2YT1A

Solution structure of the chimera of the c-terminal tail peptide of app and the c-terminal pid domain of fe65l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
185
structure length
185
Chain Sequence
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGPSSGIEGRGSSGSSGSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein and Amyloid beta A4 precursor protei
total genus 25
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yt1A01
1BTKA 2KCJA 4C0AA 3PEGA 3D8EA 4GZUA 3HW2B 2RLOA 1ISNA 4WJ7A 5HE0A 1FHXA 2CY4A 1WG7A 1WJ1A 2P0HA 1M7EA 3TVVA 1XCGA 3SNHA 2DN6A 2EMTA 2R09A 4IAPA 1E5WA 2DHKA 3HK0A 1AWEA 1WI1A 2EJ8A 1NTYA 1I7AA 1DBHA 2IYBA 2ZPYA 1EAZA 4IOYX 2G35A 3U8ZA 1P5TA 1LB1A 3X23A 2P0FA 4A5KA 4DBBA 1MPHA 1B55A 1WGQA 4F7HA 5EFXA 2I5CA 4DX90 2LYDA 1GC6A 4CHJA 2J0KA 1XD4A 1RJ2A 2J59M 4F7UP 2AEHA 2RGNB 1LW3A 2RNRB 1PFJA 4TKNA 1H4RA 1UNRA 4HAXB 5D27A 2N0YA 5C16A 2FJLA 5FI0A 1NTVA 3GYOA 4P7IA 4KAXB 2DTCA 5HE1A 2I5FA 3QWMA 2YS1A 1MIZB 2W2WA 3TFMA 2I1KA 5D3WA 3M1IB 4WSFA 4DXAB 1GC7A 3BINA 2M14A 1V5UA 2K2UA 4HHVA 3IVFA 3CIKA 2I1JA 2RSGA 2DYNA 2DA0A 1DDMA 3VIAA 1SHCA 2Y8GA 2LOXA 1ZC3B 1FHWA 3DXEA 1AQCA 4MY6A 4MT7A 2CRFA 2DKPA 2D2QA 3ULCA 2DX1A 3WYFB 4WVFB 2Z0PA 4HAUB 4GXBA 2AL6A 2COAA 2D9YA 3BJIA 4HDQA 4KHBB 3KRWA 3FSSA 2GCJA 3SO6A 4A6KA 2MDXA 1U27A 2ADZA 3G9WA 2E2XA 3TW1A 3UZTA 1OMWA 2W2XC 3FM8C 1X11A 3ODOA 3T06A 4B6HA 5JP4A 2YF0A 2LG1A 1X05A 1FOEA 4TYZA 4KVGB 2DHIA 2MKRA 2COFA 5C6RA 2CAYA 1N3HA 2KGXB 2UVMA 3ZVRA 4HAZB 4K17A 1BTNA 3KRXA 2UZRA 2LKOA 1FGZA 4HB3B 1UPQA 2MFQA 5JLJB 3PVUA 4BBKA 5GOWB 1TXDA 1X1FA 2VSZA 2MWNB 2OQBA 2EMSA 3KZ1A 5D3VA 4L6EA 3P6AA 3ULBA 3A8QA 4A6FA 1V5PA 4Z2MB 1TQZA 1Z87A 1U5GA 1KZGA 1MAIA 3PSCA 1I2HA 2DLWA 1U5EA 1BAKA 1FHOA 2K00A 1FAOA 2NMBA 2YT1A 1XR0B 1DDWA 2ELAA 1PLSA 5J3TA 1DYNA 4HB2B 4ZRKA 4K81A 5DIFB 1UPRA 1XKEA 2KUPA 2LOZA 2RVBB 1U5FA 2X18A 2XQNM 2BCJA 2DX5A 5KCVA 1U2BA 2J0JA 2Q13A 3NSUA 3SUZA 3N7CA 3DXCA 3ML4A 1Y5OA 3D8DA 1DDVA 1J19A 2DYQA 3PVWA 2V76A 2H7DA 1V88A 4F7GA 4HAVB 2Z0QA 4NSWA 3V5WA 4Y94A 3QIJA 3SYXA 3KY9A 4A6FB 1X1GA 1P3RA 5LONB 5J3QA 4A6HA 2D4QA 4ZRJA 5C79A 3AU4A 5JHGA 2H7EA 2VRWB 3MPXA 1W1GA 3DXDA 1QC6A 5JHHA 1ZSQA 1NU2A 4DX8A 3KSYA 5D3YA 4K2PA 4HB0B 2QKMA 1KZ7A 1OY2A 2HTHB 3PZDA 3CXBB 3PVLA 1W1DA 2RUKB 2GCLA 4CYEA 2DHJA 2IFSA 4HAWB 3TO1A 2L1CA 4HATB 1WVHA 1V61A 4HAYB 2NZ8B 4PQ0A 5C5BB 5KQ1A 1IRSA 5DHAB 5LOPB 3GYPA 2YSZA 4GN1A 2YT0A 2UZSA 2VKIA 1WJMA 1Y19B 3A8PA 4IFSA 1PMSA 1W1HA 4GPTB 3PG7A 2W2XD 4KHOA 5DH9B 1H10A 1ZVRA 2ROVA 4K2OA 4D0NB 1RRPB 5D3XA 3SV1A 2K2JA 3AU5A 4GMXB 2HE7A 5CLQB 2ROZB 5HE3A 2YS5A 4XWXA 5FI1A 5J3YA 4GMVA 1U5DA 4YL8A 3ZDTA 1EF1A 1KI1B 1U29A 3O96A 2R0DA 4HDOA 3AJ4A 1QQGA 1XX0A 2N23A 4EMOA 1P6SA 1GG3A 3FEHA 3TCAA 3WA0A 2D11A 1NI2A 2J0MA 1OQNA 2EC1A 2OTXA 1MKEA 4HB4B 1DROA 1Q67A 2D10A 1FB8A 1V5MA 3LJUX 4NY0A 4KHAA 1EVHA 1FGYA 5CLLB 1BWNA 3U7DA 2D9XA 1K5DB 