2YTCA

Solution structure of rna binding domain in pre-mrna-splicing factor rbm22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-splicing factor RBM22
publication title Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ytcA01
1WG1A 1X4HA 2AYMA 4A8XA 3CUNA 2RT3A 5CXTA 4RU2A 3CCVS 1X5SA 3G96A 2VOOA 3P6YC 2CQCA 2CQDA 5EN1A 5D78A 1X5OA 1N52B 1M1KT 1U6FA 1U1LA 5DDRC 2DNYA 1K9MT 3G6ES 3JB9k 2U1AA 2MKJA 5DDPC 2M2BA 3CCLS 4CIOA 3MUMP 3MD3A 2DGSA 1P1TA 1OWXA 3FEXB 2MJNA 2L41A 5CA5A 4WFAQ 3MDFA 2K3KA 1VQ4S 1JJ2R 2LXIA 2EK1A 1H6KX 1X4EA 2A3JA 1Q86T 2M8DB 3SXLA 4OZ1A 3DXBA 4ED5A 3U1MA 2OSQA 1WEZA 3VF0B 3EGZA 1N54B 1WG5A 2MKIA 2J0SD 4Y0FA 3MURP 2DNNA 2LEBA 2OTJS 3D2WA 3BS9A 5MLCV 2MKHA 5JVGQ 2G4BA 2KXFA 1FJCA 1U1KA 2CQIA 4IOAQ 2MZSA 2O3DA 2CPXA 1N88A 3TYTA 3R1HA 1UFWA 3HHNB 2DH8A 2M4MA 3PIOQ 2DGQA 2FC8A 3IWNC 3LQVA 2RU3A 3THTA 3NNHA 2DNHA 3R1LA 3LPYA 1VQ9S 2M8HA 2MQMA 5JVHQ 1Q7YT 1UP1A 2DHGA 2BZ2A 2QEXS 3Q2TC 2DNZA 2DNOA 2MB0B 5GADU 2DO0A 5LJ3Y 4C7QA 1M5OC 5IM0A 2XNRA 5HL7Q 3N9UC 4PR6A 3RW7A 3V4MA 1K73T 4WFBQ 2GHPA 1IQTA 2J8AA 2FPHX 1U1QA 2BOPA 1R8PA 3Q2SC 2DHXA 2JX2A 2MY7A 3NS5A 4W92B 3FEYB 2ERRA 2CPJA 2DISA 4TLQA 3CXCR 3CC2S 3CCMS 1SJ3P 2RS2A 2HYIB 3B4DA 3CCES 4IUFA 2E5IA 1PO6A 1RKJA 1DBDA 2RUGA 2KFYA 2RNEA 2MY8A 3SMZA 2N7CA 2DNLA 3VAMA 3VAJA 1H2VZ 1WI6A 3J7YU 1VBYA 4PRFA 2X1BA 2FC9A 3S7RA 1U6BA 2G0CA 4IO9Q 3UCZP 2DHAA 2F9DA 3I55S 4UQTA 2CPHA 1WWHA 2KXNB 3CCSS 2DH7A 1B7FA 3BO2A 2QA4S 1VQOS 5LXYA 2DK2A 2DGXA 2AYEA 1M5KC 2CQGA 1NO8A 3ULHA 1N8RT 3S6EA 1KOOA 2PEHA 1PGZA 2YKAA 1WTBA 2DGTA 2D9PA 1A7GE 2MPUA 5IM0B 2NZ4A 2CQPA 2M88A 3P5TL 3NMRA 1X4DA 2DB1A 3HI9A 2DIUA 2LEAA 3K0JA 1FO1A 3CF5Q 1WI8A 5LSLA 1D9AA 2ZJQQ 3NNAA 2G1DA 2CPFA 3H2VE 2J76E 3MXHP 2MSTA 1YJ9S 3UCGA 3J7ZT 3BO3A 2DNKA 1M5PC 1SJQA 3CMES 5H1SV 3CCJS 1SJFA 4FXVA 2MXYA 1D8ZA 5LJ5Y 3G8SA 2E5GA 4M5DB 3OW2R 1VQ6S 1U1RA 4C4WA 4IOCQ 1M5VC 2KRBA 2YH0A 2KN4A 5DDQC 1WELA 5DETA 2KI2A 2LA6A 2V94A 1UAWA 2DNGA 4F26A 2DGVA 4F02A 2NLWA 2XS7A 2KVIA 2MHNA 2KM8C 2F3JA 2HVZA 4W90B 3UD3P 1KD1T 4ERDA 2QFJA 1M90T 2MZRA 2DO4A 2LA4A 2HGLA 2MQLA 4WIIA 2E44A 2M0GB 5GAEU 2X1GA 1VC0A 4F25A 3PIPQ 1U1PA 2FY1A 3UE2A 2WBRA 1L3KA 2DITA 4CQ1A 2MQPA 3VAKA 1U1OA 1X4AA 1HD1A 2VODA 1U1NA 1SJ4P 2FHOB 2LECA 1A9NB 2MKSA 1VBXA 2ADBA 1VC6A 2MQNA 2DH9A 2CQBA 2JRSA 3CULA 3CPWR 2LYVA 2KG0A 1YJWS 2E5HA 3VAFA 2HGNA 1VQLS 5BJRA 2CPYA 1HL6A 1FT8A 2U2FA 3CCQS 5HO4A 3SDEA 1R8HA 2DNMA 3CMAS 1VQ8S 5DM6Q 3CCUS 2DGUA 2M7SA 2CQ2A 1SJRA 2M70A 1VBZA 1NJIT 4WKRA 4YOEA 2DNRA 4EGLA 3S8SA 2ADCA 1YHQS 5DDOC 3CTRA 1YWXA 1U1MA 1VC5A 2CQ3A 4PKDB 2VOPA 4C0OC 3UD4P 3P3DA 2YWKA 2HZCA 3THPA 2RS8A 3G4SS 2CPDA 1NU4A 1WHXA 4QU6A 4Y00A 5ITHA 4BS2A 1WEYA 1X4BA 3VAGA 3TO8A 1WF1A 3B4MA 1WHYA 1VQMS 1P27B 1OPIA 2XSFA 3CCRS 3L3CA 3H2UB 1S72S 1KQSR 1S79A 1RK8A 4P6QA 3NS6A 3IRWP 3CD6S 2LMIA 1OO0B 2MSSA 5CYJA 2MGZB 1YI2S 4OZ0A 2MZJA 2RQCA 3MUTP 3EX7B 3CC4S 1FJ7A 1WHWA 2KM8B 3I56S 2CQ4A 3VAIA 1WEXA 2MQOA 1YIJS 2MZ1A 1X5TA 1VQKS 1YJNS 1FXLA 2M9KA 4TU8A 1JMTA 2MYFA 2PE8A 2AYGA 2KXHA 3SDEB 2OIHA 2JVOA 1FJEB 2D3OR 1K8AT 2J0QD 5GMKa 3VAHA 2D9OA 3EGNA 4TU9A 2RVJA 5GAGU 2B0GA 5GVQA 1FHTA 2MMYA 4QQBA 1VQ5S 2RRBA 2Q79A 1HA1A 1CVJA 3MI7X 4LIRA 4CH1A 2OJ3A 3G8TA 2E5JA 1WHVA 1FNXH 1VQPS 2XS5A 2GO9A 2XB2D 2EK6A 2K8GA 1U2FA 4ZKAA 5D77A 2AD9A 4V19X 1H2UX 1KC8T 3UCUP 1Q82T 3S01A 2DNPA 1JJHA 3MD1A 2RRAA 2I2YA 1URNA 2MZTA 3MOJB 2CJKA 2KU7A 1VQ7S 1DZ5A 1DRZA 2ZJRQ 4WCEQ 1DHMA 2LKZA 2JWNA 2KG1A 2KRRA 2XS2A 2L9WA 3UWTA 2EVZA 1HD0A 3MUVP 1X4GA 3BEGB 3R27A 3DLLQ 2CPIA 2MGZA 3G71S 3NNCA 1VQNS 3U1LA 1WG4A 2MZQA 2OSRA 2LXUA 2CPZA 1G2EA 2M52A 1H2TZ 4QPTA 3CC7S 1X4CA 2CQ1A 1X4FA 2KHCA 1F9FA 2DGWA 4QU7A 4CH0S 1X0FA 1ZZNA 3BO4A 2CQHA 2N3OA 2AYBA 2YH1A 1QVGR 2CQ0A 2DGOA 5FJ4A 2RQ4A 4Z2XA 1OIAA 2X1AA 5IFMA 1AUDA 1QVFR 1XN9A 2CPEA 2KH9A 1YITS 4YB1P 4FXWA 2MJUA 2KYXA 2KT5A 4YUDA 2L08A 2JVRA 3RW6A 1SXLA 2ZJPQ 2DIVA 2OTLS 4LMZA 1QM9A 1WF2A 3ZZZA 1YTYA 4LJMA 3VALA 2N82B 5GAHU 1W2BR 2XNQA 4U67Q 2DHSA 2MQQA 4WFNQ 1BY9A 3TP2A 4J5OA 1ZH5A 5IQQA 2F9JA 3G9CA 3P49B 1Q81T 2HGMA 2MKKA 2MKCA 2YTCA 1KOHA 3US5A 2VONA 4WF9Q 1UW4A 4TU7A 2LCWA 1O0PA 5LSOA 3ZZYA 2SXLA 1WF0A 2LQ5A 4UY8T 2N3LA 1JJ4A 1ZZFA 5LXRA 2DNQA 1X5PA 5DM7Q 2I38A 2UP1A 2X1FA
chains in the Genus database with same CATH superfamily
