2YTCA

Solution structure of rna binding domain in pre-mrna-splicing factor rbm22
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-splicing factor RBM22
molecule tags Transcription
source organism Homo sapiens
publication title Solution structure of RNA binding domain in Pre-mRNA-splicing factor RBM22
rcsb
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ytcA01
5JVHQ 2DIVA 3NMRA 2N82B 3UWTA 2RRBA 3G96A 1YJ9S 2O3DA 3MOJB 2VONA 3ZZZA 1S72S 1DRZA 1PGZA 5IM0B 4LMZA 4F02A 2DGXA 1BY9A 3CCSS 1U6FA 3LPYA 4PRFA 3R27A 2KT5A 2LEAA 3NS5A 2DGUA 2FHOB 2MZ1A 1W2BR 5BJRA 1RKJA 1VBYA 1URNA 3FEXB 2M2BA 3CCVS 4WFNQ 1U1NA 3DLLQ 2LA4A 1FXLA 1VC0A 1Q81T 5GAEU 4PKDB 3CMAS 3Q2SC 1HL6A 4TU7A 2CQ2A 2CPDA 2L9WA 2ADBA 2DH9A 2N7CA 2KU7A 2OTJS 2J0SD 3THTA 1JJ4A 2CPZA 1H2VZ 2LQ5A 4ZKAA 1VBXA 2YH0A 3CMES 1FHTA 2L41A 1SJRA 3G9CA 2J76E 2YH1A 3CCQS 4IOAQ 5DDQC 2MMYA 3P5TL 2CJKA 2X1FA 4YUDA 1VC6A 2KFYA 4FXVA 5DM7Q 1CVJA 2DNPA 2M0GB 2RUGA 2CPIA 3HHNB 1VC5A 2CPJA 2MQMA 4Z2XA 1P1TA 3CCJS 2JRSA 5CA5A 2MKJA 4J5OA 4LJMA 2JVOA 2MKHA 5GAGU 5CXTA 2KXNB 1QVFR 3BEGB 1YIJS 4F26A 2OJ3A 1WI8A 3S01A 3VAIA 2UP1A 1A7GE 3CCES 1SJFA 2BZ2A 1U1OA 4IO9Q 1X4HA 1U1PA 2DIUA 1K8AT 1XN9A 2FC9A 1ZH5A 3I55S 2CQPA 2MY8A 2DO4A 3UCGA 2CQIA 5LJ3Y 2LECA 3RW6A 5JVGQ 1SXLA 3EX7B 2CQHA 1X4CA 2F9JA 3MDFA 2KG1A 2CQ0A 4CQ1A 1WHXA 2MSSA 2CPFA 1M5KC 5DDRC 4YOEA 3Q2TC 1U1MA 2U1AA 2G1DA 2CQ4A 3S7RA 2DHGA 2KXHA 3JB9k 2MYFA 1X4DA 2HGLA 1X5SA 3H2VE 5IFMA 2M8HA 2M9KA 3U1MA 2MQOA 3SXLA 1WEZA 2KG0A 3P6YC 1YITS 3PIPQ 1X4BA 4V19X 2DGWA 2DHXA 2KYXA 3K0JA 1HD1A 1X4EA 2AYMA 1X5OA 1YTYA 2KVIA 2CQ1A 4WKRA 3MUVP 2SXLA 4PR6A 1WEYA 1YJWS 3B4DA 1VQKS 2MZTA 1VQMS 2LA6A 5DDOC 3CPWR 3G6ES 4C0OC 3BO4A 2JVRA 2XNRA 3VAJA 1VQ6S 4M5DB 2DGTA 2M70A 2M88A 2PEHA 1VQ7S 2MQPA 2X1BA 1OO0B 1JJHA 2U2FA 3S6EA 2RRAA 2MSTA 2DNLA 3SDEA 3US5A 2OTLS 1U1RA 4QU7A 2MJNA 2PE8A 1WWHA 1VQ8S 3L3CA 1KOOA 1H2TZ 5GVQA 3J7YU 3G8SA 1H2UX 1OPIA 2RNEA 2LKZA 1VQOS 1N52B 2L08A 2YTCA 1VQ4S 1A9NB 3N9UC 2CQCA 2RU3A 2DHSA 2MZJA 2OSQA 2AYEA 2ERRA 2D9OA 3CULA 1X4AA 2MGZA 1FJ7A 3P3DA 2MKIA 4EGLA 3MUTP 3MUMP 3MD1A 2CQDA 2DNMA 1UFWA 2XNQA 5EN1A 5DM6Q 2DGVA 2KH9A 1KC8T 2DNYA 5CYJA 4ED5A 2MXYA 3U1LA 1U6BA 2VOPA 1WG5A 1P27B 1B7FA 1SJQA 2DNHA 5LXRA 2MZQA 2KRBA 2KM8B 5GMKa 3SDEB 2E5HA 2LEBA 4ERDA 1X4GA 5D78A 1UAWA 5LJ5Y 1SJ4P 1DHMA 2MKKA 2DH7A 3G4SS 4QU6A 3UCUP 2WBRA 2CQBA 1WEXA 2FC8A 3D2WA 2KRRA 2G0CA 2HGMA 1NJIT 1FO1A 2KXFA 1IQTA 2XS2A 3IWNC 4TU9A 2AYBA 4U67Q 4WFAQ 1UP1A 3BS9A 3BO2A 3TYTA 3BO3A 1KQSR 2F3JA 2NZ4A 4IOCQ 4TU8A 3CTRA 4A8XA 2X1AA 1Q86T 1KOHA 1WF1A 1G2EA 4WCEQ 2M7SA 4QPTA 2CPYA 1YWXA 4OZ1A 2MGZB 3CD6S 2KM8C 2DNRA 2DGOA 3UD3P 2HVZA 3SMZA 2DNOA 2EK6A 3LQVA 2ZJRQ 2ADCA 5GAHU 2K3KA 3V4MA 3H2UB 2VODA 2E5JA 4YB1P 1QVGR 3VALA 2DH8A 2EK1A 2XB2D 2J8AA 2K8GA 3OW2R 2RVJA 4C7QA 1PO6A 1WELA 2OIHA 5IM0A 1VQNS 2DITA 2HGNA 1YJNS 1VQLS 2LMIA 5GADU 5LSOA 