5DI9B 2QKLA 2GJYA 1K5GB 2Z0OA 1XODA 3P7ZA 2Y7BA 4CHMA 1UNQA 3RCPA 2DKQA 3F0WA 4YONA 4EKUA 1V89A 3VOQA 2PZ1A 2CODA 3OANA 1EGXA 1M7RA 2YRYA 2CY5A 2YVCA 3MDBC 2D9ZA 1TJ6A 4H8SA 2D9VA 4Z2NA 2Y8FA 1MK7B 2L2IA 4ZRIA 1X86A 1MIXA 2M38A 2GS0A 2D9WA 2JP2A 3D8FA 3QBVB 5DHFB 1J0WA 1SGHA 5HE2A 5L81A 2LULA 2P8VA 3F5RA 3A98B 2COCA 2YS3A 2P0DA 3ODXA 5KQ4A 1UEFA 1ZM0A 1UNPA 3PP2A 5C5BA 4PNKA 2ELBA 1WGUA 4MK0A 3ODWA 3HQCA 4EJNA 1ZC4B 1MK9B 2DFKA
chains in the Genus database with same CATH superfamily
1BTKA 2KCJA 4C0AA 3PEGA 3D8EA 4GZUA 3HW2B 2RLOA 1ISNA 4WJ7A 5HE0A 1FHXA 2CY4A 2RRFA 1WG7A 1WJ1A 2P0HA 1M7EA 3TVVA 1XCGA 3SNHA 2DN6A 2EMTA 2R09A 4IAPA 1E5WA 2DHKA 3HK0A 1AWEA 1WI1A 2EJ8A 1NTYA 1I7AA 1DBHA 3HSAA 2IYBA 2ZPYA 4QXAB 1EAZA 4IOYX 2G35A 3U8ZA 1P5TA 1LB1A 4QJ3B 3X23A 2P0FA 4A5KA 4DBBA 1MPHA 1B55A 1WGQA 4F7HA 4CSQA 5EFXA 2I5CA 4DX90 2LYDA 1GC6A 4CHJA 2J0KA 1XD4A 1RJ2A 2ZKMX 4GNKB 2J59M 4F7UP 2AEHA 2RGNB 1LW3A 2RNRB 1PFJA 4TKNA 1H4RA 1UNRA 4HAXB 5D27A 2N0YA 5C16A 2FJLA 5FI0A 2Z14A 1NTVA 3GYOA 4P7IA 4KAXB 2DTCA 5HE1A 3B77A 2I5FA 3QWMA 2YS1A 1MIZB 2W2WA 3TFMA 2I1KA 5D3WA 3M1IB 4WSFA 4DXAB 1GC7A 3BINA 2M14A 3HIEA 1V5UA 2K2UA 4HHVA 3IVFA 3CIKA 2I1JA 5I2SA 2RSGA 2DYNA 2DA0A 1DDMA 3VIAA 1SHCA 2Y8GA 2LOXA 1ZC3B 1FHWA 3DXEA 3DCXA 1AQCA 4MY6A 4MT7A 4OSNA 2CRFA 2Z4DA 2DKPA 2D2QA 3ULCA 2DX1A 3WYFB 4WVFB 2NBVA 2Z0PA 4HAUB 4GXBA 4D6WA 2AL6A 2COAA 2D9YA 3BJIA 2KUQA 4HDQA 4KHBB 3KRWA 3FSSA 2GCJA 3SO6A 4A6KA 2MDXA 1U27A 2ADZA 3G9WA 2E2XA 3TW1A 3UZTA 1OMWA 2W2XC 3FM8C 4QJ5B 1X11A 3ODOA 3T06A 4B6HA 4L1RA 5JP4A 2YF0A 2LG1A 1X05A 1FOEA 4TYZA 4KVGB 2DHIA 2MKRA 4OT1A 2COFA 5C6RA 2CAYA 1N3HA 2KGXB 2UVMA 3ZVRA 4HAZB 4K17A 1BTNA 3KRXA 2UZRA 2LKOA 1FGZA 4HB3B 1UPQA 2MFQA 5JLJB 2KR0A 3PVUA 4BBKA 2GUMA 5GOWB 1TXDA 1X1FA 2VSZA 2MWNB 2OQBA 3OHMB 2EMSA 3KZ1A 5D3VA 4L6EA 3P6AA 3ULBA 3A8QA 4A6FA 1V5PA 4Z2MB 5LG4B 1TQZA 1Z87A 1U5GA 1KZGA 1MAIA 3PSCA 1I2HA 2KIGA 2DLWA 1U5EA 4KHBA 1BAKA 1FHOA 2K00A 1FAOA 2NMBA 2YT1A 1XR0B 1DDWA 2ELAA 1PLSA 5J3TA 1DYNA 4HB2B 4ZRKA 4K81A 5DIFB 5M4YB 1UPRA 1XKEA 2KUPA 2LOZA 2RVBB 5IRSA 1U5FA 2X18A 2XQNM 2BCJA 2DX5A 5KCVA 1U2BA 2J0JA 2Q13A 3NSUA 3SUZA 3N7CA 3DXCA 3ML4A 1Y5OA 3D8DA 2R2YA 1DDVA 1J19A 2DYQA 3NWDA 2V76A 3PVWA 4QJ4B 2H7DA 1V88A 4F7GA 4HAVB 2Z0QA 4NSWA 3V5WA 4Y94A 3QIJA 3SYXA 3KY9A 4A6FB 1X1GA 1P3RA 5LONB 5J3QA 4A6HA 2FJUB 2D4QA 4ZRJA 5C79A 3AU4A 5JHGA 2H7EA 2VRWB 3MPXA 1W1GA 3DXDA 1QC6A 5JHHA 1ZSQA 1NU2A 4DX8A 3KSYA 5D3YA 4K2PA 4HB0B 2QKMA 1KZ7A 1OY2A 2HTHB 3PZDA 3CXBB 3PVLA 1W1DA 2RUKB 2GCLA 4CYEA 2DHJA 2IFSA 4HAWB 3TO1A 2L1CA 4HATB 1WVHA 1V61A 3NWAA 2K8EA 2YT2A 4HAYB 2NZ8B 4PQ0A 5C5BB 5KQ1A 1IRSA 3U12A 5DHAB 5LOPB 3GYPA 2Z13A 2YSZA 4DIXA 4GN1A 2YT0A 2UZSA 2VKIA 1WJMA 1Y19B 3A8PA 4IFSA 1PMSA 1W1HA 4GPTB 3PG7A 2W2XD 5I2MA 4KHOA 5DH9B 1H10A 1ZVRA 2ROVA 4K2OA 4D0NB 1RRPB 5D3XA 3SV1A 2K2JA 3AU5A 4GMXB 2HE7A 5CLQB 2ROZB 5HE3A 1ZYIA 2YS5A 