2AYMA 2O66A 5J2PB 5DG7A 2CQDA 2V5HG 5G4DA 1K9MT 4N77A 1UJ5A 1N0VC 4ZJOA 3P96A 4EYHB 1X7VA 2UZAA 3F44A 3ZZPA 1JJ2R 3IBFB 2B9EA 4YFUA 3PXGa 2NXUA 3M8YA 3ENAA 5DG8A 1JLGA 1HWLA 2MLXA 3HF5A 3BS9A 3OTEA 2B5JB 5AJ3F 2KXFA 5C24B 2CQIA 2L9NA 2MZSA 2W7AA 2KJVA 4J9QA 3DOKA 1VQ9S 1HQUA 3IO1A 1Q7YT 2DHGA 4DV1F 4HYKA 5FLXU 1L5UA 3Q2TC 4ZP6A 3KLHB 4OL8A 4P2FA 5ETVA 4X2BA 4ED0A 2CVEA 3EGVA 3UD5A 3HVAA 4JI8J 1R0CB 3V81B 1DARA 3NS5A 3TAQA 1F9HA 4DS4A 3CXCR 5CYQB 1Q8KA 2P2CB 1O51A 4DQRA 5J2MA 5LMUF 3GYGA 3NKYA 3DU5A 4DV5J 3POTB 5GMEA 3S7RA 3DLGA 3MCOA 3PG9A 4DSKA 1WOOA 1HNVA 2QT7A 3KG0A 2PMHA 2DH7A 4R5PB 2NZCA 3MAHA 1M5KC 1TKDA 1J5OA 4TXSA 2D3ZA 3FSIA 4X4NA 2VASA 4O3RA 2YWWA 4OJ3A 1RAFB 2DIUA 2B6AB 1D9AA 1GXTA 2G1DA 3QMQA 4DV2J 5K8OA 2IHR1 3FBFA 4JI2J 4URSA 4E98A 1GMVA 2O01C 2XI2A 5I42B 4LF8F 4DBQA 3OHAA 4R8UB 2AX1A 3B78A 4QYRA 4BC9A 1JLCB 3HHDA 4CLTA 1PCAA 2ZH9A 3W60A 3Q22A 1HHSA 2E44A 4BC7A 1RACB 4LSNB 4HTIA 2ATCB 3LA0A 2VODA 4ED8A 3QGPA 2E7XA 4R0JA 1ZTWA 3W8GA 5D0HA 1S7IA 4HEA9 1IBKJ 3PO5A 1SI9A 2NQPA 2UXDF 1H7WA 4FYYB 3SDEA 4X4TA 2YPYA 2CWXA 2M7SA 3NGDA 4NYZA 3L09A 4PKDB 5HJXA 3DRRB 2P9GA 3Q8YA 1NU4A 1G6BA 4IH7A 3B4MA 3CGIA 3BSNA 1VS3A 2JHEA 3M6WA 4KR0B 1NUEA 1GQEA 5HK4A 1RLDA 1FNOA 1BC6A 3LO3A 1X0PA 3M8PB 2QIFA 2GIFA 3SCIE 4G1QA 3SFGA 3D28A 1WACA 3MM9B 4N8OA 3KTQA 3L4BC 3TAPA 4JYAJ 4FDFA 3AD7C 4Y2IA 2EPIA 4DQQA 1QUPA 1Q8LA 3E01A 3Q0AA 3IS9B 3AOBA 4CDIA 5EX0A 3D6HB 2R4FA 4Q8EA 1TTHB 2KU7A 1QTMA 2DKOB 3PACA 3QATA 2ZH3A 1FNMA 2YVSA 4KBIA 4OYIA 3M6UA 1CJVA 4ECQA 1GK8A 3T41A 4DPOA 1KLMA 4HVZA 1G2EA 2DGWA 2CJXB 5J2PA 2R8KA 1ZZNA 5JUMA 1Y9OA 2CQHA 2FJVA 1U0SA 1SVDA 4ELVA 1FFSB 2OP5A 3N6LA 2H3EB 1OIAA 1S1XB 4P74A 3OLBA 1JLFA 2D74B 3KYLA 2ZH5A 2JJ4D 1J27A 4MH8A 4WFNQ 1UA1A 4FBUA 4J9UE 1KRPA 1ICEB 5IQQA 1Q81T 3F41A 4JBCA 2B5JA 5C24A 5HVGA 1KQFB 3IGNA 1RT2B 3MMBB 1W25A 1JQGA 3FQKA 3PW2A 4X4VA 2DNQA 1VC6A 2LVWA 2UP1A 1WG1A 3RYLA 4N76A 3FVYA 1R6VA 4QCLA 2L48A 1OWXA 3V81A 4HDGA 1Z2ZA 1FESA 5CYQA 1FRIA 3M9NB 3RBXA 3U27A 2QMXA 4LF9F 1S1VB 3POTA 3D3BJ 4Y0FA 2G2ZA 1HKAA 2LEBA 4LF4F 5JVGQ 3AJ1A 3TA2A 3GCWP 2VC0A 4GKJJ 2JC1A 4DV4F 4R5PA 2CWKA 1V5VA 3NNHA 1HNZJ 2R2TA 3LPYA 3R1LA 2FDNA 3GIIA 2JC0A 1AFIA 3HFKA 4RUAA 2HS4A 4XK8C 4RO0A 3C15B 5B09A 1I1GA 2HQDA 5F0WA 2EC0A 1TZ0A 3H4DA 4CO2A 4B3MJ 4XPEA 3HK2A 4PWDB 4KGMA 4NMXA 1HNWF 4KGZB 1F2HA 5IXUA 3BSAA 2AIRB 5I42A 1DBDA 1U09A 1M1HA 3I5BA 4R8UA 1IBMJ 3PRVA 2X1BA 4UW2A 1SJ1A 3M30B 1JLCA 1SC6A 4F0MA 4ILLA 3ILOA 4IH6A 4OJGA 1QTNB 3BGFA 3UDLA 5KFBA 3S6EA 4LSNA 2D9PA 3K8WA 3DOLA 2MPUA 2M88A 3P5TL 2ZBCA 3RB0A 5BXIA 2V8VA 3QJPA 2AZ1A 2H48B 4B17A 1AB8A 3EWGA 2F8EX 2KVQE 2R7TA 1TK8A 2AV5A 2WVDA 1RT3B 1OYEA 4C4WA 1RTDB 1XMQF 5IT9Y 2AJ4A 2KZZA 4F4ZA 5DETA 2HBRB 4P2MA 4UQGA 1J5EJ 1NDCA 1QJHA 3TUZC 2FLNA 3DRRA 1FF2A 4P9SA 2CZ4A 3EZUA 2B43A 2WW4A 2M0GB 3MM7A 5F9LA 5DS7A 4QPXA 4U9RA 4DR1J 3DFEA 3BB5A 4H4OB 3VV2B 2JRSA 4DUYF 2LYVA 3M8PA 2E5HA 4KGKA 3J7AN 4F67A 1TUWA 5E3CA 3CJRA 3MM9A 4IQXA 3AXMA 1R0AB 1RBAA 5KFEA 1Q4RA 5E7OB 1SQFA 1JXEA 4DR2J 3ET6B 1VC5A 3D6MB 3A8KA 4MT1A 4U96A 3IS9A 4UOFA 1GH8A 2YWHA 3LGHA 4DFMA 3LALA 4PG7A 1KQGB 1S72S 1UWBB 2EBGA 2EFOA 4XDDA 1YI2S 4OZ0A 2UVWA 3N6MA 1YK9A 3T1AA 3W5ZA 4NLRA 4TLRA 4LFCJ 1RT1B 5HROB 1LWCA 2E9TA 4QQBA 2WOMB 4XAKA 1XTZA 2GW8A 2E5JA 1WHVA 3CVKA 3R5JB 3HPOA 2XB2D 5IS2A 1H2UX 4IH5A 2WCXA 4KSEB 3OXLA 2CVIA 2CJKA 4F4AA 2JL9A 2XY7A 1J2VA 2ZJRQ 3PR5B 1PC4A 2JWNA 2HZVA 4XTTA 1QDUB 2E7VA 4PCQA 4LF6J 3L7UA 1RT2A 3DLLQ 3OJUA 2C3YA 3FSYA 2EKNA 3KNAA 1C0TB 3SCKE 4Q5VA 1H2TZ 4MTPA 3K17A 3F73A 4FKYA 2VQFJ 2IRXA 5E5NA 1YZ6A 2ZZMA 5A6WA 1CSJA 1RADB 1UETA 1KN6A 2VG6B 4GKKJ 4QYZJ 1YITS 2JLEA 2D69A 4YUDA 2R7WA 2E1PA 5CZVA 2VBWA 4K59A 1R89A 1S1VA 1YRTA 4J5OA 2BV3A 2F9JA 3HT0A 2VONA 4PZVA 4JI1F 2XTJP 1X9WA 5H9EK 3EUNA 1ZZFA 4YEAA 3WX4A 4Q43A 2VJUA 3C15A 3C6UA 3UNGC 4IOBA 4DFJA 1IBLJ 4LUBA 1FRMA 1Y5IB 4ETXA 3SEOA 4PWDA 4WFAQ 2L3MA 1T9VA 2UVVA 2WVBA 2R7OA 2LXIA 4MYUA 3C3LA 3NL0A 5A8KA 3ONQA 4XO0A 4ZJQA 3CJ2A 1NXIA 4Y34A 3D2WA 3TZWA 3M30A 2FHKA 4DUZF 1U1KA 3GCXP 3PW4A 4LQ3A 2ZUGA 4LF5J 2DGQA 2V9KA 3BPSP 3W61A 1V3SA 3THTA 5IV4A 3GQCA 4J9LA 4ZVTB 2IA6A 3MOZA 4UY85 1HWIA 1S49A 4ID5A 2BABA 4C7QA 4BWMA 3J80U 1RP5A 2DVIA 4QIEA 1YJUA 2BMBA 4M5JA 1MWQA 1BQXA 3LTOA 1UVMA 2BJ7A 1KVJA 2XZDB 3HULA 1S0OA 1LWXA 1FDNA 1RT3A 1ZPWX 1RTDA 1DAXA 2HFUA 3M32A 2R8IA 4JI5J 4PRFA 1CC8A 4JI4F 1S97A 2W8LA 2KXNB 4RW8A 3EZOA 2B7CB 4ZPCA 2DGXA 4P73A 2HPUA 3IXQA 8RUCA 1U4BA 4X84A 4TN2A 4B9SA 4DR3F 1HHTP 3PJ9A 2IFXA 3WIVA 1LFPA 1FWPA 3Q8QB 2ZEJA 1URRA 3K0JA 1FO1A 4J9KA 4H4OA 3T5KA 2W2OP 3ILJA 1D09B 3HFZB 4DV2F 4FZVA 4ZN1A 2HHHF 1RTIB 5EHHA 1RHRB 3CCJS 1SJFA 3FNNA 3OVSA 3KUEA 3DDNA 4KH1B 4UUXA 4IOCQ 1R0AA 1K1QA 5KG3A 1VISA 1R7IA 3KHGA 3H5YA 2XMKA 1KP6A 5CABA 3OSNA 1YBTA 3ET6A 2V50A 4UUWA 3MR5A 2CZ9A 2QFJA 2FJXA 4K0KJ 1RBLA 4PWUA 3HHLB 2DCLA 2WVCA 1S48A 3NCPA 4ZLPA 2DD8S 3CJ5A 4AXJA 1UWBA 4P7VA 2Y3YA 3W9IA 3W2WB 3IR6B 3K59A 3DMJA 2GQ2A 4USHA 1ITPA 1SJ4P 3MEEB 3PW7A 3IC1A 4DX7A 2VICA 2I8EA 3KLEB 3JS9A 1UEKA 1KTQA 3MEGB 5FDLB 4IDKA 2OGUA 1WKLA 1VQ8S 1RT1A 5HROA 3ZC4A 1HR0J 1FJGF 3QRPA 2WOMA 1QLNA 2DNRA 3PW0A 3M2RB 3FDSA 2ZITA 2YWKA 3QT5A 3AY0A 4X4UA 3DN9A 2I6WA 3HO1A 4HI2A 1RA6A 1WHYA 1VQMS 1P27B 3QO9B 1LK7A 4NL5A 2ASJA 3RRHA 4F2RA 2R7VA 1FX4A 1IM6A 2HFSA 1S59A 1T9XA 1C0TA 1WHWA 5AXMA 5AT1B 1KEKA 2NUHA 1VRUB 4MIBA 4DU8A 4F36A 2ILZA 2KHDA 2W9AA 2QYGA 4EZ6A 2VG6A 3MI7X 2QTWA 4C98A 4KE5A 3MCNA 3MOJB 4ZMMA 3D3CJ 2LLZA 3PJWA 3H5XA 2ACMA 2YX4A 4C8OA 2OPRB 3ELHA 4BCAA 3VGUA 2RAQA 3ENWA 2V8GA 2OMOA 5DZ6A 2UXCF 2Z2ZA 1FRLA 1RGVA 3MFIA 3G6XA 2Y1RI 2FJEB 3F56A 1YSJA 2ZWPA 2V2QA 1QSSA 1X8DA 2RQ4A 1UJ4A 1ZAWA 4CT9A 3KK2B 3R2CJ 2M5YA 2KT5A 3R5AA 5SZTA 5HVFA 2ZJPQ 2V2KA 4NPOA 4WP8A 3HKZD 3ZZZA 3SFUA 3VALA 3CT9A 1ZH5A 5AE2A 5LMNJ 2P9EA 