2YTCA

Solution structure of rna binding domain in pre-mrna-splicing factor rbm22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GSSGSSGEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor RBM22
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ytcA01
4QQBA 1YJNS 3MOJB 3DXBA 2LXUA 1WHVA 2M70A 5IM0A 3RW7A 2KH9A 4OZ0A 3R1HA 1H2VZ 3CMES 1X4HA 3P5TL 2MQPA 2MKCA 2MMYA 1X4DA 4YUDA 3VALA 2VODA 3UE2A 4LIRA 3JB9k 3B4MA 2HZCA 4ZKAA 1KOOA 4PKDB 1FJCA 3ULHA 3ZZYA 3CF5Q 1WEXA 1U6FA 1H2UX 5DDOC 1ZH5A 3CCMS 2U2FA 2KM8C 2MKHA 1Q82T 2RQCA 1B7FA 2DGSA 3LQVA 1HL6A 1SJQA 2YWKA 3TO8A 1SXLA 3MDFA 2SXLA 2DB1A 2BZ2A 1JJ2R 2KXFA 1CVJA 1DBDA 3NS5A 1K73T 1N54B 1U2FA 3U1LA 2L08A 2L41A 2HVZA 1X4FA 4WFNQ 1L3KA 1FHTA 3UCGA 1VQMS 4OZ1A 3CTRA 1NU4A 2ZJPQ 2N3OA 3MUTP 2OJ3A 3VAIA 4EGLA 1P27B 3CCVS 3BO4A 2MKJA 4CH1A 5IM0B 2OSQA 1URNA 2V94A 1SJRA 3P3DA 2MZ1A 2LEBA 3DLLQ 2MJNA 2QA4S 2HGMA 4BS2A 2RQ4A 5DM6Q 4ED5A 5CYJA 2DGUA 2DO4A 2YTCA 2DNLA 3EGNA 2JVRA 4A8XA 3PIPQ 3MUVP 1U1RA 2X1FA 2DNGA 3SMZA 3NMRA 2MZJA 2X1BA 3U1MA 1M1KT 1SJ4P 2A3JA 3CC7S 2HGNA 5IQQA 5GVQA 2MPUA 2MQNA 3UWTA 4WCEQ 2KT5A 4TU9A 5LJ5Y 1VQ4S 4FXVA 1OO0B 1X4EA 2XSFA 4M5DB 2KXNB 5JVHQ 3IWNC 1WG4A 3H2VE 4F26A 3V4MA 1IQTA 5GMKa 3MD1A 2E5JA 3P6YC 3J7YU 2DH9A 2KG0A 2RU3A 5GAEU 2MQLA 2KU7A 1H6KX 2ZJRQ 3G8SA 3CCRS 1S72S 2QEXS 1U1PA 2KRRA 2D9OA 2OIHA 5GAGU 2F3JA 3THTA 2LMIA 2KYXA 3D2WA 2FY1A 4C7QA 2J8AA 2JX2A 2EK1A 1UFWA 2DIVA 2MKSA 2DNNA 3B4DA 3CCQS 1DZ5A 1VQNS 1F9FA 2CQBA 4W92B 2RS2A 1WHXA 2CQHA 2LQ5A 1FJ7A 2M8DB 4IOCQ 1RKJA 5LXRA 2RNEA 1RK8A 2U1AA 1UP1A 1X4GA 5GAHU 1WELA 1VQOS 2MKIA 1NO8A 4F25A 1M5OC 2MSTA 3P49B 1WHWA 1DHMA 3MURP 1QM9A 1R8HA 2M4MA 3HI9A 4WFBQ 5JVGQ 2LXIA 2M8HA 5CXTA 2J0SD 3SXLA 3TP2A 3I56S 5EN1A 1WI8A 1VQ6S 1UAWA 3R27A 2FHOB 2MKKA 5MLCV 5HL7Q 3CC4S 1M90T 3FEYB 5LXYA 1WHYA 4WF9Q 3EX7B 2AYBA 2LYVA 4WIIA 1OWXA 5BJRA 3VAFA 2N7CA 4TLQA 2ERRA 3CCSS 2DGOA 2KG1A 2DNOA 3TYTA 3N9UC 1WG1A 4Z2XA 2DITA 3Q2TC 2MY7A 1YI2S 4QU6A 3US5A 3SDEB 2DGTA 2MHNA 3CUNA 4P6QA 1N8RT 1S79A 2CPXA 2M2BA 3THPA 2KXHA 2M88A 3UCZP 4TU8A 1ZZFA 3OW2R 1X0FA 2N82B 2AD9A 4LJMA 1JMTA 1U6BA 2HGLA 1PO6A 2CQGA 2G1DA 4WFAQ 5LSOA 1VBXA 2MZTA 2K3KA 1WI6A 2F9DA 1YWXA 2CPJA 2LA4A 2N3LA 2MGZA 2CQCA 3UD3P 4CQ1A 4IOAQ 4C4WA 3BEGB 1JJHA 2DNZA 2VOOA 4C0OC 1JJ4A 1KD1T 1X5PA 4Y0FA 5ITHA 2M0GB 2DNMA 1Q86T 2DGVA 3NNHA 5GADU 2B0GA 2MQOA 2MGZB 3J7ZT 1U1LA 4WKRA 3NNAA 3NS6A 5HO4A 3CXCR 2DNKA 1YIJS 2XS5A 2CQ1A 2XNQA 2MXYA 2F9JA 2LECA 1KOHA 4V19X 3NNCA 1DRZA 1VQLS 1X5TA 4IUFA 2CQ3A 3MUMP 2EVZA 3BS9A 3G9CA 1X5OA 2CQ4A 2J76E 1K8AT 2CPIA 1OPIA 1VQPS 2CQ2A 3Q2SC 2MZSA 3UCUP 2CQ0A 2DK2A 2X1AA 3VAJA 2CJKA 3K0JA 1WEZA 1G2EA 2E5IA 3UD4P 2MZQA 4LMZA 2CQIA 2G4BA 2VOPA 2E5HA 2UP1A 2RRBA 3BO2A 3S8SA 3VF0B 5D77A 1WG5A 1YHQS 1U1MA 1WTBA 1FNXH 2ADCA 1SJFA 1UW4A 4Y00A 2PEHA 2CPYA 2JVOA 1K9MT 2DH7A 1VQKS 2DH8A 3G6ES 1PGZA 1M5PC 1FT8A 2G0CA 2OTLS 2ADBA 2JRSA 1W2BR 1VQ9S 4TU7A 4J5OA 1WF0A 2FC8A 1WEYA 2JWNA 3BO3A 3G4SS 1QVFR 5FJ4A 1VBZA 3I55S 3VAMA 1X4CA 5DDRC 2DGQA 2KRBA 5CA5A 2OSRA 1O0PA 2QFJA 2CQDA 2E44A 4YB1P 1FO1A 2MJUA 1OIAA 2KN4A 4U67Q 2KM8B 1X4BA 2DNRA 1HA1A 5LSLA 2KFYA 1AUDA 1VBYA 2EK6A 1KC8T 2L9WA 2CPEA 1R8PA 3CCLS 2NZ4A 3RW6A 3CCES 1NJIT 2DHAA 1X4AA 3CULA 1D9AA 2J0QD 3CD6S 1VC6A 2FPHX 1WF2A 3FEXB 1BY9A 3CC2S 2ZJQQ 4UQTA 2CPZA 3SDEA 2DNQA 3S01A 2D3OR 1YJ9S 4W90B 3S6EA 2DHGA 2XB2D 1X5SA 1D8ZA 4PRFA 2RS8A 1U1OA 2KVIA 3ZZZA 2YH0A 2DHSA 2MQQA 1SJ3P 2CQPA 4CIOA 1VQ7S 2DHXA 2KHCA 2AYMA 5DM7Q 4CH0S 2CPHA 4F02A 3VAGA 2GO9A 3LPYA 1N88A 2I2YA 3G71S 2LA6A 2MSSA 2MY8A 4RU2A 1YITS 1VC0A 2MB0B 1FJEB 1A7GE 5DETA 2DGWA 2WBRA 3CMAS 3EGZA 3IRWP 3G8TA 1HD1A 2FC9A 2D9PA 2DISA 3R1LA 2NLWA 3VAKA 3S7RA 2DNYA 2DIUA 2HYIB 2RT3A 2DNPA 3MD3A 4IO9Q 2M9KA 1XN9A 1YJWS 1VQ8S 3VAHA 4ERDA 5IFMA 3G96A 3MXHP 4YOEA 1KQSR 2CPFA 2PE8A 2M52A 2E5GA 2K8GA 1VC5A 3PIOQ 2OTJS 2RRAA 1HD0A 2LKZA 4PR6A 1M5KC 2GHPA 1H2TZ 2RVJA 2VONA 2MZRA 1U1QA 1WWHA 2DGXA 1N52B 1WF1A 3MI7X 2CPDA 2RUGA 2MYFA 1ZZNA 3HHNB 2XS7A 2YH1A 4QU7A 2DNHA 2BOPA 2AYEA 2KI2A 2AYGA 2YKAA 5D78A 3CPWR 1FXLA 5DDQC 2MQMA 1Q81T 2XNRA 1A9NB 4FXWA 2O3DA 2XS2A 5H1SV 1YTYA 1M5VC 5LJ3Y 1U1NA 1Q7YT 3H2UB 2X1GA 3CCUS 2DO0A 1U1KA 1VQ5S 4UY8T 2Q79A 1QVGR 5DDPC 2LEAA 2M7SA 4QPTA 3CCJS 1P1TA 2I38A 3L3CA 2LCWA
chains in the Genus database with same CATH superfamily
