Y19 B;  1ZVR A;  2DA0 A;  1UPR A;  4A6K A;  2ROZ B;  2VRW B;  4HAV B;  2W2X D;  2DFK A;  1XD4 A;  3O96 A;  4K81 A;  1SHC A;  5DH9 B;  1ZC4 B;  2IYB A;  2N23 A;  4Z2M B;  2K2J A;  1EVH A;  4K2P A;  1MIX A;  1AWE A;  1H4R A;  2UZR A;  2I1J A;  2YT0 A;  1RJ2 A;  5DI9 B;  1TQZ A;  1AQC A;  2W2W A;  5DHF B;  1WJ1 A;  3KRW A;  1M7R A;  3SO6 A;  1ZC3 B;  1V5M A;  2M38 A;  2CY4 A;  2DHI A;  2W2X C;  2BCJ A;  1BTK A;  2DKP A;  1DRO A;  1V89 A;  5C6R A;  1FOE A;  3F5R A;  3U8Z A;  4GMX B;  4HDO A;  1OY2 A;  5LOP B;  2QKL A;  4GZU A;  3SNH A;  2XQN M;  3FSS A;  4DXA B;  2D9X A;  4YON A;  5C5B B;  1UPQ A;  2UZS A;  2ZPY A;  5J3Q A;  1J0W A;  1NI2 A;  1TJ6 A;  2J0J A;  2J59 M;  2GS0 A;  2KCJ A;  2Z0P A;  3PSC A;  4DX9 0;  2DTC A;  1GG3 A;  3D8D A;  3GYP A;  2DX1 A;  3AU5 A;  1SGH A;  3A8Q A;  1MPH A;  5JHG A;  1KI1 B;  2COF A;  5JHH A;  1EF1 A;  3ODO A;  3U7D A;  4CYE A;  3BJI A;  4KHO A;  3QWM A;  4F7U P;  4DX8 A;  2MDX A;  4IAP A;  4GPT B;  1U2B A;  1U5D A;  4HAX B;  4MT7 A;  3FEH A;  2EMT A;  1W1G A;  2OTX A;  1OQN A;  1LW3 A;  1X05 A;  2GJY A;  1BWN A;  1DBH A;  2D9Y A;  1UNR A;  1U5E A;  2K00 A;  4HAU B;  3KSY A;  3T06 A;  2MKR A;  4HB0 B;  3PZD A;  5HE3 A;  3DXE A;  5C16 A;  1WGQ A;  2D9Z A;  2Y8G A;  4EKU A;  4GN1 A;  2ADZ A;  2JP2 A;  1NTY A;  4D0N B;  3N7C A;  3KZ1 A;  2CAY A;  3TVV A;  2D10 A;  2YF0 A;  3HK0 A;  1U5F A;  5HE2 A;  5FI0 A;  1NTV A;  3HQC A;  4MK0 A;  3IVF A;  5KQ1 A;  1U27 A;  2I5C A;  2KUP A;  5CLQ B;  4A5K A;  2LG1 A;  4GMV A;  5L81 A;  1V5U A;  5FI1 A;  3DXD A;  3ODX A;  5LON B;  3P7Z A;  5C79 A;  2COA A;  2CY5 A;  2D9W A;  1K5G B;  2EC1 A;  2HE7 A;  3KRX A;  1X11 A;  1DYN A;  2Z0Q A;  5D27 A;  4Y94 A;  2P0D A;  2YRY A;  3QIJ A;  3SV1 A;  3TW1 A;  2VKI A;  3D8E A;  3LJU X;  2OQB A;  2QKM A;  4TKN A;  5KQ4 A;  2J0M A;  1XCG A;  2LOZ A;  3HW2 B;  4F7G A;  1MIZ B;  5EFX A;  2V76 A;  2PZ1 A;  2CRF A;  3A98 B;  4HB3 B;  2YT1 A;  1DDW A;  2NMB A;  4HB4 B;  1K5D B;  2UVM A;  2GCL A;  4CHJ A;  2DYN A;  4IOY X;  5JP4 A;  3NSU A;  1WI1 A;  2RUK B;  3PVW A;  1GC6 A;  1FGY A;  2L2I A;  3A8P A;  2KGX B;  1ZM0 A;  4F7H A;  1Q67 A;  2RVB B;  2P0F A;  1H10 A;  3ZVR A;  1XR0 B;  4TYZ A;  1X1G A;  4P7I A;  2AL6 A;  3KY9 A;  3PVL A;  1U5G A;  3ULB A;  1V88 A;  1PLS A;  1EAZ A;  2DHK A;  1XOD A;  1ISN A;  1LB1 A;  1M7E A;  1FAO A;  2DX5 A;  3CXB B;  3CIK A;  1UNP A;  2R0D A;  2G35 A;  3P6A A;  2EMS A;  1P3R A;  3ODW A;  2HTH B;  2YS5 A;  3ML4 A;  3WYF B;  1IRS A;  1QQG A;  2H7E A;  2IFS A;  4NY0 A;  2DYQ A;  1ZSQ A;  2LUL A;  5KCV A;  2M14 A;  5D3Y A;  1MAI A;  1W1H A;  3OAN A;  5D3V A;  2I5F A;  2YSZ A;  1N3H A;  3AU4 A;  4KHA A;  1I2H A;  2DKQ A;  2Y7B A;  1FHX A;  2RGN B;  3F0W A;  4XWX A;  4IFS A;  2L1C A;  2LKO A;  3ZDT A;  4ZRJ A;  2VSZ A;  1W1D A;  1U29 A;  1FB8 A;  4WJ7 A;  1OMW A;  2ROV A;  4H8S A;  2ELB A;  1TXD A;  4EMO A;  5DHA B;  1X1F A;  4A6H A;  2Y8F A;  4C0A A;  2NZ8 B;  5D3W A;  4A6F A;  3FM8 C;  4KVG B;  1QC6 A;  2K2U A;  1NU2 A;  2N0Y A;  3SUZ A;  1J19 A;  4K17 A;  4WVF B;  3TO1 A;  4A6F B;  1X86 A;  4WSF A;  3ULC A;  1P5T A;  4ZRI A;  2COC A;  2D4Q A;  4BBK A;  2D11 A;  1I7A A;  2EJ8 A;  3QBV B;  3TCA A;  2GCJ A;  2RSG A;  4NSW A;  1WJM A;  3AJ4 A;  2H7D A;  4PNK A;  5HE0 A;  5CLL B;  2RNR B;  3DXC A;  5C5B A;  3PG7 A;  2R09 A;  1MKE A;  1B55 A;  1V61 A;  4L6E A;  2FJL A;  2LYD A;  4DBB A;  2YS1 A;  1BTN A;  1Z87 A;  1BAK A;  4MY6 A;  3RCP A;  1EGX A;  2D9V A;  2YVC A;  3MDB C;  1Y5O A;  3PVU A;  2DHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...