1WG1A 2QA4S 1FJEB 1U1QA 1YHQS 5H1SV 2M52A 1M90T 2N3OA 5IQQA 2DNGA 2FY1A 1WHWA 3VAGA 2LYVA 1WI6A 3R1HA 1VQPS 2Q79A 2DNQA 2DNKA 2KN4A 3VF0B 4CH0S 3MD3A 1QM9A 2MKCA 2RS8A 1AUDA 2CPXA 3HI9A 3S8SA 3I56S 3CXCR 3CC4S 2JX2A 2D9PA 4W92B 2MQLA 2DNNA 2KI2A 2XS5A 1Q7YT 2YKAA 2DB1A 1HA1A 1WTBA 2NLWA 1OWXA 2MPUA 1VQ5S 3TO8A 1HD0A 3B4MA 1S79A 2KHCA 1M1KT 3CC2S 2RQCA 1VBZA 5LXYA 4CH1A 3G71S 2MB0B 3EGNA 2MQQA 5ITHA 1O0PA 1Q82T 1K73T 2F9DA 2YWKA 4C4WA 3J7ZT 1DBDA 2RQ4A 2XS7A 2CPEA 1NO8A 2DO0A 2OSRA 4TLQA 1R8HA 1YI2S 2ZJPQ 3ZZYA 2DGQA 2I2YA 3CC7S 2GHPA 3CCLS 2JWNA 4FXWA 2MQNA 2D3OR 1N54B 2LCWA 1KD1T 4Y00A 2E5GA 3NS6A 3PIOQ 2RS2A 4UQTA 2E5IA 4WIIA 2QEXS 1WHVA 2B0GA 1L3KA 3CCUS 3VAKA 2X1GA 1N88A 1U1LA 1U1KA 1ZZFA 2CQGA 2EVZA 3THPA 2AD9A 1ZZNA 2AYGA 2V94A 4WF9Q 1M5OC 5D77A 1M5VC 2M4MA 1VQ9S 3CUNA 4WFBQ 1X5PA 1X5TA 5DDPC 4BS2A 1WHYA 2CQ3A 4UY8T 3UE2A 3P49B 2MKSA 1JMTA 5MLCV 3DXBA 1NU4A 2DHAA 5HO4A 2RT3A 2E44A 2J0QD 1WF0A 2HZCA 3TP2A 1OIAA 1UW4A 1M5PC 3CCRS 4LIRA 1D9AA 2XSFA 3NNHA 3CF5Q 3ULHA 3G8TA 2VOOA 2N3LA 3MI7X 2MJUA 3IRWP 1U2FA 1SJ3P 1X4FA 3RW7A 1R8PA 4Y0FA 3R1LA 1WG4A 5FJ4A 4W90B 2DK2A 3UD4P 2DISA 1D8ZA 4IUFA 1FJCA 2M8DB 2ZJQQ 4QQBA 2LXIA 2DNZA 3UCZP 3VAFA 4F25A 1N8RT 1RK8A 4RU2A 4CIOA 5HL7Q 2DGSA 2FPHX 2MY7A 2MZSA 1K9MT 2MZRA 2BOPA 4OZ0A 1JJ2R 4P6QA 3NNCA 2MHNA 3MURP 1F9FA 2G4BA 2GO9A 1WF2A 2CPHA 2QFJA 2I38A 3VAMA 5LSLA 2A3JA 1FT8A 1FNXH 3MXHP 3NNAA 1H6KX 3VAHA 2LXUA 3CCMS 2HYIB 5DETA 1DZ5A 3EGZA 1X0FA 3FEYB
chains in the Genus database with same CATH superfamily
2EBEA 3KLFB 1HLWA 4JOUA 2AJ4A 3NMRA 4FF4A 2FVQA 2W9CA 4DX8H 3M2RA 3M6WA 5KFPA 4YEAA 1U0HB 1DRZA 4B3OB 4LMZA 1CSJA 1S1WA 3DOMB 4QR0A 1HI0P 2RB7A 1BY9A 3CCSS 3DLJA 1U6FA 4M5GA 3LPYA 4ECUA 3R27A 5CYQB 4A8FA 3R7BB 1LFWA 4I64A 3CCTA 2Y1JA 3NS5A 3T41A 1ZTTA 2QL5B 5DO2A 1NJWA 5BJRA 1NDKA 1RKJA 4RU9A 2RAQA 4TY8A 1U1NA 3DLLQ 2LA4A 1LW2A 3D67A 3QFWA 1RWWB 4OI0A 1RB0A 2O66A 2NXNA 2QX0A 3LP2B 3PV8A 1Q81T 3DLEB 1XR5A 2BKOA 2KJVA 3ILJA 3A8EA 3C15A 3OQ2A 1HL6A 2QSFA 2B6AB 2CQ2A 2YX7A 3Q2SC 5ETSA 4ED8A 1CPZA 3X3UA 4ZA1A 4LF2A 2OTJS 3H42A 4ED3A 3THTA 1NSPA 1OMSA 1JB0C 4USJC 2R7XA 4PAAA 1NRKA 4DCJB 2LQ5A 4NI2A 5M2RA 2G0IA 5C2GA 3WC2A 4BHQA 2CXEA 9ATCB 4EWTA 3DKDA 3CMES 7FD1A 2RKIB 4L72B 1R0CB 2L41A 4JI3F 3ONQA 3UVJA 4C6AA 3NY0A 4YS2A 4YY3J 3W64A 1IBCB 3B6BA 3AFGA 5IWAJ 3FZ2A 3ADAC 4HH0A 2CJKA 4KC5A 3FSXA 2I1RA 3KNGA 4DR1J 3MOZA 1CVJA 3ILIA 4ECYA 3I87A 3QLHA 2F8HA 2KVQE 2HNYA 1BQNB 1HI1A 3H4DA 1VC5A 4K0KJ 1MG7A 1RTZA 1ULRA 4WWSA 3RB3A 3EVMA 3EDRB 3QRPA 1S7HA 2WZ1A 1TR0A 3K5PA 5K8NA 3MR3A 2V5HG 2YKMB 2JVOA 4J5OA 4LJMA 4ZPBA 2ASLA 2MKHA 2JJ4D 2H3EB 1HBOB 2HIQA 1B99A 4X84A 5GAGU 4LSNB 4M94A 2ROGA 5IXUA 3TJ9A 2AQ4A 1NLKL 3IP0A 4CLTA 5C25A 2YWGA 1LQ9A 4MFBA 4OZ2A 4CWBA 3A3PB 4QPXA 2HS3A 3J7YI 2J7KA 4DR4F 5ETLA 2V2ZA 4NLOA 3S01A 3VAIA 2IMWP 2Z8QA 4J9UE 1XR6A 3UR3C 5HVGA 3CJ2A 2HRTA 1YDLA 