1YRXA 4QQBA 3F41A 1SJFA 4ENOA 1J5OB 2LXUA 5SZTA 3JTNA 3NAHA 4BC7A 1G6BA 1Q8IA 4OFZA 2X51A 1RBOB 2ROGA 2GVZB 1Q4RA 3RW7A 2V68A 5KFCA 4DLEA 4M95A 1N32J 4OV1A 2QEXS 4X4TA 1DFDA 2EG2A 3KTQA 3FGVA 3MCSA 4WXWA 3V81A 1O5JA 3DI6A 3FBBA 5CAAA 3NY0A 2MKCA 1D3WA 1HQEB 2F65A 3UNYA 3VALA 4ED6A 1QJHA 3W62A 3JB9k 1PG5B 4ETZA 2R8GA 2HZCA 3GG1A 4P75A 1C0TB 5C24A 4CCHA 1S7IA 1U7LA 4PKDB 1HYSA 4J9MA 4RJVA 3CJ2A 1K1SA 2KJWA 3CULA 1U6FA 1H2UX 3KUEA 5DDOC 2GGPB 2RILA 2JEIA 2KM8C 4K4UA 4X4OA 4RZRA 2ZBPA 1K0TA 2EXUA 4R25A 5BXIA 4ECYA 4DFMA 2EKNA 3MMJA 3PFOA 1QDUB 3KG1A 1GXLA 4DV3J 1KBRA 1BQMB 1GK8A 1JLFA 1SQFA 1DBDA 1FTCA 1RTIA 1U2FA 2WVBA 4I1TA 1T05B 2G2OA 4NYOA 3TEGA 2HHSA 1T02A 3D5MA 1E6VA 4F4WA 3HK2A 3OTBA 1DTTB 2I5JB 1UJ6A 2WW4A 5T14A 5HSPA 2NQPA 2AEJA 2BQRA 4H4OA 1YKWA 3ETOA 2VJUA 2FHJD 2VC0A 1C1CA 4G1IA 4HYKA 1KHWA 2FVCA 4NA1A 1WDTA 3VAIA 4DUZJ 3EE3A 4D3HA 1P27B 2YKQA 3PO5A 2MKJA 3MR6A 4PG8A 1RWMB 2HHQA 3AB4B 1E6YB 5B08A 2YX4A 1IVZA 3LGMA 1HI1A 3C15A 3B82A 3MECB 3HVWA 5L1IA 4X64J 1FX2A 1HBMA 1MW7A 4WE1A 2QLWA 4ZCKA 3DGPA 4DDFA 5HMZA 3TZZA 2K1RB 2QA4S 3RBEA 3G6YA 5DM6Q 3M9MB 4DR1F 4RUBA 2CWXA 4ED5A 1I5OB 2J7UA 5EUHA 1KQKA 1PYSB 4G6VB 2B3TB 3KNGA 2UXBJ 4MJKA 4DZDA 2DCUB 3M8PA 1U0HA 3CJ0A 3MUVP 3HXMA 1FA0A 2XC9A 4LRCA 5J2QA 2AQ4A 4M5JA 2NSBA 3DLGA 4JI3J 1XQIA 4LBPA 1W26A 3SMZA 2MZJA 1GMVA 2J0WA 3H4DA 2C2EA 2JFKA 1NUEA 1RQ0A 2EFNA 1R3NA 2OD6A 2P6TA 1CSJA 5GVQA 2MPUA 3BR9A 1RSCA 4NLYA 5IQQA 3UPFA 4GKJJ 5F8JA 4DMZA 2DR8A 4DSJA 3V81B 3BGFA 1UVIA 5DGAA 4WU2A 2R2UA 3OR1B 3AOBA 4G65A 2V8VA 1NM2A 2W4DA 4I2PA 2HIYA 3CJ3A 5D4LA 1VQ4S 1KQGB 3C6TB 2DD8S 3CT9A 5IV4A 1B64A 2LQ9A 3M32B 4Y2IA 2GMJA 1Q8BA 3MCOA 3T5KA 4JI6F 2QMUB 4YDDB 1HPZA 1YBUA 2CJYB 3MAAA 2GZOA 3DU5A 5IC6B 2FVSA 1VRQC 2E5JA 3PR5B 3GZ7A 4B3MJ 1S1TA 4JI7J 4LF1A 2DH9A 4M5LA 4YFUA 5H9EJ 3OL8A 2HURA 2MQLA 5KG7A 3OUYB 4E0DA 3QRQA 4RO0A 3GILA 4I2QA 4EK2A 3UDLA 3Q8RB 4ECVA 1HQUB 2NSCA 3BDEA 1F9EB 1UL3A 4M5NA 1TVRA 3G8SA 1U1PA 4KGZB 5HQMA 5L46A 3GV7B 4MIBA 4WK1A 4CT9A 4F0KA 5GAGU 1KSPA 3M9OB 3H5XA 4ZN3A 1RB0A 2LMIA 4JI0J 1NZAA 4X4UA 2ZE2B 1RHQB 4GMKA 2KYXA 4LF9F 5KFSA 4F36A 2QTWA 1D0EA 2EK1A 4X65J 1NH7A 2IBOA 2MKSA 2PDAA 4ZPWR 3SEOA 2ASJA 5H9EK 1GTHA 1DZ5A 1LK5A 1SQEA 2CQBA 2XZDB 2VFRA 3NBPA 2XZTB 1WHXA 1M0SA 2PT0A 2IAJB 3M6UA 4IOCQ 2VKZG 4YR2A 3OXLA 2U1AA 3FC9A 1O8BA 1RWWB 3V5RA 5GAHU 1IJEB 1WELA 2FDNA 1HIYA 3P96A 1VQOS 1U48A 1JLAA 1R27B 1U24A 3JAMY 4AE5A 2DR7A 3CCWA 3W2WB 1HW8A 1Z2LA 3MPWA 3Q8VA 1WC4A 3G2XA 1T3OA 1PAEX 1QM9A 1SKUB 3NG8A 5K9FA 2R8KA 2M4MA 1RAJA 2F7VA 2RDIA 3K17A 5DGBA 2CNKB 2WB1D 3HHLB 4LREA 4FF1A 1GNKA 3VQTA 2LXIA 1VRTA 1S48A 2V8PA 3UW1A 2J0SD 2HAIA 4C11A 4DR5F 4OIXA 1CJTB 3R27A 3CB4A 3DRPA 2MKKA 5MLCV 1VIXA 4AL7A 1PIEA 2VV5A 3KUHA 1A0OB 4TNOA 2HKEA 4ZVUB 5A76A 2ZKTA 2YPZA 1JLEA 1JK9B 1VISA 1GQEA 2K06A 1XTZA 1K47A 2D3ZA 1WHYA 2Z2MA 1C4AA 5HK4A 3SFUA 4YQWA 4MT1A 4WF9Q 4Q0BB 2AYBA 1CC8A 4OYOA 2EKYA 4A8FA 3CD7A 2YWHA 4NA3A 5HLFA 4KPYA 2ERRA 4WFZA 3T1YF 1WKLA 2VDIA 5LSRA 4L73A 4X4SA 5CZVA 3CMQA 1IBMF 9ATCB 3H4BA 3GFZA 2ZH9A 3QMQA 4JYAF 1RCXB 2EG1A 1RTHA 2YNFA 3N9UC 4LF7J 2X3GA 3M30B 4LR9A 1N32F 2D69A 2MY7A 2BJ3A 2IPOB 2MQ8A 3BGLA 3CJKB 1RU1A 1NK7A 2QRRA 1YI2S 2K2PA 5DQGA 2E1RA 4QR1A 3JTOA 4L75A 1S1UB 5RUBA 3R3TA 1OY9A 4H4MA 1RT5B 3ZZ0A 1FDBA 1U2RA 2Z30B 2QIFA 3QIPB 3LP1B 3MFHA 1HNWF 2DBBA 5HVHA 2CPXA 2V4JA 3HSZA 2JJ4D 3SI8A 1N5YB 4TU8A 3O44A 2B4UA 5KG3A 3N6LA 3QSIA 1C1BA 2N82B 5DS7A 4LJMA 1JMTA 1U6BA 4CTAA 3FQLA 1TP7A 2HGLA 4WFAQ 4BCAA 2OO4A 3OLBA 3DRPB 3EVWA 3H42A 5LSOA 4DI6A 2XM3A 4PG5A 4ED3A 1HHTP 3DLBA 2OELA 4CH7A 1FCAA 2ZD1A 3KK3B 4DR4F 3B54A 2ZBIA 2E7VA 4I7FB 2XG8A 3DLEA 2UU9J 2LXFA 1CBKA 1TL3A 1AZSA 4J91A 4LSNB 3NGSA 4U7UK 4PUOA 4C4WA 2W7OA 2CRLA 1R8CA 3BEGB 1JJHA 4CLPA 3NEKA 5ITHA 2M0GB 2NYHA 3DOLA 2DGVA 2VFSA 3T41A 5C42A 3QGHA 5KOWA 4X62F 4RW8A 5GADU 2AWZA 2IRXA 4CDIA 1NK6A 1WKJA 4KO0B 3N01A 4KBIA 2MQOA 2MGZB 3J7ZT 4TY8B 5K8NA 4WKRA 2Q43A 4MIWA 3CXCR 1TL4A 2DNKA 2MDAA 1GMUA 2BM0A 3GYGA 3CDWA 3G86A 1KDNA 3OVSA 5J2PA 1YJ7A 1FVSA 4KC5A 2CQ1A 4KRWA 2FZKB 5B0GA 4WZQA 3KWMA 4ZITA 1RADB 2MXYA 4V19X 2ATLA 1FVQA 2IAJA 5L39A 3W63A 5K8PA 3LP0A 3EICA 3TOQA 1MMLA 2V4JB 3BS9A 1S99A 3G9CA 1X5OA 4MTPA 2XLJA 1R0AB 1IKWB 2FJVA 2KL8A 1WD6A 3F73A 2F63A 2VPYB 2CPIA 4HH0A 1FKAF 2GJIA 2WSEC 3QT8A 4OJ1A 1MLAA 1YBAA 3Q2SC 3UCUP 3HVTB 4UW2A 4HHJA 3D7SB 2QA1A 2CQ0A 3MMBA 1YQHA 2VQFF 4QWAA 3GJTB 1RTDA 1GAOA 4LSLB 1QLNA 3K0JA 2BJ1A 4ZJQA 3M8QB 2E5IA 4URQU 3UD4P 1RAIB 1OSCA 1C1BB 1YJRA 1T95A 4O3NA 4FPIA 4U8VA 2ZM6J 2FVQA 4O3RA 2UXCJ 1IQZA 1T9XA 5E2QA 4DCJB 1JLQA 4HDGA 4KT0C 4RKUC 2UP1A 4OX7A 2YNGA 3BGUA 1TMJA 1F9HA 4L76A 2FGCA 4ANCA 2AGQA 4ID5A 2QMXA 5ETLA 4RW8B 5D77A 3S8SA 1ULRA 3HD1A 4K4YA 2E7XA 4P74A 1WTBA 3HKWA 3V6DB 1JLEB 4PABA 4CO2A 2ADCA 4U6PA 3J81j 4DF8A 1TKDA 1D9FA 2PEHA 4LR8A 1ZM9A 2R4FA 3EGVA 2VZ9A 1Y3JA 1VQKS 1TV6A 3VGVA 4K4VA 1FRMA 2KVQE 2HHWA 3W5XA 2UU9F 4O3PA 3JXOA 1M5PC 3PO4A 4DWIA 3FDSA 1UFKA 2WOMB 1RT3A 1LWXA 1NEEA 4KH1B 1G4CA 1UEUA 4NZ0A 1W2BR 5KFGA 2ZITA 4LQ3A 3VGTA 2BM1A 3ET6A 3TWZA 1KKHA 2ZZNA 2NXEA 5KFNA 2FC8A 3U7JA 3OHAA 2ALZA 2YX1A 2CZ9A 3WX8A 1VBZA 3AH6A 2GVDA 4HH1A 4NEZA 1X4CA 3DHWC 5DDRC 4EYHB 2WAQD 1HR0F 1IR2A 2KRBA 3RGIA 3NP5A 4F8RA 4O4GA 3J7AN 3EXYA 3R6LB 3IAS9 1XNRF 1U8SA 2QYCA 3TANA 2XWXA 3D0HE 4YN3B 4YB1P 2XMAA 5KTQA 1OIAA 4RWWA 2KN4A 4U67Q 1ZPWX 3EWGA 1HA1A 1RTHB 3AXMA 5K14B 5THWA 3MM7B 4ITSA 4P52A 5KFAA 2FJBB 1KC8T 3GQCA 2AKWB 4A8MP 2HVIA 1GMWA 4P71A 1HWJA 2NZ4A 2KDOA 2W4CA 2WVFA 2UV8A 3MEDA 4V1Ak 2VQEJ 4CLYA 2VQEF 3Q24A 1N6QB 3A3PB 3PY8A 2VQFJ 5J1EB 3D6FB 2B9EA 2B6AA 4KSEB 3AB2B 4YMEA 1REGX 2P5VA 2ASYA 2I5JA 2DVIA 1RT3B 3PFEA 3HM9A 3HX9A 2L9NA 1DQ8A 3EPGA 2HHPA 1BY9A 2BJEA 5HN0A 5FLXY 3CC2S 4H4KC 1RTJB 4EYIB 3IBFB 3GONA 1V6HA 