2YTCA

Solution structure of rna binding domain in pre-mrna-splicing factor rbm22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
GSSGSSGEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor RBM22
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ytcA01
3CMAS 1RK8A 4OZ0A 1PO6A 3MUVP 3G71S 4YB1P 2MKIA 1NO8A 4LMZA 1UP1A 3SMZA 2XS2A 2RNEA 1SJFA 3S7RA 4FXWA 3B4MA 1M90T 2E5GA 2M52A 1AUDA 1ZZFA 1VQKS 4V19X 2CPXA 1WF2A 1KQSR 1H2TZ 1UAWA 1WI6A 2E44A 2NLWA 5IFMA 2FPHX 2AYEA 2MJNA 1CVJA 4CH0S 4WFBQ 4J5OA 5D77A 4F02A 2LCWA 2M70A 1D8ZA 2CQ2A 5DDRC 3UD4P 4ZKAA 1VQ6S 2BZ2A 4WCEQ 5H1SV 4QU6A 2FC8A 1OO0B 2QFJA 3CPWR 3TO8A 1VQMS 1M5OC 3R1HA 1JJHA 3EGNA 1VBYA 2MMYA 5GAHU 1U1PA 3MD3A 2M88A 2XB2D 3J7YU 4WIIA 2G4BA 3SDEA 1SJRA 2N82B 3UD3P 1H2UX 2MJUA 2FY1A 2YTCA 3G8SA 2DGQA 2KRBA 2CQ1A 2MQOA 1X4GA 2CPZA 2BOPA 2ZJRQ 3G4SS 2CPIA 2GHPA 1F9FA 3IWNC 2DNHA 2EVZA 2VOOA 2XNQA 3NS5A 3CXCR 4RU2A 3US5A 2M8DB 3L3CA 1S72S 1WEXA 3U1MA 1YJ9S 3CCES 1O0PA 1WWHA 2LKZA 2MZTA 4F25A 2KM8B 3MUMP 4YOEA 5DDPC 2LA4A 1X5PA 3UCGA 2CPYA 5DM6Q 1WELA 3FEYB 5LJ5Y 2CPJA 5ITHA 2K8GA 1JMTA 2MKSA 1B7FA 3CTRA 1Q7YT 2KH9A 2EK6A 3CD6S 2EK1A 1A9NB 5HL7Q 2RQ4A 1WG1A 4WFAQ 1VBXA 2DISA 1X4CA 2U1AA 3VAGA 2E5IA 5JVHQ 1X5TA 4TLQA 1VBZA 2RRBA 1WG5A 2MQMA 2DK2A 3ZZYA 3PIPQ 2SXLA 2OTJS 3UCUP 2X1AA 4F26A 1S79A 3S01A 1VQ9S 1WF0A 1X4FA 1P27B 4IOCQ 1DHMA 2DH9A 4PR6A 2DNGA 2MQPA 3MUTP 3BO3A 2MKHA 1OWXA 1K8AT 1X4BA 1R8PA 4C7QA 2DHXA 3CCVS 1WF1A 2WBRA 2MKJA 2DHGA 4UY8T 2CQGA 2LECA 3NMRA 2KT5A 1FT8A 2J0QD 4C0OC 3CMES 2XNRA 1OPIA 3I55S 2E5HA 2CQCA 1X0FA 1VQ7S 3EX7B 2KVIA 2MKKA 3MD1A 3MDFA 1YWXA 2LQ5A 1WI8A 3ULHA 1U1NA 1ZH5A 2DGVA 2KG0A 2UP1A 2KXHA 5FJ4A 4LIRA 2KXFA 2YH0A 1X4DA 4W92B 3HHNB 4FXVA 2KYXA 3CULA 1YIJS 5LSOA 2DO0A 4QU7A 2CQIA 2JVOA 4IUFA 2PE8A 2DNOA 1M5VC 3DXBA 2LEAA 2MZQA 2YWKA 1H6KX 1VQ5S 2HGLA 2OIHA 1VQ8S 2GO9A 1U6BA 2MHNA 1IQTA 2HYIB 1K73T 5GADU 2NZ4A 2VONA 2KI2A 2DGUA 3THTA 1Q81T 3OW2R 1DZ5A 2CPHA 2CJKA 5CYJA 2JVRA 3NNHA 5JVGQ 1U2FA 4M5DB 4UQTA 2MSTA 3LPYA 4YUDA 2ADCA 4WF9Q 2XSFA 2MKCA 3RW7A 1Q82T 4IOAQ 2RQCA 5EN1A 2DNMA 1HD0A 3CC7S 1X4AA 2DITA 2DHAA 2KG1A 3VF0B 3G6ES 5GVQA 2AD9A 2ERRA 2RS2A 3P49B 3NNCA 4Y0FA 3H2VE 2RRAA 2DIVA 1X4HA 2DGWA 1NU4A 2YH1A 5GMKa 4IO9Q 3B4DA 4PKDB 1FJCA 2CPFA 3I56S 3CCJS 1QVGR 2KN4A 2MZRA 1KD1T 2XS5A 3V4MA 4WKRA 1U1KA 1A7GE 2CQDA 2O3DA 5LXRA 1R8HA 2MQQA 2I2YA 1URNA 1U1LA 1XN9A 1SJQA 4A8XA 2MZSA 2F9DA 2OSQA 3HI9A 2MPUA 5IM0B 4CIOA 3CCMS 2G0CA 1WTBA 2DO4A 1YTYA 1X4EA 3S8SA 1WEYA 4EGLA 5IM0A 2A3JA 3EGZA 2L41A 5LXYA 1YJNS 5DDQC 2M9KA 2F9JA 1VQLS 2DNYA 2MQLA 2D3OR 3CC2S 3MOJB 1JJ2R 3LQVA 3CC4S 2RU3A 5D78A 1N8RT 5BJRA 1VQNS 1QM9A 1W2BR 2QEXS 2CQHA 3VAIA 2JX2A 3H2UB 2CQ3A 2Q79A 4WFNQ 1VC5A 5CA5A 4P6QA 3MI7X 2MZJA 3MXHP 2X1GA 2M8HA 2DH7A 1WG4A 1YJWS 1FXLA 2L9WA 2CPDA 1SXLA 2FC9A 2MGZB 1PGZA 3BEGB 2N3LA 1X5OA 1QVFR 1WEZA 5DDOC 3UCZP 3CCLS 2DNRA 3TP2A 1SJ4P 3SXLA 4TU9A 2MB0B 2MY8A 2PEHA 3VALA 2AYGA 1N54B 3VAFA 1VC6A 1KC8T 1U1QA 1OIAA 1WHVA 2DNQA 5DETA 4QQBA 2CQPA 2M4MA 2RT3A 3R27A 2DGXA 2L08A 2RS8A 3CF5Q 5DM7Q 2AYBA 3NS6A 1HD1A 1HA1A 2I38A 3N9UC 2DHSA 3CUNA 2FHOB 2DH8A 2J0SD 2N7CA 2CQBA 1KOOA 3JB9k 3BO4A 1YI2S 1FJEB 2AYMA 1M5PC 2G1DA 3G9CA 4LJMA 1UFWA 2HGNA 2ZJPQ 1SJ3P 5GAEU 2KM8C 3ZZZA 1RKJA 4W90B 1FJ7A 1M5KC 2LYVA 2HZCA 1BY9A 3UE2A 3U1LA 2K3KA 2KHCA 4C4WA 1U1RA 3SDEB 2MY7A 1YHQS 2LXIA 3G96A 2D9PA 1HL6A 3FEXB 5GAGU 1Q86T 3P3DA 2DGOA 1VQ4S 3THPA 2HVZA 2N3OA 2RVJA 1N52B 3MURP 3NNAA 3K0JA 2MGZA 2CQ4A 3D2WA 2XS7A 5CXTA 1FHTA 1X5SA 2LEBA 1DRZA 1U6FA 2VODA 2U2FA 1JJ4A 1VC0A 3VAHA 2QA4S 5IQQA 1ZZNA 2KXNB 2HGMA 3BS9A 3CCRS 2RUGA 2CQ0A 3VAJA 3J7ZT 3BO2A 2DNLA 2M2BA 5LSLA 3TYTA 2ZJQQ 3UWTA 3P6YC 1KOHA 2CPEA 2OTLS 1N88A 4U67Q 2OSRA 2B0GA 4ERDA 2V94A 3VAMA 1FO1A 1VQPS 2KFYA 1U1MA 1L3KA 3VAKA 2DGSA 3P5TL 2X1BA 5LJ3Y 4QPTA 3RW6A 2MSSA 3PIOQ 1DBDA 2KU7A 2D9OA 2DB1A 1UW4A 2VOPA 2J76E 3G8TA 2M7SA 3DLLQ 2OJ3A 3R1LA 2MYFA 2M0GB 4ED5A 1WHXA 3CCUS 4OZ1A 1NJIT 1P1TA 2X1FA 1YITS 5HO4A 1U1OA 3Q2TC 2LA6A 2LXUA 4CQ1A 1WHYA 2DGTA 2DNPA 2KRRA 4Z2XA 4BS2A 2J8AA 4Y00A 4PRFA 2JWNA 3Q2SC 2DNZA 1VQOS 2MZ1A 4TU7A 2JRSA 2MQNA 2YKAA 2DIUA 5MLCV 1H2VZ 1K9MT 3CCSS 3CCQS 4TU8A 3IRWP 1M1KT 1D9AA 2DNNA 2DNKA 4CH1A 2F3JA 1FNXH 2ADBA 1G2EA 2E5JA 2LMIA 3S6EA 1WHWA 2MXYA
chains in the Genus database with same CATH superfamily