2DY1A 1R43A 2RKIA 2BKNA 2GV1A 4PG7A 1MW7A 1TKTA 3PM9A 4U9RA 4JI3J 3B82A 3C16A 3HT3A 3D6TB 3W63A 1TL7B 4ES3A 2HBYB 3DMJA 5CQGA 3NP5A 3OR1A 3I6PA 2RIJA 3K2YA 4Q2LA 5JVGQ 4DN9A 1GTEA 5LT5A 2J7UA 2YWHA 1S0OA 4KV8A 3M32B 4RJVA 4OHZA 2WVBA 3SQGB 2CNKB 1FK9A 4K2XA 4DDFA 2DD8S 3OTOJ 3DCAA 5IC6B 4ID8A 4AT1B 3M9NB 4C8LA 1U2CA 2XI3A 1FDAA 3I96A 2Z0GA 4QOTA 8AT1B 3TARA 2J6SA 3PKMA 3Q2TC 3TUPA 2DHGA 1REVA 4OLOA 2FTRA 3UDCA 3ZZOA 1RAHB 1LKZA 1MWZA 1MU2A 4BC7A 5FD1A 3EJMA 4GO7X 5KT2A 4F4XA 2XY7A 3TVZA 2I9SA 1RTHA 3TZYA 3P45B 1HBMB 2VICA 3RTVA 4RNNA 3PR5B 3QT6A 4NMLA 2CYYA 2V4JB 2WW8A 3UQSA 3POTA 1C4CA 2R7RA 2JEIA 3LWLA 3W5XA 4V19X 4DV6F 1WJ9A 2DGWA 4X64F 1UFLA 2KYXA 6FD1A 1S49A 2BJ8A 3BPSP 4ANCA 3BQ0A 1I6JA 2B7CB 3C16B 2ZH1A 4LF8J 1X4EA 1XQIA 4LF6F 2OEKA 2XMUA 1HQ2A 1B70B 3KHGA 1HW8A 3ZZRA 4DUYJ 3A3NB 5H9EJ 1N5YB 3HJFA 3SSSA 1RWOB 5SUHA 1Z2LA 4K4TA 5C7PA 2R7UA 3H90A 1C4AA 2SXLA 2YNFB 1WEYA 1VOMA 3FBBA 1VJQA 3OXFA 3QFHA 4P7TA 4TKTA 3TJAA 2HQCA 3MTKA 3GQCA 3ET6B 4AD6A 4QIVA 5HN0A 4LBHA 4X65F 3T19A 4ECXA 2Z58B 5M2PA 1SKRA 1E6YB 2ZE2B 3M6VA 5D4LA 3TZZA 4OYXA 1NPRA 1Y11A 2QV6A 5KFMA 2DR8A 2M88A 4DR7J 2PEHA 2ZH4A 2O5DA 1HPZA 1KDNA 2MLZA 3Q86A 1KS2A 1OO0B 4LFBF 3EZUA 2RRAA 2VUGA 1N36F 1WC6A 3FNNA 3VZHA 3US5A 1U25A 3LALA 2D3ZA 1Q79A 3W65A 4OYZA 4CO1A 5HJYA 2OTLS 2MJNA 4PG5A 2PA3A 2O67A 4EBDA 1EKSA 1S5ZA 1N6QA 3PYFA 1VQ8S 2QA1A 2W7AA 2AW0A 3L3CA 1RWNB 3N28A 2HWIA 1QUPA 4YMEA 3BGRA 3T9NA 4DXLA 6FDRA 3MM7A 5K20B 3T1HF 3NMAA 3BBFA 1TAQA 4NRTA 4DV6J 1QY7A 4MK8A 3VQSA 4K4WA 4DFPA 2RU3A 3RBEA 5E0OA 2OSQA 2UZAA 3K8VA 4HACA 1X8DA 2AYEA 1YJRA 3WIVA 3TA1A 2HEKA 1FRIA 1UWBA 2MGZA 3M8RA 1SUQB 5C42B 3UW1A 2XLKA 2V63A 3O44A 3G6XA 3MUTP 4QYRA 4UW2A 3RBZA 3C2PA 1DJ0A 4FS2A 1RISA 1S6PB 2CQDA 2VPYB 5GMDA 4D3GA 4DL6A 4NXMF 2KO1A 2V8GA 1U4BA 1DAXA 3ENQA 4CT9A 1KC8T 3DOLB 4KR0B 3JSMB 4OHYA 1JLQA 3W2VB 4LT6A 1WC5A 3U1LA 3U7JA 1U6BA 1ACMB 2BJ9A 3ISZA 4L6V3 1NSQA 1P27B 1FEHA 1GMWD 1RHMB 3FC9A 2N4CA 2MZQA 2NUUG 1FRHA 3BGUA 5GMKa 1UVJA 5C25B 4ERDA 1QE1B 4GKJJ 4ILLA 1Q5YA 1RT1B 2GGPB 3LF0A 3CJ4A 4C2MA 1RYSA 1UEVA 1UA0A 1N6QB 5IT9Y 4ECSA 1DHMA 3LGMA 1RHRB 3IRXB 1S97A 3G82B 3I32A 2LU2A 4KQZA 4PXBA 4OL8A 4X62F 4OI1A 2XZWA 1WEXA 3AODA 1U09A 3I9V9 3MM9A 2VA3A 1U26A 2NPFA 2VJVA 2DRBA 4HACB 3SBMA 4B17A 3HHDA 4J90A 4CTAB 2KXFA 5L46A 3QZ7A 2G0JA 1NK0A 7AT1B 2WW4A 2ZKTA 4RW6B 2JEJA 1Y7PA 2D3UA 4TU9A 4B9NA 1H98A 5I3UA 2E9TA 1JJCB 4WFAQ 5KFLA 3K5NA 4PQUB 3BS9A 5K9FA 2UUWA 4JI8F 4DV5J 2EFPA 3TYTA 4QWAA 2JLFA 2FHJD 3BGOP 3JQKA 2WOMB 3R5GA 1E6VA 4U8YA 4PUOB 3Q22A 2C3UA 1IKWB 2W2MP 3CTRA 4ZVGA 3W8PA 4A8XA 3KLGA 4ED2A 4DV7F 2X1AA 2MDAA 2IBOA 4ED0A 2BDPA 5BYSA 1CLFA 1FDNA 1HNVB 4CM2A 1C1CB 4QPTA 4EBCA 1QAXA 1CJUB 2HNZA 3FDSA 3QRRA 4FBUA 5ETTA 2CJAA 2DGOA 3POTB 2W8KA 4DR6J 1W25A 4IQMA 3FVYA 1LV5A 1QSLA 3IG1B 3IRXA 2HVZA 1RHJB 3SMZA 3G82A 1NXIA 4MMOA 4MIBA 3ZFVA 1DFDA 4OJ3A 3IS9A 