2OEJA 3D67A 3D54A 3HULA 3EXCX 4USIA 4KHMA 5CABA 5KFBA 2QMWA 1FF2A 3CCZA 2M5YA 3MAAB 3KK1A 3FSIA 3GIIA 2D3OR 1UW9A 3O2IA 2R8IA 4A8SA 1YJ9S 2DHGA 2BDPA 2DXFA 1KP6A 5B7WA 1NKEA 3QIDA 1BQXA 4I4BA 3GSIA 3GPAA 3NWRA 4TXSA 1PKUA 1D9DA 2OMOA 4OZLA 1HQUA 1XR5A 3MZIA 5E3QA 3DLGB 3ZZZA 2WW8A 3OR1A 1TKXA 3VGSA 4K4SA 1VMBA 3W9HA 2K7JA 3NS7B 2UUCF 3GMGA 3WC2A 3NWGA 2AT1B 2OD4A 1R8AA 1H72C 1VQ7S 3LA0A 4USWA 5DM7Q 2UVRA 2FJEB 4G1PA 3TJ9A 5A8KA 1RHMB 2KYZA 3W2VB 3OTEA 4NLWA 3VAGA 2GO9A 2GIRA 1U25A 3ZO7A 5LOQA 3BYPA 4EI2A 4ETXA 2IY5B 1N6QA 1PCAA 1TL7A 1LKZA 4X4PA 4ZVFA 3A1YG 3G71S 4RUCA 2KZMA 1CLFA 3BSOA 1U0HB 2Y1RI 1C2PA 3DLKB 1GX5A 1H0HB 4O4GB 1Z2ZA 3HT3A 5AE3A 5F9NA 3GWCA 2LDYA 4Q43A 4RU2A 1KS2A 1YITS 2MB0B 1TL7B 2HBZB 1A7GE 5DETA 2OEKA 3LP0B 3IRWP 4G3IA 1HD1A 3N6MA 4HI1A 4HTIA 4ZVTB 2D9PA 1FESA 1HNZJ 3VAKA 2MLXA 2J7WA 3S7RA 2HYIB 4F2RA 3TAQA 2D1CA 2H9ZA 4IO9Q 3OTDA 3ADAC 2V34A 3T19A 1XN9A 3KJNB 3TZYA 4WXOA 4KQZA 3VAHA 3A3OB 2FB0A 3JS9A 8RUCA 1IBKF 4F4XA 1IBKJ 4N5SA 4DPYA 3QJPA 2CPFA 2PE8A 1IKVA 2M52A 3BN7A 3DRSA 5B0BA 2X7IA 5KFDA 1T9VA 2DR9A 4USHA 3IR6B 2F5GA 1HD0A 3KLIA 4PR6A 2BE2B 3WX4A 1M5KC 1JNZB 3BKFA 4ED7A 4AL5A 4KFBB 4JI7F 1R31A 1DTQB 1H2TZ 1U8WA 1VK3A 2RE1A 2EFVA 4YEAA 4QPXA 2MZRA 4X66F 2VFTA 1RAHB 4KGKA 4PXDA 1S0OA 2PA8D 4B9LA 1CC7A 2PEBA 3GCXP 4B9VA 1LXJA 4NEYA 1FRLA 2HW3A 3MI7X 4DUYF 5HI7A 2B51A 4TKTA 2MKYA 1AYEA 2DNHA 4YB7A 5GMEA 4Q45A 2VICA 1NSKL 2VB6A 4ED4A 1I51B 2V9WA 2YKAA 1Y0HA 1Z4UA 2IFXA 1PAUB 1FXLA 4ZPCA 1R43A 2MQMA 4MYTA 3DHXA 1WJ9A 2GS8A 3THVA 1NPRA 3MM5A 4FXWA 4C2MA 1SB6A 1NPPA 5AE1A 4JI5J 3KYLA 2BBEA 4J9KA 4Y2MA 1LXNA 1T9WA 2BUNA 3HVAA 4ZOSA 8AT1B 2H5IB 1V5VA 1FJGF 3W8GA 3U02A 3MM7A 2HRYA 3M2RB 3HP6A 1T9TA 2LQJA 3VQSA 3LWMA 4L74A 3MF5A 5IZHA 1RHJB 4V19J 4I67A 4AD6A 4TVAB 2WONA 1LWCA 4R5PA 3D6MB 4DV0J 2OLWA 4ECZA 2NXUA 1HBNA 1TL1B 3H2LA 2QYGA 2H5EA 2DYAA 4QOTA 2ZBCA 1HWLA 2XCPA 4KJIA 5D4OA 3P5BP 4QPTA 4E8UA 3CCJS 3RRHA 2XHWA 2I38A 1S0MA 1KNZA 4ZA1A 4K2XA 4ZN1A 4DL5A 4LRAA 4OYMA 2R7VA 4F3MA 8ATCB 2C2MB 2B8QA 3TR5A 1U45A 1RT7B 1RWVB 3D0IE 5HMXA 3ZZPA 3SCJE 1VCTA 5ETNA 4ZVOB 5DQHA 3PX4A 4LR7A 1RABB 2C2KB 2BANB 3SV4A 4QYZK 1F3FA 1KVKA 2CXEA 3LALA 4P2MA 1KRPA 1LEOA 1H2VZ 5EWFA 4W98A 1X4HA 4UZCA 1NDKA 1RT7A 1REVB 4K2JA 4MYUA 3TA0A 2MQPA 4CYUB 2W8LA 2VODA 1JJCB 2C2DA 3K59A 1FJGJ 2JEGA 5KFFA 1UVLA 2CYYA 2QSWA 2ZFHA 3NL0A 1FJCA 4KB7A 3BGRA 5KT5A 2QJ3A 5IT9U 1S5ZA 2R8JA 1LK7A 3OVAA 3HFVA 2HHHJ 2B9YA 1N5QA 1SUQA 1TAQA 1Y3KA 3KMSA 1ZH5A 4MAKA 1MN7A 1XBWA 1UEVA 4OI4A 1N0UA 2YKOA 4OI2A 4OZ5A 3H5UA 1KONA 2B4PA 1LWCB 2Q3PA 4C98A 4CTAB 4ZK7M 4UZBA 3KLEA 4C6AA 1OQ6A 2RQCA 2JOQA 1X9SA 4C8OA 1TFWA 4CO5A 1O51A 3W3SA 3QATA 1VHIA 1N5YA 1SXLA 2SXLA 2DB1A 1ACMB 3UVJB 3M05A 1JJ2R 2NUHA 5B09A 4PXEA 4E98A 1YK9A 1CVJA 4GKJF 3K5MA 4KHPJ 2NYIA 2ZZMA 3C3LA 2O66A 3M8ZA 1ZETA 4DV5J 2HVHA 3UN3A 4CLTA 4EEYA 1X4FA 4WFNQ 1L3KA 4LVNP 2ILZA 2VJVA 4ER8A 3Q8SB 1J5OA 1S0VA 1FHTA 2YKMA 3GYNA 3H59A 4DL6A 2UUBF 4FN5A 3CTRA 5A8WA 3SV3A 3OD2A 1XMQJ 3PTWA 2ZNZA 2VPWB 3A3NB 4IFYB 1UA1A 2H5JB 2N3OA 2KO1A 4EGLA 2GV1A 5BYRA 3LUYA 3BO4A 3WIUA 4XPEA 4QYZJ 4CH1A 2OSQA 1URNA 1W2IA 1S1TB 1S6QB 1SJRA 3ILOA 3OPKA 3P3DA 4NASA 2WZ1A 3A8IA 4XK8C 2HBYB 4X66J 2MZ1A 2QA4G 2JEJA 4Q8FA 5CD4A 2BW7A 3M32A 2RQ4A 3HLUA 3KK2A 2QLFB 1NSPA 4Y2AA 3AA9A 3O8WA 5CYJA 1Y7PA 2P9CA 1NK9A 4U7UD 1WC5A 2AJFE 1U09A 2DO4A 3MWBA 4NOHA 2E1PA 4XTTA 3OVBA 5HROB 3FK4A 2CJ9A 2DNLA 1BE4A 3EGNA 1U1RA 2HSEB 4WWSA 4ZP7A 1N36F 2PMZD 2NXNA 4LF8J 3DGVA 4M94A 1UJ4A 4ZCMA 1RT4A 1RISA 3PYGA 2AGOA 5A0YB 3RRGA 3MTJA 4C0HA 2J5AA 1FRIA 2X1BA 1KEKA 2BQ3A 3ZNUA 1T8EA 1M1KT 1XEZA 3BM7A 4IG0B 5HVFA 4YS2A 3J7A1 2R8HA 3L09A 1HNZF 3MEEA 4Y2CA 1JX4A 1OSDA 2F8EX 4FYVB 2AJQA 2BJ9A 4F0MA 1FD2A 4A8YA 5KFOA 2ZBRA 1SV5A 1SKRA 1OO0B 1EZZB 2VDHA 3KLVA 2KTQA 1T0TV 1X4EA 2CJAA 2XSFA 4M5DB 3V4IB 5BYSA 1FXRA 3M4XA 2K1RA 4C97A 3IWNC 2Q6CA 2VASA 2VG5A 3H2VE 4LRBA 1QE1B 4WKYA 5KFQA 1IKVB 3BSAA 1IQTA 3DU6A 5GMKa 1FNOA 4AUKA 4QU6A 3MD1A 5AT1B 1NK5A 3KLHA 1RWUA 1RWNB 3ILIA 4CI0B 2OPQA 4JB8B 3G8QA 3J7YU 4DSLA 1OMSA 1PBUA 3D9BA 5K8MA 5I3UA 1Y4ZB 1S7HA 2XGQA 4KFBA 4ECSA 5M2RA 2YKNA 1NHUA 2BMBA 2XYGB 3T1YJ 4AFFA 2UXDJ 5CH7B 1NPKA 2W9BB 4DV5F 1WTFA 2UXBF 2KRRA 1MMNA 3PG9A 1FKOA 5HAOA 2C3OA 1VS3A 2GQCA 2BACA 1SL2A 2V9KA 2F3JA 4M5IA 5J1EA 3GJSB 2FVPA 6FDRA 2WVCA 4EO8A 3G82B 2ZH5A 3E51A 4C7QA 3EMTA 5LL6d 4YR3A 1NK8A 2JX2A 4C8LA 3H20A 1VRUA 5BYQA 1BWVA 1N5VA 2DNNA 2CZVC 4USJC 2E9ZA 5F8GA 3RB3A 4LF5J 1F9FA 2DEJA 4F4AA 3CD5A 5M2PA 2RS2A 2DEIA 3FBFA 3KJVA 2J0XA 4IDKB 1EETB 2M8DB 2AP6A 5LXRA 2ZH1A 1URRA 3ONQA 3CC7S 1UP1A 1VK8A 2AIRB 2HS3A 3AD7C 1X4GA 1YLXA 3F44A 3IFEA 3PCOB 2MKIA 3K2YA 4K8RA 1TAUA 2K7KA 3QGPA 1M5OC 1JLAB 1RTZA 3TQEA 3P49B 2W2PP 1WHWA 1DQ9A 1LQ9A 3ZNJ1 5CD4H 3BQ2A 4JI3F 3CWJA 1IBLF 4TLRA 3GFYA 1F5CA 1MWQA 4RR5A 4A8OA 4WFBQ 4HT7A 5D8HB 2CJQA 2OHDA 3DI6B 5KT7A 4TYAA 3KOAA 3KK1B 2QL9B 1VLYA 4ILRA 3TQ1A 3POTA 3SXLA 3TP2A 4OYWA 4OI3A 1RAFB 3RUBL 2FIUA 3L95X 3QYYA 5EWGA 1UAWA 2WK4A 2HNZA 5B0DA 4JI2J 1Q95G 3SSRA 4QWDA 4NMXA 3KK2B 1CS4A 3FEYB 