4XWXA 5FI1A 5J3YA 4GMVA 1U5DA 4YL8A 1T77A 3ZDTA 1EF1A 4GOUA 1KI1B 1U29A 3O96A 2R0DA 4HDOA 3AJ4A 1QQGA 1XX0A 2N23A 4EMOA 1P6SA 1GG3A 3FEHA 3TCAA 3WA0A 2D11A 1NI2A 2J0MA 1OQNA 2EC1A 2OTXA 1MKEA 4HB4B 3A58A 2KIEA 1DROA 1Q67A 2D10A 1FB8A 1V5MA 3LJUX 4NY0A 4KHAA 1EVHA 1FGYA 5CLLB 1BWNA 3FVCA 3U7DA 2D9XA 1K5DB 5DI9B 2QKLA 2GJYA 1K5GB 2Z0OA 1XODA 3P7ZA 2Y7BA 4CHMA 1UNQA 3RCPA 2DKQA 3F0WA 4YONA 4EKUA 1V89A 3VOQA 2PZ1A 2CODA 3OANA 1EGXA 1M7RA 2YRYA 2CY5A 2K49A 2YVCA 3MDBC 2D9ZA 1TJ6A 4H8SA 2D9VA 4Z2NA 2Z59A 2Y8FA 1MK7B 2L2IA 4ZRIA 1X86A 1MIXA 2M38A 2GS0A 2D9WA 2JP2A 3D8FA 3NWFA 3QBVB 5DHFB 1J0WA 1SGHA 5HE2A 5L81A 2LULA 2P8VA 3F5RA 3A98B 2COCA 2YS3A 3NW8A 2P0DA 3ODXA 1MI1A 5KQ4A 4HSIA 1UEFA 1ZM0A 1UNPA 3PP2A 5C5BA 4PNKA 2ELBA 1WGUA 4MK0A 3ODWA 3HQCA 4EJNA 1ZC4B 1MK9B 2DFKA
chains in the Genus database with same CATH topology
1BTKA 2KCJA 4C0AA 3PEGA 3D8EA 4GZUA 3HW2B 2RLOA 1ISNA 4WJ7A 5HE0A 1FHXA 2CY4A 1WG7A 1WJ1A 2P0HA 1M7EA 3TVVA 1XCGA 3SNHA 2DN6A 2EMTA 2R09A 4IAPA 1E5WA 2DHKA 3HK0A 1AWEA 1WI1A 2EJ8A 1NTYA 1I7AA 1DBHA 2IYBA 2ZPYA 1EAZA 4IOYX 2G35A 3U8ZA 1P5TA 1LB1A 3X23A 2P0FA 4A5KA 4DBBA 1MPHA 1B55A 1WGQA 4F7HA 5EFXA 2I5CA 4DX90 2LYDA 1GC6A 4CHJA 2J0KA 1XD4A 1RJ2A 2J59M 4F7UP 2AEHA 2RGNB 1LW3A 2RNRB 1PFJA 4TKNA 1H4RA 1UNRA 4HAXB 5D27A 2N0YA 5C16A 2FJLA 5FI0A 1NTVA 3GYOA 4P7IA 4KAXB 2DTCA 5HE1A 2I5FA 3QWMA 2YS1A 1MIZB 2W2WA 3TFMA 2I1KA 5D3WA 3M1IB 4WSFA 4DXAB 1GC7A 3BINA 2M14A 1V5UA 2K2UA 4HHVA 3IVFA 3CIKA 2I1JA 2RSGA 2DYNA 2DA0A 1DDMA 3VIAA 1SHCA 2Y8GA 2LOXA 1ZC3B 1FHWA 3DXEA 1AQCA 4MY6A 4MT7A 2CRFA 2DKPA 2D2QA 3ULCA 2DX1A 3WYFB 4WVFB 2Z0PA 4HAUB 4GXBA 2AL6A 2COAA 2D9YA 3BJIA 4HDQA 4KHBB 3KRWA 3FSSA 2GCJA 3SO6A 4A6KA 2MDXA 1U27A 2ADZA 3G9WA 2E2XA 3TW1A 3UZTA 1OMWA 2W2XC 3FM8C 1X11A 3ODOA 3T06A 4B6HA 5JP4A 2YF0A 2LG1A 1X05A 1FOEA 4TYZA 4KVGB 2DHIA 2MKRA 2COFA 5C6RA 2CAYA 1N3HA 2KGXB 2UVMA 3ZVRA 4HAZB 4K17A 1BTNA 3KRXA 2UZRA 2LKOA 1FGZA 4HB3B 1UPQA 2MFQA 5JLJB 3PVUA 4BBKA 5GOWB 1TXDA 1X1FA 2VSZA 2MWNB 2OQBA 2EMSA 3KZ1A 5D3VA 4L6EA 3P6AA 3ULBA 3A8QA 4A6FA 1V5PA 4Z2MB 1TQZA 1Z87A 1U5GA 1KZGA 1MAIA 3PSCA 1I2HA 2DLWA 1U5EA 1BAKA 1FHOA 2K00A 1FAOA 2NMBA 2YT1A 1XR0B 1DDWA 2ELAA 1PLSA 5J3TA 1DYNA 4HB2B 4ZRKA 4K81A 5DIFB 1UPRA 1XKEA 2KUPA 2LOZA 2RVBB 1U5FA 2X18A 2XQNM 2BCJA 2DX5A 5KCVA 1U2BA 2J0JA 2Q13A 3NSUA 3SUZA 3N7CA 3DXCA 3ML4A 1Y5OA 3D8DA 1DDVA 1J19A 2DYQA 3PVWA 2V76A 2H7DA 1V88A 4F7GA 4HAVB 2Z0QA 4NSWA 3V5WA 4Y94A 3QIJA 3SYXA 3KY9A 4A6FB 1X1GA 1P3RA 5LONB 5J3QA 4A6HA 2D4QA 4ZRJA 5C79A 3AU4A 5JHGA 2H7EA 2VRWB 3MPXA 1W1GA 3DXDA 1QC6A 5JHHA 1ZSQA 1NU2A 4DX8A 3KSYA 5D3YA 4K2PA 4HB0B 2QKMA 1KZ7A 1OY2A 2HTHB 3PZDA 3CXBB 3PVLA 1W1DA 2RUKB 2GCLA 4CYEA 2DHJA 2IFSA 4HAWB 3TO1A 2L1CA 4HATB 1WVHA 1V61A 4HAYB 2NZ8B 4PQ0A 5C5BB 5KQ1A 1IRSA 5DHAB 5LOPB 3GYPA 2YSZA 4GN1A 2YT0A 2UZSA 2VKIA 1WJMA 1Y19B 3A8PA 4IFSA 1PMSA 1W1HA 4GPTB 3PG7A 2W2XD 4KHOA 5DH9B 