1GTHA 5HVFA 1BC6A 4YY3F 2CWKA 5GAHU 1Y5NB 3SQOP 3W61A 2FHMA 3NGKA 4F0KA 2VODA 1IXKA 5KTQA 1P9QC 2AJ2A 3HHKA 3KXDA 3SCKE 5KG4A 1RBLA 2B4OA 2W25A 2OELA 4KGVB 3RJMB 4N76A 1M5HA 2AZ3A 2IRYA 1IJFB 2J8AA 1FE0A 3DRXA 3GYGA 3ET6A 4I1TA 4R0EA 3OLAA 1NKEA 3GIJA 4C7QA 3SYZA 1IVZA 5LMNJ 1E6YA 4JB8B 1NK5A 3M4XA 1S1UA 4A46A 1NUEA 1BMQB 2GJFA 4ZIWA 5IM0A 2VQFF 2BA9A 3PNIA 3HHLC 3TANA 2KTQA 2XMMA 4LFCJ 2UXDF 1TKZA 1FJEB 2ALYB 4CLFA 3HD2A 2BJEA 1U1QA 2F5GA 2B4UA 2BE9B 1I3OB 2DCUB 1PBUA 1WUUA 2M52A 3M8YA 4J9MA 4DQRA 5IQQA 2DNGA 4B9MA 1VCTA 1WHWA 8ATCB 4FYXB 5EGYA 3KMQA 5IT9U 3QATA 2V4QA 4DV0J 2R3VA 1V3SA 3FFIB 3PFOA 2Z4PA 2UU9J 4CH0S 4R25A 1OS5A 2J0XA 2VFSA 2PDAA 3G2XA 3MD3A 2E66A 3D6HB 1QDUB 1QM9A 2QC3A 2VPWB 5THWA 5HMYA 3KKFA 3R5CA 2CPXA 3MM7B 2ABYA 5LM7E 3TZWA 3NS7B 1N34J 1HNZF 1HWUA 2B9WA 1N5VA 1S1TA 3TUJC 3S1TA 3T9ZA 1BQXA 3UI3A 1I94J 3N6NA 4EYHB 2FIUA 3DYAA 3E3XA 2DNNA 1U47A 1Q7YT 1FTRA 2E9ZA 1MLAA 4ED6A 3AHPA 3H0PA 4KRWA 3OSPA 4PQAA 1S48A 5ETNA 1Y4ZB 4H4KA 2KT2A 2NLWA 5KT7A 4QWEA 4KTQA 3PYDA 2QA4G 3NBPB 4OZ3A 5IOLA 4DPWA 1S1XB 2YQ0A 4CNYA 3GILA 4P52A 4X4VA 1S10A 4ZVTB 1EP4A 1WOPA 2B56A 5LXYA 4AQYF 1R89A 1H38A 1RQ0A 3Q8QB 3DOMA 3NOGA 2KJWA 2XG8A 4C8YA 1XMQJ 2CZ4A 3CB4A 4ID5A 3OT9A 4S0MA 4UZBA 4PZVA 3KK2A 1OY8A 3J7Z5 4ES1A 1ZPVA 4BWJA 1KR4A 2IDEA 3UFCX 5LMUJ 2RQ4A 2F4FA 1S9FA 1RU2A 3LTOA 2XS7A 2YNHA 3TEHB 3TJ8A 5CD4A 1ZM3A 2DO0A 2CIMA 1MROA 1R8HA 3DU5A 3CO0P 4EMDA 5B0BA 2HBQB 3CC7S 1FFSB 2Z57B 2WB4A 2GHPA 4X64J 1TZ0A 2KT3A 1U8SA 4B3TF 3W62A 4LF8F 1SH2A 2B4VA 2OMOA 3M1VA 1N5TA 1IR2A 2QT7A 1R8CA 3BH6B 4NASA 4WFXA 4RZRA 1N54B 5HQLA 4IFYA 3V6KA 3EZ5A 2D3O1 2ZM6J 2LCWA 2BYCA 4W98A 4Y00A 1B0VA 2E5GA 4ZOSA 4CDIA 5I3UB 3PIOQ 2RS2A 4PWWA 1U0SA 2HK3A 1EJ7L 4FBTA 4K59A 5GAGI 2ZH7A 1S4EA 2JZ5A 4B3OA 1WDDA 4JI6J 2IDLA 3PG9A 3M8ZA 3H5XA 4O4GB 3J80Y 3IBFB 2VFTA 4DL4A 5I42A 2R7SA 2CFXA 1U1KA 3JAMY 1Q0NA 3VGVA 2VF3A 3PX4A 4LIWA 4IRDA 3BSCA 4LFCF 4ZP7A 2GS8A 4M63A 1ZZNA 2JFKA 1ZOTA 2NPIA 2E7VA 2OHDA 3DHWC 4AXJA 3MAAA 1HWIA 4ED4A 2BUNA 1DQ9A 3SIPB 2GVDB 3KK1A 4GRSA 4A8SA 1NSAA 1TL4A 1M5VC 1VQ9S 1RHKB 4MYTA 3KJNB 3CUNA 4JI1F 1N48A 1R8AA 3U02A 4K4XA 1T3NA 1X5PA 2HKEA 2FLLA 3C15B 1Y0HA 3K5OA 4B3MF 2B6AA 3OBIA 1MROB 2V0NA 3VZIA 3OJUA 2EXUA 5A2QY 2CUYA 4N8NA 5F8JA 1RT5A 5CD4H 3HKZD 3DXBA 5C24A 4DSKA 1ZA1B 4LFAF 1RT4A 4QBUA 5IZHA 4DV2F 3V6DA 2AEJA 2BBEA 2R8IA 1KONA 4OHVA 2Z2YB 2FVSA 4YN3B 3V81A 1SL1A 5FDLB 2J0QD 4ETZA 5KFVA 4ELVA 1RBAA 1KLMA 2FLPA 5D15A 3PRDA 3IO1A 4ZPDA 2QIFA 4RW9B 3G8TA 1Y5IB 4B3SJ 3LO3A 2PEBA 1CQNA 4M5JA 2CG8A 3ZC4A 2AGQA 4MKVA 1S1UB 3IRWP 3JSBA 2V6AA 5ETPA 1JNZB 2P9CA 3MGJA 2W7PA 2IAJB 4A8OA 4X4QA 2WRMA 3OVAA 4DWIA 1F5AA 5GADI 1FRMA 5D0GA 1L3VA 5FJ4A 1S6UA 1U0HA 2GAHC 2QYGA 4ECZA 3FBFA 1AFJA 2ZNYA 2NXEA 4CLPA 2YQ1A 2DPJA 1Q16B 3M32A 3MAAB 3J7A1 3W9HA 2V8HA 4USTA 2KHDA 2DISA 4DLEA 1U02A 2FJEB 3UN5A 2XY6A 2FD2A 2DEJA 3UCZP 2M8DB 