5IOLA 2W9AA 3IR5B 3BSNA 1VGYA 3LF0A 4N8NA 1RAOA 2HIQA 2R42A 4KIAA 3F56A 2XCAA 2A2CA 3EX7B 4E2FB 1GH8A 1CULB 2ZHOA 4MKYA 3VAFA 1RTJA 4WIIA 2IYGA 3UN5A 4DSEA 4JOUA 2XMMA 3C14A 2DGOA 4LIWA 4JBCA 1M5HA 2FD2A 2VC1A 4C3MA 2KG1A 1EQ0A 4FDFA 1IKXA 5F41A 1UJ5A 1EARA 1WG1A 3V6KA 2HQCA 5JUMA 4B3RF 2N4DA 2DITA 4O4RA 3FSYA 4ZLJA 2QSFA 4DFJA 3N4WA 3WHIA 3M2VA 2V8HA 4LF4J 1YZ7A 2EFOA 3DM2B 2VBWA 2NS1B 4A4JA 2GGPA 4ED2A 4X4VA 3D1HA 1JWWA 1SV5B 4QW9A 3PW5A 4TQSA 2JSXA 1N8RT 4WBFA 2W2OP 4K5SA 2YWEA 4P73A 3IWLA 1GXTA 3BH6B 3WC0A 2ZH2A 2M2BA 2LQBA 3THPA 5E3AA 3T5JA 3UCZP 1RJJA 4K4ZA 4UT4A 4LF6J 2VD3A 4IG3B 4QJVA 1IM4A 3Q22A 2CAJA 2H3EB 2AD9A 4W90B 3UFCX 3VHQA 2D3O1 4PAAA 1X8DA 3CIMA 2CQGA 5ETRA 1F3VA 3T6JA 4NI2A 4ZLPA 1RTDB 1QAJA 1VBXA 1S6PB 4GVLA 4DX6A 5G4DA 1U4BA 1WI6A 2VUGA 3QNWB 4FKYA 4RWXA 3M6WA 3C6UA 4ELTA 1OY8A 2N3LA 2MGZA 4EBCA 1B70B 1ZPVA 1R6VA 1HNVB 3QFHA 1LW2B 2CQCA 3PHEA 3J7YI 3QRRA 1SI9A 2JH3A 1HKAA 4PQUB 1RA7A 4GO7X 4ID8A 1VI7A 1APSA 1W25A 3MM8B 1FFSB 4C0OC 1JJ4A 1KD1T 4Y0FA 3SYZA 1REVA 2DNMA 1N4LA 3ENQA 5KFJA 1HNIB 2WOMA 1RLCL 2CG4A 1HHQA 4Y3CA 1FRXA 3ILJA 3IC1A 1U1LA 4RU9A 3DKDA 1JLQB 1YIJS 1TV6B 3SQOP 2UZAA 1S12A 1SC1B 1SIZA 5EWEA 2P2CB 3FUYA 3NNCA 4F2SA 4N8OA 3H25A 3V6DA 2H4YB 2AU0A 1DRZA 3MM9B 3E8OA 4H4OB 3NAIA 1SQGA 1X5TA 3RBXA 5AXLA 5HMWA 2LLZA 3QJLA 3NLCA 2YKNB 3OJUA 3IG1A 4ZCLA 1NJZA 4LQ9A 1WC3A 4JI1F 3HSJA 4FNHA 2DK2A 1IBMJ 3OXGA 1FKPB 4F4ZA 2AV5A 3PV8A 1F60B 1OS5A 2GIFA 2ACMA 2LDIA 4OJHA 1G2EA 2HQFA 4LMZA 4EUVA 2IIHA 1S1VA 2QT7A 5GAEI 4YHHF 4GC7A 2E5HA 4OX9F 2E9RX 1UVKA 2VL1A 1ZM2A 2W2NP 2IVYA 2Z56B 3R5JB 4CWBA 2AX1A 1H38A 2W2MP 3CEDA 3EDRB 3KLFA 2R7TA 5K8OA 2FHKA 1RWOB 2VIHA 1SVDA 1HHSA 1U1MA 3QO9B 3MPVA 1YHQS 2PMHA 3DOLB 3QZ8A 1FNXH 1ZOTA 4OHXA 1B0TA 5DLGA 2I9SA 4DFKA 5HP1B 1JLBA 3FCVA 4ZP6A 2CPYA 4YP3A 2XMKA 3JSBA 1XMQF 1K9MT 3EZ5A 3QAUA 3L4BC 3AA8A 4YB5A 3ZZTA 3HZGA 1SUQB 4CLWA 2OPRA 1WOPA 4DPXA 1FT8A 2MTLA 3T3FA 4H54A 4CO3A 3OL7A 2ADBA 2ZH3A 2W24A 3BV8A 3MFIA 1QTNB 2HBRB 1IUJA 2RQMA 2VKRA 2IM3A 1V3SA 3TAMA 2E5LJ 1EQMA 5IT0A 3C19A 3I4HX 3OTCA 3TRGA 4CYUA 1U49A 3TUIC 4KHPF 2JWNA 3OXFA 3IP0A 3G4SS 2XI2A 1QVFR 1HNVA 5FJ4A 3VAMA 1NB2A 4B3RJ 4Y28C 5FLXU 1CJKB 1XIQA 3HHLD 3DOKA 5IV3A 2V8GA 2XY7A 1WNEA 2CKWA 1R89A 2Y1LB 5IWAJ 3PX6A 3I4PA 4RUHA 1S1UA 4OI0A 3TEHB 1RU2A 2DXEA 3MR2A 2E1MC 2J7KA 4JV0A 1GXUA 5KG4A 3QWPA 2KM8B 2DNRA 3FCWA 2P6SA 1TELA 3U27A 5HQLA 1N34J 5LSLA 1HI0P 3UD5A 4FBTA 1AUDA 2C28A 1ICEB 1Q5YA 1QSYA 4OHVA 4ZPVR 1VBYA 4QIFA 5KT6A 2IVMA 3CW2C 3W2WA 1CJVA 2L9WA 5BR8F 1SL0A 3OSPA 2CNLB 4OI1A 1Y5IB 2H1YA 2E5LF 3KG0A 4XDCA 1L3SA 1ELOA 1OPZA 1RACB 1PJ7A 1Q8LA 4ED8A 1IKYB 2XY5A 1X4AA 3BPDA 5F8IA 1B99A 3MEKA 2WVDA 5H9FJ 1U2CA 1TK5A 3MM8A 1RYRA 5A8KB 1L3UA 3VWSA 4EO6A 3CD6S 2FPHX 3A13A 3NXZA 1WF2A 4ECTA 4HL9A 2V2QA 4I2QB 1S1XB 3D0GE 4B3MF 3ICLA 1LW2A 4BDPA 1RZMA 1I94J 4IRDA 2QL5B 1HW9A 1ZS6A 2PMWA 3W9IA 4B3TF 4UQTA 3KLFB 1NLKL 2RMLA 2IC3B 3QGIA 2YNIA 2P9EA 3CJ8A 3R5DA 5L9NA 4KGMA 4ECRA 3GB0A 5HMYA 5C25A 3V2UC 2HFNA 2I1RA 2ZWPA 1SKWA 2N7YA 1D8ZA 2OFGX 5E3PA 2XMVA 4EFAC 1T9YA 5EHHA 4PRFA 2RUSA 1FRKA 1UMJA 1YSJA 2V2KA 2DHHA 1AXQA 3OHBA 4BC9A 2I8EA 5I3QA 2YH0A 4NLRA 5LT5A 5F8NA 3SIPB 3FJ2A 5T7LB 1UZDA 1CQMA 5HANA 3UR0A 2OAUA 2K3IA 1V9OA 4LFCJ 1JXLA 1LNQA 2ZC3A 1S6OA 2FZGB 3AT1B 3FCHA 3RRKA 4C3KA 1O6XA 4OYBA 2CIMA 1DURA 1RT6B 2RKIA 4F67A 2QC3A 4DOZA 5GAHI 3OTOJ 3Q23A 4ECXA 4RNMA 2Z0GA 3ENVA 4R0EA 3KG4A 1H7WA 5H9FK 5KFHA 2B4OA 4UTGA 3FRZA 2RF2A 3LPYA 3RU0A 2P9GA 3H5YA 1N88A 1T7PA 4QCLA 4OMFG 5JMNA 5J2QB 1LFWA 2NZCA 1XMOJ 2HHTA 2B5JA 3M1VA 3DNCA 4WYLA 1BMQB 2AZ1A 4Q5VA 3JSMA 1S1WB 4ZPBA 4YR0A 1VFJA 1UWBB 1OYEA 4K7QA 3TUZC 1VC0A 4FYDA 1NH8A 2WBRA 1R6YA 1FI4A 3EGZA 2IYIA 1VBKA 4C8YA 1TMMA 2FC9A 4DS4A 4WU3A 3ZZRA 2NLWA 4YY3J 1LV5A 2A18A 4YDXA 2RT3A 4G1QA 2G0JA 1RP5A 4PCQA 3MM5B 3G96A 3MXHP 4DLGA 4RW6B 2EW9A 4MK9A 4CP5A 1QAYA 5CHCB 3WZ0A 2E5GA 1GTEA 4OYPA 1VC5A 1Z1ZA 2RRAA 5ETQA 4DR4J 4NLPA 4N77A 3OUYA 1RTIB 2VONA 1WUUA 4DR6F 2LU2A 3DLJA 5I3PA 5GADI 3CGIA 1L3TA 4F4KA 2EFQA 1VRUB 4P2FA 5AXNA 4O0IA 1X9WA 1WF1A 1ZTWA 2YXLA 3DDNA 2RHQB 4QYRA 2YH1A 4PUOB 2F4FA 2BOPA 3KJVB 2AYGA 2ZM6F 3GV5B 2E9TA 3T9ZA 3DRSB 4ELUA 4Q2MA 4RL1A 1IBCB 3CDAA 1Y11A 1LWEA 2W4PA 5CYMB 3HJVA 4I2PB 1PC4A 3KLGA 1Q81T 3GIJA 2XNRA 3RR8A 1A9NB 3MTKA 4A48A 3SCIE 1MMDA 1S10A 2XS2A 1PSDA 4JI8F 1BC6A 5KFKA 5K20B 1M5VC 5AXKA 5LJ3Y 2VG5B 1U1NA 4B9MA 4KGVB 3FNNA 1B4SA 3V6HA 4AQYJ 5IT9Y 3ZTPA 2X1GA 5KFVA 4FF4A 1BLUA 3M6XA 3OV7A 3H40A 5I3UB 2GJFA 4QR0A 5KT3A 3PRDA 2ZC4A 3GP9A 4LBHA 4UY8T 1FXDA 1QVGR 1JNRB 3POTB 4ZVRB 4X64F 2M7SA 5DDPC 4A8KA 1XNQF 1XNQJ 4DL0C 4PPZA 3I0SA 3TNVA 3KNAA 3L3CA 2WTFA 2LCWA 4AL6A 1MN9A 4YB6A 4P7VA 4I68A 4LSZB 2GMLA 4CLSA 1YJNS 3MOJB 4MFBB 4PQAA 1DTTA 1UWBA 1S6QA 1XMOF 2Y1IA 2HQIA 1WHVA 4L3KA 3TI0A 4DV6J 3OFFA 3Q8QB 2HBQB 2KH9A 1CJKA 2FHMA 1UKUA 4J9UE 3VVUA 1IBLJ 1PJ5A 2Z57B 4K4WA 1Q0NA 2HHUA 1X4DA 3MMCB 2DXDA 2GC8A 4YUDA 3NGTA 4JI5F 4MK8A 4LIRA 4LFCF 3B4MA 4P9SA 4DV7F 2ZOFA 4KKOA 3K8WA 4GVBB 1KR4A 5DJBA 4ZKAA 5B0CA 2I0XA 3UDEA 4WZMA 