5G4DA 2JEJA 4ZA1A 5D8HB 2XG8A 1OQ6A 4OZ0A 3AH6A 4C3MA 5KG5A 3FBFA 8ATCB 2E1MC 3IAS9 1YJTA 1QJHA 3R9LA 3C3LA 3FKBA 1QAIA 1RB0A 5KG3A 1RT1A 3G71S 4MIBA 3KDOA 2XYGB 4ZVTB 3FGVA 1WACA 4DFJA 3DMJA 2RMLA 4DV5F 1CULA 1CS4A 4FXWA 3CB4A 4I7FA 3DYAA 2XO7A 3C8YA 3W9JA 4DV5J 1T03B 3PRBA 4KHPJ 3LGMA 5KFQA 3NGKA 1Y3JA 4V19X 2HRTA 1FVQA 1FRHA 4DPOA 4K5SA 3W64A 3S1TA 1S1XB 3NL0A 1WI6A 2V34A 3CGIA 5B09A 4UOGA 2Y0SD 3Q0AA 1CQNA 1TL4A 5C2CA 2FGOA 5DJBA 4C97A 2BANA 3CDUA 4YEAA 4ATNA 1IR1A 3ETMA 3GYNA 2FJVA 5L1LA 4OI3A 2BQRA 1JLQB 2QE5A 2QLBB 1R43A 1XJWB 3DDIA 1S6OA 1IN0A 4ZP7A 1EZZB 2P5VA 1TK5A 4GKJF 4FZVA 3BKFA 4KHRA 3KK2B 3H59A 4J5OA 4YOEA 1WKLA 1RQ0A 1D8ZA 1GNKA 3E2EA 3G8QA 2CQ2A 4R0JA 4F4YA 3H5XA 1VQ6S 4LBPA 4LF4F 4USJC 3AY0A 5K5MA 2FC8A 2OGUA 2H9ZA 2MTLA 3BSCA 3C66A 3HHLD 2YKPA 3RBXA 4LR7A 3CSKA 1NK4A 3TQ1A 1ZM4A 5A6WA 2YNIB 2Z2MA 2JLFA 4QYZJ 4KY3A 5HJYA 2I1RA 1T9TA 2J5AA 2HHQA 2KFNA 5JXSA 3MECA 3V6DA 2Y9HA 1JK9B 4A8FA 2CJQA 4FXDA 3Q24A 1T3OA 1J5EF 2E7WA 1V6HA 4HDGA 2ZM6J 3W1YC 4Q0BB 2MLYA 2H4WB 5CHCB 3J7YU 2G4BA 2XMWA 2ZHAA 3C19A 1TL1B 3B6BA 4LF8J 1TUVA 2FY1A 2C42A 2FUG9 2YX7A 2GIFA 2NYHA 3KJQB 1TV6B 2E29A 2KRBA 3OFGA 1BXNA 4H4KA 3ZTQA 6FD1A 1MWYA 5IQ6A 4DR7F 5B0FA 5KT6A 1W26A 3G4SS 1S6PB 1GMWD 3FRYA 1IUJA 2C2EA 4A46A 1F9FA 2JH3A 4LFBJ 2DNHA 3RB0A 1HMVA 2IBOA 3CVKA 2HWIA 1SL1A 3PO5A 5EWEA 1TAQA 3ZTOA 2UVUA 3UN3A 2BJEA 3NY0A 1DLOA 3RU0A 1HHQA 2RKIB 3US5A 4EMDA 4L76A 2NREA 4ZN3A 3L3CA 4RW8A 1HWJA 3OSPA 3TA0A 3U1MA 4ECWA 3TVKA 2HNZB 4HDHA 2NXNA 2MZTA 1IKVB 1RT3A 2QLXA 4F25A 1KVIA 1M5SA 1DAXA 5DDPC 1RTIB 1X60A 2LQBA 2W2OP 2WBMA 4DPXA 2OKQA 5DM6Q 2BE2B 2H54B 1RTIA 3IXQA 4KRWA 3R7SB 1ZA1B 2NQPA 2HW3A 1KSPA 2CPJA 5E2QA 5ITHA 3R5BA 2PEBA 4JI4J 3RJMB 3FQKA 2WSCC 5FDLB 4PXBA 2K8GA 1JMTA 1HNZJ 1Y3KA 2HS3A 1CJVB 4RW8B 2XMVA 1IM6A 5KFMA 4NCAA 2EK6A 3QNWB 4F36A 1O51A 3CD6S 4CO2A 1VBXA 1WG1A 2BUNA 5BYSA 4O3QA 3EGWB 3VGSA 4U96A 4Q8FA 1NNDA 2U1AA 4C3LA 1S6PA 2E5IA 4ER8A 3HP6A 5IT0A 4RW9A 3Q23A 1LWEA 1RWXB 2GNKA 3DHWC 4H4OB 2HZAA 3V4IA 4ECYA 2RRBA 4LFBF 1S6UA 1WG5A 2FTRA 3TZZA 1R8CA 2DK2A 3PIPQ 4NASA 2FYXA 4PEOA 4V1Ak 1JNZB 4NLQA 3SCJE 1GH8A 1R3NA 3TUPA 1A0OB 4TXSA 4K4UA 1T9YA 1TK8A 2O67A 3RW6A 1X4FA 4NWBA 1U2CA 4NLTA 2EBEA 1IKYB 4P52A 4GO7X 2DNGA 2NXUA 1YJRA 4EUVA 3LF0A 4ECZA 4IQMA 4NCGA 4DR4J 4WZMA 4RW6B 3MECB 3V6DB 3V2UC 1R8PA 2DHXA 2AT1B 2ZH7A 4J9VA 4DJBA 4B3OA 1HLWA 4AQYJ 4LT6A 2WBRA 3PR4A 5DZ7A 1U0SA 2MKJA 2OAUA 3M1VA 4B17A 2LECA 2KT5A 3NMRA 1FT8A 1P8GA 3FC9A 1NK5A 1HKAA 1WTFA 4AL7A 4DXLA 4A47A 2DEJA 2VG6A 3FBBA 5GAEI 1RAJA 3CCZA 3I55S 1VQ7S 3MOZA 2HHTA 2KVIA 3B54A 2MKKA 2W25A 5J2NB 1LW0A 3H5UA 4ZLJA 1TK0A 3R5AA 1RT2A 1SV5A 2MHEA 2V8DA 1LFWA 1LW2A 2ZFHA 3MMBA 4IKAA 4PPDA 1NH7A 4OX9F 4PG8A 3M9NB 1L5UA 3T1AA 2VJVA 2E1CA 1VLOA 2A6OA 4ZIWA 2O1PA 3QPIA 4DUZF 1IBMJ 4OFZA 2K06A 2Z4PA 2YKMA 1X31C 1YBAA 1RU2A 2IM3A 4LIRA 4NI2A 3GQCA 4M1KA 5HBMA 2XY5A 2AV5A 4JV5J 1FCAA 2X7IA 1I3OB 4IR1A 1VBKA 2C3MA 1CBKA 4K2JA 4WYLA 2KYXA 5LSOA 3EICA 3FUYA 1T7PA 4LBIA 4GMKA 1RWMB 2F8HA 2KVQE 1IWGA 3LAMA 2DKOB 4AXIA 4F4AA 5KFJA 1DY3A 3HHLB 1RHJB 2Y0BB 3C6UB 4TY8B 2GIRA 2HVHA 1UETA 3JTNA 2DNOA 3ELHA 3OT9A 2HG4A 3TEHB 3DXBA 5IWAF 4DQQA 3K5LA 1N6QA 2CJYB 3G82B 3H42A 3TAMB 5EUHA 2BW7A 4O3NA 4LSZB 4HTIA 1YRTA 3HJVA 4D3HA 1S9GA 5CH7B 2OIHA 2D41A 1HW9A 2D69A 1CSJA 3ZZTA 4CH7A 2XMKA 2FHKA 2HQGA 1EQMA 1K73T 1CJTA 4UUWA 2MDAA 1FTRA 3ZO7A 2V4JA 3MAQA 1YZ7A 4GVLA 3E51A 4KB7A 5E3AA 2OPPA 4C48A 3H40A 1YRXA 3C2PA 3OW2R 2FHMA 2VFTA 1ZH5A 3SQGA 3I0SA 4O23A 1NKCA 3PJ9A 1X9SA 2UU9F 1QUVA 2JVRA 4GKKJ 4I2PA 1SBRA 3MMCB 1HHTP 1ZM3A 4DZDA 2FY8A 1XR5A 2PIIA 2MSTA 1CJUB 2JFDA 1JLAA 3HVTA 2F4FA 1OS5A 1FKOA 2HHHF 4QOTA 2MLXA 1S5ZA 2B6AA 2M3DA 4RBTA 2GHWA 3BBFA 4IOAQ 1RA6A 4RBUA 2V4JB 1JJCB 2DHAA 1UPPA 5U47A 3EZOA 1PC5A 3VF0B 2P6SA 2NXJA 2AD9A 3D6FB 1R6YA 1RCOB 1S9GB 4ZJLA 3GIKA 5LMNF 1C1BA 1JLBA 2RRAA 3NNCA 2IRYA 2K7JA 4DN0A 1RWUA 2DGWA 4USMA 1T05A 4EBDA 4O3SA 3EJMA 2HHVA 5GMKa 2HWHA 4IO9Q 1RT6B 4K4SA 4DQIA 4M5HA 2CPFA 2OPRB 3MM9B 4AYBD 4N41A 3HHLA 2KN4A 4F8RA 4P74A 1SQGA 5IS2A 4ZOSA 7FD1A 9ATCB 4B3MJ 4U8YA 4MFBA 4IYQA 2B4VA 2XS5A 2VHGA 3H7HB 5KFWA 2NPFA 3IBCB 1H7WA 3IBFB 1U1KA 1A7GE 1F0XA 2CQDA 2HQDA 2K7KA 2O3DA 2OP5A 2RILA 1R8HA 2W2NP 3GSDA 3TX8A 2MQQA 4DF8A 2I2YA 2BQUA 1FD8A 1SJQA 2VPXB 3DN9A 1U1LA 2IJFA 2KYZA 3EE3A 3A12A 3MM7B 4IFYB 4ZVHA 2W9CB 4HACA 2B4OA 3A3PB 5IXUA 2ALYB 4K4WA 5IM0B 4CIOA 4C8KA 2G0CA 4JI8J 2VIHA 3MMBB 3M6VA 5E41A 2WZ1A 5EHHA 1HNWJ 2P8IA 3TZWA 3GZ7A 2DTJA 4DLGA 1X4EA 1O8BA 2PMHA 3S8SA 4C8MA 4LFAF 3TVYA 3PG9A 4ES3A 1RYRA 2WCXA 2IIHA 2PMWA 3CJKA 4EI2A 5A8RB 1XMQF 5LXYA 5DDQC 3ENQA 2M9KA 2F9JA 2JLEA 3QSIA 3KLGA 3KLVA 1VQLS 2D3ZA 3J7A1 1FFWB 1S7IA 2MQLA 1D8YA 3T3FA 1UJ5A 2R8KA 1HQEB 4LFCJ 2FLOA 4O4GA 3RUBL 4B9TA 4KKOB 1HNVB 3M2VA 1W25A 2WK4A 3BREA 1U8WA 4NCGB 1F5AA 3MM8A 1CLFA 2BVZA 1XERA 3OD2A 1S57A 1XWLA 4Y2AA 2R8HA 2D3UA 1NDLA 2VFSA 3M8PB 2CQ3A 3VVTA 3K59A 2UVRA 1VC5A 1Z2LA 2OUGA 1Q8KA 5KOXA 5KOWA 3GILA 2X1GA 2GO8A 2DH7A 5CCMA 5F8GA 5KFOA 3OLBA 1RBOB 3GB0A 4NXNJ 1NHVA 2J7UA 3AB4B 4KGZB 3TA2A 2R7VA 5K8NA 3NCPA 2XLKA 2MQ8A 3LP1B 4O3OA 1TKXB 1UVJA 5F9LA 4CO0A 4OYIA 3T9NA 4DV6F 1RUSA 5M2RA 3OLAA 3IR5B 4ILMA 1KHVA 3UQSA 4BC9A 3SXLA 4TU9A 3NCQA 2JSXA 5FDLA 4WU2A 2IPOB 3QIDA 2W1BA 1N54B 4J9NA 4A8QA 2I5JA 1L3UA 1RWWB 1VC6A 3OR1A 1U1QA 2JEIA 2VFUA 2R8JA 4GC7A 1YKWA 1I94F 2WW8A 4QQBA 4LSLA 1EETA 1JLGB 3NBPB 3W9HA 2RT3A 5DETA 1SI9A 5HROB 1KDNA 1S1VB 2DGXA 2RS8A 3V81B 3MPWA 1IBMF 1HA1A 1RT7B 3N9UC 4WKYA 5K20B 4F3OA 2FHOB 2XI3A 1Q78A 1G6BA 2DH8A 4YR0A 2J0SD 2V2QA 1O6XA 1RCXB 1W2IA 1PBUA 4HL9A 3W2VB 2GAHC 5GAHI 3X3UA 1M5PC 1EX8A 2E7VA 3HKWA 1Q8IA 4TYAA 4OLOA 3VHQA 3GV8B 2UUCF 1TTHB 3BDPA 4ALZA 1GXLA 3Q83A 4X65J 1RU1A 4W90B 3PFOA 1N4LA 1T02A 3KLFA 1ZETA 