1H10A 1ZVRA 2ROVA 4K2OA 4D0NB 1RRPB 5D3XA 3SV1A 2K2JA 3AU5A 4GMXB 2HE7A 5CLQB 2ROZB 5HE3A 2YS5A 4XWXA 5FI1A 5J3YA 4GMVA 1U5DA 4YL8A 3ZDTA 1EF1A 1KI1B 1U29A 3O96A 2R0DA 4HDOA 3AJ4A 1QQGA 1XX0A 2N23A 4EMOA 1P6SA 1GG3A 3FEHA 3TCAA 3WA0A 2D11A 1NI2A 2J0MA 1OQNA 2EC1A 2OTXA 1MKEA 4HB4B 1DROA 1Q67A 2D10A 1FB8A 1V5MA 3LJUX 4NY0A 4KHAA 1EVHA 1FGYA 5CLLB 1BWNA 3U7DA 2D9XA 1K5DB 5DI9B 2QKLA 2GJYA 1K5GB 2Z0OA 1XODA 3P7ZA 2Y7BA 4CHMA 1UNQA 3RCPA 2DKQA 3F0WA 4YONA 4EKUA 1V89A 3VOQA 2PZ1A 2CODA 3OANA 1EGXA 1M7RA 2YRYA 2CY5A 2YVCA 3MDBC 2D9ZA 1TJ6A 4H8SA 2D9VA 4Z2NA 2Y8FA 1MK7B 2L2IA 4ZRIA 1X86A 1MIXA 2M38A 2GS0A 2D9WA 2JP2A 3D8FA 3QBVB 5DHFB 1J0WA 1SGHA 5HE2A 5L81A 2LULA 2P8VA 3F5RA 3A98B 2COCA 2YS3A 2P0DA 3ODXA 5KQ4A 1UEFA 1ZM0A 1UNPA 3PP2A 5C5BA 4PNKA 2ELBA 1WGUA 4MK0A 3ODWA 3HQCA 4EJNA 1ZC4B 1MK9B 2DFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BTK A;  2KCJ A;  4C0A A;  3PEG A;  3D8E A;  4GZU A;  3HW2 B;  2RLO A;  1ISN A;  4WJ7 A;  5HE0 A;  1FHX A;  2CY4 A;  1WG7 A;  1WJ1 A;  2P0H A;  1M7E A;  3TVV A;  1XCG A;  3SNH A;  2DN6 A;  2EMT A;  2R09 A;  4IAP A;  1E5W A;  2DHK A;  3HK0 A;  1AWE A;  1WI1 A;  2EJ8 A;  1NTY A;  1I7A A;  1DBH A;  2IYB A;  2ZPY A;  1EAZ A;  4IOY X;  2G35 A;  3U8Z A;  1P5T A;  1LB1 A;  3X23 A;  2P0F A;  4A5K A;  4DBB A;  1MPH A;  1B55 A;  1WGQ A;  4F7H A;  5EFX A;  2I5C A;  4DX9 0;  2LYD A;  1GC6 A;  4CHJ A;  2J0K A;  1XD4 A;  1RJ2 A;  2J59 M;  4F7U P;  2AEH A;  2RGN B;  1LW3 A;  2RNR B;  1PFJ A;  4TKN A;  1H4R A;  1UNR A;  4HAX B;  5D27 A;  2N0Y A;  5C16 A;  2FJL A;  5FI0 A;  1NTV A;  3GYO A;  4P7I A;  4KAX B;  2DTC A;  5HE1 A;  2I5F A;  3QWM A;  2YS1 A;  1MIZ B;  2W2W A;  3TFM A;  2I1K A;  5D3W A;  3M1I B;  4WSF A;  4DXA B;  1GC7 A;  3BIN A;  2M14 A;  1V5U A;  2K2U A;  4HHV A;  3IVF A;  3CIK A;  2I1J A;  2RSG A;  2DYN A;  2DA0 A;  1DDM A;  3VIA A;  1SHC A;  2Y8G A;  2LOX A;  1ZC3 B;  1FHW A;  3DXE A;  1AQC A;  4MY6 A;  4MT7 A;  2CRF A;  2DKP A;  2D2Q A;  3ULC A;  2DX1 A;  3WYF B;  4WVF B;  2Z0P A;  4HAU B;  4GXB A;  2AL6 A;  2COA A;  2D9Y A;  3BJI A;  4HDQ A;  4KHB B;  3KRW A;  3FSS A;  2GCJ A;  3SO6 A;  4A6K A;  2MDX A;  1U27 A;  2ADZ A;  3G9W A;  2E2X A;  3TW1 A;  3UZT A;  1OMW A;  2W2X C;  3FM8 C;  1X11 A;  3ODO A;  3T06 A;  4B6H A;  5JP4 A;  2YF0 A;  2LG1 A;  1X05 A;  1FOE A;  4TYZ A;  4KVG B;  2DHI A;  2MKR A;  2COF A;  5C6R A;  2CAY A;  1N3H A;  2KGX B;  2UVM A;  3ZVR A;  4HAZ B;  4K17 A;  1BTN A;  3KRX A;  2UZR A;  2LKO A;  1FGZ A;  4HB3 B;  1UPQ A;  2MFQ A;  5JLJ B;  3PVU A;  4BBK A;  5GOW B;  1TXD A;  1X1F A;  2VSZ A;  2MWN B;  2OQB A;  2EMS A;  3KZ1 A;  5D3V A;  4L6E A;  3P6A A;  3ULB A;  3A8Q A;  4A6F A;  1V5P A;  4Z2M B;  1TQZ A;  1Z87 A;  1U5G A;  1KZG A;  1MAI A;  3PSC A;  1I2H A;  2DLW A;  1U5E A;  1BAK A;  1FHO A;  2K00 A;  1FAO A;  2NMB A;  2YT1 A;  1XR0 B;  1DDW A;  2ELA A;  1PLS A;  