1RT4B 1S57A 4FF3A 3IS9B 1RKIA 3F0NA 1WEXA 5JXSA 3JAMU 1ITPA 4Q8EA 5DZ6A 1HYSB 1S59A 3UR3C 1C4CA 1UEKA 4LRDA 1HL6A 3PXGa 5KFLA 4IRCA 1SJQA 2YWKA 2CJXB 3DRRA 4NA2A 2V2ZA 4CLLA 4DG1A 2VPXB 1I94F 5LM7E 4EMDA 6FD1A 3NGRA 3GTYX 4FS1A 4DQQA 2KXFA 4L72B 2BX6A 3KMQA 2BXJA 2HQ3A 3HFKA 3MR7A 5G0RA 1F2GA 1N54B 3BF4A 4AT1B 3GV8B 3BREA 2L08A 1U02A 1EP4B 3T9NA 2R9LA 2Y1JA 1J27A 3K7RA 2LVWA 4U95A 4DQRA 5BR8J 4NLTA 2CJBA 2A2DA 2GCFA 2W7PA 1N33F 3UCGA 1VQMS 1XC9A 2UUAF 4OZ1A 1HLWA 1IR0A 1NU4A 3R6GB 2EC0A 2ZJPQ 2WBMA 4MIAA 3MUTP 5KG2A 1RAEB 3IN5A 3N6NA 4QWCA 4DV1F 3CCVS 4PXCA 4J9RA 2V6AA 1JKHA 3BBFA 4J7CA 3C66A 4X4RA 2ZH7A 2V94A 1FD8A 4WJBA 5ADZA 4O44B 1FE4A 3UVJA 5LMUF 2KT3A 4C8NA 3UDCA 2QN6B 3GYXB 3I9ZA 4Y2KA 3SCKE 2LEBA 1PYOB 2JFDA 1XJWB 2XTJP 1RGVA 4PWWA 1ZM3A 3ZXWA 4DHVA 2GAGC 2V50A 3SZ2A 4EBEA 4BS2A 5E0OA 1CJUA 4ZVPB 2XSJA 3IRXB 2C2ZB 4USVA 2YTCA 3I87A 4HT5A 4QIGA 3PIPQ 1TL5A 2JVRA 2VHGA 2YPYA 4LF7F 4MKAA 4OJGA 2X1FA 3QLHA 4OX6A 1QD1A 2DNGA 2G0IA 2MHEA 3BGRB 3PJWA 3VR1A 4DCOB 3NMRA 2OI2A 3GE9A 1H3DA 4OZNA 1G7CB 3R97A 1S9GB 2C3UA 2A3JA 2GJ2A 7AT1B 4A8QA 1SJ4P 3TZXA 4ILMA 1MU2B 4UQGA 1BUXA 4QBUA 1VJQA 1FWKA 2HS4A 3ETMA 2KT5A 4TU9A 5ETMA 2GW8A 5LJ5Y 3A12A 3QIPA 4H4MB 4DFPA 3MHYA 3H90A 4ED0A 3I32A 3HO1A 3W60A 1YDLA 2BRKA 4A46A 5JVHQ 3VGUA 1M1GA 2BYCA 3AD9C 5HP1A 4KGXB 3FQKA 4IFYA 4ZS6A 3I31A 3CJ4A 1QUVA 3I0RB 4F26A 3V4MA 3C16A 4F3QA 1H73A 5ETTA 2CUYA 2JZ5A 2J9CA 3QO9A 4HHHA 5ETKA 5IXUA 1IKYA 1AA1B 1WC0A 4IOBA 1RBLA 3OLAA 1BQNB 1U47A 2UXCF 3P6YC 2DRBA 4DPOA 2HRUA 2HEKA 3W1YC 2FQQB 2HAFA 5KFXA 4B3OA 1H6KX 2HFZA 1PJ6A 1SH0A 3TJ8A 2J6UA 3BDPA 1S1VB 2KHDA 2BE2A 3R5GA 4LBIA 4ZHRB 2ZJRQ 3CCRS 1GMWD 3W5YA 3PHTA 3H8YA 4Z7CA 2D9OA 3RBDA 2OIHA 3THTA 2XGPA 4A8WA 1SJ1A 2YQ1A 2EEYA 1RLDA 1EP4A 2V67A 3SSSA 3PR4A 1U0SA 2FY1A 3ELHA 2C3YA 5KAKA 4NLDA 1V5IB 2F8MA 2RSQA 5MAOA 2HZVA 2PC6A 1C0UA 1UFWA 2DIVA 2X3DA 3WIVA 1M5SA 3PW4A 3B4DA 1CULA 2Y0BB 3IWXA 2IBKA 2UVVA 4NPOA 1VQNS 2BRLA 4FVCA 2O5DA 3DFEA 2UVWA 2XWYA 1JLCA 3UDVA 5C42B 2LQ5A 1F5AA 1R0BG 4DR6J 1FJ7A 1CS4B 1RKJA 2RJZA 2HHHF 1S9EA 4IH5A 2V69A 5L8RC 4AQYF 1WC6A 2FGOA 4F3OA 3EGWB 3CE8A 4JV2A 1NO8A 4F25A 1HBNB 2E7WA 2QLXA 2R7RA 2DTJA 2QA2A 2MSTA 3MMAB 2G9OA 3MCNA 3MM6A 4R0JA 5KG6A 5ETOA 3MURP 1OY6A 4QWEA 1R8HA 2Y3YA 3NOCA 3PX0A 5A2QU 2BQUA 2CNNB 4NX9A 3TA2A 1FRJA 2W1BA 2Z2ZA 2M8HA 2HVDA 3D28A 3NGKA 4DXLA 1T9UA 1NAQA 3HHDA 1LW0B 4ZPDA 5CXTA 4O44A 4LF6F 3FZBA 2JDJA 5EN1A 5AXMA 2YY3A 1VQ6S 2BV3A 2AEFA 3CCTA 4GRSA 5J2MA 2FHOB 2KZZA 2PIIA 5HL7Q 3QGGA 5C2CA 1VIOA 2G2YA 1M90T 5LXYA 4IG3A 1ZYQA 3HHEA 1LWFB 2GNKA 3Q89A 3VCDA 2V5HG 4BLGA 2ZDOA 4NLUA 3AJDA 1KVJA 3EZUA 4PPDA 1OWXA 1S1WA 5BJRA 2N7CA 4TLQA 4HHUA 4NXNJ 3PNIA 1RT1A 2IMOA 3D1OA 1XWLA 2MEWA 4FXDA 2DNOA 1DAXA 3U1NA 5KFMA 1NHVA 5D0GA 4JV5J 3AY0A 2IM1A 2XMTA 1Q7LB 3Q2TC 3BB5A 4F50A 3MCMA 1H74A 1RT6A 2RKIB 3ILLA 3TUJC 4Z37A 5HBMB 1N5SA 4C48A 2HMIB 3US5A 3SDEB 1YG0A 1S72S 2W25A 3N5BA 4HTJA 5DG9A 3T1HF 2DGTA 3CUNA 2B9WA 1AFJA 1HNXF 4HACB 1S79A 2JLEA 2HFOA 4CNZA 2VBXA 2M88A 1ZZFA 3OW2R 2B7BB 1X0FA 2LEPA 3QJJA 4NL5A 1Q1KA 2C3MA 5F0WA 3R5BA 4ZIWA 3PEHA 2J9EA 3A8KA 2A10A 3RAXA 1PO6A 4H4KA 3FBEA 2KFNA 2BKOA 1UFLA 3AOCA 4RNHA 2OMLA 4WYWA 2NR0A 2CPJA 4NCBA 2LA4A 4RX6A 1YZ6A 1LW0A 3C6UB 2ZZTA 2WSCC 3UD3P 4KPCA 4ZJOA 4CQ1A 3J7Z5 2B43A 4PZVA 3ZTSA 4IOAQ 1I1GA 4K0KF 3CNQP 4ES2A 2PSZA 4JV1A 1Y9OA 5FDLA 2FLNA 2AJ4A 4DU8A 1WSRA 3HD2A 2POKA 4RW6A 4DS5A 1Q86T 4NYZA 2OP5A 2VBZA 3FFIB 2B0GA 1MROA 2XZWA 1MG7A 5C2GA 2ZHAA 4JP8A 1SBRA 4TY9A 3V6JA 1FERA 2AJ2A 2XS5A 2R3VA 3DLKA 3GR0A 4K5RA 2QLBB 5HBMA 1MROB 2IM0A 4N41A 1S9EB 2XNQA 2F9JA 2LECA 1YVFA 3TX0A 1VQLS 3FMBA 3HKZD 3AJ1A 2DPJA 4IUFA 2CQ3A 5I42B 3MUMP 2FZCB 1IKXB 4OYAA 4RBUA 4ED1A 3KDNA 5J1PA 2CVEA 2CQ4A 2J76E 1RT1B 4O3SA 2LFVA 1NBEB 2RAQA 3GJQB 3HCXA 3ZTQA 3LAMA 1W7WA 4ES1A 5C5JA 4IR9A 2CQ2A 2HHXA 1BQMA 1JLFB 1MWZA 1RCOB 2HNYA 4OV6A 5T41A 1RXOB 2X1AA 2JLFA 2DRAA 2UXDF 2O01C 2VG7B 1UZHA 5DO2A 4LUBA 2L48A 2FUG9 1TUGB 2HK2A 1KVIA 1RT2A 2R7QA 1UVJA 2CQIA 3MMBB 1VYAA 3DLHA 3HPOA 2KB2A 5KOXA 3HFZB 4XIUA 2A0FB 4FZVA 2ZEJA 1BQNA 1IWAA 4LFAJ 4NYPA 4QIEA 4ZIVA 3BO2A 3DMJB 4NCGB 2G2ZA 1HNXJ 1ZAVA 3FFIA 1WG5A 4ES3A 1BGXT 1XR6A 2EI5A 4DR5J 1JB0C 3LO3A 4M1KA 1I3OB 3R8YA 3V4IA 2JVOA 4O3QA 2RDJA 5IC4B 4KV8A 1FEHA 2ROEA 4ID5B 4I56A 4KY3A 2YX7A 5J2MB 2YNIB 2GQQA 2DH8A 2IHR1 5CZXA 3G6ES 1BHNA 3K5NA 1LOUA 4TYBA 3DOMA 5D0EA 5HQ8A 4DV7J 1PGZA 3JQKA 2FVRA 4GKKF 2G0CA 3FBCA 3RAMA 4BWJA 4DEZA 3AFGA 3LGNA 3DCAA 3Q0AA 2YVSA 1C0TA 5C24B 4J9PA 1J5EJ 1CG2A 1FRHA 2JRSA 2Y0SD 3MEEB 1R0AA 1J5EF 1VQ9S 2GHWA 2XMUA 1RUSA 4NXNF 3CDBA 2E29A 1JLCB 2GAHC 3KXDA 5J2NA 3NGDA 4DN9A 3CO0P 5J1NA 2BR0A 3NCQA 4F04B 3GFHA 5J2PB 2GVZA 1X7VA 3VVTA 2J6TA 1NDLA 3BPSP 3LOUA 5CA5A 5HROA 2QFJA 1HFEL 2CQDA 4OZJA 2R7OA 3ENWA 3N79A 4DU7A 1HMVB 2OPSA 3G82A 1XR7A 3IBWA 4ZP8A 5A6WA 1YBTA 3C8YA 2MJUA 4Q2LA 3RB6A 4DV1J 4Q7AA 2HVEA 4X65F 4WFYA 5F8LA 5B0EA 5DLFA 2BE9B 5KFPA 4GC6A 3J81U 1HMVA 2GO8A 2OPSB 3W61A 4FNIA 2EK6A 2HWIA 3BN4A 3DRXA 4CRJA 3A8JA 4RPFA 4UF4A 2HFSA 3CCLS 3CJRA 2ABYA 