4YHHJ 3M2VB 4WF9Q 4CLUA 1FFGB 4TU7A 5LSOA 1HYSB 1RDRA 2VFSA 3W66A 3ISZA 1FFWB 5CCLA 2FIUA 3GV8B 1XNQJ 1R8AA 5ETKA 4B9TA 1LK5A 3KMSA 3G82A 3PEHA 5D78A 4PQAA 3UDVA 1N52B 3HSDA 4LT6A 4M8LA 4K4YA 4WU3A 2HRUA 3CCLS 1N33F 5C7PA 3U02A 4CLYA 3W5YA 1KKHA 1PC5A 3VVUA 5C5JA 3BH6B 5T41A 4F0HA 1Q86T 4ETZA 3T3FA 1NZ8A 3HJFA 3CCZA 2OTJS 2J7KA 5MLCV 2QL7B 2HVIA 4DV7F 3HHNB 1HW8A 2XYPB 1FRHA 3L95X 3Q8VA 3PHEA 3M1VB 4WK3A 3GU0A 4OX9F 3AXKA 4JV2A 4U95A 1Q53A 3W9JA 2MB0B 2HW3A 1FTCA 2Y0BB 2X7IA 1NB2A 3EDRB 4FNIA 2BOPA 3AB2B 3OXGA 2IBKA 1RTIA 3KLIB 3EGWB 3B4DA 4AQYJ 3Q8SB 2KFYA 1GX5A 3NGRA 4FVCA 5J1NA 3EJMA 3D54A 4OMFG 2CPHA 3PYFA 3BH7B 4I6WA 3BO2A 4TY9A 2AEMA 3FKBA 3WX8A 3MCMA 4A8QA 1SKSA 1NK9A 2OEMA 2K7KA 2DGTA 3W2WA 3T9ZA 2PFFB 3MEEA 2BJ3A 4GVLA 4USVA 2V4QA 3NXZA 4MK7A 2J76E 2R8GA 5K8NA 3KLEA 5B0GA 3MEGA 2GVZB 3GFZA 5FDLA 3J7YI 1NEEA 1Y0HA 4W4MA 4M5HA 1RTHA 2BRLA 1RI7A 4HHJA 2ASLA 3UN3A 3RB6A 2DNGA 4NA3A 3AOAA 1NRKA 2KTQA 1N5YA 2F3JA 3PYDA 4P72A 3OL7A 4PXCA 4C3KA 1WUUA 2MQLA 5GAEU 3KOAA 3O8WA 4P71A 2HWHA 1DURA 5ETOA 4CLKA 3GMGA 2ADBA 2C2EA 3J80Y 2BJ8A 1Q95G 2HGNA 2DTJA 5DQHA 1VRUA 5HN0A 1R8HA 3J7Z5 2DNMA 1EP4B 4A8YA 3K89A 2DGUA 1LEOA 1SJRA 1MWYA 1BD6A 1VQYA 2AKWB 2Q43A 1YHQS 1HI1A 2VOPA 1K0VA 2Z2MA 1JWWA 1JLAB 1BHNA 3G4SS 3T5JA 1RAGB 2W2NP 1T3OA 3QFHA 3TO8A 1CG2A 2GIQA 3ZTPA 3RAMA 5I3QA 2F8MA 1FA0A 2OPRA 2R7SA 2QLWA 1XJWB 3PFEA 2G1HA 3I56S 3JYTB 3DDKA 5CQGA 3OFEA 2MYFA 2KZMA 1MLAA 4GVBB 1FJEB 3HZEA 4LSLB 2D3OR 2BJ1A 2QA2A 3JSMB 5GAGU 1WJ9A 2MMYA 2OKQA 3R6GB 1ZM4A 3KK2A 2QL9B 5CCMA 3G8TA 4F4XA 3TX8A 1SQGA 3I87A 2DNPA 3IWXA 2VKRA 1VDHA 4I4BA 2GX8A 4UOGA 3R5CA 1XC9A 3HLUA 3M2VA 2W4PA 1B4SA 4LFBF 1HYSA 2B51A 3TUPA 3M9MB 1HMVA 4EBCA 1NNDA 2OSRA 1VCTA 3CC7S 1X4CA 1QSYA 2V34A 3HX9A 2VQFF 1F5AA 3AT1B 2XHCA 4MKVA 1SXLA 2R7QA 3JSYA 4E0DA 1G7CB 1IM4A 7FDRA 1F3VA 2GQQA 5EWFA 1FKOA 4Q44A 3D66A 2MKKA 3AOCA 4YMEA 1RWOB 4KT0C 1T9TA 4O4GB 3UR3C 1S0NA 2YWGA 1U02A 4UY8T 5KFPA 3CD7A 1FWKA 1NDKA 3LH2S 5HAOA 4QIVA 3D6TB 2CQCA 1EIYB 5DDRC 4ILRA 1U25A 1DTTB 3TJ8A 2MKJA 3PKMA 5D0GA 2CNOB 4S0MA 3NGKA 4HDHA 1TAQA 2L41A 3GFYA 3ZXWA 3VQSA 3KLIA 1ZBTA 1LXNA 2VFTA 3CE8A 4GO5X 3ZTSA 2YKPA 4DN0A 2O3DA 2BBEA 2CPXA 3TYTA 4FBTA 3K7RA 2XO7A 2JFKA 5D3GB 1RABB 4TYAA 1N32J 3ZZOA 3PZPA 2BM0A 3K57A 1UWAA 4NCAA 4J9RA 4DV3J 2DISA 1WC6A 3LWLA 1QE1A 5JJBA 3CCMS 2A6MA 4OJHA 1YJ7A 1NH8A 4Y65A 3KK3B 4MIAA 2C22A 4CTAB 2ZNYA 4YR2A 3C66A 4CI0B 3K5LA 3CCWA 1JLEB 2F9DA 4B3SF 2V2VA 1AZSA 4P7TA 4M5KA 2B9XA 2E66A 3BGRB 2YKMB 2CQGA 2RIJA 4FPRA 1ZAVA 5DO2A 4NCGB 2Z30B 1EQ0A 2YKAA 2HS3A 1RAEB 1A7GE 2BDPA 4G1PA 4C3LA 4ECWA 5B0DA 4CLLA 2PMWA 3RGIA 2BEFA 4YR3A 4X66F 3E51A 2MTLA 4MMOA 4F2SA 1VLOA 5B0CA 1EP4A 2YH0A 3IM8A 3F0NA 3O5TB 1PBAA 3PRBA 1VIOA 1U8WA 4EK2A 3TW0A 3TQ1A 4W90B 2IRUA 1K1SA 1JLAA 2E7WA 3LGNA 4NE9C 1S1WB 4MK9A 4ZVPB 1M90T 3ICLA 4ANCA 2DEIA 4ATNA 3NAIA 3SYZA 2V8PA 4DS5A 1S77D 2W2MP 4ANEA 1KHVA 3AFGA 1UZDA 4DSEA 1VBXA 4ZHRB 3HDSA 3JYTA 2DYAA 5LL6d 2HHWA 1XR7A 4DX6A 5DG9A 3CCQS 4GVBA 2R2UA 4LSLA 1YQHA 4WJBA 3JSMA 3L7PA 2HBYB 3DLKB 7FD1A 1E6YB 5D8HB 3S8SA 2F5GA 2GHWA 1EKSA 1U1MA 3KWMA 4C0OC 3T6BA 3C46A 1D8YA 1F9EB 1WHXA 4ECUA 2ZHOA 3BBCA 2C3OA 4WYLA 2FVQA 1SKUB 4HLBA 1RK8A 4RJVA 2V68A 3HSZA 5I3UA 3OT9A 2IAJA 4F4YA 3QT8A 4C2MA 5IQ6A 2WK4A 3VZHA 4EFAC 3I0SB 4X65J 3SSQA 3VTIA 4OX7A 2UVRA 2W9CB 3QT7A 2ZH4A 4AFFA 4JI0J 3UDEA 1R27B 5GVQA 1FHTA 2FLOA 2KDOA 1OYDA 3NRBA 1T8EA 1DFDA 3AD9C 2EK6A 1U2FA 3M8RA 1SPBP 4DR7F 3N01A 3OR1B 5J2QB 2CFXA 4P10A 1LFWA 4O4GA 5KFQA 1T9WA 2BKNA 3JAMY 1NSQA 2GAGC 3BEGB 4LF7J 4JV0A 4QIFA 5L38A 2KFZA 1Q5YA 2IJNA 3CDWA 4RBVA 3W7BA 3BO4A 5ETMA 2AJQA 2XQCA 1W7WA 4DSJA 1DTTA 2B4VA 1N48A 3FMWA 3BSOA 4HH0A 2H65B 3J81U 3T1YF 3MPVA 4FF1A 3QIDA 4FXWA 4OHYA 2EW9A 4G6VB 1B7YB 4F4KA 3M8SA 5EWGA 2UU9J 5GAHU 5A0YB 2WONB 2XNQA 1RLCL 4OZLA 2AGQA 5HJYA 4KJIA 4ZVQB 2RSQA 3P49B 5EUHA 3KKFA 4YHHF 4QIGA 5KG6A 1N6QB 3BQ1A 2LCWA 1VK8A 4PG6A 4IO1A 2IBOA 1JJ4A 3UN2A 2QMWA 3TOQA 4EI2A 1Y7PA 3SSRA 2X1FA 3Q24A 5D3GA 3P6YC 2RJZA 5K8PA 1M1KT 3PV8A 1U6FA 2WB1D 3G6ES 1NPKA 2M2BA 2B4OA 4NLQA 3MUMP 3FEXB 2FQQB 5ETQA 2WZ1A 2Z2LA 4C8ZA 2EWHA 3H2LA 1H6KX 3KK3A 3DC2A 4CTAA 3FRZA 3U1MA 5L1JA 3VF0B 4N8NA 4TKTA 2MKIA 2R2SA 1JLEA 3BGLA 2HFVA 1FJCA 1NCLA 2FGCA 1N34J 4ZS6A 3BZQA 2D1CA 1NK0A 1VRQC 3BGRA 2YKMA 2HHUA 2AWZA 4NCGA 4ZLJA 3X1LB 1PIEA 3QPIA 1WC0A 1REVB 1NDLA 4DV0J 3PM9A 2K2PA 3V4MA 3D0GE 4WTYA 1U1QA 1SL2A 2A0FB 2HLTA 1M1GA 2CPJA 3CC2S 4JI3J 4LBIA 2D7SA 2E5IA 4UTGA 1D3WA 1N5SA 4ED7A 3VAMA 1WKJA 2ZDOA 3ZTQA 2VPXB 2XLKA 2AEJA 4I1TA 1RAOA 4WFZA 2G0CA 3FBEA 1WWHA 3KXDA 4HT5A 3TI0A 3DLJA 1S1WA 4P75A 4LREA 1DQ8A 2OPPB 1RBOB 1S6UA 1CC7A 4YS2A 2PEHA 1XR5A 2PMZD 7AT1B 1S76D 2ALYB 5IM0B 3V6JA 4L3KA 6FD1A 1YJVA 3NY0A 2G9OA 5ETRA 5KT4A 5D4LA 4DV6J 1CBKA 1Q8BA 2FD2A 2BQ3A 3H2VE 4ZHRA 1ZOTA 5C25B 3W8PA 3J7ZT 3PJXA 3CMES 1WDTA 1XWLA 4A8MP 2K3IA 3CW2C 3RRKA 1U1RA 4ZJLA 2HVDA 3DLKA 1E6YA 1MROB 4RNNA 1YDLA 1YJTA 4WXWA 4LF1A 2FVPA 3NS7B 4F26A 4F02A 2XS7A 1FRJA 2V4RA 2RD5C 2E29A 1I3OB 5IC6B 5B7WA 2HAFA 3MF5A 1CS4B 