5GMEA 1FTCA 2ILZA 5E0OA 2MEWA 5K8MA 3UE2A 4Z37A 2K3KA 2KHCA 4LF4J 4XTTA 2CVIA 2YKNA 1U1RA 5I42B 5B0GA 2ZWPA 4DCPB 3HF5A 4NOHA 5CZVA 3MMJA 3D67A 5E3RA 4CZCA 4K7QA 3HSZA 3J7YI 1QD1A 2QL5B 2XWYA 3DOMA 1JLFA 1HQ2A 3QO9B 3THPA 3M2RA 3LO3A 3Q89A 3Q8YA 4O44A 4NPOA 2N3OA 4K50A 2RVJA 4QYZK 3SCKE 2HVEA 2OO4A 3CWJA 1URRA 4DV7F 3SZ2A 4ECUA 2NUUG 5GADI 3MFIA 4U7UD 3N5BA 3DI6B 2ZBCA 2NR0A 1O5JA 3NNAA 2MGZA 1S48A 4OHYA 5J2MA 5CXTA 1X9MA 1FHTA 2NZCA 3ZZPA 2ATCB 2RSQA 4NEZA 4ANDA 1F5BA 2X3DA 2OD6A 1X5SA 4Y2KA 4R0EA 2BYCA 3KJVA 3CCTA 4OZ3A 1HBOB 3GFXA 2Q1LA 5IQQA 1UW9A 3BH6B 2HGMA 1RT5A 3H25A 3CCRS 4GC6A 2QFIA 2RUGA 3GU0A 3UPFA 3AB2B 2CDQA 3LP2B 4KQZA 4HVZA 2RDJA 4I0WA 2M2BA 1Z2ZA 1KONA 1HBOA 2VPWB 3DNCA 1N5TA 1VRQC 1F3VA 2YWHA 4LQ9A 4I2QB 4YB7A 3MR3A 1RHQB 1YLXA 1EJ7L 4RU9A 2OHDA 1HARA 1HBUA 3P6YC 4N76A 3IM8A 4M5LA 4YY3J 3IBWA 4X4VA 3W65A 2OSRA 3I82A 3IC1A 2JC0A 4PCQA 2RB7A 1R31A 2ZKUA 3M6XA 5F8HA 4I7FB 5KT3A 1FO1A 5ETPA 2LQJA 3RYLA 2KFYA 3VAMA 1VQPS 1CULB 1L3KA 5ETLA 4J9RA 3D0HE 4ZHRA 2DGSA 1UZHA 5LJ3Y 1AUSL 3OTOF 3IN5A 1ZM9A 1N36F 4IRDA 5D0RA 2J9CA 1LXJA 1Q5YA 1T94A 4OHWA 1F3FA 4IDKA 4ES1A 3MM6B 2ZNZA 2HQCA 2CJXB 2KU7A 3O1LA 4CT9A 2QN6B 2XCAA 3HCXA 2DB1A 5FIIA 2PN6A 4DV4F 4A8SA 3G8TA 3PEJA 3R5CA 4ZVRB 3DLLQ 2AP6A 3IS9B 3M8RA 4P2FA 1WOOA 3WC2A 4Q8EA 2OI2A 4ED5A 4OJHA 3K7RA 1TP7A 2L3MA 2R7RA 4X84A 1YG0A 4DR3J 5KAKA 4O3PA 3DRRA 5CZXA 3GSIA 3Q2TC 3ENWA 1QSLA 2BM0A 1WHYA 2LU2A 1U02A 3PYEA 4LBHA 4LVOP 4TQSA 2DGTA 4DL4A 2HMIB 1B4SA 1VJWA 2JFKA 2V9WA 4F4KA 2IC3A 3UO0A 3EVWA 2XEXA 2J8AA 1VISA 2BR0A 4MK7A 5LSRA 4KSEB 5BR8F 2JWNA 2VQEJ 5HROA 1DTQB 3SV4A 1RWNB 3NBPA 1NK7A 2MZ1A 4TU7A 5HLFB 2PI4A 2Q3PA 3N0VA 1DURA 2L9DA 2V67A 4ED2A 4DS4A 3OR1B 2H5JB 3BDEA 4OYBA 1UEKA 2YY3A 5DLGA 3ONQA 3OR2B 4TU8A 3FSYA 1TMMA 1L3TA 3AA8A 5THWA 1N0UA 4N8OA 3EGVA 2D1CA 3T5HA 3RR8A 1A6LA 1GQEA 3MEGB 2PMZD 2GCFA 4K5RA 2AX0A 3CO0P 3M8ZA 3W60A 2PI5A 2MXYA 5J2PA 5F9NA 3JSYA 1RK8A 3PJWA 2E1RA 3GIIA 1S4FA 4HKQA 1EHWA 2J9EA 2Q6BA 4JI1J 2CJBA 3BGRA 3IGVA 3MUVP 1K1QA 1UPMB 2ZD1A 4WU3A 1FWLA 3HLUA 4KV8A 3FK4A 4ANEA 3KXDA 1U25A 1UP1A 3SMZA 1HNXJ 4TY9A 5AXKA 2YBVA 5D3GA 2RNEA 4E2FB 2ZDOA 1R0AB 1FJGJ 2BEFA 2QMWA 2ASJA 1UKUA 2COLA 2GFFA 1P1LA 5C2GA 1AUDA 2HRUA 3M8YA 5L1KA 4DPTA 1H7XA 3GP9A 4USTA 2ZC4A 4DG1B 5LT5A 1HNZF 1ZAXA 2I9SA 5J1NA 1KQSR 1V5VA 3GIRA 1H2TZ 4G1QB 1JKHA 2PD1A 4KKOA 1NB2A 1G4CA 5IFMA 1HPZB 1SPBP 1OPZA 1S4EA 2FVQA 1NZAA 2FPHX 4NLPA 2M5YA 3PW0A 1B99A 3HJFA 3SBMA 2MJNA 1U8SA 1XK8A 4Q2MA 2Y8YA 2BE9B 2EEYA 3PACA 2XTJP 2XMUA 5F0WA 4ZVOB 3KLEA 3PW7A 3KLHA 1IBKJ 4WFBQ 4L75A 2IRUA 1C1CB 4KYZA 3WDOA 1R27B 2LCWA 4OV6A 2M70A 3C14A 4DV3F 1WC3A 1TL3B 3AT1B 4ZMMA 4H4MA 2KFZA 1RAOA 2BZ2A 2ZBQA 4FNHA 3W8PA 2KKHA 3GCWP 4MKYA 1XMOJ 4NEYA 2B9EA 2QG9B 2YNHA 1KVKA 1YDLA 3GTYX 4NLXA 2QFJA 1XMOF 3TO8A 1IVZA 3CJRA 1FDNA 1VQMS 4PWDA 1KHWA 3D7SB 1RSCA 2AMCB 2FZKB 2JC1A 3C15A 4DCJB 4JI3J 1R8AA 4ZITA 3M30B 1S49A 3TANA 2J6UA 2R2UA 2RJZA 5C42A 2ZH3A 2H4YB 5J2QB 3EGNA 4I4BA 4DX7A 2NXEA 2HVDA 4GKJJ 2MMYA 4TKTA 1U1PA 3R2DJ 2F8EX 4ZJOA 3MEGA 3SDEA 1AFIA 3FCWA 4YB5A 1SJRA 4S0MA 2N82B 3P45B 1IJFB 4JI1F 3UDEA 1JXLA 3RAXA 3SCLE 2UV8A 1KEKA 3G8SA 1CJKA 4NLGA 3OR2A 4DEZA 2YNGB 2QV6A 4QJVA 3W2WA 2MQOA 2CPZA 2XLJA 4UF4A 3H4DA 3PHEA 2ZJRQ 5KFNA 2W2MP 3HSJA 4ID8A 4U95A 4MIAA 1MW7A 2CJ9A 1RTZA 1NJYA 2AGOA 2K1RB 2HQFA 3FBCA 3OXGA 5A0YB 3PW4A 2XNQA 4OHXA 4DV3J 4ELTA 3NS5A 3CXCR 1SH2A 1K47A 3AJ1A 3IO1A 4RU2A 2B6AB 5B0AA 4M8LA 1XTZA 2M8DB 2W9BB 3KG4A 1WEXA 3AJ2A 1JLAB 3SSSA 3WBZA 3C16B 3QT5A 2LKZA 5LL6d 2IVFB 5C7PA 3OL7A 2W8KA 2WB1D 2VV5A 2XSJB 2KM8B 3M8WA 2IJRA 3KHHA 2HSEB 1OSCA 2V6AA 1BQMB 1AB8A 1NHUA 4MYTA 3DLJA 3ENAA 2CPYA 3HX9A 3JQJA 4DPUA 4QW9A 3OVSA 5E5NA 5LMUF 4ED8A 2JEFA 3FEYB 4ZVPB 1KFSA 3M9MB 1GAOA 2ILYA 3V6HA 3IG1A 3MPVA 3JYTB 5D0GA 2VL1A 3E01A 4JV0A 1HWIA 1JXEA 4RUBA 2FLPA 4KPYA 3CTRA 1Q7YT 4FF4A 4F0HA 1B7FA 2OH2A 1F1BB 1RDRA 4J9SA 4ILRA 3SSRA 2KH9A 3HD2A 1A9NB 4FS1A 5HL7Q 3NP5A 3EM1A 3TAMA 2ZH8A 3PKMA 2RU9A 4WP9A 2AQ4A 2PC6A 4H4KC 1SJ1A 1X4CA 4HI2A 4USIA 4DL6A 2Y1LB 1X9WA 1B0PA 2BA9A 5JVHQ 5B0DA 4TLQA 1RTHA 1PYTA 4DS5A 1AROP 3HKZD 4YY3F 2BMBA 5A0YA 2MQMA 3J81Y 2V2VA 2SXLA 1SQEA 4K0KJ 3QGGA 4JI0J 3ZNJ1 3ILJA 1S79A 1VDHA 4DR1J 3PVXA 2W7OA 5ETOA 1KN6A 4I2QA 2V9KA 2F4VJ 1H98A 3W2WB 2R7SA 2B7BB 2DH9A 4N7TA 4Q45A 2B5JB 3KMSA 4I1TA 4RJVA 1IJEB 4ITSA 3MCNA 4CLPA 1MNEA 2MKHA 5D4NA 1K8AT 1QTMA 3UDVA 4CDIA 1X4BA 4C7QA 5IV3A 1LW2B 1SUQA 1VLYA 1XBWA 2XYPB 2CDRB 2R3VA 1WF1A 5T14A 3KOAA 4RUAA 4F04B 3DC2A 3D6HB 1RAIB 3MTJA 4FKXA 2E1AA 2CQGA 3QZ8A 4B3TF 4UY8T 2HWTA 5J2QA 2J0QD 1Y11A 4EO6A 4PAAA 1P9QC 1FJCA 2XNRA 1VMBA 1OPIA 2E7XA 2E5HA 3SFUA 4YP3A 1N0VC 3DI6A 3KHRA 2Q43A 3MD1A 3JAMU 4LRDA 2ASDA 3QBCA 4OYZA 2CNKB 3EPIA 3MDFA 2IBKA 2H48B 1XEZA 4FVMA 2LQ5A 3ULHA 2FLNA 4RW6A 2F65A 2RIJA 3M8SA 1RJJA 4FNIA 2KG0A 3OUYB 3QIPB 5HMXA 2KXHA 2ROGA 1IKYA 2Y1JA 3GE9A 4P71A 1PILA 2KXFA 3MAAB 3AQPA 1CG2A 5AE2A 4WZQA 1I51B 1X4DA 4Y28C 2J7KA 2OLWA 1APSA 3J7AN 3QLHB 2ZDPA 1TKZA 5KFLA 4NLDA 5T41A 2VFRA 5D15A 3KLEB 1KQFB 4ZPTR 