5T7LA 1P1LA 4TY8A 3PW0A 2UUBJ 3TA1A 1WSVA 2EC2A 2QV6A 2WONB 9RUBA 3CCES 3RW6A 5KFRA 2FYXA 3HHLC 2DHAA 2XQCA 1DQAA 2GX8A 4RNNA 3T5HA 2EPIA 4P7TA 4DX7A 4F0HA 2QZ8A 1P9YA 4OYIA 4CO0A 2J0QD 4DR7F 5A8RB 2Z8QA 3M2RA 3LTOA 3UQSA 4ZHRA 1R8BA 2FJXA 4X4QA 4OLPA 4Y65A 4J90A 2Z2LA 3FEXB 3G6XA 1TUWA 3EJMA 4QZVB 2RD5C 2H4WB 4HDHA 2IC3A 2RH3A 4B3SJ 1IKWA 4U7CA 4IYQA 2OH2A 1NJYA 3FRYA 2DNQA 3CVKA 4WP9A 1FK9A 2AJ0A 1WOSA 3CIZA 4IH6A 4MH8A 4ATNA 1X5SA 1SC3B 3EVMA 4CM2A 5IWAF 1HBOA 2N4CA 3RR7A 2XB2D 3E01B 2QGFB 2VG6B 4RBVA 4LSLA 1U1OA 4J9VA 1VLOA 5L1KA 3OQ2A 3D4JA 2XULA 2ZNYA 3WBZA 3DMJA 4NCGA 4ECUA 1EB0A 2ZUAA 4LF9J 2KVIA 3QRPA 3W64A 3HVTA 2LU1A 2BANA 5EDWA 3L7PA 3IRXA 3MOZA 4ZVGA 3SSQA 3K8VA 4CIOA 2DHXA 2KHCA 4GVBA 2PO4A 2AYMA 4WP8A 1RT2B 4CH0S 2CPHA 3BYRA 4F02A 1TR0A 3C16B 1S9GA 3MM9A 1EKRA 3LP2B 4WPAA 3ZTRA 4I6AA 2R7XA 3ITHB 1TUVA 4B17A 5HATA 3OL9A 1TZ0A 2HNYB 2AX0A 4DV2J 2I2YA 2BKNA 4FYXB 3LPEA 3IG1B 1FFGB 4JI6J 3OSNA 1TL1A 1IN0A 1TK0A 1CPZA 5IQ6A 2MY8A 2COLA 1CJUB 1FDNA 2A1BA 1NJWA 5J2NB 1FJEB 2DGWA 3CMAS 1DJ0A 3G8TA 1MU2A 1TU0B 3VZIA 1S9FA 5GMDA 2DISA 4DR2J 1UVMA 4QIWD 2HNZB 3QFWA 2DNYA 2DIUA 2DNPA 7FDRA 3OFHA 4ALZA 4OJ3A 1RYSA 1OJ4A 3PW7A 1PYTA 2O67A 3LWLA 2GHVC 2HNDA 1VQ8S 4NRUA 5DQIA 4ERDA 3MAHA 1RHKB 4NWBA 2ZE2A 1VHFA 1QSLA 4JI1J 4YOEA 2NXCA 1ZTTA 2VBYA 1ZA1B 2WRMA 3I0RA 3GJRB 2J6SA 1TVRB 1V3ZA 4DN0A 4PQUA 2YNHB 4QR2A 2KJVA 3KLEB 1TK8A 4USTA 3GR1A 1VJWA 4AXIA 4R8UA 2GHPA 2DR5A 3UN2A 2RVJA 3EUNA 1BD6A 3PJXA 3Q8PB 1QTMA 2A6MA 2PI5A 5L38A 2W01A 2Z2YB 4NE9C 4C8MA 5HVGA 3KLGB 3BBCA 1HPZB 2C42A 3AXKA 3DM2A 4DUYJ 2VA3A 2ZKUA 4OHWA 3UO0A 1G1XA 2CPDA 2RUGA 2MYFA 1ZZNA 3D66A 5EX3A 2XS7A 3CO9A 3ZFVA 3BR8A 2JC1A 2KI2A 2IDEA 3D6TB 4DZ6A 4XDDA 3CPWR 3BQ0A 4JI0F 1TKTA 3A4TA 4OX9J 4C3LA 4NXMF 4C11B 1D8YA 5D0RA 2VF3A 3MEGB 5DG8A 2R7WA 3IXQA 3OBIA 4NLQA 3SQGA 4DV4J 1XERA 4DV4F 2C2RA 1AB8A 2HLUA 2LQ8A 3RYLA 5H1SV 3BBBA 3LW5C 4I6WA 3DRRB 2HLTA 2CVIA 2O1PA 5GAGI 2YKPA 3MMCA 1S4FA 3DYAB 1EX8A 3AHPA 3LGHA 2VPZB 4JI2F 1HWUA 3I0SB 2NPFA 1Q7YT 3NOGA 3NCRA 5FIIA 2HQGA 5D6GA 2XEXA 3H0PA 3KJQB 4U96A 5L9XA 1U1KA 3BZQA 3D1QA 3KHGA 1GFWB 1WORA 2VH7A 2Q79A 4CLZA 1N5TA 3QAEA 3T6BA 2LEAA 4NLOA 5ETVA 1QAIA 1P1TA 2A6OA 4ELVA 2NUUG 4WK3A 2AGPA 3HHLA 4HKQA 1KLMB 1HNWJ 2FJWA 3DXBA 3S1TA 4Y6IA 4IFVB 4J9QA 2BJDA 2M70A 4O23A 5IM0A 4DSIA 3I5BA 3NGUA 1L3VA 5G0RB 4OZ0A 3R1HA 1N33J 3IM9A 4P2SA 1T11A 4GO5X 4IH7A 4RNOA 1TKZB 1YX2A 1T03B 2W2QP 3P5TL 3DRYA 1VQSA 4IFVA 4UUXA 2ACYA 3CMES 2MMYA 1FKOB 3QBCA 3W2VA 4GKKJ 4IG0A 3UE2A 1NMEB 2UUCJ 1AW0A 1QUPA 1RAGB 1KOOA 2XMWA 4ZCIA 1JLGB 4NLVA 3ULHA 3KHHA 2APOA 3ZZYA 1SPBP 1EKSA 2BKPA 4WTOB 2VA2A 3CF5Q 4KE5A 1FNMA 3CDEA 4DR1J 2BA9A 3CCMS 2U2FA 4IR1A 2CDRB 3Q86A 1SH3A 3H98A 4OHZA 1JLGA 2MKHA 4NLXA 3L7UA 4OZ2A 3I9V9 1Q82T 4J9OA 4IQXA 2DGSA 1FEEA 5KFEA 3JSRA 1K44A 3LQVA 2WB4A 3M8SA 1EETA 2Q66A 3D68A 1NB7A 3JSYA 1UCNA 2B6AB 3FSXA 3NCPA 4WP3A 3TO8A 3TAPA 3B6BA 3MDFA 2WCXA 3R2DJ 4DR3J 2BZ2A 3VTIA 4IQMA 3SQGB 1S77D 2C3PA 1S4EA 1ZAWA 3N0VA 3NS5A 4ZMMA 1Y10A 2AMCB 5D4PA 2HPUA 1BXNA 4OYZA 3U1LA 4R8UB 1K73T 3E2EA 2L41A 2HVZA 4L3NA 1X0PA 3PKYA 4JI8J 2B4VA 5CCMA 1TKTB 4F4YA 3I96A 5M2UA 1N36J 1NCLA 1UPPA 4PYAA 4USUA 5FD1A 2R2TA 2HFVA 3QT6A 1NSQA 3R7NB 2ALYB 3I6PA 3M7VA 2RB7A 2YWGA 5DRKA 4M5DA 3EPIA 1T03A 1B3TA 3R7SB 2OJ3A 3I82A 1P6TA 4PG6A 4FS2A 2ZVIA 4LFBJ 2AEMA 3TJAA 1NK0A 2HRTA 1SKSA 5IM0B 2R7SA 4C8ZA 5E7OB 2DPIA 4LF5F 1Q79A 3DDIA 2ZUGA 3K89A 4KH0B 3O3LA 2C22A 1T94A 1JXEA 1PILA 1X31C 2RQKA 1KLMA 1Q8KA 2XYPB 2MJNA 3HSDA 3KKFA 1KQFB 2LP4A 3DLLQ 2D41A 1UPMB 1HBMB 2HGMA 4WE1B 1RDRA 3W65A 4Q44A 2D3UA 4C0BA 3OFEA 2W7AA 1HQEA 3W9JA 2CADA 1JQGA 3Q8YA 2DGUA 1E6YA 1EAYC 2OUGA 4XAKA 4QW8A 4EU0A 3HSGA 1S0NA 3M8RA 1PBAA 3M1VB 3MEGA 4KAIA 3NKYA 1ZBTA 4ZP9A 4A8XA 4ZLLA 4KTQA 3C46A 3M2UB 4LF8F 3ZC4A 4CZCA 1LWEB 5CYMA 4ZPTR 1YJTA 3ZZOA 2RF2B 1UVNA 2BOAA 4LF2A 3U1MA 3G6VA 1KLNA 2HGNA 3RJMB 2V4QA 2W8KA 1F2HA 2MQNA 3PEJA 5SUHA 2OGUA 1NDPA 1YRUA 3HT0A 2OFHX 3MR5A 3UWTA 2HWTA 4FBUA 4WCEQ 1N0VC 3K5OA 3R7BB 2F4VJ 1ZA2B 4ZJLA 4J9NA 3IAM9 1C0UB 3IGNA 3QQCD 3T5LA 3KDOA 4F7VA 4OL8A 2B5JB 2F1FA 4FXVA 3DC2A 1NJXA 3RG6A 2HHVA 3R5CA 3IO1A 2KXNB 1YRTA 4DUZF 2UVUA 1YJVA 5A6PA 3D3BJ 5D3GB 1KHVA 4BBYA 5F3ZA 4ANEA 1WG4A 1QAXA 3D3CJ 3KJFB 3IR7B 2CNOB 2YKMB 4C8KA 1HQ2A 1NXIA 1N56A 2HZAA 1F0XA 4LF4F 2BEFA 4DL2A 2KG0A 2RU3A 2IVFB 5GAEU 3TVYA 1R0CB 2KU7A 4OLOA 3IBCB 4IKAA 4RW9B 5HJXA 4CM0A 2AF6A 1NRKA 1Q16B 1HARA 3KFWX 5KG0A 5A8WB 1D1UA 2HWHA 4MK7A 4I64A 5A2QY 3GG0A 1DLOB 2VG6A 3PJ9A 4DV6F 2IJFA 4RBTA 4LRFA 2PI4A 2BJ7A 3C2PA 2IRUA 1RWXB 1S6UA 2G13A 3JYTA 3SCLE 3D2WA 5LMNJ 4DR3F 4NXMJ 4B3OB 2UV8G 2J8AA 4FYYB 2AHOB 4WIQA 5KFZA 3HDSA 5ETSA 2D7SA 1RWKB 4QWBA 4FKXA 5F8HA 4M8LA 3CCQS 5LMUJ 3SFGA 3G87A 4FPRA 3OFGA 4USMA 4W92B 1AFIA 4NLSA 2EWHA 2C2NA 2CQHA 2IM2A 2HS0A 2RNEA 1RK8A 3MPUB 1KTQA 4JUZA 5C7PA 3GFXA 3MR3A 2WHOA 3IMQJ 4DX8H 4U8YA 2V2VA 4RW7A 1CJTA 1VDHA 4J9SA 4DV2F 1IJFB 1UTAA 2GMHA 4JYAJ 2CZ4A 1RI7A 4PWUA 4DF4A 2YWWA 3D6HB 1ROFA 1XMBA 2XHCA 3ZTOA 3ITHA 3DDKA 1RHRB 4RW7B 1DHMA 