3FFIB 2QO3A 2BJ9A 2V8HA 2X1GA 4F25A 1SH3A 4FS1A 3GJTB 2N7YA 4MKBA 2QJ3A 1U0HB 3I0SA 4I69A 4OYBA 4CT8A 1FT8A 1CJKB 2YNFA 2U2FA 2WAQD 4CO4A 5A8WB 2O5DA 2PC6A 1BMQB 2W9CA 3A4TA 4ELUA 1JX4A 3GILA 3V4IA 5DQIA 4DPWA 4YY3F 5B0FA 3P3DA 5BR8F 2RS8A 1MNEA 3N5FA 5L39A 1U6ZA 2DR9A 4ECZA 3MECA 2KFNA 1S79A 2GHVC 3A3OB 4BBYA 2LMIA 3QYYA 3OHBA 3BKTA 5CD4A 3VAIA 4C8KA 3R97A 4EMDA 4ZVUB 5HATA 2ZC4A 2PEBA 5KG1A 1QAJA 1YZ7A 3A3PB 4TU8A 3PHTA 1F60B 3IBCB 1VI7A 4MIWA 1S9EB 4RR5A 3MCSA 3QLHB 2RVJA 4DPYA 3GYNA 4ICLA 3DXSX 3AHPA 2XS5A 2VHGA 1YG0A 1OQ3A 5A0YA 2WONA 4DN9A 3MD1A 2RRAA 2FYXA 5KG0A 4NXNJ 3W2VB 3UWTA 1HNXF 1N6QA 4QWDA 3VGVA 1FI4A 2Q6CA 3G8QA 3IM9A 1RQ0A 5ADZA 3D5MA 4ER8A 3UN5A 2LXUA 3OXFA 5KOXA 2LEPA 4M63A 4QU7A 3G86A 1XNRJ 3AJ2A 3H0PA 4EUVA 4RWXA 3EZ5A 1NLKL 1RTZA 3IMQJ 1B3TA 5IFMA 2YKQA 3OR2A 3E3XA 5LT5A 1L3TA 2DY1A 8ATCB 1IKWB 4UOCA 3V6HA 5CZXA 2W24A 2F4VJ 1W2BR 4UT4A 1NKEA 1KVIA 2R2RA 3MEKA 2D3O1 3D1HA 3G9CA 1HARA 4X64J 4R25A 4B3TJ 1KOHA 4LFAJ 1FRXA 1IQZA 2AJFE 2E9ZA 3EE3A 5KT2A 3SV4A 2VPZB 3CIZA 1V9OA 1SUQB 3TAMA 3CUNA 2GAHC 3FMBA 3CCVS 1REVA 1X5SA 3FCHA 3NP5A 3CNQP 1T9UA 1NK6A 5M2PA 2EBEA 3I31A 3R7SB 1RKIA 4LSZB 2V63A 3H42A 1W26A 3OVAA 1GEHA 3AD8C 1I94F 1WC4A 4A48A 1WG5A 4L3NA 4OYMA 2J0SD 4DDFA 3TZXA 4J37A 2MKHA 2VJVA 4IOAQ 4CO3A 1KTVA 1R0BG 2RU3A 4ZCLA 2M8HA 1NKCA 1J5OB 1Y10A 2OPPA 2BZ2A 3D0IE 2DNOA 2G13A 5IM0A 2BVZA 3DYAB 5G0RB 1U45A 1NJWA 2BOAA 2CA9A 5KFNA 3HJVA 2HG4A 2MEWA 5D0EA 1XERA 3V6KA 2XHWA 3V6DB 3NCRA 2DHXA 2NREA 4TLQA 3CMQA 4DV3F 4WIQA 3J81Y 1IN0A 2J9EA 3CCES 4IUFA 3FC9A 2YKNB 4PAAA 1NK4A 2DNLA 2J8SA 4DL4A 3GG0A 1MROA 5D6GA 2WHOA 1GMUA 1TKTB 1FXDA 1YGYA 2PFDA 3TEHB 3D4JA 1B7FA 1XK8A 3M7VA 4DWIA 1TKXB 4I0WA 1CS4A 1BLUA 4EBEA 3V2UC 4DX5A 4IR1A 2K06A 1V3RA 4NA2A 3TJAA 2EFVA 2W7OA 2DB1A 4WE1A 3D6FB 5EX3A 4QW8A 3T5HA 3CF5Q 3IAS9 4DEZA 3KLFB 2F40A 1TU0B 1F6TA 3MXHP 4K4VA 1CJKA 3M8QB 4EZ9A 3SQOP 5A8WA 1HLWA 2H54B 1JIHA 2QSFA 4H4MB 1EJ7L 3K5PA 2CDRB 3I82A 2UV8A 2PO4A 3DCAA 1RXOB 1IXKA 5THWA 1JK9B 1OS5A 2GJ2A 4V19J 4ZA1A 2XMTA 5SUHA 1HQEA 4DPXA 4I64A 1C1BB 3SCLE 1FERA 2PI5A 3UI3A 2KT3A 2FHOB 3H7HB 2FLLA 5KT6A 4DMZA 2NYIA 2WSCC 2Z0GA 1AUSL 2LP4A 1R6YA 2EFNA 2NUUG 5HQMA 2ZZTA 1I51B 4IR9A 1S9EA 3QLHA 1GNKA 3MPUB 3Q8UA 1BQMB 1IVZA 2ABYA 4WWSA 4RZRA 3ENQA 4ZVHA 5ITHA 2H51B 4O0NA 3PVXA 2PI4A 5KFZA 4JV5J 1PKUA 3R2DJ 5KFTA 5F41A 1RYSA 4TVAB 2ZUAA 1H74A 4QIWD 4O3SA 5EGYA 1S4EA 1VQKS 5L9NA 1NHUA 5KOWA 2M9KA 2LU2A 1JMTA 2VA2A 2ZBPA 2AYGA 4USTA 4BWJA 5B0AA 3G6YA 2DXDA 1Y5LB 4X62F 3MTJA 1IR1A 3KUHA 1JLFB 4I2QB 4X4OA 5GAHI 4O3PA 1IKWA 4UF4A 3X3UA 5J1EA 2GO8A 4PQUB 1TV6B 1RT7B 1Q82T 5T14A 1S6PB 1ZS6A 4R0EA 1K47A 2VC1A 3NG8A 1NHKL 2XC9A 3RBEA 4NLGA 3GWCA 2KG1A 4KRWA 2BJDA 3QIPB 3R27A 4CO1A 1RHQB 2EFPA 4FF4A 3CJ0A 3NNCA 2UUCJ 3RJMB 1WG4A 2MZQA 3OFHA 3VGTA 1ACMB 1SUQA 3OTCA 4LRDA 1GXLA 2HQ3A 2OFHX 4CH0S 1X0FA 5CD4H 4YP3A 4OYPA 2YH1A 1GFWB 2DGOA 5AXLA 4NEZA 5MAOA 4NXMJ 2C2RA 3M4XA 1FDDA 2QA1A 5HVHA 3JXOA 1XN9A 2LQBA 4YB1P 2KYXA 4YR0A 1EAYC 3TQEA 2MQQA 2RE1A 3T1HF 3O3LA 1K0TA 4J9PA 2DXEA 2ZH8A 4BDPA 1IBCB 1WF0A 5BYRA 1GXUA 3PNIA 1IKYB 2HIYA 4M5MA 2BR0A 2AGPA 2A2DA 4C8MA 1U1LA 3DYAA 5G0RA 3EXYA 4A8SA 5DDPC 3OVBA 1P1TA 3V6DA 3LUYA 1BQNB 3BKFA 2VDIA 4OI0A 2YWEA 4PABA 1UCNA 4KC5A 2R7RA 2P9CA 4DJBA 1VIXA 2YKNA 4QR2A 1X4EA 1JXVA 2M8DB 1HWKA 4ZIVA 1WKKA 2OSQA 3GIKA 2WW8A 1LQ9A 2BQUA 5L9XA 1TKTA 2F1FA 3R6LB 1O5JA 1Y00A 2AJ0A 3ZO7A 4DR4F 4J7CA 3KHLA 1HHQA 1TKXA 4C8NA 4KTQA 4FKXA 2IDEA 2MLYA 4P52A 1HNIA 5GADU 5HQ8A 3DOLB 2AHOB 1K73T 3QSYB 1HBOB 2GHPA 3UFCX 1IQTA 2KT2A 2GVDB 4L73A 3WHIA 1WSRA 3KLFA 4C48A 3FEYB 4RNFA 2WTFA 4O0IA 5A2QY 1UEUA 1YRUA 3M8QA 2IJRA 5ETLA 2RUGA 4PXBA 2FHJA 4H4MA 3O2IA 4WFYA 2XCPA 1WI6A 2F4FA 3TZYA 2GMLA 5L1IA 1GT8A 4OZJA 3QZ7A 2I0XA 4M5LA 1T05B 1TELA 4NRTA 1V6HA 4OLPA 2HVHA 2J5AA 3ULHA 1BXNA 3MM7B 2OD4A 1C1BA 4TQRA 5KFUA 2A10A 3EYZA 2NZ4A 3NMRA 4DU7A 1RJJA 2YX1A 2QG9B 1WI8A 1S1UB 1E6VB 3OV7A 2ZJQQ 4A8FA 2PDAA 2BKPA 4NOHA 3UCGA 5K14B 2HNDB 3JQJA 1PYSB 1APSA 2P5VA 3DHWC 1VHIA 2BYCA 2E5GA 1Z2LA 4M5DB 3CJKB 1ULRA 5FIIA 3QBCA 1QAIA 4YQWA 1TL5A 2LA6A 5AJ3J 1BQMA 2YXLA 2WSFC 2MHNA 4OHZA 4JI7F 3H4BA 5A8RB 1YBAA 4JP8A 4AD6A 2FTRA 3V5RA 4DV1J 2HNZA 2J6TA 3DKDA 1FD2A 4OI3A 3VAKA 4J9SA 4ITSA 2YNGB 3M9OB 5AXNA 1YJWS 1TMMA 4DX8H 1VQLS 5BJRA 3QWUA 2XM3A 2CPYA 2YY3A 3HSGA 4L72B 1S0VA 3BREA 2FVCA 5LMUJ 4DL0C 1X31C 3GPAA 4F3MA 1LWCB 3HHLD 3OLAA 1FEHA 4JV1A 4YOEA 4I2QA 1Y4ZB 4PQUA 1TV6A 1RT7A 1JKHB 5KFKA 1S6PA 2CPDA 4NLXA 5HP1A 1HIYA 1QD1A 1UVIA 3L3CA 2YNHB 3QIPA 1N4LA 3NS6A 2LQ8A 3H20A 3OPKA 3E2EA 2ZBQA 3OJSA 2MZJA 2RQCA 5JXSA 1KONA 4CYUB 4M5IA 4PG8A 2F65A 2R7UA 1MMNA 3MM8B 1Y3JA 5T7LA 5BYQA 4M5NA 1UJ6A 2BW2A 3GZ7A 4CCHA 3DHXA 2BQRA 1RUSA 3PR4A 3S01A 2VIHA 4FF2A 3EVOA 1RAJA 2Q3PA 4ED3A 1UPMB 3AODA 3D68A 1KVKA 1DZ5A 5C42B 4WCEQ 4ES2A 4LR7A 3CJ8A 2L9WA 4ZP8A 3DLEA 3R7BB 2HQGA 1IKYA 3R5DA 2UXDJ 1XNRF 3C6UB 2ZVIA 2OO4A 2Q66A 2CQ0A 2FGOA 4L6V3 2BKOA 3I32A 3PTWA 1F2GA 4ZVGA 1BQNA 4OX6A 4EEYA 4OIXA 3O1LA 2YX7A 1RU1A 2Y8WA 1YTYA 3WBZA 2HHSA 2F4VF 