3HHNB 2HHWA 3NWGA 1AXQA 5DG8A 4BC7A 5JUMA 5DLFA 2DO0A 3OXFA 1UA0A 2NCKL 4JI5J 3VZHA 4FPRA 1HPZA 4L6V3 5ETRA 5KFUA 2VFVA 2Z8QA 4EFAC 2EFNA 2VUGA 3LW5C 3NLCA 2QIFA 2WAQD 3QGHA 1TUWA 4FVCA 4G1QA 2VC1A 2WVBA 1VIXA 2Z58B 1DQAA 1TVRB 2A6MA 4OHVA 4DOZA 1FEHA 4ECTA 3QSYB 2Y1IA 4DWIA 1DQ8A 5FLXU 1H6KX 3ZTPA 1XQIA 3NGRA 1VQ8S 1NXIA 3CJ8A 4RPFA 1MROB 1FE4A 3EMTA 4PYDA 1GMUA 3LWMA 4DL5A 2MHNA 2VA3A 2RQMA 5SZTA 2JLGA 3V81A 4ECQA 2LFVA 1RE1B 2NZ4A 3W66A 2DGUA 4UOCA 1PAEX 1NZ8A 3BGRB 1BGXT 1DZ5A 2CPHA 2IAJA 1S6QA 1TFYA 5KFYA 2IM0A 3NNHA 4CWBA 2WTFA 5JVGQ 1KNZA 3AODA 3CDEA 1LOUA 3PNIA 1SL2A 1N5SA 1RWVB 3D28A 2ADCA 2VKRA 3IMQJ 5B7WA 2XSFA 3I5BA 3D6TB 2C2MB 3O2IA 2QSFA 2RQCA 5EN1A 1HD0A 1X4AA 3AD7C 4WP8A 4HH1A 3SQGB 5GVQA 3HPOA 3CJTA 4FYVB 4DV7J 2ERRA 1OYEA 2HFSA 4ZLPA 3OV7A 4M5IA 3LWLA 1RT4B 3L95X 1S1WB 4BWMA 1VJQA 1DARA 1YQHA 4DPWA 5CD4H 3N79A 1X4HA 2WVFA 1NSQA 1NU4A 1TV6A 1FX4A 1VHFA 2BJ1A 2OEJA 2YH1A 2D3O1 5L46A 3B4DA 4WE1A 2MKYA 2YVSA 5HJXA 3SSQA 4ZCLA 3I56S 4J9QA 2HLTA 4IFVB 5LOQA 1EQ0A 4J91A 1HWKA 3DRSA 4Z7YA 4MT1A 3BZQA 3MAAA 1SH3A 4R25A 4UUXA 3V4MA 4WKRA 3F41A 3MM8B 3VR1A 3QIPA 1JLEA 4CLWA 4B9NA 1D09B 2OD4A 4ED4A 4M5MA 3TEGA 3PRVA 2ZHOA 2IA6A 2UUAF 2VG5A 3PEHA 4LF1A 4QIVA 4NA2A 4J9PA 1J5OA 2HAFA 2UXBJ 2ZM6F 4DX5A 5KFVA 4FP9A 5KFEA 1XN9A 5EWFA 3A13A 3KLGB 3F0NA 2CA9A 2VQFJ 2ZKTA 5AXMA 4HT7A 4B02A 4QPXA 4YQWA 1DFDA 2GX8A 2VBXA 3F44A 5SUHA 2AW0A 2MPUA 3PHTA 3VQTA 4OX6A 4OX7A 4A48A 4DL3A 2CIMA 3CEDA 4YR3A 4ED6A 4IRCA 1S99A 4X66F 1HNWF 3IWXA 4YHHJ 1RZMA 2YX1A 3TZXA 2XYHB 2V68A 3J81j 4HHUA 4LQ3A 5E3QA 1N32J 2WOMB 3BPDA 3UFCX 5IM0A 4DL2A 3HFVA 1U7LA 2A3JA 4IFYA 4K59A 2QGFB 3CIMA 2W01A 3LTOA 4I64A 1SC1B 2L41A 2QL7B 3CDAA 1BQNA 2ZE2B 2QC3A 5EX3A 2BANB 4USKA 1FWPA 1NPKA 2DY1A 4DV4J 4XPCA 1NDCA 4K4YA 3MZIA 3OHAA 3LQVA 3Q8UA 4AL5A 3KJFB 3PYDA 3A8KA 3M9OB 1N8RT 1C4AA 1EIYB 2GAGC 2E5LJ 1VQNS 2PA8D 1W2BR 4NLRA 3VAIA 3H2UB 1ZPVA 4QWBA 4ECXA 4JI0F 1L3SA 4W4MA 2ZH2A 3BF4A 3W8GA 1RAAB 3HULA 3MI7X 3OTCA 3U7JA 2R8GA 2HLUA 4DFPA 4FF3A 1LK7A 1WG4A 2NSCA 2QLFB 1HQUA 3JSBA 3RBZA 1YJWS 2DVIA 4JYAF 2HQ3A 4X62F 4ANCA 1GX5A 2CPDA 2NS1B 3E3XA 5IWAJ 2WRMA 2FC9A 4ZVGA 1U2RA 2DYAA 4QIWD 2MGZB 1PGZA 1X5OA 1Y10A 2YXLA 2HBQB 4X4PA 4TQRA 4ELVA 1MWZA 2XWXA 3NCRA 4ZPBA 4NLYA 3UCZP 5KG1A 2HS4A 3OL8A 1J5OB 3CD7A 1H0HB 1BQMA 4F2RA 3IGNA 1WC4A 2MB0B 2XSJA 1WC5A 4RNMA 4HHHA 1JLEB 3QT7A 3RAMA 3VALA 2AYGA 2UUAJ 4DFKA 2C2KB 2G1HA 4HLBA 3BGOP 3X1LB 5KT5A 2CNNB 3BKUA 3L09A 5G0RB 1WHVA 4CO5A 4KR0B 1FXDA 1C4CA 4WE1B 2GVZA 3CF5Q 5DM7Q 1HD1A 1IWAA 1C0TA 4KO0A 4DL0C 2HFVA 2A10A 5HATA 3KLFB 3OFEA 4EYIB 1GFWB 2DCLA 4NE9C 4QR1A 1RT4A 3J80Y 5HQ8A 2DXDA 4JI8F 2CQBA 3LGNA 3QWPA 2QLWA 3KTQA 2AYMA 2FZCB 1HNIA 3KKFA 2OFHX 3G82A 3W5YA 1CJKB 4B3TJ 5JJBA 4LJMA 4X4SA 2HGNA 4OI4A 4KIAA 1IBLJ 3C6UA 4OV1A 1SJ3P 2W2PP 4K4TA 5J1PA 4ED3A 3KMQA 1JNRB 5GAEU 2GW8A 5A8WA 2AGQA 2HHHJ 2FJBB 2GGPB 1RWKB 4L73A 4DCOB 2LYVA 1M5KC 1IXKA 2WVCA 1I94J 2DXEA 3W7BA 2R9LA 3U1NA 4YMEA 5B08A 2XMAA 1G7CB 4LRBA 2O01C 3N4WA 5HBMB 2G0JA 4PG5A 3V6KA 3G96A 2YKMB 1RAHB 2D9PA 3DKDA 5KG0A 4B3RJ 2EXUA 3IAM9 3G87A 2J9DE 2JZ5A 4J9KA 1NJWA 4JI7F 2ZZNA 5B0EA 1Y5LB 2ABYA 1VQ4S 2HNYA 1TKDA 1NKBA 3RRGA 2W4PA 2HVZA 2H1YA 4H4MB 1WSRA 2LQ9A 1TVRA 4PYAA 5KG7A 3MWBA 3KLIA 4LF7F 1FX2A 3LP1A 1AZSB 3T6BA 1C1CA 5D6GA 2XS7A 2QTWA 2HNDB 3R2CJ 1TR0A 4PXCA 4RX6A 2ADBA 2HZVA 4CO1A 1RXOB 4CLUA 2VODA 5C24B 1PC4A 1JJ4A 1KR4A 4DR2F 3VAHA 1VC0A 1NAQA 3D66A 2W4DA 5KFRA 3BS9A 4JI4F 3ZNUA 1GX6A 4KGKA 3POTA 4OZ2A 1IBKF 2KJWA 4QR2A 3QLHA 1F6TA 1FFGB 4Y6IA 1Q8BA 4ZVSB 2RUSA 5LSLA 1NCLA 3UR0A 2E9RX 3AHPA 3JAMY 2ACYA 2AF6A 1KLMB 2FJEB 4AL6A 3A8JA 4M94A 1TMJA 4DUZJ 3IM9A 4NMLA 5D4OA 3RAQA 1KOHA 1S1TB 3H2LA 2UXCJ 1TZ0A 2XMMA 1N88A 4NYOA 4CP5A 2G9OA 3BGLA 5HVHA 4I6WA 4U67Q 2XGPA 1QAXA 1UCNA 4K4VA 2P9GA 4NZ0A 3P5BP 5CCLA 3D1OA 1AA1B 4OI6A 2HNDA 5KFHA 4X4OA 4USVA 1U1MA 1ZM2A 4HEA9 2C2ZB 3WZ0A 2X1BA 1UTAA 1CQMA 3KLIB 5J2PB 4J9LA 1Y5NB 1S0MA 2FVCA 4RUCA 3U27A 4DUYF 1Y5IB 2EFOA 4C0HA 3PIOQ 3HSDA 5F8LA 1DBDA 2ATLA 1HFEL 1BHNA 1TKTB 4ZVEA 3MM7A 2FQQB 5KFSA 2W9CA 3PX0A 2F40A 2J76E 4WJBA 4AE5A 4Q43A 5LMUJ 2OJ3A 4EZ9A 3H90A 2Y8WA 2MYFA 4BCAA 3CE8A 4EK2A 1XNQF 3PCOB 4KFBB 5FLXY 2XMJA 4U8VA 4P73A 1UFLA 3W5ZA 4JI3F 4ZN1A 3GLJA 2I6WA 1NJIT 4QYRA 3TARA 1T95A 1M1HA 3E8OA 1UVNA 2X1FA 3N6MA 1U47A 5A76A 2LA6A 2LXUA 2YKOA 4FDFA 3R5DA 1NSKL 2KO1A 1FRJA 3D54A 4IR9A 2DNPA 1DLOB 2IA0A 5KFFA 4QWAA 2OPRA 3GIMA 2C2RA 3J7Z5 1SL0A 1IQZA 1RT6A 2ZUGA 2ZBRA 4LF8F 4K4ZA 5IOLA 5A2QY 2Z2YB 1T05B 1VQOS 4XIUA 1K0TA 1LWCB 3MEKA 4NLUA 3VTIA 2YKAA 4UOFA 4DBQA 3TI0A 1HW8A 2IY5B 4ICLA 3ZTSA 4RW4A 1ICEB 3CJQA 3PZPA 3DLHA 3CCSS 3UNGC 5MAOA 3CCQS 3UD5A 4B9VA 5H9FK 3I9V9 2NXCA 1D9AA 4ECRA 2F4VF 1S10A 2B56A 1Q8LA 4IDKB 2E5JA 2LMIA 3A3OB 3OTBA 1UWBA 2A1BA 1CJUA 1WHWA 3HVTB 3TA1A 3MR2A 4CTAB 1KS2A 4DU8A 4GO5X 3FCHA 4I2PB 3L7PA 2HFOA 2AZ1A 4NCBA 1N5QA 1EAYC 1H3DA 4NX9A 4A8WA 1N33J 3KUGA 2DR5A 3C6TA 2ZH4A 5GMDA 2R7XA 4YB1P 2DR8A 2MKIA 1NO8A 2EFQA 3I6PA 3QFWA 1HNXF 4LIWA 1F9HA 3FDSA 3P8BB 4JI2F 2QZ8A 2J9DA 3K5MA 