4ECWA 4RW4A 5F8MA 1CQNA 1FWLA 2ZOGA 1FWPA 2UUTA 2QG9B 2V8DA 1P8GA 4A47A 3HI9A 2MLYA 2E66A 1JXVA 2AZ3A 2GA7A 4M5MA 5JVGQ 4K4XA 1N34F 4NZ6A 4DSKA 2BW2A 2W9CA 1IR1A 1DY3A 3PRVA 3I56S 4PWDB 2EBGA 2Q6BA 4U9RA 2Y8YA 4DQPA 1WI8A 1Q53A 3PYFA 1CEZA 3MPYA 1SC4B 2GQ2A 3PKMA 1MSWD 4B02A 3CC4S 3JYTB 1YGYA 3E01A 1HWIA 2UUWA 4ZVQB 4DV0F 3M9NB 1IWGA 3HF5A 5D4NA 2P8IA 1FK9B 3LP2A 3P4UB 3VV2B 2FLLA 2EFPA 4RUAA 1KTVA 3FZ2A 1H98A 4K4TA 2FJAB 2L9DA 2HG4A 2MLZA 2F4VF 1H7XA 2LYVA 2IA0A 3JTPA 4EBDA 1JKHB 4ILLA 2DJWA 2QLJB 3CJQA 3O1LA 1UWAA 3PYEA 3HMJG 3CCSS 4DL4A 3QT5A 5HLFB 5AJ3F 3M2VB 3W5ZA 3RAQA 4N56A 2CDQA 3TYTA 4EZ9A 3M6VA 2Y8WA 1DLOA 3R5AA 4S0MA 4Z2XA 2YNFB 5KG1A 3FKBA 4DPUA 2F8HA 2ZHBA 4Y34A 1VOMA 2JNJA 1F1BB 3DN9A 3W66A 1F5BA 5DG7A 1TTHB 1L5UA 4I69A 1KWMA 2ZH6A 2MHNA 4P6QA 4P10A 4D3GA 1SC6A 3FMWA 4LVOP 5U47A 4Q0BA 1KFDA 3PACA 3K5LA 1DTQA 1EIYB 3P45B 2B7CB 2KXHA 3H7HB 3SBMA 3CJ5A 1NK4A 1LFPA 1WACA 3KLIB 1TQLA 2B8PA 5A8RA 4EZ6A 3B8HA 1GT8A 2G1DA 1RAAB 2IJRA 2EBEA 1FKPA 1WC1A 2MZTA 3AQOA 4BHQA 2BE7D 2HK3A 2K3KA 5CYQB 4BWMA 3RBZA 4LFBF 2F9DA 3M2UA 1YWXA 4I7FA 3IS9A 1R7IA 1S49A 2OPRB 2NXJA 1S97A 1KFSA 1D09B 2V0NA 4I6YA 3ENAA 4PG7A 2XSJB 2XI3A 4DSFA 4JV5F 2FLOA 3EZOA 4KKOB 2PA3A 2VFVA 3MAQA 5FDLB 3GU0A 2XY6A 2PN6A 2JEFA 2DNZA 4Z7YA 2VOOA 2E1CA 4X4NA 1X5PA 2NPIA 2IMWP 1J2VA 3L7OA 4UY85 1SH2A 1B7FA 3NNHA 4HI2A 1FFWB 2CWKA 5E3RA 3KHRA 3UNGC 1QSSA 4HVZA 1TKXB 2PFFB 3LP1A 3M8PB 5L1JA 3NNAA 3NS6A 4OX8A 4DPTA 6AT1B 5HO4A 3LANA 1XNRJ 3IM8A 2AW0A 4JI4J 5I4MA 4MFBA 2OKQA 5KFYA 1KOHA 3M8YA 4IDKA 4CLKA 2XLIA 2IDLA 4FYWB 3C15B 2EVZA 1AUSL 1HBUB 3MECA 4HR2A 5E33A 4N7TA 2C1EB 3AD8C 2XYHB 1WOOA 4HACA 3OR2B 3X3UA 4RNFA 1K8AT 3K5PA 3GIMA 1OPIA 4HEA9 3GIKA 1VQPS 2UUAJ 3EM1A 1FDAA 3QZ7A 2RU9A 2H48B 2MZSA 3I5CA 4ZVSB 2ASDA 2HMIA 1HI8A 2EFGA 3H5SA 4DG1B 2V4RA 5AJ3J 1C1CB 1S6PA 4K59A 2FJDB 3VAJA 2CJKA 4KV8B 5KG5A 3LH2S 1IXKA 3P8BB 3QPIA 1WEZA 1ZAXA 4MKBA 3ET6B 1HWKA 3CJTA 4K50A 3OL6A 2MZQA 4UOGA 5KT2A 4ZVEA 5D3GA 3X1LB 1E6VB 2CFXA 3MEDB 2G4BA 3Q83A 2ROPA 3IA0A 4ICLA 4KR0B 2VOPA 1DARA 4XO0A 5AE2A 2RRBA 1VR6A 1NKCA 3TUPA 1RBAA 1FX4A 2YQ3A 2ZDPA 1VRTB 3AOAA 3QT7A 1HNIA 1PC5A 1VQYA 3VF0B 3W8PA 4J9LA 3GCWP 5KFUA 1KN6A 1Y5LB 3R9LA 2ZBQA 2DY9A 3Q8UA 1ZM4A 1UW4A 2RDDA 3ISND 4N47A 4Y00A 3WDOA 5C25B 3J81Y 2DH7A 2VG7A 4B08A 2IA6A 3EDQB 1BWEA 1TKZA 2ILYA 3C14B 4DJBA 2H54B 4OI6A 2F40A 4DR7J 3ZZUA 3RB4A 2YWFA 2GVDB 4G1QB 1P9QC 4CO4A 4PEOA 3K58A 2OTLS 4CO1A 1GEHA 1TFYA 4NI2B 4HLBA 3RB0A 4K0KJ 4TU7A 4NZ7A 5K14A 3VZHA 3M8QA 1EHWA 1F6TA 1U6ZA 1WF0A 4J5OA 4P2XA 1LWFA 3DGPB 5F0UA 2PFDA 1WEYA 3GIRA 3BO3A 2ZOMA 3HHKA 4YY3F 3PZPA 4M63A 3GLJA 3I55S 5E41A 1U26A 2ZWOA 2XMJA 2JHEA 4UOFA 3TVKA 3LAKA 2DGQA 1FTRA 3AQPA 1OQ3A 2OSRA 5CYQA 3OR2A 4IO1A 1O0PA 2HQDA 4I0WA 4ANDA 3JSMB 2QFIA 2Y9HA 1YJUA 2E44A 2G1HA 3M8WA 2ZH8A 4PXBA 4WTYA 1FO1A 2CG8A 3OT9A 4B3TJ 4JI4F 1GX6A 1Y00A 3PW2A 3DYAA 1X4BA 4ZVHA 4DCPB 4DL7A 4OQJA 1OYDA 3TW0A 2KFYA 3JQMA 1K1QA 3R2CJ 4UOHA 3AJ2A 3W7BA 2YNGB 2KKHA 3KUGA 2RRNA 3A8EA 4OZ3A 2CPEA 4UOCA 4ZPAA 1R8PA 3MMAA 4C9DA 3HVRA 4ICLB 3BKTA 3PDNA 4DBQA 2GFFA 4NMLA 1NJIT 5EX0A 4ZLNA 4MMOA 3E3XA 2NCKL 5B0FA 3J80U 3AODA 1D9AA 1NSAA 1VC6A 5B0AA 2W9BA 3BSCA 3GSDA 1EJ7L 2B56A 4M5HA 2KT2A 4M5GA 3FVYA 4X84A 4AXJA 4EWTA 1MWYA 1X60A 2RIJA 5K5MA 4DV3F 1T05A 3C6TA 3EVOA 2ZJQQ 2ZVSA 3PVXA 1B0PA 4RLEA 3PRBA 4B9SA 1SCJB 2CPZA 3CSKA 1FE0A 2CA9A 4TN2A 4DR2F 3AAWB 3BQ1A 3QSYB 4DUTA 3SDEA 1HR0J 3S01A 1JLBB 5KFWA 1A6LA 1WDDA 1HBOB 2C2OB 3S6EA 1SIWB 2FY8A 4J37A 4CNYA 4URGA 2QE5A 1MNEA 5EGYA 2RS8A 5IT4A 4XPCA 2ASLA 4N76A 3TVZA 1N48A 5A0YA 1T3NA 5LMNF 2BABA 3BGOP 3BJYA 2DHSA 5KT4A 2MQQA 3HZEA 1SJ3P 1NZ8A 5E5NA 4FF2A 2CQPA 1Q5VA 2OPQB 2Z58B 5F9LA 1NKBA 1HBUA 3OTOF 1QY7A 1Y5NB 2DCLA 4M5KA 2PD1A 3CJKA 1NDCA 3J80Y 1QE1A 2J9DE 2D74B 2DY1A 2YBVA 4O3OA 5F3TA 3N28A 1FDDA 4AYBD 1AZSB 2YQ0A 3CDUA 2WSFC 5HJYA 2DT9A 2XO7A 2BVZA 3RZAA 1UETA 2IRYA 3QLHB 4FVMA 3UI3A 1RE1B 1B7YB 2R7UA 2RHSB 2ZD1B 2LA6A 2VFUA 2JLGA 2MSSA 1CJVB 2R2RA 2DKOB 4LT6A 2ATCB 1RWPB 1M1HA 2W9CB 4KO0A 4ECQA 5KFTA 3NMAA 4B3SF 4DL3A 5JJBA 3T1HJ 3CD0A 5D0HA 4X62J 3OJSA 3TAMB 3R1LA 4IRKA 1RA6A 2NREA 3PM9A 1TL3B 2I6WA 1JIHA 2BJ8A 3CJSA 3ISNC 2M9KA 3MD3A 3DLEB 3MM6B 2V63A 5L1LA 2XLKA 3DOKB 3DXSX 4R5PB 1YJWS 4B9TA 2R2SA 2AJ1A 3RTVA 3KLHB 5CCLA 5IFMA 1X9MA 2HFUA 3NRBA 1Q78A 4MKVA 2KFZA 3N5FA 1KQSR 2K8GA 2E1AA 4KHRA 4PYDA 3PIOQ 2OTJS 3PYDA 2WVEA 2LKZA 2VU5A 3T1AA 4RW4B 5IS2A 4CT8A 4P72A 2J8SA 4LSNA 2OPPA 3KHLA 3BKUA 5KFIA 3O5TB 3JQJA 2H51B 2L3MA 1NHKL 3DOMB 1U1QA 1NNDA 2J9DA 4L6V3 4PG4A 3KK3A 4ZDNA 4DPWA 1WWHA 3IGVA 4OHYA 4TQRA 2DGXA 4LFAF 1N52B 2OPPB 2Q1LA 2M3DA 1S1XA 4B9UA 1RHUB 2YNHA 2ZH4A 4NRTA 3HHNB 4QU7A 2XO6A 4QIVA 3ISZA 2AYEA 3M30A 4UUWA 4DQIA 4NCAA 4URSA 5D78A 2FTRA 5E3CA 3TX8A 1AROP 5DDQC 4CLFA 4RW9A 4YHHJ 1I6JA 4B9NA 2H65B 4DQSA 3MPDA 3K57A 2OEMA 3L9ZA 2HNDB 1UA0A 1SL1A 1RT5A 4CLUA 2FHJA 2O3DA 3QWUA 1V3RA 4W4MA 1WKKA 2PGCA 3FEZA 1B0VA 2JL9A 2QX0A 4FP9A 1S76D 2GIQA 5CQGA 5DZ7A 1IM6A 2IJNA 4OYXA 1YTYA 1AT1B 4O0NA 2QO3A 5ETPA 1XK8A 3H2UB 4NLGA 3HJFA 3CCUS 3WQPA 2DO0A 2Z4PA 4X2BA 3BH7B 3MGJA 3I5AA 4USKA 7FD1A 1VQ5S 2DRDA 4KYZA 2JC0A 4DX5A 3B78A 4PWDA 2FLPA 1G3OA 4WFXA 2QL7B 3TZWA 3EYZA 5I42A 2B9XA 2DR6A 3TARA 2XBPA 1K0VA 3O6QA 5D15A 3NBPB