3A3NB 3FK4A 5A8KB 2XYGB 3S1TA 3U1NA 1TUGB 1SBRA 4X4PA 3SV3A 3CO0P 4ED1A 1O0PA 2E9RX 8AT1B 4DI6A 4KGXB 4WKYA 4I2PB 5HMXA 2GQCA 4V1Ak 2DHHA 3FUYA 4A8XA 1R8BA 4ID5B 1X5OA 2VG5B 4OYAA 3ITHB 2QC3A 1HBOA 1G1XA 3Q8RB 2GVDA 2DGSA 3P4UB 2ASDA 2UUAF 5D0RA 2RRNA 2Q6BA 4ZPVR 4USMA 1X9MA 4D3GA 1SQEA 2CG8A 4E2FB 3BYPA 2GMHA 1RWWB 1TL3A 3TARA 3M32B 1IR2A 3JSRA 2GS8A 2VQEF 3UPFA 1OPZA 4A47A 2X3DA 4RW8B 1T05A 2ZNZA 2M4MA 3PIOQ 2DR8A 1GTHA 2HSEB 1IWAA 1Q78A 2CJYB 1UP1A 1NJXA 1ZA2B 3GG1A 2QEXS 5KFAA 2DO0A 1WC1A 5LJ3Y 1S9FA 1M5OC 5FLXY 2BE2B 4NEYA 3GE9A 1N0UA 1S1UA 3BJYA 2ZOFA 1E6VA 2CDQA 1R8PA 3GIRA 2OEKA 2AJ1A 3I4HX 3M6VA 2CUYA 5K14A 2HNDA 3BKUA 4X4QA 1JXLA 1IKVB 3GP9A 4M95A 1FDAA 4M5DA 3CJKA 5KFFA 1NSAA 3VAJA 1H2VZ 3J7YU 1UVNA 2OUGA 5U47A 2ROGA 2C2NA 3EVMA 2BJEA 3MPYA 5A8RA 4KHPF 3QJJA 1SC3B 3EDQB 4Q0BB 5AE1A 3PFOA 2JH3A 4RWWA 3CJTA 1YLXA 4MKYA 3LP1B 2QX0A 3KDNA 3DMJB 3HI9A 2YNGA 4FYWB 3D1QA 2QL5B 4ILMA 1LOUA 3N28A 4J9VA 2DNKA 3CJ3A 1KBRA 3MWBA 3Q8PB 4FXVA 2MXYA 4IDKB 5ETTA 1CJTB 1WC3A 4PEOA 4LF9J 2L9DA 4K5SA 4KB7A 2DRDA 3K5MA 5I3PA 1U48A 2EFQA 4LBHA 4DR5J 4AT1B 1JKHA 4MJKA 2GNKA 1FXRA 3FSXA 3CJQA 4M94A 2CAJA 5HLFB 3GFHA 4ZVRB 2IVYA 4KYZA 1H72C 2YNHA 2W2QP 4LRFA 2IJFA 2JNJA 1U1NA 4C8YA 1SB6A 4OI1A 4CYUA 3HZGA 2MQ8A 1Q1KA 1UZHA 1TAUA 1SL1A 3MM8A 2LXFA 3CMAS 2GV1A 1ZM9A 1AROP 4PXDA 1OSCA 1N36F 2R7XA 2PGCA 4OZNA 3GJQB 3HCXA 1WF1A 4DLGA 2ALZA 4RBUA 5C42A 4C3MA 3HVWA 4ZCKA 2CKWA 2J6UA 3K5OA 2MSSA 4RL1A 1WSVA 4ZPWR 2HKEA 2BM1A 3CEDA 1GX6A 4NX9A 5E2QA 3SI8A 3ISND 2E1MC 4UOHA 4RNMA 1QUVA 4WFXA 3DM2A 3E8OA 5F0UA 5AE3A 2KXHA 2WSEC 1XMQJ 1HWJA 3ZZUA 5FD1A 2IM1A 3AB4B 3KHHA 4TQSA 4Z7CA 4P2SA 4ZDNA 2O1PA 3HHEA 2OJ3A 3HHKA 3MR2A 4EO8A 3QT6A 1KLNA 3R8YA 1RWKB 2HMIB 2ZD1B 2CADA 3U7JA 3N79A 5B0EA 2XWYA 5DLGA 5DJBA 4DUYJ 4I2PA 3CSKA 3JSBA 3LPEA 4MKAA 3K58A 2ZKTA 2JEJA 5E33A 3MR3A 3G82B 4CLPA 2VG5A 3ITHA 1UMJA 3W64A 2OI2A 4PG4A 1U26A 1AUDA 4JI8F 4ELTA 4DCPB 1P6TA 4QOTA 5CAAA 3G6VA 2JVRA 2DIVA 2OTLS 2V2ZA 2IC3B 3HM9A 1QM9A 3MPWA 3DI6B 3TP2A 1YRXA 4L74A 3FZBA 4DV5F 4EO6A 2JLFA 4F0KA 2XMWA 2PA3A 4ECRA 2LQ5A 2PA8D 1WOPA 3BQ0A 2IPOB 1TFWA 2B9YA 5GADI 3UQSA 1A0OB 5DM7Q 4OYOA 3SBMA 2RT3A 4OHVA 3G96A 3KJVB 3BR9A 2BE2A 2B8PA 6FDRA 1WORA 1NH7A 5DGBA 4KGVB 3QZ8A 5HSPA 2FJAB 4JI2F 1L3SA 1XMOJ 1IKVA 3GSIA 3K2YA 1WEZA 1B64A 3SIPB 2KYZA 2CYYA 4USKA 4RBTA 2YNIA 4UZBA 2FC8A 1KWMA 1XBWA 4IFVB 5J2NB 3DRYA 2A2CA 5B0BA 1FKAF 4Q0BA 3EICA 5JVHQ 2Y8YA 4WZQA 5E3RA 3LP1A 3N9UC 4PR6A 5IOLA 3Q2SC 2DXFA 2DRBA 2JX2A 2MY7A 2ERRA 1IBKF 2PD1A 4KAIA 4B3OB 1CJTA 2APOA 3SMZA 3N4WA 1ZM3A 1RTHB 1Y11A 4RUBA 4O3QA 2HVEA 1U2CA 1RWUA 1N5YB 1D1UA 3WZ0A 2RQKA 5LXYA 3N5BA 5HLFA 2AF6A 3A8JA 3RUBL 1NM2A 2FLPA 4GC6A 2LEAA 3OD2A 3OBIA 1DTQB 2CPFA 1NJYA 2D3UA 4B9VA 5IT9U 1GAOA 1CEZA 4DSLA 1FKPB 3H40A 2ZHBA 2KN4A 3PO4A 3IP0A 4YB7A 2KI2A 4AXIA 2HRTA 1UAWA 4JYAF 4DUZJ 1C4CA 2NLWA 2WRMA 1N56A 3KUGA 4U7UK 2C1EB 1VC0A 2ILYA 1DLOB 4ZPDA 2LFVA 4DXLA 3RB3A 4CRJA 1A9NB 1JB0C 3KDOA 2CQBA 3CPWR 4TYBA 1KFDA 5KG5A 1CLFA 1T7PA 1TL1B 2OLWA 4OLOA 2JOQA 1H38A 5DM6Q 2RDDA 3OTBA 3NCQA 3P8BB 4JI4J 1RAIB 4EGLA 2J9DA 3EMTA 2FB0A 5DDOC 2HHVA 3CTRA 4RU9A 2A1BA 2CQ3A 3CD5A 2VBYA 3THPA 4WBFA 4URGA 1U7LA 2HMIA 4AE5A 4QU6A 4Y00A 2VDHA 2H9ZA 2ZD1A 4OV1A 2UUTA 4DR3J 3CDEA 4TNOA 1RHKB 3M2UA 3C16B 3H2UB 5C2GA 4P6QA 1B0PA 1JLQB 5CYJA 2B7BB 1HMVB 4I6AA 2VFRA 2XMAA 4USJC 1VRTB 2KM8B 2HHHJ 3PYEA 4NLPA 2MZ1A 3L9ZA 2FZGB 3RBZA 1K8AT 2J0QD 4FXDA 1HI0P 2DR6A 4KPYA 1UFLA 2KO1A 1ZTTA 1VQSA 5KFHA 1VQ5S 4LIRA 1DQAA 2V6AA 3NGTA 2G0IA 2ZOMA 4A4JA 2IC3A 4A8KA 4V19X 3GV7B 5KFLA 3DI6A 1URNA 5IV3A 1FKOB 4X4SA 1OSDA 1B0TA 4OI2A 4OI6A 4GKJF 2GJIA 5F8LA 4RUHA 2MGZA 2AMCB 4OFZA 4H4KA 4RPFA 2RQMA 1HNZF 4B9MA 4Y2CA 2FJBB 1NDPA 1X4FA 4ZP7A 1F9FA 3KJVA 3A8IA 1UVLA 4GO7X 1QVGR 2EFGA 3NAHA 4CLWA 2XI3A 3ILIA 5H9FK 2DRAA 1FJGJ 3JQKA 2I5JB 3FQLA 4CH7A 4DL7A 2R8HA 1EQMA 4B3MF 2C3UA 5CYMB 3KG4A 2RU9A 3TRGA 1S99A 4U67Q 1F5BA 3R5BA 3BGUA 2HURA 1IBMF 3HSJA 5C2CA 4IG0B 3HD2A 1UW4A 2GC8A 2PN6A 2RUSA 4IFVA 4FYVB 5J2NA 2ZM6J 1X5PA 1RHUB 1FE0A 1X4HA 4IRCA 5EN1A 5KTQA 2H1YA 4FS2A 3JB9k 3AA9A 4ZVFA 2FZCB 2NXEA 2RHSB 3GV5B 4RX6A 1SKWA 1QE1B 4B3OA 3OFGA 1RWXB 1VQ4S 1P9QC 4KHMA 2A3JA 5HMZA 2K1RB 2HQCA 2W25A 4ED5A 4DQSA 4I6YA 4ALZA 1NPRA 1LWEB 4KY3A 5RUBA 1XQIA 3KJNB 1AZSB 3IR7B 1J5EF 1CPZA 3NBPA 3HVTB 1DJ0A 5DRKA 3IWNC 2HAIA 2UXCJ 3H98A 2XULA 2LDYA 4DR1F 3BQ2A 4XIUA 2XSJB 1DTQA 4OI4A 4W92B 4ES3A 3GYXB 4QWCA 1PBUA 2ZOGA 1BE4A 1FKPA 4M5GA 4OX8A 5IC4B 1SC4B 1EZZB 2QE5A 2Z4PA 2QFIA 4QWBA 4I67A 1HPZB 2FC9A 3H90A 3I55S 4USUA 3W5XA 4BHQA 3CCSS 4DR2F 2AJ2A 4ED6A 1VQOS 2IYGA 1HBNB 3OSPA 3R9LA 2OH2A 1QAXA 3OQ2A 1DLOA 2HHPA 3J7A1 3H59A 2BANB 3KLHA 1N33J 4CM0A 1U2RA 5BYSA 1DY3A 2RDJA 2YQ3A 1RHMB 3PDNA 2MSTA 4LF2A 1M5PC 1D9DA 1TL1A 2NPFA 3I5CA 3BPDA 1D8ZA 5KG2A 5LJ5Y 2VF3A 4Y2KA 4LFCF 2B8QA 1PYOB 2KRBA 3A1YG 2MDAA 4L76A 4DQIA 2NSBA 2XGQA 2NSCA 4DV7J 2AP6A 3IRXB 1QSLA 4DL5A 3FJ2A 2CNNB 4DR5F 1NK7A 4JOUA 4RUCA 2OHDA 3MZIA 4OX9J 1U1PA 2VG7B 3ENVA 2VU5A 3C16A 2DITA 4CQ1A 3BF4A 3SQGB 2BRKA 