2GVZA 3LGHA 1FRJA 2FHKA 3QT5A 4WTYA 2R4FA 3BSAA 1N8RT 2EI5A 1RK8A 1LXJA 4CO5A 4CIOA 1KTVA 5HL7Q 2KFZA 3MPUB 3ILLA 2NREA 1X9SA 1BHNA 5H9FJ 3HF5A 5E3CA 4K4ZA 3R7NB 3NCRA 3SCJE 3GONA 1K9MT 4TYBA 3GCXP 2CJYB 1H0HB 2YNIA 4P6QA 4FF2A 3M9MB 1X7VA 1YZ7A 5F8GA 4ITSA 2EG1A 2QG9B 3NGDA 1LWCB 4QIGA 4TN2A 2A3JA 3CDEA 2V4JA 3IAM9 3D3CJ 5KFTA 1TUWA 2MLYA 4OJ1A 2XO7A 1RT3B 3GLJA 5A6PA 3CCMS 4KY3A 5DETA 2HYIB 2BRKA 1Q8IA 2VPZB 1FESA 2C3YA 3NBPA 1TK0A 4M5MA 1FWLA 4Q5VA 5JVHQ 3OR2A 4ZCMA 4B3SF 3GIIA 1HYSA 4DV5F 1YJ7A 1YJVA 3PCOB 2O3DA 4LF5F 2AX0A 2UVRA 2D7SA 1RI7A 1YJUA 1F1BB 2AWZA 2ZWPA 2V8VA 2DGXA 4MK9A 4ZCKA 4F02A 4DQIA 2HNYB 4Q8FA 5KG3A 4WP3A 4P74A 4JV2A 3E8OA 4UOCA 4DL0C 2QLFB 2MZ1A 3O5TB 1FKAF 2QSWA 2MKYA 1TV6B 3I0RB 1URNA 5RUBA 3CCVS 2G13A 2YXLA 4WFNQ 4DV3F 3BR9A 4IRCA 5A8RA 5KFRA 2RILA 4DPUA 1IBMJ 2WK4A 1HBMA 3OL7A 3BN4A 1GMVA 5H9FK 2PSZA 2HBRB 5KT6A 5KFCA 2C22A 3NGRA 3A12A 4RLEA 1FJGF 2HMIA 3TX8A 4TU7A 1NDLA 4JI0J 2CPDA 2ADBA 3AJ1A 2J9DE 2AHOB 3FCVA 3RAXA 2VZ9A 3BDPA 1LK7A 1LWEB 1VYAA 1K47A 1S6QB 4K5RA 2OEJA 4OJGA 1UWAA 4P2FA 3BQ1A 2KFNA 1IBKF 1KNZA 3OVBA 1FHTA 4I4BA 4GC7A 2K3IA 1X9WA 2HVHA 2PO4A 2J76E 3OXLA 2DYAA 3W9IA 3GU0A 3FCWA 3MAQA 3CCQS 4XO0A 2BE7D 2E29A 4URGA 4R5PA 4IOAQ 2YX4A 2MMYA 1FWPA 4O4GA 4C0BA 2YPYA 4X4UA 2CZVC 1VC6A 2BJ7A 4FXVA 1HIYA 1NSKL 3D1HA 3K8WA 4F7VA 4ZLNA 3HMJG 4X65J 5DM7Q 1RCXB 4RNFA 2M0GB 3HHNB 4ZVQB 2CNNB 4HVZA 5KFHA 3IXQA 3WC0A 4Z7CA 2MQMA 3V4IB 2LQBA 4ZLLA 1UVIA 4AL6A 2O1PA 4IG3B 1IM4A 2VBYA 3Q8RB 3EM1A 2QMUB 3GV7B 4F2RA 1K0VA 1P1LA 1RDRA 2ZOFA 1JLQB 3ZZUA 1RTDA 4JV5J 4UQGA 4H54A 2IJRA 3AXKA 4LFBJ 2BE2B 1IBMF 2QZ8A 4I2PB 3D6FB 1QVFR 1JNRB 2XWXA 1APSA 1TP7A 3G86A 1YBAA 3H4BA 1FJGJ 1NDPA 3GPAA 3UR0A 4F3MA 1JLBB 2VKZG 1JLFB 1SC3B 4ECWA 4WU3A 1RWPB 1PJ6A 4XTTA 2HK2A 1FXDA 4RPFA 4ZMMA 1C0UB 4IRKA 1KLMB 1CJTB 2BZ2A 2Q43A 4ZN1A 1FEEA 1U1OA 4YR0A 1RWVB 4USUA 5EDWA 2JFDA 3QGGA 1XN9A 1GMUA 4EK2A 4ELTA 1FKPB 1HQEA 1SUQA 2BX6A 1B0PA 2P2CB 4UTGA 1TFWA 4UOFA 2MY8A 1SQFA 2DO4A 3KUHA 1HNWF 4NLRA 5KG1A 3W2WA 2CQIA 1SV5B 2LECA 3R6GB 4HI1A 2ROEA 3R5DA 3CDWA 4USKA 4X4TA 2FJWA 4LF5J 3GP9A 4WXOA 1SXLA 5DQIA 2ZEJA 3UN2A 1X4CA 5E7OB 3LGNA 1FFGB 4KHRA 3OUYB 1AW0A 2CQ0A 4CQ1A 3MR5A 1T7PA 4X66J 3IBWA 1IM6A 4CT8A 2LXFA 2CPFA 1FNOA 3KHHA 1M5KC 4CNZA 2JL9A 1ZAXA 3OFHA 4J9OA 4DLGA 1RT2A 2VASA 3JYTB 1N56A 2CNLB 2GMHA 3E01B 4GMKA 2W9BA 2UXCJ 2CDRB 2GMJA 3KTQA 5F8LA 1UPMB 5CYMA 5DLFA 1RWUA 3MM5B 1HWJA 4M5LA 4C98A 2M8HA 3U1MA 2BEFA 5IFMA 1KSPA 1HARA 5ETQA 3SXLA 1JLFA 4QR2A 1O8BA 1CJUA 2HNZB 1SL0A 1FRXA 3P6YC 4DF4A 4RW4B 3RGIA 4IR1A 3BBCA 3QMQA 3PIPQ 1X4BA 1Z2ZA 3TOQA 3BGRB 3CT9A 4E2FB 3RR7A 5F0UA 4C97A 4EZ9A 2C3OA 1FERA 3L7UA 1FE4A 1YKWA 2JH3A 2RHSB 4F8RA 3K0JA 3HFZB 3QAUA 4B3RF 4DG1B 2AYMA 2RF2B 2Y0SD 3OR2B 2IC3B 3M2VA 4FP9A 1ICEB 5JUMA 3I4HX 2CQ1A 3NEKA 1DTQB 3H7HB 3W2WB 4LF6J 1NB2A 4LSLB 1S1VB 4ANDA 2WSCC 4AFFA 4RBUA 1UWBB 