5J3T A;  1DYN A;  4HB2 B;  4ZRK A;  4K81 A;  5DIF B;  1UPR A;  1XKE A;  2KUP A;  2LOZ A;  2RVB B;  1U5F A;  2X18 A;  2XQN M;  2BCJ A;  2DX5 A;  5KCV A;  1U2B A;  2J0J A;  2Q13 A;  3NSU A;  3SUZ A;  3N7C A;  3DXC A;  3ML4 A;  1Y5O A;  3D8D A;  1DDV A;  1J19 A;  2DYQ A;  3PVW A;  2V76 A;  2H7D A;  1V88 A;  4F7G A;  4HAV B;  2Z0Q A;  4NSW A;  3V5W A;  4Y94 A;  3QIJ A;  3SYX A;  3KY9 A;  4A6F B;  1X1G A;  1P3R A;  5LON B;  5J3Q A;  4A6H A;  2D4Q A;  4ZRJ A;  5C79 A;  3AU4 A;  5JHG A;  2H7E A;  2VRW B;  3MPX A;  1W1G A;  3DXD A;  1QC6 A;  5JHH A;  1ZSQ A;  1NU2 A;  4DX8 A;  3KSY A;  5D3Y A;  4K2P A;  4HB0 B;  2QKM A;  1KZ7 A;  1OY2 A;  2HTH B;  3PZD A;  3CXB B;  3PVL A;  1W1D A;  2RUK B;  2GCL A;  4CYE A;  2DHJ A;  2IFS A;  4HAW B;  3TO1 A;  2L1C A;  4HAT B;  1WVH A;  1V61 A;  4HAY B;  2NZ8 B;  4PQ0 A;  5C5B B;  5KQ1 A;  1IRS A;  5DHA B;  5LOP B;  3GYP A;  2YSZ A;  4GN1 A;  2YT0 A;  2UZS A;  2VKI A;  1WJM A;  1Y19 B;  3A8P A;  4IFS A;  1PMS A;  1W1H A;  4GPT B;  3PG7 A;  2W2X D;  4KHO A;  5DH9 B;  1H10 A;  1ZVR A;  2ROV A;  4K2O A;  4D0N B;  1RRP B;  5D3X A;  3SV1 A;  2K2J A;  3AU5 A;  4GMX B;  2HE7 A;  5CLQ B;  2ROZ B;  5HE3 A;  2YS5 A;  4XWX A;  5FI1 A;  5J3Y A;  4GMV A;  1U5D A;  4YL8 A;  3ZDT A;  1EF1 A;  1KI1 B;  1U29 A;  3O96 A;  2R0D A;  4HDO A;  3AJ4 A;  1QQG A;  1XX0 A;  2N23 A;  4EMO A;  1P6S A;  1GG3 A;  3FEH A;  3TCA A;  3WA0 A;  2D11 A;  1NI2 A;  2J0M A;  1OQN A;  2EC1 A;  2OTX A;  1MKE A;  4HB4 B;  1DRO A;  1Q67 A;  2D10 A;  1FB8 A;  1V5M A;  3LJU X;  4NY0 A;  4KHA A;  1EVH A;  1FGY A;  5CLL B;  1BWN A;  3U7D A;  2D9X A;  1K5D B;  5DI9 B;  2QKL A;  2GJY A;  1K5G B;  2Z0O A;  1XOD A;  3P7Z A;  2Y7B A;  4CHM A;  1UNQ A;  3RCP A;  2DKQ A;  3F0W A;  4YON A;  4EKU A;  1V89 A;  3VOQ A;  2PZ1 A;  2COD A;  3OAN A;  1EGX A;  1M7R A;  2YRY A;  2CY5 A;  2YVC A;  3MDB C;  2D9Z A;  1TJ6 A;  4H8S A;  2D9V A;  4Z2N A;  2Y8F A;  1MK7 B;  2L2I A;  4ZRI A;  1X86 A;  1MIX A;  2M38 A;  2GS0 A;  2D9W A;  2JP2 A;  3D8F A;  3QBV B;  5DHF B;  1J0W A;  1SGH A;  5HE2 A;  5L81 A;  2LUL A;  2P8V A;  3F5R A;  3A98 B;  2COC A;  2YS3 A;  2P0D A;  3ODX A;  5KQ4 A;  1UEF A;  1ZM0 A;  1UNP A;  3PP2 A;  5C5B A;  4PNK A;  2ELB A;  1WGU A;  4MK0 A;  3ODW A;  3HQC A;  4EJN A;  1ZC4 B;  1MK9 B;  2DFK A; 
#chains in the Genus database with same CATH topology
 1BTK A;  2KCJ A;  4C0A A;  3PEG A;  3D8E A;  4GZU A;  3HW2 B;  2RLO A;  1ISN A;  4WJ7 A;  5HE0 A;  1FHX A;  2CY4 A;  2RRF A;  1WG7 A;  1WJ1 A;  2P0H A;  1M7E A;  3TVV A;  1XCG A;  3SNH A;  2DN6 A;  2EMT A;  2R09 A;  4IAP A;  1E5W A;  2DHK A;  3HK0 A;  1AWE A;  1WI1 A;  2EJ8 A;  1NTY A;  1I7A A;  1DBH A;  3HSA A;  2IYB A;  2ZPY A;  4QXA B;  1EAZ A;  4IOY X;  2G35 A;  3U8Z A;  1P5T A;  1LB1 A;  4QJ3 B;  3X23 A;  2P0F A;  4A5K A;  4DBB A;  1MPH A;  1B55 A;  1WGQ A;  4F7H A;  4CSQ A;  5EFX A;  2I5C A;  