1JLQA 4LF6F 4MAKA 2B6AA 2WB4A 5I3UB 3AJDA 1B0VA 2IAJB 4K2JA 2KG0A 2HEKA 1VRTA 4J90A 1RSCA 3MM6B 1L3VA 2VZ9A 3EPIA 2G2YA 1PG5B 1HQ2A 2NYHA 3SZ2A 4NLTA 2M70A 3WIUA 4GKKF 5HI7A 3P45B 1YWXA 3BYRA 2JDJA 4AL5A 1Y5NB 3PX4A 4WZMA 3GFXA 2QLJB 4ZCMA 2RDIA 2XSFA 3CCRS 1HBMB 4QBUA 1O6XA 3CD6S 1OO0B 5E3QA 2VD3A 1WDDA 4GC7A 3OTOJ 4ZPBA 4RW7B 4PPZA 5D15A 3B82A 4YB6A 3CB4A 1FXLA 2Y1IA 2EEYA 4O23A 2OIHA 2VBXA 3O44A 4ZPTR 5IWAJ 1IBLF 2D9OA 4ZOSA 2HZAA 2I5JA 1LW0B 1CVJA 3DGVA 4CH1A 4NLWA 5CYMA 1FNXH 3PKYA 2I9SA 4Q2MA 1S12A 1KDNA 3UCUP 1RAAB 4XDCA 1MW7A 3QAEA 4K8RA 4CM2A 2I2YA 1RB0A 3BBFA 2P6TA 3D9BA 1TR0A 4IG0A 1ZPVA 1IJEB 1VFJA 1X4GA 1F0XA 4NZ6A 4LF5F 3B8HA 2J6SA 4MFBB 4C0BA 4KKOB 4IKAA 3T5LA 4ZVSB 1V3ZA 1M0SA 2CNLB 2J9CA 3HXMA 2IY5B 2RF2B 4EWTA 1TUVA 3K8VA 5J1PA 3VZIA 4F7VA 3DNCA 3OL9A 4NLDA 2IM0A 1RCOB 3RW6A 4NZ0A 4LRCA 2EKYA 2UXBJ 2N82B 2VFUA 2K1RA 3QRQA 2HBQB 5KAKA 3HT3A 1TK5A 3FBBA 3QJLA 4FPIA 2F63A 4JI5F 1LWEA 3US5A 2C42A 3UO0A 3HVTA 4B02A 2UUBJ 2R3VA 4ED4A 3TUJC 2I38A 1TK0A 4OJ1A 1AYEA 2VOOA 2R42A 1RT6B 4JB8B 2ZZNA 3A8EA 2XSJA 1S1XA 1C0UB 4Z37A 3WQPA 2H5IB 1K44A 4DLEA 1XMOF 3SXLA 1VHFA 2OPSB 4CZCA 2XYHB 3VHQA 1HPZA 3MURP 5H9EJ 1H98A 1RWVB 4LFBJ 3LP2B 2GA7A 3NGUA 3CJSA 1HBNA 2LDIA 3MMBA 2DEJA 1PAEX 3LAKA 4K0KF 5K8MA 5LM7E 2BANA 2OEJA 4YN3B 4WFBQ 2J8AA 1SH2A 2XMJA 1UKUA 2AX0A 5KFDA 4I68A 1GMWA 4NYOA 1OMSA 1PO6A 4IRKA 3IR5B 1LW2B 1RKJA 1T95A 2LQ9A 3NWGA 4LVOP 1JJCB 1PJ5A 3BM7A 1HR0F 4IO9Q 1RAHB 1NKBA 1QY7A 4UQTA 3QGIA 1SCJB 3IRXA 4NYPA 4U6PA 1UW9A 2HQFA 2AYEA 2C3PA 5DZ7A 1UA0A 1UFKA 4DZDA 2VG7A 2W2PP 3LP0B 4B3RJ 4I56A 2XY6A 3SQGA 3ILLA 1X4DA 2RMLA 3GIMA 3T9NA 2J7UA 1ELOA 1QAYA 3EVWA 3TZZA 3MM6A 1T3NA 1REGX 3MAQA 2HHXA 2OELA 3DOMB 4F8RA 2YNFB 2HLUA 1EB0A 3G8SA 1L3UA 4K7QA 5HQLA 2V94A 3V4IB 2XWXA 4Y6IA 1WC5A 1NJZA 3D0HE 3QRRA 2QLFB 3UD3P 4ERDA 2VFVA 2MZRA 3Q89A 2DO4A 2XZWA 2HGLA 3KG1A 1LNQA 1KFSA 2FY1A 3UE2A 5K20B 4PYDA 2NXJA 3MECB 1HBMA 1VLYA 5E3PA 2VB6A 2LECA 2FHJD 1U49A 4RW4B 2MQNA 4QZVB 2JFDA 4IFYB 4RW7A 2C2OB 2JLGA 3VAFA 1CJUB 2KB2A 2QLBB 4DF4A 1WOSA 3I96A 4RNHA 1NSKL 4CLZA 2CQ2A 4NLYA 1LW0A 4B3SJ 4ICLB 4E8UA 1G3OA 1Z4UA 4GMKA 2DJWA 4LRAA 2H5EA 4KQZA 3DRSB 4O3OA 4BS2A 1YKWA 1SC1B 4NA1A 1T03B 1AA1B 5KFYA 1S6OA 5KFRA 1MMLA 5LMNF 2BUNA 1TL7B 1Q79A 1FCAA 3EX7B 2CRLA 1FJ7A 1FX2A 4C97A 5E0OA 4MFBA 4KKOA 2CQ4A 4ZLNA 1YIJS 1XIQA 2BX6A 4X66J 3C14B 1XNQF 3JTPA 4KIAA 5F8JA 4B9LA 2RF2A 4LIWA 4C0HA 5GMKa 4N56A 1ZAXA 2QV6A 3OR2B 4F04B 3I5AA 4H4KC 2RRBA 4H54A 3M8WA 3OTDA 2ROEA 2ATLA 3NGSA 1TVRB 2K8GA 3GB0A 5D77A 3IN5A 1SIWB 4NLUA 3KLGB 1JJHA 1BUXA 4K4SA 1KS2A 2LKZA 3OUYB 4LR8A 4Q45A 3AQPA 2H4WB 4DFKA 3R7NB 2V69A 2XG8A 1R8CA 3TAMB 1TKZB 4HKQA 3VQTA 3KHRA 3GTYX 1RT6A 4QR0A 2VA3A 4Z2XA 2X1AA 2IMWP 4OQJA 1C0UA 2CPEA 2KH9A 4K50A 4NLVA 4G3IA 1CQMA 2QZ8A 4HACB 2XZTB 2HK2A 4DHVA 2OPSA 2J9DE 2Z58B 4AQYF 2FY8A 3DRPB 3LP2A 3CDBA 3NMAA 2CZVC 3ZZYA 3PY8A 2P8IA 3HVRA 5LXRA 2BE9B 2ZM6F 4Y3CA 5B08A 2AGOA 3C19A 2IIHA 5EWEA 4K4WA 1MWZA 1VGYA 2DNYA 2JEGA 2K7JA 4ECSA 4FF3A 2MJNA 3KJQB 4ZIWA 3MDFA 1AFJA 2RHQB 1NMEB 2EK1A 1TQLA 1MU2B 4K4UA 1LW2A 4HHHA 4OZ1A 4DR7J 3TJ9A 3DXBA 2A6OA 4FYDA 2EI5A 2GCFA 4ECTA 1S9GB 4U8VA 1N88A 2AW0A 3R1HA 1FDBA 3NLCA 4USWA 2XO6A 3LOUA 1PJ6A 2VL1A 3MEDB 3LP0A 3RAXA 2FVRA 3I6PA 2Q1LA 4Z7YA 3RW7A 4WE1B 3TEGA 2DCUB 3T1YJ 3W1YC 4ZCIA 1PJ7A 1FTRA 2FUG9 2C2DA 1SJ3P 3DOMA 2HYIB 2EG1A 2ZHAA 4N47A 3RBDA 1N5TA 1O8BA 1Q8IA 1JLBB 4DR6J 2KL8A 3W63A 3OFFA 2C28A 3ADAC 4U7CA 4OZ2A 5KFGA 4C9DA 1N8RT 2HNYB 4Q2LA 1HQEB 3TNVA 2OMLA 4QW9A 1WTBA 2E1CA 1NBEB 5H9FJ 1WNEA 5E3AA 4N5SA 5D4NA 3CJ4A 2D41A 4RW4A 4OV6A 5LSLA 2NR0A 3Q86A 4IFYA 1YJ9S 3QGHA 1CJUA 1C4AA 3RU0A 2AQ4A 3BO3A 2HS0A 3FBCA 4QR1A 5E41A 1VQ6S 1CULB 3IFEA 2IVFB 4B9UA 4AUKA 4IRDA 1WELA 2GJFA 4NZ7A 3FRYA 2DGVA 2FHMA 2KVIA 2KM8C 2R8JA 5IT4A 3DRSA 5A6PA 3UVJB 1WD6A 3GLJA 3HP6A 1T03A 1VOMA 2FVSA 4DL2A 2MQPA 1Q16B 4PPDA 2HK3A 4IG3B 1TL7A 1JNZB 2V8DA 1RYRA 2XMMA 3W65A 3UNYA 1B99A 1IUJA 3C14A 4QWAA 3MGJA 4OHWA 2VUGA 1EKRA 4OZ5A 2VPWB 2ZH7A 2CG4A 4DFPA 4DQPA 2IA0A 1TVRA 5J1EB 4LR9A 3PX6A 4FP9A 3KLGA 4DPUA 3JTNA 1X4BA 3UR0A 3VAGA 2Y1LB 2HFNA 3HHLA 1Q7LB 3HD1A 3OUYA 3IRWP 4HH1A 2NCKL 3MUTP 3OTOF 5KFSA 4D3HA 1TKZA 5KG7A 2MQOA 3GIJA 1YJNS 2X51A 2ZBRA 1HW9A 4YB5A 3HMJG 3HFVA 1VBKA 1T02A 3VAHA 3VVTA 5IWAF 4EBDA 2ACYA 2Q79A 3DGPB 1YVFA 2MKYA 2VH7A 2IVMA 1VQPS 4HACA 1JNRB 2GO9A 3M2RA 4J9MA 5A76A 3LGMA 9RUBA 3B6BA 3JAMU 3MAAB 3QO9A 3JTOA 3MMCB 2B4UA 3DRPA 2KRRA 5F8MA 3L7OA 1TMJA 1HD0A 2HQIA 1M5SA 2CPIA 3W62A 2J7WA 1RA7A 1VQNS 5L46A 5D4OA 1M5HA 3MMJA 2DPJA 3BV8A 2H5JB 2N3OA 2AYBA 1N32F 5ETSA 3ETOA 2UV8G 3NOGA 4OZ3A 3LW5C 4OYWA 4CP5A 4YY3J 3RZAA 2MJUA 1IJFB 2W4CA 2L08A 5BR8J 4LMZA 1WF2A 3MM5B 1MU2A 1FE4A 2UXBF 5HBMB 1SL0A 2HGMA 1S9GA 2F7VA 1RTJB 2R9LA 4QWEA 2UUBF 2N3LA 1OJ4A 2PT0A 3TA1A 5L1LA 1G4CA 3MEDA 1RWPB 1HNIB 2EG2A 1SKRA 1F5CA 4RU2A 4A8WA 2ZE2B 1S57A 3KK1B 2U1AA 5KFJA 4ECVA 2IM2A 3R5GA 2N4CA 4NWBA 3IA0A 2MLZA 3GR1A 3FEZA 2CJQA 1BWEA 2K3KA 4J91A 2J0XA 3BBBA 2IM3A 2X3GA 5D4PA 1NHVA 5M2UA 1RCXB 2ZH6A 4G65A 