3Q89A 4PR6A 5B7WA 4NYZA 5C42A 2YWFA 5DQGA 5SZTA 2B43A 2A6OA 5KFKA 4GKKJ 5B0DA 1VQKS 4H4OA 3C46A 4O3OA 2BQUA 4IR9A 4IFVA 4RUCA 1UW9A 1S6PA 2XYGB 3OFFA 4DMZA 3HFKA 2JVRA 3ZNJ1 2IMOA 1EHWA 1CULA 1M1HA 3VAJA 4LF9F 2YVSA 2V4RA 4WK3A 4X2BA 1VQ7S 2H4WB 3PJ9A 1EIYB 1JJHA 1DTTB 3S6EA 4KHPF 2DNLA 2UXCF 3O3LA 2UVWA 1UJ6A 2Z2LA 2ZDOA 2X3DA 2EEYA 5JJBA 3EWGA 4WE1A 1H74A 2ZBQA 1WDTA 3K59A 3IS9B 1KOOA 3I5BA 1H2TZ 2GA7A 4FNIA 4BBYA 3C14A 1H2UX 1J2VA 2Y0BB 3DLGB 3IFEA 4JI2F 4Q45A 2P6SA 1VQOS 1T05A 1N52B 1ZETA 1VQ6S 1S1TB 1H73A 4OZJA 3KHRA 2MZJA 4ZDNA 2PI5A 1QD1A 4ETXA 1RHQB 2DR9A 3PX0A 4C8KA 1HNWJ 4FYDA 1RGVA 2D9OA 3BQ2A 3CULA 1RA6A 2W4CA 3HD1A 3CJKA 5I3QA 3P3DA 2MKIA 1NJZA 4DZ6A 3MUMP 3MD1A 1VHFA 4USWA 4FF3A 3ZO7A 4I6WA 3L7OA 2ZNZA 2ZKUA 2BABA 3KDOA 1HQUA 4U95A 2RQMA 2DNMA 4DR2J 5EN1A 3ZZPA 3QPIA 6AT1B 1VBKA 3O1LA 4E8UA 4PUOA 4OX7A 1Y9OA 1HWKA 1E6VB 4P73A 2DNYA 1QLNA 2XWYA 1VGYA 3QJJA 3KWMA 4N5SA 4KGZB 2ZZTA 4BLGA 3FFIA 1B7FA 1SJQA 1IKVA 3ITHB 4F4KA 1SC6A 5LXRA 4DOZA 4PYAA 1Y3KA 2B9XA 1PAUB 2E5HA 2HRYA 2WONB 5AXLA 3SCIE 1BQMA 4B9LA 1VK3A 5EWEA 1KKHA 1JLEA 5D78A 1UAWA 3PTWA 4YDDB 1SJ4P 3GR1A 1RLDA 2AGPA 2ZUGA 2VG7A 3QJLA 2DHHA 4WXWA 4QU6A 5HQ8A 2WBRA 1RAEB 3UCUP 5E3QA 3FBCA 1S7IA 2L9NA 2E1CA 2FC8A 2HFOA 2AGOA 2IIHA 1UJ4A 3MEEA 3H5YA 2GJIA 3IAS9 2AT1B 3GJQB 3GWCA 4P9SA 3I5CA 2G2OA 4URQU 4QWDA 2H1YA 5D3GA 2VBZA 2NSBA 2XS2A 4KBIA 3MCMA 2VBWA 3Q8VA 2W8LA 4J9SA 3W9JA 3A3OB 4ICLA 3OUYA 2C2RA 4IQXA 1B0TA 3BO2A 3CE8A 5G0RA 1F60B 1OY6A 4OZ5A 3UNYA 4WP8A 2FGOA 4F3QA 1KQSR 4NLSA 3VVTA 1Q8LA 2V68A 4Y3CA 2DXEA 3AH6A 2NZ4A 5HROA 3MZIA 3HSZA 4WYWA 2E1PA 5CHCB 4ZHRA 3M8SA 2IY5B 4ZP9A 3AOCA 1VHIA 3M30A 4EEYA 2FQQB 1Q8BA 2ZHOA 3BM7A 3T5JA 4KPYA 2YNHB 1Q86T 2BJDA 2YKMA 1WF1A 2WSEC 2H5IB 1VR6A 2C2NA 1RACB 2M7SA 4L75A 3U27A 1SI9A 3VTIA 4QWCA 3K5LA 4UY85 3KOAA 4DV3J 2CPYA 3C6TA 1UTAA 4J91A 4LSNA 3WDOA 2IPOB 2XCAA 1FVSA 4DUZF 2GCFA 2B8QA 3GB0A 4RW4A 1R27B 4X4RA 2HNDB 3BSNA 3JTPA 2Z56B 3UD3P 3DLHA 2J0WA 1GNKA 2E7WA 3M1VB 4EBEA 4DPOA 1RJJA 1ZTWA 1SIZA 4DEZA 2OPRA 3QJPA 4YP3A 1F9HA 2K3KA 2IC3A 1JXVA 1LK5A 2CWXA 3H2UB 3M2VB 1RTIA 4NA1A 4ZVHA 1SVDA 3ZTQA 4EO6A 5M2UA 5L1KA 1IBKJ 2V8PA 2AP6A 5J2NB 3MR2A 4F2SA 2DH8A 2G2YA 4CO0A 3UPFA 4H4OB 2V8DA 3A8IA 3EZOA 2K8GA 5EWGA 3TA0A 3CD0A 1J5EF 1D0EA 1VLOA 1S1XA 2FUG9 5D8HB 2F65A 1WOOA 1LXNA 1VQLS 2MQ8A 2LMIA 1PG5B 2ZITA 4A8QA 1T8EA 3BKTA 5GADU 2GVDA 2QTWA 5CYQA 1HKAA 1WG1A 3CIZA 5LSOA 4U7CA 3IN5A 1FVQA 2QA4S 1YHQS 2HZVA 1YLXA 2BW7A 1TUGB 1WKJA 2Q6BA 2BANB 2YWWA 3KLHB 2FY1A 1LW2B 4NLYA 2OPSA 1WI6A 2LQ8A 1RXOB 4O4RA 5HSPA 3BKFA 3R1HA 1VQPS 3VGUA 1MU2B 1NMEB 3O8WA 2DR6A 3DLEA 3VF0B 4DUTA 4DV0F 3P5BP 4CLWA 3MPVA 2MKCA 3GMGA 5FIIA 1RT4B 1XJWB 3V6DB 2RS8A 2QL7B 1AUDA 3ZTPA 3DDNA 2JSXA 2ZZNA 4PWDA 5KFBA 2E5LF 4K2JA 3IWXA 2PFFB 2VU5A 3WHIA 3CGIA 3K5MA 3CC4S 4I69A 5EUHA 5FLXY 4Q7AA 4W92B 2MQLA 4RW7A 4OX6A 4DCPB 1NK4A 3CJ0A 