4DX9 0;  2LYD A;  1GC6 A;  4CHJ A;  2J0K A;  1XD4 A;  1RJ2 A;  2ZKM X;  4GNK B;  2J59 M;  4F7U P;  2AEH A;  2RGN B;  1LW3 A;  2RNR B;  1PFJ A;  4TKN A;  1H4R A;  1UNR A;  4HAX B;  5D27 A;  2N0Y A;  5C16 A;  2FJL A;  5FI0 A;  2Z14 A;  1NTV A;  3GYO A;  4P7I A;  4KAX B;  2DTC A;  5HE1 A;  3B77 A;  2I5F A;  3QWM A;  2YS1 A;  1MIZ B;  2W2W A;  3TFM A;  2I1K A;  5D3W A;  3M1I B;  4WSF A;  4DXA B;  1GC7 A;  3BIN A;  2M14 A;  3HIE A;  1V5U A;  2K2U A;  4HHV A;  3IVF A;  3CIK A;  2I1J A;  5I2S A;  2RSG A;  2DYN A;  2DA0 A;  1DDM A;  3VIA A;  1SHC A;  2Y8G A;  2LOX A;  1ZC3 B;  1FHW A;  3DXE A;  3DCX A;  1AQC A;  4MY6 A;  4MT7 A;  4OSN A;  2CRF A;  2Z4D A;  2DKP A;  2D2Q A;  3ULC A;  2DX1 A;  3WYF B;  4WVF B;  2NBV A;  2Z0P A;  4HAU B;  4GXB A;  4D6W A;  2AL6 A;  2COA A;  2D9Y A;  3BJI A;  2KUQ A;  4HDQ A;  4KHB B;  3KRW A;  3FSS A;  2GCJ A;  3SO6 A;  4A6K A;  2MDX A;  1U27 A;  2ADZ A;  3G9W A;  2E2X A;  3TW1 A;  3UZT A;  1OMW A;  2W2X C;  3FM8 C;  4QJ5 B;  1X11 A;  3ODO A;  3T06 A;  4B6H A;  4L1R A;  5JP4 A;  2YF0 A;  2LG1 A;  1X05 A;  1FOE A;  4TYZ A;  4KVG B;  2DHI A;  2MKR A;  4OT1 A;  2COF A;  5C6R A;  2CAY A;  1N3H A;  2KGX B;  2UVM A;  3ZVR A;  4HAZ B;  4K17 A;  1BTN A;  3KRX A;  2UZR A;  2LKO A;  1FGZ A;  4HB3 B;  1UPQ A;  2MFQ A;  5JLJ B;  2KR0 A;  3PVU A;  4BBK A;  2GUM A;  5GOW B;  1TXD A;  1X1F A;  2VSZ A;  2MWN B;  2OQB A;  3OHM B;  2EMS A;  3KZ1 A;  5D3V A;  4L6E A;  3P6A A;  3ULB A;  3A8Q A;  4A6F A;  1V5P A;  4Z2M B;  5LG4 B;  1TQZ A;  1Z87 A;  1U5G A;  1KZG A;  1MAI A;  3PSC A;  1I2H A;  2KIG A;  2DLW A;  1U5E A;  4KHB A;  1BAK A;  1FHO A;  2K00 A;  1FAO A;  2NMB A;  2YT1 A;  1XR0 B;  1DDW A;  2ELA A;  1PLS A;  5J3T A;  1DYN A;  4HB2 B;  4ZRK A;  4K81 A;  5DIF B;  5M4Y B;  1UPR A;  1XKE A;  2KUP A;  2LOZ A;  2RVB B;  5IRS A;  1U5F A;  2X18 A;  2XQN M;  2BCJ A;  2DX5 A;  5KCV A;  1U2B A;  2J0J A;  2Q13 A;  3NSU A;  3SUZ A;  3N7C A;  3DXC A;  3ML4 A;  1Y5O A;  3D8D A;  2R2Y A;  1DDV A;  1J19 A;  2DYQ A;  3NWD A;  2V76 A;  3PVW A;  4QJ4 B;  2H7D A;  1V88 A;  4F7G A;  4HAV B;  2Z0Q A;  4NSW A;  3V5W A;  4Y94 A;  3QIJ A;  3SYX A;  3KY9 A;  4A6F B;  1X1G A;  1P3R A;  5LON B;  5J3Q A;  4A6H A;  2FJU B;  2D4Q A;  4ZRJ A;  5C79 A;  3AU4 A;  5JHG A;  2H7E A;  2VRW B;  3MPX A;  1W1G A;  3DXD A;  1QC6 A;  5JHH A;  1ZSQ A;  1NU2 A;  4DX8 A;  3KSY A;  5D3Y A;  4K2P A;  4HB0 B;  2QKM A;  1KZ7 A;  1OY2 A;  2HTH B;  3PZD A;  3CXB B;  3PVL A;  1W1D A;  2RUK B;  2GCL A;  4CYE A;  2DHJ A;  2IFS A;  4HAW B;  3TO1 A;  2L1C A;  4HAT B;  1WVH A;  1V61 A;  3NWA A;  2K8E A;  2YT2 A;  4HAY B;  2NZ8 B;  4PQ0 A;  5C5B B;  5KQ1 A;  1IRS A;  3U12 A;  5DHA B;  5LOP B;  3GYP A;  2Z13 A;  2YSZ A;  4DIX A;  4GN1 A;  2YT0 A;  2UZS A;  2VKI A;  1WJM A;  1Y19 B;  3A8P A;  4IFS A;  1PMS A;  1W1H A;  4GPT B;  3PG7 A;  2W2X D;  5I2M A;  4KHO A;  5DH9 B;  1H10 