3ZZRA 1JLBA 3NOCA 3FCWA 3BDPA 1HNXJ 2G4BA 2NPIA 4RW9B 2O67A 1KNZA 2DNHA 2WVFA 3G2XA 4ID8A 2HNYA 2YQ1A 1H0HB 9ATCB 2KJWA 5KFVA 2DNZA 2MHEA 4HHUA 1EETB 4KPCA 5HL7Q 1RT5B 2NXCA 2OFGX 5F3ZA 4KV8B 2CXEA 4CNYA 1Q0NA 3KFWX 5F8IA 2GFFA 2RS2A 2AZ3A 1RZMA 2GMJA 1EX8A 1S0MA 1CULA 2RNEA 2N7CA 3J81j 4ECYA 2PIIA 3PX0A 3K5NA 3UCZP 3GJRB 3VWSA 3IG1B 1S6QB 2DBBA 2VPYB 1TL4A 4GRSA 3UVJA 4F4WA 1NO8A 2V4JB 2HNZB 3M1VA 1BGXT 4OYXA 4FVMA 3CO9A 4B3RF 3RG6A 1W2IA 2CQPA 2WVEA 4IG3A 4LQ9A 1N5VA 4LBPA 2E5LJ 1EARA 2CNKB 4TY8B 4X65F 2E1RA 1I94J 2EXUA 3OW2R 2HBZB 4IYQA 2M3DA 4RNOA 4JI0F 4JUZA 2HHQA 3CD0A 3BGOP 1D9FA 4JI6J 2Y0SD 3EXCX 2JZ5A 4WIIA 4WU2A 2QA4G 5HP1B 4DL3A 2WBRA 1L3KA 2PSZA 2XLJA 1UVJA 1HD1A 1UVKA 3ZTRA 1FWLA 5F9NA 4LF7F 2QGFB 1UEVA 1YJRA 2JSXA 3CULA 4DZ6A 4HT7A 3MR6A 2GVZA 1V5IB 3C2PA 1IKXB 2DR7A 1ROFA 3MFHA 6AT1B 3RTVA 1LKZA 5T7LB 3AQOA 3DGPA 1ZM2A 1NAQA 4C8LA 4DUTA 5KT3A 3UD4P 3H5UA 2HZCA 1MN9A 2AEFA 2UU9F 5KT7A 4J9NA 3PEJA 3MAAA 3MMCA 2Y1JA 3DLEB 5LSRA 5JMNA 4C6AA 3CDAA 3IBWA 1I6JA 3H25A 3WDOA 2ZC3A 3ZTOA 3M8ZA 4FYXB 4NLOA 1KSPA 4CO0A 1HA1A 3DLBA 3I4PA 2NS1B 3TVYA 1AT1B 1F1BB 3DU6A 3MM5A 4HR2A 3BN7A 4USIA 4UZCA 4RLEA 2QLXA 3MPDA 2HWTA 4F3OA 5HBMA 4ANDA 1VQ7S 5F3TA 3NWRA 4NI2B 3MUVP 1VR6A 2I1RA 1RTJA 1S1TB 3HKWA 4PUOB 1N34F 3G87A 4ZLLA 4O44B 3G71S 3QFWA 3U1LA 3RR7A 4ES1A 4QPTA 1PAUB 3C6TB 2KHCA 1PILA 5CH7B 1T11A 4DSIA 3LWMA 4DV0F 2ZE2A 3KK1A 5FJ4A 2XCAA 1FRKA 4JI3F 3CWJA 4KO0B 2C2ZB 2BACA 1TL3B 2CIMA 4HL9A 5K5MA 1ZA1B 1BY9A 2MKCA 3I0RB 2ASYA 3PW5A 4RW9A 3MMAB 5AXKA 5GMDA 2SXLA 3FGVA 2OPQB 3QSIA 4IQMA 4CLSA 1AXQA 5CXTA 1P8GA 1EETA 1RT5A 1Q5VA 1P1LA 2ZVSA 1S7HA 4KV8A 4CIOA 4X62J 5I4MA 4DV6F 4DSFA 5CA5A 4NRUA 4ZVOB 3C8YA 4K5RA 2B4PA 2ZH1A 1MN7A 1PYTA 3GONA 2BXJA 1N54B 2DNNA 4YDXA 4ZN3A 5DGAA 5EDWA 2F8HA 2QMUB 3IG1A 3AA8A 1S6QA 2UUWA 4DPTA 3LQVA 4XPCA 2LU1A 2MQMA 2V4JA 4C11B 2QYCA 4K4TA 2XLIA 3EM1A 2EC2A 4P2XA 1S4FA 1YX2A 2BA9A 1DQ9A 1HBUB 2FPHX 4URQU 4G1IA 4WK1A 2POKA 3ZZTA 1A6LA 1H7XA 4TY8A 5F8GA 2QN6B 1U24A 4CO5A 3T1HJ 1PSDA 3T19A 1HFEL 1XR6A 4DR6F 5K9FA 3VR1A 2HFOA 5KT5A 2QA4S 2DK2A 3D67A 1VJQA 3N0VA 4KFBB 2KKHA 1KOOA 1PGZA 2Z57B 4QJVA 2RH3A 4Y28C 1RWMB 2ZH2A 1GTEA 3NNAA 1X9SA 5DLFA 5F8HA 3KNGA 4PWWA 4Y2MA 1SJQA 4DG1B 1OY6A 5H1SV 4WPAA 1IKXA 4LF8J 3TR5A 1TP7A 2A18A 3TVKA 1M5VC 5DDQC 2XMVA 2AT1B 4NMLA 2CJ9A 2HVZA 3SCJE 4DR4J 2BE7D 4DOZA 2LA4A 2W01A 3PIPQ 3BDEA 4F3QA 3KLVA 2DPIA 4EYIB 2UVUA 4NXNF 3GSDA 4ZP9A 1MSWD 1X4AA 2ZWOA 3TANA 2MKSA 4CLFA 3OL8A 1RT4B 4RKUC 3Q23A 2H4YB 1OY9A 3CIMA 2GGPB 5KFXA 3HHLC 1XMBA 3GJSB 3PRDA 1Y3KA 3DM2B 3Q83A 2QRRA 1SV5B 1RWNB 1FVSA 3CCUS 4LVNP 2GIRA 2B9WA 1VBZA 4WKRA 2FZKB 3MHYA 2ADCA 3RB4A 2YWFA 1VYAA 5DQGA 1P9YA 1BWVA 5GAEI 3WC2A 2FJDB 3FZ2A 2IRYA 4X4RA 1CQNA 2XMUA 1OPIA 4X64F 4NI2A 4B3TF 1XEZA 2G2OA 4LFAF 3TA0A 1S1TA 4PUOA 1FK9B 4O44A 3IWLA 1WEXA 3C6TA 3BN4A 4K4ZA 4NASA 2IDLA 1SIZA 3MR7A 4DCOB 1LWFB 3DLHA 3T6JA 3DDIA 2B0GA 5KG4A 2DT9A 4N7TA 5F8NA 3EPGA 2HFZA 2C2MB 4RW6B 4JI7J 3ZZ0A 4KO0A 2AD9A 4O3NA 1KC8T 1NK5A 2OD6A 5CHCB 2LQJA 5KFIA 4K2XA 2HRYA 4A46A 3R3TA 2RKIB 3I0RA 2AU0A 2W1BA 2EVZA 2YKOA 3MMAA 2B3TB 4BLGA 2OPQA 4I7FB 3WC0A 1R43A 2CPZA 2M52A 2XBPA 4AYBD 1T94A 3UW1A 1ZYQA 5GAGI 4L75A 2ZDPA 4ZITA 4OHXA 4WP9A 3LF0A 3P5BP 1QVFR 1HI8A 4U8YA 2VKZG 1RHJB 2C3MA 1ZETA 5HMYA 1SH0A 1VMBA 4ZVEA 4LJMA 3UDCA 3RRGA 1S10A 4CNZA 3OR1A 5J2QA 2YTCA 4MK8A 2YNIB 2Z56B 2W9BB 2JEIA 1UTAA 1AW0A 1TFYA 4C11A 2FJWA 4CWBA 3QWPA 4NLSA 3FCVA 1C1CB 2Z2YB 4YDDB 2N4DA 3RR8A 3NEKA 2W8KA 5KFMA 4A8OA 1HBUA 3MD3A 3AAWB 4ZPAA 2ZBIA 3O6QA 3QQCD 3W3SA 1NZAA 3VCDA 3BSCA 1KQKA 4F50A 1RE1B 3THVA 2YBVA 5ETNA 4K4XA 3EGZA 3KMQA 3QNWB 4LF4J 5HANA 5L8RC 3TUIC 4DV4J 1UFWA 2C2KB 2DH8A 4WYWA 2HWIA 3LAMA 4KFBA 1UPPA 1X60A 2P6SA 4Y2AA 2XNRA 1VK3A 1WTFA 4AL7A 1B70B 2G0JA 1F3FA 1Z1ZA 2XGPA 5A2QU 3QAUA 3TVZA 1IR0A 1HNWJ 3CDUA 2DR5A 4DG1A 2IMOA 3SSSA 3A13A 2VBZA 2XY5A 1NK8A 2MY8A 1JLGB 1VBYA 1U6BA 2DHAA 2VV5A 4U7UD 4DF8A 1HWUA 1RU2A 4KH0B 3DOKB 5ETPA 1HQUB 1S5ZA 4DCJB 4JV5F 2DY9A 4ED2A 2ROPA 1N5QA 1YBUA 3M6XA 3JQMA 1RT4A 2UUAJ 4B08A 2E5LF 2V0NA 3ETMA 2GGPA 3PYGA 4ENOA 2CJAA 2Y9HA 5J2MB 3D1OA 1SV5A 1OY8A 2Z8QA 5KFWA 3DLGB 1FEEA 2VQEJ 2HHTA 1HNVB 3A12A 3N6NA 1EHWA 4WP3A 1KD1T 4JI6F 1MMDA 4HTJA 4QYZK 4DL6A 2WBMA 4PYAA 3H8YA 4J9OA 4NCBA 2ZKUA 3M2UB 4N41A 2RILA 4M1KA 1GMWD 4PXEA 1U1OA 3IAM9 3RAQA 4ECXA 2E1AA 3BR8A 1FK9A 3W9HA 3I9ZA 2DH9A 4AL6A 3ZNUA 2UUCF 1FVQA 3CCTA 2RB7A 5C25A 2CJBA 1T0TV 1FD8A 1HL6A 5HO4A 4MYTA 4B9NA 3I9V9 5HMWA 1NPPA 1LWFA 1OQ6A 4NXMF 2COLA 1NJIT 3MTKA 1NB7A 3IGVA 4RW6A 3LANA 4KHPJ 1I5OB 1MG7A 1H3DA 1WEYA 3FFIA 2QSWA 4Q7AA 2RKIA 3ISNC 1R31A 3VGSA 2B56A 1KQSR 1C2PA 2IYIA 1IWGA 2YQ0A 1LV5A 4KHRA 4I7FA 2YPZA 2MGZB 1U8SA 3CC4S 1U0HA 1X5TA 5M2RA 5IZHA 2PE8A 2HIQA 4HI1A 3SDEB 2XEXA 2JVOA 4Q8FA 2V67A 1VJWA 3ZFVA 5IT0A 3EGNA 5KFCA 4TU9A 2J0WA 1KR4A 2V9WA 4FN5A 4ZKAA 3DRXA 4FNHA 2MZTA 4OYZA 5LOQA 1DRZA 3D7SB 1DHMA 3QGGA 2ZFHA 1T9YA 2XS2A 3B54A 1R3NA 2W9BA 3TX0A 4WXOA 2JEFA 1H73A 1U47A 3AH6A 4EU0A 3TWZA 4G1QB 2CQ1A 1C1CA 5L1KA 3H5SA 3PCOB 1KHWA 3KJFB 1LXJA 1N36J 2BW7A 1NSPA 3E01B 4PG5A 4WTOB 4ZK7M 2DHSA 2GZOA 1UL3A 2NXNA 3GR0A 2OAUA 3W2VA 4JI1J 3M05A 4LRBA 1RISA 5KFOA 3OL6A 1D0EA 3NBPB 1CJVB 4O4RA 2W7PA 4W98A 3ZNJ1 1KLMB 2W4DA