2YKAA 3GIRA 2DRAA 2MEWA 2DB1A 2H4YB 1WTBA 1RT3A 1MMDA 3EGWB 4J9PA 2B9YA 2R2RA 4O23A 4P2XA 3QYYA 2F1FA 3T5KA 2X51A 5E33A 3TO8A 4LF7F 3C6UB 4PXCA 2OMLA 2VG6B 1SQGA 2YWEA 4C11B 4X4NA 2QLBB 2HBZB 3DDIA 5HAOA 4DX5A 3RAQA 1R0AB 3FQKA 3G71S 1VBZA 1VISA 4HT5A 2W4PA 5ITHA 4DSLA 5CAAA 2ZC3A 1K73T 2RDIA 3KLHA 2KL8A 1KWMA 1IR1A 1EQMA 2YWKA 3IMQJ 4C4WA 2OPPA 4IDKA 1DBDA 1Q82T 2FLOA 1ZPWX 1RAJA 3N79A 4NX9A 3F44A 2YKPA 3QWUA 4ZVUB 1NO8A 4Q2MA 1DQ8A 1DLOA 1N0VC 3DLKB 2BVZA 4LF1A 1RZMA 3DRRA 2Q66A 2P9GA 2ZH5A 2UV8G 2OSRA 1XERA 1J27A 1T11A 1ZBTA 4TLQA 5DRKA 4ECTA 4O3NA 3RZAA 4BWMA 4CLLA 1YI2S 1BXNA 3P4UB 3PX6A 2G1HA 4RR5A 3KG0A 4Y2CA 2VJUA 3A8KA 4DS4A 3CCLS 3JSYA 4LQ3A 2E9RX 1T3OA 4FXWA 3IGNA 1JWWA 1W7WA 2MQNA 3PO4A 4B3RJ 1LWXA 1LWEA 4V19J 2FZKB 1M1GA 1NHKL 2EFQA 3DHXA 3EDQB 4DJBA 5A2QU 2QFIA 1W26A 2GAGC 2F7VA 3DXSX 4J7CA 3G9CA 4I67A 4KO0B 2FB0A 2ZH9A 4ICLB 1NHUA 4KIAA 4AQYJ 2C2OB 3OR1B 4OHWA 5KFIA 4ANEA 5KG5A 1L3KA 1KBRA 2CJQA 3C8YA 3VAKA 2WAQD 1RWXB 1U1LA 1J5OB 4YQWA 1QTMA 4RNHA 4NLUA 3D0HE 3THPA 1IBLJ 3M30B 1S12A 2V94A 5K14A 3VGSA 2I6WA 2AYGA 5LMUF 1AZSB 1M5OC 4TY8B 1YSJA 5A8RB 5DQHA 2K2PA 2RRNA 4KHMA 4HHHA 3W2VA 3CDBA 1REVB 2M4MA 2GVZB 4H4KC 2YY3A 3HT0A 4C8OA 1N0UA 1DLOB 4WFBQ 1SPBP 3V2UC 2IVMA 4BS2A 3DI6A 3NAHA 1KVKA 1OYEA 2W2OP 4UOHA 4UT4A 1FX4A 5KFDA 5MLCV 4G6VB 1X31C 4WBFA 4JYAJ 4YB6A 3BB5A 1NU4A 2DHAA 4ILRA 4I7FA 4Z7YA 2ZHBA 3TR5A 4KPCA 1RTIB 2RT3A 4OI2A 4HKQA 4LVOP 4PXDA 4CYUA 2HHQA 2XEXA 4BDPA 1OIAA 1UW4A 4JI4F 3D68A 4Y34A 4A8MP 3TQ1A 1M5PC 5AJ3F 2BOAA 4LRDA 4MJKA 3W1YC 1UFKA 4KO0A 4EZ6A 3CF5Q 1CJKA 2VOOA 3RRGA 2NXJA 2N3LA 2XHCA 2OUGA 4DPXA 2JOQA 3GJTB 3FBEA 5HLFB 3BF4A 2DR7A 3T6BA 5J1EA 2K1RB 3H5UA 5G4DA 4WTOB 1HYSB 1S77D 1R8PA 1WC0A 1VLYA 2Y9HA 1S57A 3HSGA 3V4IA 1K1SA 4JUZA 2L9DA 2Z2MA 4PWUA 2V2KA 4L76A 5ETOA 4W90B 4X4OA 1RAAB 3KK3A 4N41A 5HMXA 4NXNJ 4IUFA 1D8ZA 1HPZB 2LP4A 1FJCA 2ZJQQ 1R0BG 4F04B 1OPZA 3VAFA 3SV3A 4F25A 2IFXA 1VRUA 1PKUA 4D3HA 5IV3A 3PZPA 1GQEA 3J7AN 4RBVA 2WSFC 4I56A 1C1CA 4NLGA 1S6OA 5DZ7A 3NAIA 1EKRA 2W9BB 2GW8A 2NUHA 4FS1A 3A13A 3J81U 1MNEA 4O44A 1CJTA 2MHNA 1UETA 4ZN3A 2G4BA 1VMBA 1WF2A 1HI8A 3IG1A 4XPEA 2I38A 2QFJA 1UVLA 2OD4A 1FTCA 2DKOB 1TKTB 2I8EA 3AOBA 1FT8A 1RA7A 3HKWA 3NNAA 3R5JB 3F0NA 3VV2B 2VQEJ 4C11A 2LXUA 1JLCA 3GFZA 4QYZJ 4FN5A 1NCLA 3B78A 1SV5A 3MMBA 4G1PA 4DUYF 3EGZA 3HZEA 2MGZB 3SFGA 1TUVA 3OL8A 5J1PA 1GEHA 5HATA 3H40A 2AJFE 4DQSA 2C2DA 3VHQA 2N82B 2Y3YA 3H2LA 1DTQA 3G96A 2BXJA 2ZDPA 4ZS6A 4LSLA 2KB2A 3FMWA 3ZZZA 3D7SB 4G65A 4RUAA 3Q8PB 2VONA 1GXTA 2QRRA 3FQLA 2ALZA 1S72S 3I0SB 1HWLA 3CIMA 4I2QB 4WZMA 2IRXA 1RT7B 4Y2IA 3H98A 2HIYA 1D9DA 3HHLD 4PRFA 4URSA 3T5LA 2VQFJ 1LEOA 3QT8A 2AKWB 2FHOB 4DR7F 1W2BR 4QW9A 1VBYA 2HRUA 3FEXB 1V9OA 1UVKA 3RUBL 2W2NP 2UXDJ 2J8SA 3DOKA 3RRHA 2LFVA 3C3LA 1FXLA 4RNOA 1VC0A 1N32F 1HNXF 2EW9A 4ZIVA 5IV4A 1RADB 5DG7A 3CMAS 2BV3A 3QQCD 4KE5A 4O44B 5T7LA 