1VK3A 3PW2A 1XC9A 1M90T 2E5GA 3SIPB 3EYZA 2LVWA 1D9FA 1VQKS 3OVAA 2CXEA 5ETVA 2CPXA 1CC8A 2QSWA 2AKWB 3IA0A 3LP2A 1N6QB 2DRAA 3NRBA 3NOCA 2NLWA 2VPZB 2Q6CA 2J0XA 8AT1B 3HHLC 1M0SA 4C11A 3MEEA 1FA0A 4DQRA 2VG7A 3P4UB 5E3PA 4PG7A 2AYEA 2ZOGA 2IMWP 2GQCA 3T41A 2DJWA 1LV5A 5F3ZA 1SC4B 2UV8G 3GWCA 2LQ8A 3WX4A 4CH0S 2MLZA 1GT8A 5ADZA 1PYSB 4CCHA 3ITHB 2IFXA 1Q1KA 1RBAA 2QA1A 1S1XA 3M30A 1RHKB 2XULA 5D77A 3ILLA 1LXNA 1UJ6A 3CJ2A 5EX0A 4F02A 3C15B 5DGBA 3UD4P 2Z57B 4U9RA 3A1YG 3PYFA 4ZKAA 3BB5A 1T9UA 5BYRA 2YNHB 3DFEA 3I4HX 3M2RB 1BD6A 4X66J 2NPIA 5H1SV 4KTQA 1WDDA 2EKYA 2C3OA 1OO0B 2P2CB 3O8WA 4KHMA 3F73A 4LF5F 3CPWR 1QUPA 4CNYA 3T6JA 1REGX 3ICLA 5KTQA 2PDAA 3C14B 1T8EA 2V5HG 1RT1B 3GPAA 1BUXA 1S7HA 4ZPCA 5K9FA 3I0RA 2ZVIA 3OL6A 5I42A 2ZEJA 1NKEA 3NS7B 4CI0B 2NSBA 2EG1A 4EYHB 3PX6A 4DSKA 1S1UB 2XBPA 2EFGA 1SKSA 5GAHU 3MD3A 4NLWA 2M88A 3MR6A 2XB2D 2FB0A 4R5PB 2RQKA 4OJGA 1LKZA 3NMAA 3UD3P 2VG5B 1H2UX 3QJJA 1JKHB 1I5OB 1ELOA 3HFKA 2N4CA 1BQXA 4DV2F 2KTQA 2IYGA 3Q8VA 4E98A 4OI2A 4DZ6A 1X4GA 2B7CB 3SYZA 1X7VA 3TUIC 4DSJA 4IFVA 2UUWA 1NLKL 1Y0HA 2N4DA 2CPIA 2QLJB 4DX8H 2GHPA 1TFWA 3MM5B 2VJUA 3IWNC 3D4JA 1YBTA 1S1VA 4XAKA 3I32A 4C8ZA 1S1WA 2BM1A 1JXVA 3LANA 1RTJA 3FCVA 4RW9B 2Z56B 3V4IB 1U45A 2IMOA 3T1YJ 3UW1A 1F2GA 3QT8A 2XZWA 4KGMA 3W62A 1VRTA 1O0PA 3NKYA 4BWJA 1DJ0A 2AX1A 3MUMP 4L72B 1DQ9A 2LA4A 2YX4A 1VK8A 3VWSA 2C3PA 3SV3A 2BX6A 1X5PA 1MU2A 2RH3A 4A8OA 1MU2B 5A8KB 1WELA 2FLLA 2ZBPA 3PM9A 1YJVA 1FKPA 4FYXB 1HR0F 5LJ5Y 3MEDB 4ETZA 4AFFA 5KFBA 5EDWA 4DV6J 1HR0J 3DLGA 2C2NA 3JS9A 2V0NA 2MKSA 4WPAA 1S6QB 4FF2A 1NHKL 2R7TA 2QMUB 2FD2A 2BE2A 3DXSX 2FGCA 2FJAB 1TELA 2EK1A 5KT2A 1IKVA 1RT3B 1PJ5A 1Q53A 2EI5A 2IRXA 1FRLA 2RQ4A 1HWUA 2DISA 2YNFB 5J1EA 2OEMA 4IQXA 4G6VB 4BLGA 4OHZA 1GMWA 1MROA 4YHHF 3HXMA 2KZZA 3DOLA 1X5TA 2H3EB 2PA3A 3JQKA 4MJKA 4C3KA 1R7IA 5KFPA 3QGIA 2QYCA 2XM3A 2GMJA 2BQ3A 2VBYA 4A4JA 2LLZA 4JB8B 2UXCF 1IBCB 1HMVB 2YQ0A 4OJ1A 3ZZYA 4JI7J 3DRRB 4Y34A 2OTJS 4TLRA 3TJAA 1BLUA 1HQEA 4QWCA 5KFKA 2DBBA 4F26A 1S9EA 2FJXA 3CDBA 1H74A 1IKXB 3O3LA 3IS9A 4DR6J 1P27B 1DHMA 2ACMA 3UNYA 4D3GA 2MQPA 4WBFA 3MUTP 4LVNP 5A8RA 3KUHA 3WC0A 2CRLA 3CJKB 2BACA 2GMLA 3JSRA 1TKZB 1OWXA 1EB0A 1AT1B 1SC3B 4HT5A 4I69A 4DMZA 4ES2A 4G1PA 4PZVA 3Q22A 3CCVS 2FVSA 2GMHA 3QFHA 1Y00A 5HVGA 5AJ3J 1J5EJ 2WONA 3SCIE 4NZ6A 1NBEB 3O5TB 2DHGA 4ZHRB 3BM7A 1QLNA 3JSMA 3KHLA 1HI0P 3CMES 3VGVA 4K2XA 4HACB 1X0FA 1H72C 4F3MA 4ENOA 2VC0A 3FMWA 4OZ5A 2XGQA 4OYPA 1J27A 2HHUA 4XDCA 2W24A 1K44A 4KC5A 3AFGA 1SCJB 1WI8A 2X51A 4WK3A 3WHIA 4M5GA 5HMYA 1IM4A 2UP1A 3DGPB 1NK0A 1RWPB 4NLOA 2LDIA 4MFBB 4ZCIA 1FKAF 1IR0A 2VG7B 2XZTB 1SUQB 4F3QA 2POKA 3DU5A 3MEEB 5T7LB 5KFCA 2DR9A 4RNFA 3HM9A 2H5EA 4W92B 2B5JA 1JLQA 2VB6A 3MCMA 2DHHA 4FXVA 4DR5J 1YIJS 4DUYJ 3CULA 4DR6F 2RE1A 4UQGA 4G3IA 4CO4A 2JVOA 1QE1A 1TL5A 2A0FB 3HT0A 1Q79A 3ZZ0A 3EXYA 3THVA 3PO4A 4BDPA 1UFKA 3VV2B 5J2MB 4EWTA 3T5LA 1HBMB 2LEAA 5DQHA 5I4MA 4HTJA 3HO1A 2R42A 2DRDA 2YWKA 4P75A 1RTHB 5DGAA 1VQ5S 4O44B 2CG4A 1VCTA 2YPZA 2GO9A 3OHBA 1NDPA 1OMSA 4PWWA 1U6BA 2GV1A 4E8UA 1T0TV 5AE3A 2CNOB 4X4UA 1IQTA 3MMCA 1FD2A 4EZ6A 4E0DA 3NAHA 5HAOA 4DL7A 2KI2A 5HQMA 4PUOA 2JOQA 2YKNB 2CJKA 2DY9A 3KWMA 1FVSA 2OPPB 3D9BA 1U49A 2YWFA 2VF3A 1Q5VA 3E01B 1CJTB 1Z4UA 3DDNA 3I87A 1NK6A 4UQTA 3LPYA 3RTVA 3DGVA 4DUTA 2WVDA 5H9FJ 1GXTA 4RW4B 1D1UA 3MCOA 4YS2A 5A6PA 1VQYA 1F9EB 4PUOB 4WYWA 1LWCA 1Q82T 2UVWA 1F60B 2CZVC 2L9NA 3HSGA 1FJGF 3CC7S 4ZIVA 1AW0A 4KHPF 1NK9A 1QSYA 3GJQB 4B9LA 2KG1A 3G6ES 4ZP9A 2LP4A 4TY8A 3KK3A 3B78A 2VA2A 3P49B 5AXLA 4Y0FA 1W7WA 3H2VE 1RT7A 1RBLA 2K1RA 4NMXA 4NLVA 4C9DA 3OJSA 4DV0F 2V2ZA 4CLSA 1EETB 1JLGA 1WOPA 4W98A 3BQ2A 2E9ZA 3OBIA 4KFBA 1JQGA 3CIZA 2AEJA 3MFHA 4MK9A 4C8LA 2BJDA 4ZCKA 1VS3A 2VDHA 4B3RF 2I5JB 2R2TA 3I96A 3LOUA 4CLFA 3T5KA 5HP1B 2I0XA 1AFJA 4PXDA 1B3TA 2WSFC 3K5OA 3RRHA 3BGUA 1KFDA 3GIJA 5I3UB 1TKTA 4A8MP 4N8NA 4ZDNA 2HFUA 5T7LA 3HMJG 4DR1F 1T9XA 1U6ZA 1RT2B 1SV5B 4OYOA 3LP0B 1URNA 2KDOA 1C2PA 1KBRA 1Y9OA 4HR2A 5CYMA 4A8XA 1YJUA 2OSQA 3HI9A 2VQEF 5CYQB 2DPJA 5C42B 1WDTA 1R8BA 4ZVFA 5B0BA 3CCMS 2ZH9A 2ZNYA 3CMQA 1EKRA 3N6NA 5KT4A 4MAKA 2WB4A 1YTYA 3FZ2A 3VGTA 3AAWB 4PWDB 2F5GA 3EVMA 1WUUA 4OX8A 1WEYA 2D74B 1S0NA 4EGLA 1S59A 5F3TA 4DR3F 1WSVA 3KFWX 3PRDA 4RWXA 2BKPA 3EGZA 4OMFG 3PR5B 1KLMA 5K14B 1TL3A 3R7BB 5GAGI 3V5RA 1XIQA 1RADB 2BJ7A 4MMOA 5CQGA 2EFVA 1MG7A 3CC2S 3CW2C 3MOJB 4O4GB 3K17A 1VI7A 4X4TA 1IR2A 3CC4S 4NYPA 5BJRA 2HBRB 1SIZA 3FZBA 2HS0A 1KVJA 4NXMJ 3QMQA 2EW9A 3D0IE 3NG8A 2CQHA 4L3NA 2QEXS 2JX2A 5AE1A 5IT4A 1J2VA 2Q79A 4WFNQ 3EVOA 3PKYA 4XO0A 2MZJA 3PDNA 3H5YA 2I8EA 1N32F 4X64F 2DXFA 4OYAA 3QQCD 2PSZA 1HIYA 1S76D 2KL8A 2L9WA 1CJVA 4U7UK 3H5SA 1SXLA 2HK3A 3W63A 3BEGB 2N3LA 1B70B 1PKUA 1UEUA 1WEZA 3OTEA 4Y2CA 2ZD1B 3DLKA 2DNRA 3VQSA 2V8VA 1YK9A 3EXCX 3TP2A 4Q44A 4ECVA 1S0VA 4LSNA 1MN9A 4OZNA 2HFNA 4FYWB 1U26A 2HEKA 2MY8A 2PEHA 3DLGB 4OYMA 3TUJC 4JV5F 2HNZA 4MK8A 1RHRB 1S9FA 3GMGA 1M1GA 4WFYA 1D0EA 2WW4A 4QBUA 5CABA 2BKNA 4GVBA 1KC8T 1Y4ZB 2ZVSA 3WIVA 2DNQA 4ZP6A 4TVAB 1QAJA 4B9MA 2CQPA 