A;  1ZVR A;  2ROV A;  4K2O A;  4D0N B;  1RRP B;  5D3X A;  3SV1 A;  2K2J A;  3AU5 A;  4GMX B;  2HE7 A;  5CLQ B;  2ROZ B;  5HE3 A;  1ZYI A;  2YS5 A;  4XWX A;  5FI1 A;  5J3Y A;  4GMV A;  1U5D A;  4YL8 A;  1T77 A;  3ZDT A;  1EF1 A;  4GOU A;  1KI1 B;  1U29 A;  3O96 A;  2R0D A;  4HDO A;  3AJ4 A;  1QQG A;  1XX0 A;  2N23 A;  4EMO A;  1P6S A;  1GG3 A;  3FEH A;  3TCA A;  3WA0 A;  2D11 A;  1NI2 A;  2J0M A;  1OQN A;  2EC1 A;  2OTX A;  1MKE A;  4HB4 B;  3A58 A;  2KIE A;  1DRO A;  1Q67 A;  2D10 A;  1FB8 A;  1V5M A;  3LJU X;  4NY0 A;  4KHA A;  1EVH A;  1FGY A;  5CLL B;  1BWN A;  3FVC A;  3U7D A;  2D9X A;  1K5D B;  5DI9 B;  2QKL A;  2GJY A;  1K5G B;  2Z0O A;  1XOD A;  3P7Z A;  2Y7B A;  4CHM A;  1UNQ A;  3RCP A;  2DKQ A;  3F0W A;  4YON A;  4EKU A;  1V89 A;  3VOQ A;  2PZ1 A;  2COD A;  3OAN A;  1EGX A;  1M7R A;  2YRY A;  2CY5 A;  2K49 A;  2YVC A;  3MDB C;  2D9Z A;  1TJ6 A;  4H8S A;  2D9V A;  4Z2N A;  2Z59 A;  2Y8F A;  1MK7 B;  2L2I A;  4ZRI A;  1X86 A;  1MIX A;  2M38 A;  2GS0 A;  2D9W A;  2JP2 A;  3D8F A;  3NWF A;  3QBV B;  5DHF B;  1J0W A;  1SGH A;  5HE2 A;  5L81 A;  2LUL A;  2P8V A;  3F5R A;  3A98 B;  2COC A;  2YS3 A;  3NW8 A;  2P0D A;  3ODX A;  1MI1 A;  5KQ4 A;  4HSI A;  1UEF A;  1ZM0 A;  1UNP A;  3PP2 A;  5C5B A;  4PNK A;  2ELB A;  1WGU A;  4MK0 A;  3ODW A;  3HQC A;  4EJN A;  1ZC4 B;  1MK9 B;  2DFK A; 
#chains in the Genus database with same CATH homology
 1BTK A;  2KCJ A;  4C0A A;  3PEG A;  3D8E A;  4GZU A;  3HW2 B;  2RLO A;  1ISN A;  4WJ7 A;  5HE0 A;  1FHX A;  2CY4 A;  1WG7 A;  1WJ1 A;  2P0H A;  1M7E A;  3TVV A;  1XCG A;  3SNH A;  2DN6 A;  2EMT A;  2R09 A;  4IAP A;  1E5W A;  2DHK A;  3HK0 A;  1AWE A;  1WI1 A;  2EJ8 A;  1NTY A;  1I7A A;  1DBH A;  2IYB A;  2ZPY A;  1EAZ A;  4IOY X;  2G35 A;  3U8Z A;  1P5T A;  1LB1 A;  3X23 A;  2P0F A;  4A5K A;  4DBB A;  1MPH A;  1B55 A;  1WGQ A;  4F7H A;  5EFX A;  2I5C A;  4DX9 0;  2LYD A;  1GC6 A;  4CHJ A;  2J0K A;  1XD4 A;  1RJ2 A;  2J59 M;  4F7U P;  2AEH A;  2RGN B;  1LW3 A;  2RNR B;  1PFJ A;  4TKN A;  1H4R A;  1UNR A;  4HAX B;  5D27 A;  2N0Y A;  5C16 A;  2FJL A;  5FI0 A;  1NTV A;  3GYO A;  4P7I A;  4KAX B;  2DTC A;  5HE1 A;  2I5F A;  3QWM A;  2YS1 A;  1MIZ B;  2W2W A;  3TFM A;  2I1K A;  5D3W A;  3M1I B;  4WSF A;  4DXA B;  1GC7 A;  3BIN A;  2M14 A;  1V5U A;  2K2U A;  4HHV A;  3IVF A;  3CIK A;  2I1J A;  2RSG A;  2DYN A;  2DA0 A;  1DDM A;  3VIA A;  1SHC A;  2Y8G A;  2LOX A;  1ZC3 B;  1FHW A;  3DXE A;  1AQC A;  4MY6 A;  4MT7 A;  2CRF A;  2DKP A;  2D2Q A;  3ULC A;  2DX1 A;  3WYF B;  4WVF B;  2Z0P A;  4HAU B;  4GXB A;  2AL6 A;  2COA A;  2D9Y A;  3BJI A;  4HDQ A;  4KHB B;  3KRW A;  3FSS A;  2GCJ A;  3SO6 A;  4A6K A;  2MDX A;  1U27 A;  2ADZ A;  3G9W A;  2E2X A;  3TW1 A;  3UZT A;  1OMW A;  2W2X C;  3FM8 C;  1X11 A;  3ODO A;  3T06 A;  4B6H A;  5JP4 A;  2YF0 A;  2LG1 A;  1X05 A;  1FOE A;  4TYZ A;  4KVG B;  2DHI