chains in the Genus database with same CATH topology
1YRXA 4QQBA 3F41A 1J5OB 2LXUA 5SZTA 3JTNA 3NAHA 4BC7A 1G6BA 1Q8IA 4OFZA 2X51A 2ROGA 3RW7A 1Q4RA 5KFCA 4DLEA 4M95A 4OV1A 4X4TA 1DFDA 2EG2A 3KTQA 3FGVA 3MCSA 4WXWA 3V81A 1O5JA 3DI6A 2MKCA 1D3WA 1HQEB 3VALA 4ED6A 1QJHA 3JB9k 4ETZA 2R8GA 2HZCA 3GG1A 1C0TB 5C24A 4CCHA 1U7LA 4PKDB 1HYSA 4J9MA 3CJ2A 1K1SA 2KJWA 1U6FA 1H2UX 5DDOC 2GGPB 2RILA 2JEIA 2KM8C 4K4UA 4X4OA 4RZRA 1K0TA 4R25A 4ECYA 4DFMA 3MMJA 3PFOA 3KG1A 1GXLA 1BQMB 1JLFA 1DBDA 1FTCA 1RTIA 1U2FA 1T05B 4I1TA 2HHSA 4NYOA 1T02A 3D5MA 1E6VA 4F4WA 3HK2A 3OTBA 1DTTB 2I5JB 1UJ6A 5T14A 2NQPA 2BQRA 4H4OA 3ETOA 2FHJD 2VC0A 1C1CA 4G1IA 4HYKA 1KHWA 2FVCA 4NA1A 3VAIA 4D3HA 1P27B 2YKQA 3PO5A 2MKJA 3MR6A 4PG8A 2HHQA 3AB4B 1E6YB 5B08A 2YX4A 3LGMA 1HI1A 3MECB 3B82A 3HVWA 5L1IA 1HBMA 1MW7A 4WE1A 4ZCKA 2QLWA 5HMZA 3DGPA 4DDFA 2QA4S 3RBEA 2K1RB 2AGPA 3G6YA 5DM6Q 3M9MB 4DR1F 4ED5A 2J7UA 5EUHA 1KQKA 4G6VB 2B3TB 3KNGA 4MJKA 2DCUB 3M8PA 3CJ0A 3MUVP 3HXMA 1FA0A 2XC9A 5J2QA 2AQ4A 2NSBA 3DLGA 3SMZA 2MZJA 2C2EA 2J0WA 3H4DA 2JFKA 1RQ0A 2EFNA 2OD6A 1R3NA 2P6TA 5GVQA 1CSJA 5IQQA 2MPUA 3BR9A 4NLYA 3UPFA 2R7UA 5F8JA 4DMZA 2DR8A 4DSJA 3V81B 3BGFA 1UVIA 5DGAA 4WU2A 2R2UA 3OR1B 2V8VA 2W4DA 4I2PA 5D4LA 1VQ4S 3CJ3A 1KQGB 3C6TB 2DD8S 3CT9A 1B64A 2LQ9A 3M32B 4Y2IA 2GMJA 1Q8BA 3T5KA 4JI6F 4YDDB 1HPZA 3DU5A 2FVSA 2E5JA 3PR5B 3GZ7A 1S1TA 4YFUA 2DH9A 5H9EJ 3OL8A 2MQLA 5KG7A 3OUYB 4E0DA 3GILA 4I2QA 3UDLA 3Q8RB 4ECVA 1HQUB 3BDEA 2NSCA 1UL3A 3G8SA 1S72S 1TVRA 1U1PA 3GV7B 4MIBA 4WK1A 4CT9A 1KSPA 5GAGU 3M9OB 3H5XA 2LMIA 1NZAA 4X4UA 2ZE2B 4GMKA 2KYXA 4LF9F 5KFSA 1D0EA 2EK1A 1NH7A 2PDAA 2MKSA 2IBOA 4ZPWR 3SEOA 2ASJA 1GTHA 1DZ5A 1LK5A 1SQEA 2CQBA 2VFRA 3NBPA 1WHXA 1M0SA 2PT0A 2IAJB 3M6UA 4IOCQ 2VKZG 4YR2A 3OXLA 2U1AA 1O8BA 3V5RA 5GAHU 1IJEB 1WELA 2FDNA 1VQOS 3P96A 1U48A 1JLAA 1R27B 1U24A 3JAMY 4AE5A 2DR7A 3CCWA 3W2WB 1HW8A 1Z2LA 3MPWA 4ZPCA 4QW9A 4IQXA 1T3OA 3NG8A 1QM9A 5K9FA 2R8KA 2M4MA 1RAJA 2F7VA 2RDIA 5DGBA 2WB1D 3HHLB 4FF1A 1GNKA 3VQTA 2LXIA 1VRTA 1S48A 2J0SD 3UW1A 2HAIA 4C11A 4DR5F 4OIXA 3R27A 3CB4A 3DRPA 2MKKA 5MLCV 1VIXA 4AL7A 4ECSA 2VV5A 4TNOA 2E1CA 2ZKTA 1JLEA 1JK9B 1GQEA 1XTZA 2D3ZA 1WHYA 2Z2MA 1C4AA 4YQWA 3SFUA 4WF9Q 4Q0BB 2AYBA 1CC8A 4A8FA 2EKYA 3CD7A 2YWHA 4NA3A 5HLFA 4KPYA 2ERRA 4WFZA 3T1YF 5LSRA 4X4SA 5CZVA 1IBMF 3H4BA 3GFZA 2ZH9A 3QMQA 4JYAF 2EG1A 1RTHA 2YNFA 3N9UC 2X3GA 3M30B 1N32F 2MY7A 3CJKB 2UU9F 3BGLA 1NK7A 2QRRA 1YI2S 2K2PA 5DQGA 2E1RA 4QR1A 3JTOA 1S1UB 3R3TA 4H4MA 1RT5B 3ZZ0A 1FDBA 1U2RA 1HNWF 2QIFA 3QIPB 3LP1B 3MFHA 2DBBA 2CPXA 2V4JA 2JJ4D 3SI8A 1N5YB 4TU8A 3O44A 2B4UA 5KG3A 3N6LA 1C1BA 2N82B 5DS7A 4LJMA 1JMTA 1U6BA 4CTAA 3FQLA 1TP7A 2HGLA 4WFAQ 4BCAA 2OO4A 3OLBA 3DRPB 5LSOA 1HHTP 4PG5A 4ED3A 3DLBA 4CH7A 1FCAA 2ZD1A 3KK3B 4DR4F 2ZBIA 4I7FB 2XG8A 3DLEA 2LXFA 4PUOA 1TL3A 4LSNB 4U7UK 4C4WA 2W7OA 2CRLA 1R8CA 3BEGB 1JJHA 5ITHA 2M0GB 5C42A 3DOLA 2DGVA 2VFSA 5KOWA 4X62F 3QGHA 4PUOB 4RW8A 5GADU 2AWZA 2IRXA 1NK6A 2MQOA 4KO0B 3N01A 4KBIA 2MGZB 3J7ZT 4WKRA 4TY8B 5K8NA 2Q43A 4MIWA 3CXCR 1TL4A 2DNKA 2MDAA 2BM0A 3CDWA 3G86A 3OVSA 5J2PA 1FVSA 4KC5A 2CQ1A 4KRWA 5B0GA 4WZQA 3KWMA 2MXYA 4V19X 2ATLA 1FVQA 2IAJA 5L39A 5K8PA 3LP0A 3TOQA 1MMLA 2V4JB 3BS9A 1S99A 3G9CA 1X5OA 4MTPA 2XLJA 1R0AB 1IKWB 3F73A 1WD6A 2VPYB 2CPIA 4HH0A 1FKAF 2GJIA 2WSEC 4OJ1A 1YBAA 3Q2SC 3UCUP 3HVTB 4UW2A 4HHJA 2VQFF 2QA1A 2CQ0A 3MMBA 1YQHA 4QWAA 1RTDA 1GAOA 4LSLB 1QLNA 3K0JA 3M8QB 2E5IA 4URQU 3UD4P 1OSCA 1C1BB 1YJRA 1T95A 4O3NA 2FVQA 4O3RA 1IQZA 5E2QA 1JLQA 4HDGA 4KT0C 4RKUC 2UP1A 4OX7A 2YNGA 3BGUA 2FGCA 2AGQA 4ID5A 2QMXA 3S8SA 4RW8B 5D77A 1ULRA 4K4YA 2E7XA 1WTBA 3HKWA 3V6DB 1JLEB 2ADCA 4CO2A 1TKDA 4U6PA 4DF8A 1D9FA 2PEHA 1ZM9A 2R4FA 2VZ9A 1Y3JA 1VQKS 1TV6A 4K4VA 1FRMA 2HHWA 4O3PA 1M5PC 3PO4A 4DWIA 3FDSA 2WOMB 1RT3A 1NEEA 1UEUA 1W2BR 4NZ0A 5KFGA 2ZITA 4LQ3A 2BM1A 2ZZNA 5KFNA 2FC8A 3U7JA 3OHAA 2ALZA 2YX1A 1VBZA 3AH6A 4HH1A 1X4CA 3DHWC 5DDRC 4EYHB 2WAQD 1HR0F 4F8RA 2KRBA 3NP5A 4O4GA 3EXYA 3IAS9 1XNRF 1U8SA 2QYCA 3TANA 2XWXA 3D0HE 4YB1P 5KTQA 1OIAA 4RWWA 2KN4A 4U67Q 1ZPWX 1HA1A 1RTHB 5K14B 5THWA 3MM7B 4ITSA 5KFAA 2FJBB 1KC8T 3GQCA 4A8MP 2HVIA 1HWJA 2NZ4A 2KDOA 2W4CA 2UV8A 3MEDA 2VQEF 3Q24A 3PY8A 1N6QB 5J1EB 2B6AA 4KSEB 3AB2B 4YMEA 2P5VA 2ASYA 2I5JA 2DVIA 1RT3B 3PFEA 3HM9A 3HX9A 2L9NA 1DQ8A 3EPGA 2HHPA 1BY9A 2BJEA 5HN0A 5FLXY 3CC2S 4H4KC 1RTJB 4EYIB 1V6HA 3D54A 4USIA 3EXCX 4KHMA 5KFBA 2QMWA 1FF2A 3CCZA 2M5YA 3KK1A 3FSIA 3GIIA 2D3OR 3O2IA 2R8IA 4A8SA 1YJ9S 2BDPA 2DHGA 4W90B 5B7WA 1NKEA 3QIDA 1BQXA 4I4BA 4TXSA 1D9DA 2OMOA 4OZLA 1HQUA 1XR5A 3MZIA 5E3QA 3DLGB 3ZZZA 2WW8A 3OR1A 1TKXA 4K4SA 1VMBA 2K7JA 2UUCF 3WC2A 3GMGA 3NWGA 1VQ7S 2OD4A 1R8AA 5DM7Q 2UVRA 2FJEB 4G1PA 5A8KA 2KYZA 3W2VB 3OTEA 4NLWA 3VAGA 2GO9A 2GIRA 1U25A 4ETXA 1N6QA 4X4PA 1LKZA 4ZVFA 3A1YG 3G71S 4RUCA 2KZMA 1CLFA 3BSOA 2Y1RI 3DLKB 1C2PA