4QIEA 2IVYA 3R27A 2C3YA 3KJNB 1HNIB 1AYEA 2AYBA 4KE5A 4FF1A 2I38A 4JI6F 4FBUA 3OVBA 5F8NA 1Z1ZA 3J80U 2DHSA 4M95A 1C1BB 1JLBB 2AZ3A 2E9TA 2H5IB 1RTJB 5DQGA 3QZ7A 1YX2A 2N7CA 3DDKA 2ZHBA 1LEOA 3GYXB 3BO4A 1Q0NA 2CFXA 3ISNC 3MPDA 3JB9k 5HLFA 1D3WA 1YI2S 2E66A 1LNQA 4L74A 5IC6B 2CZ4A 2G1DA 5L39A 4J9MA 4DSLA 1UFWA 4WXWA 1RLCL 2IC3B 1DTTB 3HVWA 2EG2A 2DR7A 2CZ9A 2ZBIA 2Z2ZA 3UN2A 2VU5A 4N5SA 2KM8C 1RKJA 1NK8A 4NZ7A 3CT9A 5KFZA 1N5YB 2ASLA 5HMZA 3R3TA 2VBZA 1OY9A 3PV8A 2HZCA 1BY9A 4ID5B 3KK1B 4ZPVR 2JDJA 4C4WA 2ZH5A 2MY7A 1YHQS 3UR3C 1WKKA 2LXIA 2G0IA 3FBEA 3UN5A 2YNIA 3FEXB 4BBYA 5GAGU 3BSNA 4H54A 3VGUA 1Q86T 3ETOA 5HK4A 1S1UA 1NJXA 3QRRA 3P3DA 2KJVA 2DGOA 3MM6A 2YWWA 1G3OA 1XR7A 1PJ6A 3I0RB 1OQ3A 4QIFA 4OI1A 4FPIA 1N36J 1U09A 1WORA 3QJLA 4ZJQA 2V4RA 3WIUA 2R7UA 2J7WA 5DG7A 5LMNJ 1UJ4A 3D2WA 4HYKA 5DRKA 3H20A 2R8IA 4ED0A 4OYXA 3TAPA 2GVDA 2B3TB 2BXJA 4ECSA 1YZ6A 1PAUB 2LEBA 1DRZA 4WTOB 1PCAA 3R8YA 3BN4A 4AQYF 1XNRF 2QA4S 4AUKA 3OTDA 1FDBA 4JP8A 1Q4RA 1N33F 2GQQA 3ITHA 1HBUB 2CQ0A 2CG8A 2BE7D 3O44A 3R7NB 3PY8A 2F1FA 5IT9Y 3ZZRA 1XMBA 2DNLA 3BYPA 4ZLLA 2EPIA 3BN7A 3W61A 3AXKA 4J9UE 5KG4A 2HKEA 2PO4A 3LH2S 4TN2A 3TYTA 4DI6A 2LXFA 1RLDA 5KFTA 3FMBA 3DYAB 3QATA 1T03A 2HBZB 2J0WA 2ZOFA 4MKAA 4DU7A 1FDAA 3UWTA 1ITPA 1RT5B 3CNQP 4UOHA 4ZCMA 5F8IA 2CPEA 1UMJA 4RO0A 1FE0A 2DEIA 2GS8A 1LW0B 2LU1A 3D3BJ 2BW2A 1K0VA 3GG1A 3TZYA 1T11A 3KJVB 2G2OA 3CCWA 4HH0A 4Q5VA 2IHR1 2V94A 4ILLA 2W7PA 3BQ0A 1UVIA 4ZS6A 1WJ9A 3BR8A 2VICA 5D0HA 2V8PA 2OPQA 2W4CA 3P5TL 4F4ZA 8RUCA 5HI7A 1T9WA 4QPTA 3GR1A 1S77D 2MSSA 3DLEB 2GJ2A 1EP4B 2BOAA 1WC1A 4MYUA 3EZUA 4QZVB 1U0HB 3SEOA 1JLFB 3QO9A 2KHDA 3M4XA 2OEKA 1SKRA 4C8YA 4JOUA 2B9XA 3CD5A 2CADA 1Q95G 3ILIA 2O5DA 4ID5A 3JTOA 3KK1A 3M7VA 4CTAA 1FEEA 4IH6A 2M7SA 4DV2J 2QJ3A 5DQIA 3R1LA 2B51A 1HBNA 2CAJA 2M0GB 4QCLA 3HHDA 3M6UA 1WHXA 1CEZA 4HHJA 4CLLA 3CCUS 3L9ZA 5BXIA 3M8QB 2R7QA 1T9VA 4OYWA 2GIQA 4CM0A 1VGYA 5BYQA 4ZK7M 5L9NA 5HO4A 1YITS 2FZGB 3GJRB 3GJTB 4PQAA 4CQ1A 3TAQA 6FDRA 5H9EK 1D9DA 2V69A 4J90A 4NA1A 2G13A 4KT0C 2FVRA 4ICLB 2B43A 3RBEA 3GYGA 3I9ZA 1NDKA 3N01A 3HVAA 5C25A 3KNGA 4PPZA 4Z2XA 4BS2A 4Y00A 3AD9C 3KHGA 4IRKA 2AWZA 5HQLA 2Z0GA 3AQOA 4IO1A 3W2VA 1F5CA 1NSPA 2W8LA 2MQNA 2DIUA 1XR6A 4ZP8A 5MLCV 3QRPA 2YQ1A 3T1HF 1K9MT 3K57A 4Y3CA 2ZZMA 2LDYA 4RNHA 3KDNA 1NEEA 5F41A 1WNEA 3D3CJ 2OMLA 2IM1A 2GJFA 4KGVB 5ETQA 1M1KT 2R7OA 3TW0A 2B8PA 2P6TA 3FSXA 1FRXA 2F3JA 3BKTA 4LSLB 2IAJB 4ZPWR 1FNXH 4V19J 1RWOB 4LSNB 3L7OA 5KG6A 1FDDA 1G2EA 3AJDA 2H65B 3JXOA 3ZTRA 4M5DA 1H73A 2L48A 3CMAS 1C0UA 2KB2A 4F4XA 1U48A 1CPZA 3HK2A 4G1IA 4IOBA 1SC6A 2RF2B 3DLBA 4B9SA 2H51B 4CM2A 4U6PA 2RKIA 2DD8S 1PO6A 3QAEA 4NYZA 4B9UA 4I67A 3DU6A 3UDCA 2OMOA 4LRAA 4BHQA 3PYGA 4K4XA 3T5JA 4LMZA 4OIXA 2XS2A 3TVZA 3D1QA 3S7RA 1SJFA 4ED1A 4JI2J 3DRPB 3B4MA 3R5JB 2M52A 3OJUA 1ZZFA 4ZPAA 4KPCA 3DOKA 3RB3A 4JI5F 2PFDA 2VBWA 1WF2A 2GHVC 2NUHA 2HRYA 1RKIA 1FESA 1S1TA 1QY7A 4PABA 3MMAA 4NA3A 1UAWA 2E44A 3K58A 3G2XA 5KFIA 3M8PA 3UDLA 3F56A 1TL1A 4AXJA 4MH8A 2IVMA 4NRUA 2AJ0A 1VR6A 1YRUA 3IFEA 5F8MA 4Q0BA 4RWWA 1CVJA 3QYYA 3HZEA 3TNVA 3OUYA 1NM2A 2RAQA 4Q2LA 1LWFA 2F63A 4DV1F 2QYGA 3JTPA 5KFXA 3FSIA 3KG0A 3POTB 2RD5C 2IJNA 2OPSA 3PTWA 4NL5A 2UUCJ 1VRUB 2KZMA 3VCDA 4IH7A 3KYLA 1GTEA 5DDRC 1RAGB 4DLEA 4X65F 5ETKA 2BRKA 3OSNA 4QWEA 1LK5A 1JWWA 4DSEA 4M5KA 2DPIA 1P9YA 4ELUA 2DCUB 2P9EA 4USUA 4WCEQ 2C28A 4OX9J 4QU6A 1LFPA 2X3GA 4RW7A 3GFHA 5CYQA 1AZSA 4LF5J 3L7UA 1N48A 5CYMB 1M5OC 4JI6J 1SH0A 3LALA 1GMVA 4A8KA 4F67A 5KT7A 3KK2A 9RUBA 5L8RC 2FHJD 4CLYA 5AJ3F 1WOSA 3GFYA 3R1HA 2XY7A 1JJHA 5I3UA 1GK8A 3MCSA 2ZC3A 4DSIA 1VBYA 2V63A 3FEZA 1NH8A 1ZAVA 4DN9A 2BJ9A 4RNNA 2K3IA 2PGCA 4LRFA 1V3RA 2XMTA 2VH7A 4USHA 4WIIA 3R97A 4RKUC 1RABB 4YR2A 5A2QU 1EARA 3ISZA 2AEMA 2MJUA 2YTCA 3RR7A 1JB0C 2FIUA 1FNOA 1KQKA 1PSDA 3TRGA 4OI0A 4Z7CA 2DGQA 5ETNA 2VDIA 4J9OA 2CQ1A 3V6JA 3I31A 1REVA 2BOPA 1JIHA 3JQMA 4UTGA 3KK3B 3Q8SB 1VHIA 5AXNA 2QA2A 3T19A 5DS7A 3DMJB 2FVPA 4B3SF 4LRCA 3I4PA 2EVZA 3MR5A 4J37A 4P2SA 3G6VA 2VOOA 3QRQA 5C25B 4XPEA 4Q7AA 4DX6A 2WHOA 1WKJA 2ZWOA 1JLCB 4P72A 4WP3A 1HHSA 1S72S 1R89A 2F8MA 4J7CA 4U7CA 4UY85 3GCXP 3IRXA 1YJ9S 3Q8QB 3CCES 3A3NB 1WWHA 3AOCA 3IG1B 4URSA 3M8QA 3JYTA 1PYOB 2E5LF 2UUBJ 4YDXA 1RGVA 4EEYA 3W3SA 3UCGA 4ZVUB 2C2OB 3BJYA 4G65A 4CNZA 4KBIA 4JBCA 2HQIA 2JNJA 7AT1B 3NGDA 1WC6A 3C16A 2AJ1A 2LEPA 2V8HA 3K89A 5H9EJ 1ZTWA 1NB7A 2NYIA 3MPYA 2QO3A 3DM2A 2W9BA 1EP4A 1RHMB 2ALZA 1HYSB 2V8GA 4WTYA 4X4NA 4RZRA 1QAYA 4WFAQ 2OPQB 1HBMA 1BWVA 4RLEA 3T1YF 1QSSA 3C46A 3VAGA 1B7YB 4OL8A 2HBYB 2BABA 1X0PA 3TWZA 2YWGA 4TNOA 1HQUB 1VBZA 2J6TA 3BV8A 2RHQB 2YNGA 4I56A 2JEGA 4C8NA 2FDNA 3HHKA 4DF4A 4QW8A 2B4PA 5F0UA 5HVFA 3UCUP 1RYSA 3K8WA 1H38A 2XO6A 1WC0A 4M63A 2X1AA 4PWUA 1N34F 1HI1A 3S01A 2RDDA 2PFFB 3KUEA 3OFHA 4P9SA 1WF0A 3UVJB 1VQ9S 3PX4A 2C3UA 3BBCA 3WQPA 4IOCQ 3DGPA 4PR6A 1NRKA 4DDFA 3MAHA 1OY6A 4PG4A 3BO3A 3R6LB 4LF2A 4Y65A 1YJ7A 1RP5A 6AT1B 1HWLA 3T1HJ 1BMQB 4R8UA 2EKNA 4NI2B 3BH7B 1BQNB 2ZE2A 2EFPA 2E1PA 4CO3A 2A2CA 4DQSA 1R6VA 3OTOJ 4LFAJ 