A;  2MKR A;  2COF A;  5C6R A;  2CAY A;  1N3H A;  2KGX B;  2UVM A;  3ZVR A;  4HAZ B;  4K17 A;  1BTN A;  3KRX A;  2UZR A;  2LKO A;  1FGZ A;  4HB3 B;  1UPQ A;  2MFQ A;  5JLJ B;  3PVU A;  4BBK A;  5GOW B;  1TXD A;  1X1F A;  2VSZ A;  2MWN B;  2OQB A;  2EMS A;  3KZ1 A;  5D3V A;  4L6E A;  3P6A A;  3ULB A;  3A8Q A;  4A6F A;  1V5P A;  4Z2M B;  1TQZ A;  1Z87 A;  1U5G A;  1KZG A;  1MAI A;  3PSC A;  1I2H A;  2DLW A;  1U5E A;  1BAK A;  1FHO A;  2K00 A;  1FAO A;  2NMB A;  2YT1 A;  1XR0 B;  1DDW A;  2ELA A;  1PLS A;  5J3T A;  1DYN A;  4HB2 B;  4ZRK A;  4K81 A;  5DIF B;  1UPR A;  1XKE A;  2KUP A;  2LOZ A;  2RVB B;  1U5F A;  2X18 A;  2XQN M;  2BCJ A;  2DX5 A;  5KCV A;  1U2B A;  2J0J A;  2Q13 A;  3NSU A;  3SUZ A;  3N7C A;  3DXC A;  3ML4 A;  1Y5O A;  3D8D A;  1DDV A;  1J19 A;  2DYQ A;  3PVW A;  2V76 A;  2H7D A;  1V88 A;  4F7G A;  4HAV B;  2Z0Q A;  4NSW A;  3V5W A;  4Y94 A;  3QIJ A;  3SYX A;  3KY9 A;  4A6F B;  1X1G A;  1P3R A;  5LON B;  5J3Q A;  4A6H A;  2D4Q A;  4ZRJ A;  5C79 A;  3AU4 A;  5JHG A;  2H7E A;  2VRW B;  3MPX A;  1W1G A;  3DXD A;  1QC6 A;  5JHH A;  1ZSQ A;  1NU2 A;  4DX8 A;  3KSY A;  5D3Y A;  4K2P A;  4HB0 B;  2QKM A;  1KZ7 A;  1OY2 A;  2HTH B;  3PZD A;  3CXB B;  3PVL A;  1W1D A;  2RUK B;  2GCL A;  4CYE A;  2DHJ A;  2IFS A;  4HAW B;  3TO1 A;  2L1C A;  4HAT B;  1WVH A;  1V61 A;  4HAY B;  2NZ8 B;  4PQ0 A;  5C5B B;  5KQ1 A;  1IRS A;  5DHA B;  5LOP B;  3GYP A;  2YSZ A;  4GN1 A;  2YT0 A;  2UZS A;  2VKI A;  1WJM A;  1Y19 B;  3A8P A;  4IFS A;  1PMS A;  1W1H A;  4GPT B;  3PG7 A;  2W2X D;  4KHO A;  5DH9 B;  1H10 A;  1ZVR A;  2ROV A;  4K2O A;  4D0N B;  1RRP B;  5D3X A;  3SV1 A;  2K2J A;  3AU5 A;  4GMX B;  2HE7 A;  5CLQ B;  2ROZ B;  5HE3 A;  2YS5 A;  4XWX A;  5FI1 A;  5J3Y A;  4GMV A;  1U5D A;  4YL8 A;  3ZDT A;  1EF1 A;  1KI1 B;  1U29 A;  3O96 A;  2R0D A;  4HDO A;  3AJ4 A;  1QQG A;  1XX0 A;  2N23 A;  4EMO A;  1P6S A;  1GG3 A;  3FEH A;  3TCA A;  3WA0 A;  2D11 A;  1NI2 A;  2J0M A;  1OQN A;  2EC1 A;  2OTX A;  1MKE A;  4HB4 B;  1DRO A;  1Q67 A;  2D10 A;  1FB8 A;  1V5M A;  3LJU X;  4NY0 A;  4KHA A;  1EVH A;  1FGY A;  5CLL B;  1BWN A;  3U7D A;  2D9X A;  1K5D B;  5DI9 B;  2QKL A;  2GJY A;  1K5G B;  2Z0O A;  1XOD A;  3P7Z A;  2Y7B A;  4CHM A;  1UNQ A;  3RCP A;  2DKQ A;  3F0W A;  4YON A;  4EKU A;  1V89 A;  3VOQ A;  2PZ1 A;  2COD A;  3OAN A;  1EGX A;  1M7R A;  2YRY A;  2CY5 A;  2YVC A;  3MDB C;  2D9Z A;  1TJ6 A;  4H8S A;  2D9V A;  4Z2N A;  2Y8F A;  1MK7 B;  2L2I A;  4ZRI A;  1X86 A;  1MIX A;  2M38 A;  2GS0 A;  2D9W A;  2JP2 A;  3D8F A;  3QBV B;  5DHF B;  1J0W A;  1SGH A;  5HE2 A;  5L81 A;  2LUL A;  2P8V A;  3F5R A;  3A98 B;  2COC A;  2YS3 A;  2P0D A;  3ODX A;  5KQ4 A;  1UEF A;  1ZM0 A;  1UNP A;  3PP2 A;  5C5B A;  4PNK A;  2ELB A;  1WGU A;  4MK0 A;  3ODW A;  3HQC A;  4EJN A;  1ZC4 B;  1MK9 B;  2DFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...