chains in the Genus database with same CATH topology
2AYMA 4A8XA 2O66A 4QIVA 5EWEA 1R8BA 4ID5B 5J2PB 4K4WA 5DG7A 2CQCA 2CQDA 1MWZA 2V5HG 1X5OA 5G4DA 2VG5B 1VGYA 3ITHB 5DDRC 2DNYA 4ILRA 1HBOA 1K9MT 1G1XA 1KN6A 2JEGA 1U25A 3Q8RB 1DTTB 2K7JA 2MKJA 3PKMA 4ECSA 4FF3A 3NGKA 2DGSA 4HDHA 4N77A 1TAQA 1UJ5A 2L41A 2MJNA 2ASDA 1N0VC 2UUAF 3GFYA 2RRNA 3P96A 2Q6BA 4ZPVR 1X7VA 4EYHB 3MDFA 3VQSA 1AFJA 1X9MA 2UZAA 3F44A 1ZBTA 3KLIA 3ZZPA 4D3GA 1LXNA 1SQEA 2VFTA 1JJ2R 2EK1A 1TQLA 1MU2B 2GMHA 3CE8A 4K4UA 1LW2A 4YFUA 1TL3A 4OZ1A 2NXUA 3PXGa 3DXBA 4GO5X 3M32B 3JSRA 5DG8A 3TARA 2YKPA 1JLGA 4FYDA 2EI5A 1HWLA 2GCFA 4ECTA 3HF5A 3BS9A 2VQEF 3OTEA 2B5JB 1OPZA 2KXFA 4DN0A 1S9GB 4A47A 5C24B 2CQIA 2L9NA 2MZSA 2O3DA 4RW8B 2BBEA 2W7AA 1T05A 2CPXA 1N88A 3TYTA 2AW0A 2ZNZA 3R1HA 2M4MA 2KJVA 3PIOQ 2DR8A 1FDBA 1GTHA 3NLCA 4FBTA 4J9QA 3DOKA 3LOUA 1Q78A 1VQ9S 3K7RA 1HQUA 3IO1A 2XO7A 2VL1A 1Q7YT 1UP1A 2DHGA 1NJXA 3GG1A 3MEDB 4DV1F 4HYKA 2QEXS 1L5UA 2JFKA 3LP0A 3Q2TC 3RAXA 5D3GB 5KFAA 2FVRA 3I6PA 2DO0A 5LJ3Y 1S9FA 4ZP6A 3KLHB 1M5OC 4TYAA 2Q1LA 3RW7A 4OL8A 3ZZOA 5FLXY 3PZPA 2BE2B 4X2BA 4WE1B 4ED0A 3GE9A 2BM0A 2CVEA 2DCUB 1N0UA 1S1UA 3BJYA 2ZOFA 3K57A 1E6VA 3HVAA 2CDQA 4NCAA 4ZCIA 1R8PA 3V81B 4J9RA 2AJ1A 1DARA 1FTRA 3NS5A 3TAQA 3I4HX 2FUG9 2DISA 3M6VA 5K14A 3LWLA 2HNDA 1QE1A 3CXCR 4DS4A 5JJBA 2C2DA 5CYQB 3CCMS 3DOMA 1SJ3P 2HYIB 4OJHA 4X4QA 1JXLA 1IKVB 1NH8A 1O51A 2EG1A 4Y65A 4M95A 2ZHAA 4DQRA 1FDAA 4M5DA 4MIAA 3KK3B 3CJKA 2C22A 4N47A 4CTAB 2ZNYA 5KFFA 4YR2A 5J2MA 3RBDA 3VAJA 1O8BA 1N5TA 1Q8IA 3C66A 5LMUF 1H2VZ 1JLBB 4CI0B 3NKYA 3DU5A 3J7YU 1UVNA 3POTB 3K5LA 3S7RA 3DLGA 3CCWA 1JLEB 4DSKA 5U47A 2F9DA 4B3SF 1HNVA 2ROGA 3OFFA 2QT7A 3KG0A 2PMHA 2C28A 2R8KA 2BJEA 4P7TA 2DH7A 3MPYA 4U7CA 2B9XA 4R5PB 5A8RA 4KHPF 2E66A 3MAHA 5KFGA 3QJJA 3BGRB 2YKMB 1M5KC 2CQGA 1TKDA 4Q0BB 1J5OA 4TXSA 4C9DA 2RIJA 1N8RT 2HNYB 4FPRA 1HQEB 1ZAVA 4Q2LA 5DO2A 3TNVA 2OMLA 5AE1A 2D3ZA 4NCGB 3PFOA 4QW9A 3FSIA 2YKAA 1WTBA 4X4NA 2JH3A 2VASA 4RWWA 2HS3A 2E1CA 5H9FJ 1A7GE 4O3RA 2BDPA 4MKYA 5E3AA 1WNEA 3LP1B 4G1PA 4N5SA 4OJ3A 5D4NA 3DMJB 3CJ4A 2DIUA 3HI9A 2YNGA 2B6AB 4C3LA 4ECWA 2D41A 3D1QA 4RW4A 5B0DA 5LSLA 1LOUA 2NR0A 1D9AA 4ILMA 1GXTA 2G1DA 3QMQA 4IFYA 5K8OA 1YJ9S 3QGHA 3N28A 3RU0A 1C4AA 2AQ4A 3BO3A 2IHR1 2HS0A 2DNKA 4URSA 3CJ3A 3MWBA 4E98A 3Q8PB 2O01C 4FXVA 4QR1A 4X66F 3E51A 2MXYA 4YR3A 5E41A 4MMOA 4IDKB 2XI2A 4F2SA 5I42B 1VQ6S 4LF8F 5B0CA 4DBQA 1EP4A 3IFEA 2IVFB 4B9UA 2L9DA 3OHAA 2YH0A 4AUKA 4IRDA 4K5SA 1WELA 4R8UB 4KB7A 3O5TB 2AX1A 3PRBA 3K5MA 3B78A 1VIOA 4NZ7A 5I3PA 4QYRA 3FRYA 1U48A 2DGVA 4BC9A 1JLCB 2FHMA 3HHDA 2KVIA 2KM8C 3TW0A 3TQ1A 2R8JA 2EFQA 4W90B 5IT4A 2IRUA 1K1SA 1JLAA 2E7WA 3DRSA 3LGNA 1JKHA 1S1WB 4MJKA 2GNKA 4MK9A 1FXRA 2ZH9A 1M90T 3FSXA 5A6PA 3ICLA 1WD6A 4M94A 3HP6A 3Q22A 1HHSA 1T03A 2E44A 5HLFB 4BC7A 3GFHA 1VOMA 2IVYA 4ATNA 2FVSA 3NAIA 3SYZA 4LSNB 4DL2A 4HTIA 2MQPA 2YNHA 4DS5A 1S77D 1Q16B 4PPDA 2IJFA 1KHVA 4IG3B 2VODA 4ED8A 1U1NA 4DSEA 3QGPA 1JNZB 4C8YA 1VBXA 2V8DA 2E7XA 4R0JA 1RYRA 1ZTWA 2XMMA 4HEA9 4ZHRB 1SB6A 3HDSA 4OI1A 3HZGA 5LL6d 3JYTA 3PO5A 2HHWA 1IUJA 1XR7A 1SI9A 1Q1KA 2NQPA 4QWAA 3MGJA 4OHWA 2UXDF 1TAUA 1SL1A 1H7WA 5DG9A 2VUGA 3CCQS 4OZ5A 3SDEA 4X4TA 2R2UA 3MM8A 1YQHA 4LSLA 2LXFA 4WJBA 3CMAS 2GV1A 2VPWB 1ZM9A 3JSMA 2ZH7A 1AROP 3L7PA 3DLKB 2M7SA 7FD1A 2CG4A 1E6YB 4PXDA 5D8HB 1OSCA 3NGDA 3S8SA 1N36F 4DFPA 2R7XA 2PGCA 2GHWA 4NYZA 4DQPA 4OZNA 1U1MA 3L09A 2IA0A 3KWMA 4PKDB 1TVRA 4C0OC 5J1EB 3PX6A 3T6BA 3DRRB 3C46A 2P9GA 1D8YA 4FP9A 3KLGA 1NU4A 1WHXA 1G6BA 4ECUA 2ZHOA 3JTNA 4IH7A 1X4BA 3UR0A 3VAGA 2HFNA 3HHLA 1WF1A 3B4MA 4DLGA 2ALZA 4RBUA 5C42A 3CGIA 2C3OA 4C3MA 4WYLA 3BSNA 1VS3A 1Q7LB 2FVQA 2JHEA 3HVWA 4ZCKA 3M6WA 2CKWA 4KR0B 3OUYA 4HLBA 1RK8A 2J6UA 3IRWP 1GQEA 3K5OA 4HH1A 2MSSA 4ZPWR 1FNOA 1BC6A 2BM1A 3CEDA 1GX6A 4NX9A 5E2QA 3MUTP 3SI8A 5I3UA 3ISND 2IAJA 2E1MC 4F4YA 3OTOF 3LO3A 1X0PA 3M8PB 2QIFA 5KFSA 4C2MA 5IQ6A 2WK4A 4D3HA 3SCIE 4RNMA 3VZHA 4G1QA 1TKZA 5KG7A 2MQOA 3GIJA 4EFAC 3I0SB 3SFGA 3D28A 1YJNS 1WACA 1QUVA 2X51A 4WFXA 3SSQA 3DM2A 3E8OA 4OX7A 5F0UA 3VTIA 3MM9B 2UVRA 4N8OA 5AE3A 1HW9A 2KXHA 4YB5A 2WSEC 3KTQA 3HMJG 1HWJA 3ZZUA 2W9CB 5FD1A 1T02A 2ZH4A 3VAHA 4AFFA 5IWAF 1R27B 4EBDA 2IM1A 5GVQA 1FHTA 2FLOA 3TAPA 3AB4B 3KHHA 4TQSA 2ACYA 2KDOA 2Q79A 4P2SA 4ZDNA 1YVFA 2O1PA 3HHEA 3NRBA 1T8EA 2OJ3A 3HHKA 2VH7A 2IVMA 4Y2IA 3MR2A 4EO8A 1DFDA 2EPIA 1VQPS 1JNRB 4DQQA 2GO9A 1QUPA 3M2RA 1Q8LA 4J9MA 2EK6A 1KLNA 3E01A 1U2FA 3M8RA 3Q0AA 3IS9B 2HMIB 2ZD1B 5EX0A 4DR7F 2R4FA 3LGMA 4Q8EA 2KU7A 3N01A 1QTMA 3OR1B 3U7JA 5J2QB 2CFXA 3PACA 3QO9A 3JTOA 1FNMA 2ZH3A 3MMCB 2B4UA 3N79A 3DRPA 2KRRA 2YVSA 5B0EA 5F8MA 3L7OA 4KBIA 2XWYA 1LFWA 3M6UA 4O4GA 5KFQA 1HD0A 4ECQA 3JAMY 2HQIA 3BEGB 5DJBA 5DLGA 1M5SA 2CPIA 4JV0A 2J7WA 4I2PA 3CSKA 3JSBA 1RA7A 1VQNS 4QIFA 4MKAA 5D4OA 4DPOA 1KLMA 4HVZA 1G2EA 3K58A 2ZKT