4C0OC 2ROPA 2QL9B 2WOMA 3BYRA 4UT4A 2CQCA 3JSMB 5IT9U 3EX7B 2AJFE 3Q8RB 5J2NA 2UUTA 4ZPDA 4HI1A 2WONB 1ZTTA 4EBEA 5I3QA 4RW7B 1YWXA 2VG6B 3M2UA 4IH5A 4DR7J 1U1NA 4FKYA 2JJ4D 4FYYB 3KLHB 2DGVA 3TOQA 1TU0B 3M1VB 3MTKA 3VVUA 3LGHA 3ET6A 4DR4F 5FJ4A 1TL7A 2YH0A 1ACMB 1VRUA 3G6YA 2J6SA 2AHOB 2OPSB 4B3OB 3RB6A 1MN7A 1RAEB 1ZPWX 3BPSP 4F0KA 2W7AA 5M2PA 1LWFB 3G6XA 1N34J 3OL9A 3AOBA 4EO8A 1N5YA 2CWKA 2RRNA 3EDQB 5L9XA 1K1SA 4WFZA 4QU7A 4GKKF 2CQIA 3DRSB 4RNOA 1E6YB 4IUFA 2PE8A 1DTTA 3RB4A 4RL1A 5D3GB 1S0OA 1M5VC 3FNNA 3D0GE 3QWUA 4P2XA 3ADAC 5J1EB 1ZAWA 4C2MA 5JMNA 3AXMA 1RA7A 3DOKB 3BQ1A 1ROFA 2MZQA 1N56A 1SB6A 1LWEB 4H4OA 5HN0A 4I6YA 5L1IA 2K2PA 2HGLA 3DRPA 4FBTA 1SVDA 2HIYA 2CKWA 3M6WA 2EC2A 1T3NA 2GC8A 2V2KA 1NPPA 3OPKA 2HYIB 3BBBA 2WVEA 3OFFA 5GADU 3D5MA 4JUZA 3T9ZA 4LF6F 1F2HA 5E7OB 3A4TA 3LA0A 2XY6A 2VONA 3THTA 1Q81T 5A8KA 2DRBA 4GVBB 1PIEA 2RF2A 5CYJA 2G2ZA 2BJ8A 4JV1A 3TX0A 4K0KF 3HDSA 2CUYA 4ETXA 5RUBA 3NWRA 1U2FA 4M5DB 1S97A 5IZHA 4N77A 4YUDA 4KJIA 2O66A 1ULRA 2OELA 4F0MA 4WF9Q 2UUBF 2HPUA 2MKCA 3RW7A 1MMNA 2OFGX 2B9YA 1MSWD 4DR2J 3SI8A 2HK2A 1BE4A 2DNMA 3RBDA 3PW5A 2HIQA 2DITA 4RUHA 4PQUB 5HMWA 3GV5B 2HAIA 3MM5A 4RR5A 2EWHA 4YB6A 3LUYA 2V4QA 2HMIA 5DG9A 2RS2A 1E6YA 3EPGA 4LF7J 1RI7A 2VD3A 4UW2A 5D4LA 4MKVA 4URGA 3DRYA 2DIVA 4LR9A 1FFSB 5HANA 1B0TA 2QT7A 3MR7A 1ZA2B 3DHXA 3QAUA 4PKDB 5KFDA 4L3KA 1KKHA 4QR0A 3CCJS 2P9CA 1UVKA 2MZRA 2Y3YA 2VQFF 1QVGR 1KD1T 3AD8C 3HHEA 4R5PA 2IDLA 2RDIA 2BDPA 4P7TA 1KP6A 3ET6B 5KFGA 1SKUB 3FFIA 2C22A 3L4BC 3DCAA 2ASYA 2J8SA 3UI3A 5LXRA 1R0CB 3BR9A 4N47A 1FK9B 4YDDB 1RHUB 1E6VA 3EZ5A 4XDDA 4DFMA 3GONA 1RTDA 2ZH1A 4FYDA 3TR5A 3ISND 5K14A 2MZSA 5BR8J 2F9DA 2R4FA 2VPYB 2XI2A 1VYAA 3NAIA 1Y7PA 2HHPA 3PXGa 2C2DA 4B08A 1QTNB 4MTPA 1WD6A 1WTBA 3BSOA 2B4UA 2DO4A 3O6QA 4RBVA 5I3PA 1KWMA 1UZDA 2IDEA 4NLSA 4P2MA 4R8UB 2AIRB 3TQEA 3WX8A 1QDUB 2QRRA 3U02A 5C5JA 2DT9A 4IG0A 3K8VA 3FJ2A 3TJ8A 1YJNS 4LR8A 3M32B 4C8OA 3P96A 2DNYA 2YQ3A 3FVYA 4LREA 1UVMA 1G1XA 3LP0A 4MIWA 2WSEC 2XQCA 2D3OR 2HHXA 4KH0B 1OY8A 2XHCA 2AJ4A 1PJ7A 2EBGA 2VZ9A 3MF5A 4C11B 5CD4A 4X4QA 1JJ2R 2UXDJ 5D4PA 3RG6A 1FWKA 4OLPA 2YWEA 1GXUA 2UXDF 2APOA 5D78A 2RU3A 1TQLA 5DZ6A 2IM2A 1KTVA 1FNMA 1QM9A 3CJ3A 2W9AA 3M32A 4YN3B 4X4RA 1YSJA 3DRXA 4IG0B 1BWEA 1TUGB 2W2QP 4CRJA 5CA5A 5F8JA 2JL9A 1XNRJ 3IWLA 1UL3A 1V5IB 3LAKA 4P6QA 4WFXA 1L3VA 3MXHP 2M8HA 3HVRA 2QA4G 3NGUA 5K8OA 4C6AA 1VOMA 4LUBA 4NXNF 4DPYA 2N7YA 3TJ9A 1RACB 3C6TB 1FXLA 3QJPA 2GVDB 1HYSA 3B8HA 1CS4B 2C1EB 3DM2B 3DOMB 2AGPA 4CLKA 1GTHA 5EWGA 1NJZA 2VASA 5L38A 2YPYA 1QVFR 3MGJA 5DDOC 1UWBB 1RTDB 3CCLS 3H98A 1E6VB 1SJ4P 3IR6B 1FK9A 4N56A 3H4BA 4O0NA 5M2UA 1KRPA 2Z30B 4FN5A 4QIGA 3FFIB 2FJWA 1X8DA 3W5XA 5IV4A 2HFZA 4DSFA 3IRXB 4FS2A 4GRSA 1OJ4A 3VAFA 1OIAA 1FXRA 5ETMA 1JLCA 1B0VA 4PG6A 3RRKA 4YFUA 1R0BG 1UA1A 4WIQA 2M4MA 2XZDB 3GJSB 1BC6A 4USWA 2L08A 3TUZC 3NS6A 4Y2IA 4CLZA 2AEFA 1EKSA 1RAFB 1PG5B 4CT8A 2XHWA 2ZITA 4ZLNA 1Q16B 3CUNA 5EGYA 1NUEA 3AA9A 3GG0A 1P6TA 1MWQA 1REVB 2A2DA 3CJSA 5ETSA 1KOOA 4O4RA 4P7VA 2ZUAA 1FJEB 1VIOA 1S12A 1U4BA 4PQUA 3QT6A 1SIWB 3G9CA 1IKWA 2AJQA 3K5PA 2GZOA 4X2BA 2ZJPQ 1QE1B 2PT0A 1CC7A 3MPUB 4ZVQB 5KFAA 3GR0A 1FJ7A 3ZZZA 1ZBTA 3D6MB 3ZXWA 2AJ2A 5D0EA 2KT3A 3H0PA 2IYIA 3HFZB 3CD0A 3NGSA 1UWAA 3U1LA 4P10A 4K8RA 3ZZOA 4CYUB 4I68A 1XNQJ 1TAUA 1LQ9A 2KT2A 4UZBA 3SDEB 3Q8PB 2B8QA 3LPEA 5K8PA 2HVIA 1V3ZA 3FRZA 4EBCA 4B3MF 1HL6A 1TKXA 4C0BA 5CAAA 2Y1RI 4TYBA 3NGTA 7FDRA 4LF6J 1UVLA 1YBUA 5AT1B 3KG1A 3N28A 2FHJA 2V50A 4OJ3A 2BV3A 2BRLA 2R7WA 1M5HA 3NEKA 4DQPA 3DLKB 2UZAA 1N52B 1V3SA 2ROEA 3A8EA 4IG3B 4JYAJ 1NMEB 1ZS6A 3MURP 4X64J 1FRKA 3CJ4A 4OZJA 2CQ4A 2G2YA 4X62J 4O3RA 3K0JA 2VKZG 4XK8C 5IC4B 4UZCA 4F50A 3N6LA 1MMDA 3D1HA 4KAIA 1U6FA 2U2FA 2AU0A 2GA7A 3G86A 3CDWA 3I5AA 4OZLA 5B0CA 1JX4A 1ZZNA 2KXNB 4F7VA 4JV2A 1HNVA 1HI8A 3M2VB 2QMXA 4DR5F 4DV1J 1FRMA 1PBAA 3GFZA 4M5JA 3VAJA 4I6AA 3J7ZT 3MMAB 2RHSB 3CJ0A 3IR7B 3BO2A 3NXZA 5LM7E 4LF9F 5FD1A 1TL7B 2Q66A 4LF9J 5C24A 1IKXA 1VFJA 5ETTA 3IP0A 3PFEA 1S9EB 4LFCF 2ZJQQ 1N5VA 3FQLA 4KGXB 3GV7B 2CWXA 3M2UB 4CLTA 2CJAA 1FF2A 4KH1B 3K5NA 2Z2LA 3ILOA 2R2RA 1Q7LB 2OTLS 3OXLA 1GEHA 4DG1A 2GQ2A 1SKWA 2F7VA 2B0GA 4F2SA 4EU0A 2ZOMA 2BJ3A 4B3SJ 4ERDA 3MHYA 2ZZTA 1NPRA 1SQFA 2GJIA 2HNYB 3DOLB 4PXEA 3SQOP 5KG2A 1R0AA 2EC0A 3VAKA 4OQJA 1C0UB 2D7SA 2YNFA 3RZAA 3CO9A 1LWXA 5HSPA 4IG3A 4KV8B 2BBEA 3ENVA 3AOAA 3NOGA 3I5CA 5L1JA 2CYYA 4NXMF 3H8YA 2D9OA 1MLAA 3PJXA 2ZH6A 4Y2MA 1UW4A 3VZIA 2R2SA 2VOPA 2GGPA 3MEDA 2B9WA 5A8WB 3UVJA 1FKPB 4F4WA 5DO2A 1B64A 2XLIA 4CYUA 2UU9J 2UVVA 1V9OA 3MM9A 1UEVA 3HZGA 1KTQA 3HD1A 4OZ1A 4A8YA 2CVEA 3EDRB 1MMLA 3W9IA 1P1TA 1IBLF 1VRTB 1XMQJ 2QX0A 1U1OA 4NRTA 3EUNA 3M05A 3SFGA 4DHVA 4ED7A 5HP1A 3R5GA 4WXOA 1FI4A 1FRIA 1ZOTA 2KRRA 3BGFA 2HHSA 3R6GB 4QWDA 4MKBA 3RGIA 2BKOA 2DR6A 1DTQA 1IKWB 2HURA 1C0TB 3D68A 3N5FA 1YGYA 1FERA 4KO0B 4PRFA 2GVZB 3Q2SC 2DNZA 1VQSA 3OQ2A 4URQU 4AD6A 2XC9A 4O0IA 2JHEA 2JRSA 4C98A 1KLNA 1ZYQA 3J81U 5G0RA 1H2VZ 3ZC4A 3HT3A 1HBNB 1FKOB 3EWGA 3QGPA 3ZFVA 1RISA 3B82A 3ZZUA 3KNAA 1I6JA 1KQGB 2UXBF 1OSDA 3IRWP 2DNNA 2DNKA 4WK1A 5E33A 2CNLB 3I0SB 3CJ5A 2A18A 2YKQA 3K2YA 1OYDA 1U0HA 1NSAA 3BSAA 3Q86A 4WWSA 1YVFA 4AT1B 3S6EA 2XCPA 3DLEA 3A8IA 4M5NA 5E3CA 4CH1A 2FJDB 1U24A 1I1GA 4DV0J
chains in the Genus database with same CATH topology
5G4DA 2JEJA 4ZA1A 5D8HB 2XG8A 1OQ6A 4OZ0A 3AH6A 4C3MA 5KG5A 2E1MC 3IAS9 1YJTA 1QJHA 1QAIA 5KG3A 1RT1A 3G71S 4MIBA 3FGVA 1WACA 4DFJA 3DMJA 2RMLA 4DV5F 4FXWA 3CB4A 4I7FA 3DYAA 2XO7A 3C8YA 1T03B 3PRBA 3LGMA 5KFQA 3NGKA 1Y3JA 4V19X 1FVQA 1FRHA 4DPOA 4K5SA 3S1TA 1S1XB 3NL0A 1WI6A 3CGIA 5B09A 3Q0AA 2Y0SD 1CQNA 1TL4A 2FGOA 5DJBA 4C97A 2BANA 3CDUA 4YEAA 4ATNA 3GYNA 2FJVA 5L1LA 4OI3A 2BQRA 1JLQB 2QE5A 1R43A 4GKJF 1S6OA 1IN0A 4ZP7A 1TK5A 2P5VA 4FZVA 4KHRA 3KK2B 3H59A 4J5OA 1RQ0A 1D8ZA 1GNKA 3E2EA 3G8QA 2CQ2A 4R0JA 4F4YA 3H5XA 1VQ6S 4LF4F 4USJC 3AY0A 5K5MA 2FC8A 2H9ZA 3C66A 3BSCA 3HHLD 2YKPA 3CSKA 1NK4A 3TQ1A 1ZM4A 5A6WA 2YNIB 2Z2MA 2JLFA 4QYZJ 2I1RA 2J5AA 2HHQA 2KFNA 5JXSA 3MECA 3V6DA 1JK9B 4A8FA 2CJQA 4FXDA 3Q24A 1T3OA 2E7WA 1V6HA 4HDGA 4Q0BB 5CHCB 3J7YU 2G4BA 2XMWA 2ZHAA 1TL1B 1TUVA 2FY1A 2C42A 2FUG9 2YX7A 1TV6B 2E29A 2KRBA 3OFGA 4H4KA 6FD1A 1MWYA 5IQ6A 4DR7F 5B0FA 5KT6A 3G4SS 1S6PB 3FRYA 1IUJA 2C2EA 4A46A 1F9FA 2JH3A 2DNHA 3RB0A 1HMVA 2IBOA 3CVKA 2HWIA 1SL1A 3PO5A 5EWEA 1TAQA 2UVUA 2BJEA 3RU0A 1DLOA 2RKIB 3US5A 2NREA 3L3CA 4RW8A 1HWJA 3OSPA 3TA0A 3U1MA 4ECWA 3TVKA 2HNZB 4HDHA 2MZTA 1IKVB 1RT3A 2QLXA 4F25A 1KVIA 1M5SA 1DAXA 5DDPC 1RTIB 2WBMA 2LQBA 2OKQA 5DM6Q 2BE2B 1RTIA 3IXQA 4KRWA 2HW3A 2NQPA 1KSPA 2CPJA 5E2QA 5ITHA 3R5BA 3FQKA 2WSCC 5FDLB 4PXBA 2K8GA 1JMTA 1Y3KA 2HS3A 4RW8B 2XMVA 5KFMA 4NCAA 2EK6A 3CD6S 1O51A 4CO2A 1VBXA 1WG1A 2BUNA 5BYSA 4O3QA 3EGWB 4Q8FA 1NNDA 2U1AA 4C3LA 1S6PA 2E5IA 3HP6A 5IT0A 4RW9A 3Q23A 1LWEA 2GNKA 4H4OB 3DHWC 3V4IA 4ECYA 2RRBA 4LFBF 1S6UA 1WG5A 2FTRA 1R8CA 2DK2A 3PIPQ 1JNZB 4NLQA 3SCJE 1GH8A 1R3NA 4TXSA 4K4UA 3RW6A 1TK8A 2O67A 1X4FA 4NWBA 4NLTA 2EBEA 1IKYB 4ECZA 4GO7X 2DNGA 2NXUA 1YJRA 4EUVA 3LF0A 4IQMA 4NCGA 4WZMA 4RW6B 3MECB 3V6DB 3V2UC 1R8PA 2DHXA 2ZH7A 4B3OA 4DJBA 4LT6A 2WBRA 3PR4A 2MKJA 2OAUA 3M1VA 4B17A 2LECA 2KT5A 3NMRA 1FT8A 1P8GA 1NK5A 1WTFA 4AL7A 4A47A 2VG6A 5GAEI 1RAJA 3CCZA 3I55S 1VQ7S 3MOZA 2HHTA 2KVIA 2MKKA 2W25A 5J2NB 1LW0A 3H5UA 1TK0A 3R5AA 1RT2A 1SV5A 2MHEA 2V8DA 1LFWA 1LW2A 2ZFHA 3MMBA 4IKAA 4PPDA 1NH7A 4OX9F 4PG8A 3M9NB 1L5UA 3T1AA 1J5EF 2E1CA 2O1PA 3QPIA 4DUZF 4OFZA 2Z4PA 2YKMA 4LIRA 1YBAA 2IM3A 3GQCA 2XY5A 4M1KA 5HBMA 2AV5A 1FCAA 4IR1A 2C3MA 4WYLA 2KYXA 5LSOA 1T7PA 4AXIA 4GMKA 2F8HA 3LAMA 5KFJA 3HHLB 3C6UB 2HVHA 4TY8B 2GIRA 1UETA 3JTNA 2DNOA 5IWAF 4DQQA 2HG4A 3DXBA 1N6QA 3K5LA 3TAMB 5EUHA 4O3NA 4HTIA 1YRTA 4D3HA 1S9GA 5CH7B 2OIHA 2D41A 1HW9A 1CSJA 3ZZTA 4CH7A 2XMKA 2FHKA 1K73T 4UUWA 2MDAA 1FTRA 2V4JA 3MAQA 3E51A 4KB7A 5E3AA 2OPPA 3H40A 1YRXA 3C2PA 3OW2R 2FHMA 2VFTA 1ZH5A 1NKCA 3I0SA 4O23A 1X9SA 1QUVA 2JVRA 4I2PA 1SBRA 3MMCB 1HHTP 1ZM3A 1XR5A 2PIIA 2MSTA 2JFDA 3HVTA 1JLAA 1OS5A 1FKOA 2HHHF 4QOTA 2B6AA 2M3DA 4RBTA 2GHWA 4IOAQ 1RA6A 4RBUA 2V4JB 2DHAA 5U47A 1PC5A 3VF0B 2P6SA 2AD9A 5LMNF 1R6YA 3NNCA 1S9GB 3GIKA 1C1BA 1JLBA 2RRAA 2IRYA 2K7JA 4DN0A 1RWUA 2DGWA 1T05A 4EBDA 4O3SA 2HHVA 5GMKa 2HWHA 4IO9Q 1RT6B 4K4SA 4DQIA 2CPFA 2OPRB 3MM9B 4AYBD 4N41A 3HHLA 2KN4A 4F8RA 5IS2A 4ZOSA 7FD1A 4MFBA 4IYQA 2B4VA 2XS5A 5KFWA 2NPFA 1H7WA 1U1KA 1A7GE 1F0XA 2CQDA 2K7KA 2O3DA 2OP5A 2RILA 4DF8A 1R8HA 3GSDA 2MQQA 3TX8A 2I2YA 2BQUA 1FD8A 1SJQA 2VPXB 3DN9A 1U1LA 2IJFA 2KYZA 3MM7B 4IFYB 4ZVHA 2W9CB 2B4OA 5IXUA 4K4WA 5IM0B 4CIOA 4C8KA 2G0CA 3MMBB 3M6VA 5E41A 5EHHA 3GZ7A 2DTJA 4DLGA 1X4EA 1O8BA 2PMHA 3S8SA 4C8MA 4LFAF 3TVYA 4ES3A 1RYRA 2WCXA 3CJKA 5A8RB 1XMQF 5LXYA 5DDQC 3ENQA 2M9KA 2F9JA 2JLEA 3KLGA 3KLVA 1VQLS 2D3ZA 3J7A1 1D8YA 2MQLA 3T3FA 1UJ5A 2R8KA 1HQEB 2FLOA 4O4GA 4B9TA 1UVJA 4KKOB 1HNVB 3M2VA 1W25A 2WK4A 3BREA 4NCGB 1F5AA 3MM8A 1CLFA 2BVZA 1XERA 1XWLA 4Y2AA 2R8HA 2D3UA 3K59A 2VFSA 3M8PB 2CQ3A 2UVRA 1VC5A 1Z2LA 5KOXA 5KOWA 3GILA 2X1GA 2GO8A 2DH7A 5CCMA 5KFOA 3OLBA 3GB0A 1NHVA 2J7UA 3AB4B 3TA2A 2R7VA 5K8NA 3NCPA 2XLKA 3LP1B 4O3OA 1TKXB 5F9LA 4CO0A 3T9NA 4DV6F 5M2RA 3OLAA 3IR5B 4ILMA 1KHVA 3UQSA 4BC9A 3SXLA 4TU9A 3NCQA 2JSXA 5FDLA 4WU2A 3QIDA 4J9NA 1N54B 4A8QA 2I5JA 1L3UA 1VC6A 3OR1A 1U1QA 2JEIA 2VFUA 2R8JA 4GC7A 1I94F 2WW8A 4QQBA 4LSLA 1EETA 1JLGB 3NBPB 5DETA 2RT3A 1SI9A 5HROB 1IBMF 1S1VB 2DGXA 2RS8A 3V81B 3MPWA 1HA1A 1RT7B 3N9UC 4WKYA 4F3OA 2FHOB 2XI3A 1Q78A 1G6BA 2DH8A 4YR0A 2J0SD 1W2IA 4HL9A 3W2VB 5GAHI 3X3UA 1M5PC 3HKWA 1Q8IA 4TYAA 4OLOA 3GV8B 2UUCF 3BDPA 4ALZA 1GXLA 4W90B 3PFOA 1N4LA 1T02A 3KLFA 1ZETA 1FTCA 2ILZA 5E0OA 5K8MA 3UE2A 4Z37A 2K3KA 2KHCA 2CVIA 2YKNA 1U1RA 5I42B 5B0GA 3HF5A 4NOHA 5CZVA 3MMJA 5E3RA 4CZCA 3J7YI 2XWYA 3DOMA 1JLFA 3QO9B 3THPA 3M2RA 3LO3A 4O44A 4K50A 4NPOA 2N3OA 2RVJA 3SCKE 2OO4A 3CWJA 4ECUA 1URRA 4DV7F 3SZ2A 2NUUG 5GADI 3MFIA 3N5BA 3DI6B 2ZBCA 2NR0A 1O5JA 3NNAA 2MGZA 1S48A 4OHYA 5J2MA 5CXTA 1X9MA 1FHTA 3ZZPA 2RSQA 1F5BA 2OD6A 1X5SA 4Y2KA 4R0EA 2BYCA 3KJVA 3CCTA 1HBOB 3GFXA 2Q1LA 5IQQA 2HGMA 1RT5A 3H25A 3CCRS 4GC6A 2RUGA 3UPFA