1VJWA 2L9WA 2N7CA 2KU7A 3D6MB 1JLBA 5KG6A 4J9QA 2J0SD 4FYYB 4KGKA 2HLTA 5EX3A 4DV4F 1S0NA 3DM2A 4CLKA 2VIHA 2R7TA 1R6VA 2ZHAA 1H2VZ 4YB5A 1C0UA 1V5VA 1VBXA 1M5SA 2RE1A 4K7QA 1S9GB 4USHA 4O0IA 3DN9A 4AUKA 3BSOA 2MTLA 1NJXA 4JI4J 3FRYA 5F8NA 1TU0B 2XGPA 5HP1A 1GXUA 2CVIA 2GNKA 5LL6d 3CDUA 3UN3A 5KG0A 2YNFA 1FKPA 1HQEB 2GJ2A 5B09A 1G7CB 1T03A 5DDQC 4PXEA 3P5TL 3FRZA 2X1FA 4IFVB 1VRTA 1S4FA 4FVCA 4YUDA 1S59A 4RO0A 1QAJA 5KFGA 3HXMA 1F5BA 2IM0A 1OYDA 3ISND 4OX8A 4DF8A 2FVPA 4OX9F 1YBTA 1FKOB 5E3AA 4Z2XA 4OHXA 3CCJS 5CA5A 2J6TA 2MKJA 1NBEB 4RX6A 5HJXA 4B02A 4USMA 4YHHJ 3HK2A 2UVVA 3Q23A 1HBUB 2XZTB 3KK2B 1YG0A 2GIFA 1HMVB 3MPYA 1NEEA 2EFGA 3NWRA 3CJRA 4HDGA 4MKAA 4YR2A 1VQSA 2H5EA 3ICLA 4Y6IA 5F9NA 2KXNB 5L1JA 5CXTA 3RU0A 3MMAB 3G6YA 3RB6A 2C2KB 3I82A 3CJ5A 1YIJS 1Q1KA 2E7XA 4P7VA 5E5NA 4TQRA 3NG8A 4F26A 2OJ3A 1WI8A 5J2PA 4C8ZA 4HEA9 4DU8A 3N5BA 2PT0A 3KNAA 4LFAJ 4BC9A 3UDVA 1A7GE 2RH3A 3T1AA 5HMZA 2R8HA 5HLFA 4IO9Q 1X4HA 1ROFA 3P96A 1T02A 3OV7A 3PW4A 5HP1B 4LR7A 2QGFB 1L3SA 2F8EX 1X9MA 4DL2A 2FC9A 3I55S 2J5AA 3MECA 3MEEB 1ZAWA 3LWMA 4AL7A 3AA9A 2GHVC 3UCGA 3RW6A 5KT4A 3FUYA 3QO9A 3W5ZA 4NA3A 4OMFG 4JI7F 3N6MA 1HQUB 5KFWA 3EX7B 4DQPA 3PW7A 2CQHA 2F9JA 4GO5X 1T9YA 3GFYA 5KFFA 1F5CA 2FY8A 2K7JA 3D4JA 3DOLA 3MFHA 4NLTA 2RDDA 2HQDA 2DJWA 5G0RB 3KJFB 2IHR1 2XSJB 1NZ8A 2ZFHA 3LH2S 2P8IA 4LVNP 5DDRC 3GSDA 5D0HA 4HTIA 2YKOA 2ZH3A 5B0EA 3PFEA 5HROB 2G1DA 4NYPA 3S7RA 1U1MA 1QSSA 2NQPA 2OD6A 2GX8A 2KXHA 3K17A 3NGTA 2MYFA 1EB0A 3JB9k 3SZ2A 3HM9A 2XQCA 2J9CA 3L7PA 4DR3F 3J80U 3TX0A 2HGLA 1XNRJ 3MMAA 3ZNUA 1AT1B 1X5SA 3H2VE 3TAQA 5IS2A 2M3DA 1CJVA 2ACMA 4C8MA 1ZAVA 3I4PA 3UDEA 3GJRB 1V3ZA 4WE1B 1CQMA 3CMQA 4DV2J 3J81Y 1SB6A 3AA8A 3C14B 3DLGA 1JKHB 2DHXA 2XBPA 3DYAB 1XIQA 4OIXA 4P2MA 2XLJA 2L3MA 1HD1A 5J1NA 1NAQA 3JYTA 2VH7A 3UD5A 1X5OA 4KB7A 4DFKA 1LW0B 1YTYA 1TK8A 3JSRA 3RG6A 1EARA 2H51B 2OFHX 1C0TA 2FLNA 4WKRA 1D1UA 3EYZA 3PEHA 3MUVP 3MAHA 1JQGA 1XMOF 2DT9A 4NLWA 4I2QA 1FDBA 2A0FB 2LVWA 4M5IA 1S9EA 1XK8A 2MZTA 3HSJA 5BYQA 3HVTB 4NZ6A 3TRGA 5DDOC 3KLEA 1UVMA 2KZZA 1EP4B 3G6ES 4CM0A 4C0OC 3MM6A 4BCAA 2A1BA 3BO4A 2XULA 3KLGB 3MEDA 3NXZA 5T14A 4C0HA 1UA1A 1T9XA 1U6ZA 2C3MA 2IJNA 3TUZC 1P8GA 2RD5C 2MQPA 1HNIB 3TA2A 3N01A 3DRYA 5ETMA 1IKVB 1I1GA 2MSTA 3EXCX 1O5JA 4OI3A 3RBXA 3SDEA 3IR7B 4DR3J 2LDIA 1U49A 1K1QA 2ZD1B 2V50A 1CJVB 4JYAF 3JXOA 5DG9A 4ER8A 3NL0A 2PE8A 2R7VA 3H20A 1RTJB 3IWLA 4DX6A 2YNIB 4RW8A 4N56A 2EKNA 4E98A 3KG4A 5GVQA 3G8SA 5JMNA 1BWVA 2CRLA 1TL1A 1OPIA 2RNEA 2H65B 2LKZA 2AF6A 3MEGA 3TEGA 2C2EA 3GFHA 4PEOA 4DN0A 5L1IA 3N9UC 2C2MB 1VQ4S 4OYBA 2HVDA 2CQCA 2OP5A 3BDEA 2DHSA 3QGPA 4I6AA 2ILYA 4KFBA 3K89A 4CCHA 3E2EA 2R2TA 1VRTB 5AJ3J 4CLZA 2QYCA 4G1QA 1X4AA 4C8NA 4Q43A 1SL2A 2QLWA 1XR7A 3KLFA 1WNEA 1SIWB 2IJFA 2NYIA 3LAMA 1NDCA 4HT7A 2XMKA 5A8WB 1EZZB 3V5RA 3KHLA 3M2RB 1ZM2A 1CS4B 5A8KA 5CZVA 3OLBA 2OO4A 1KHWA 2XNQA 4ZVFA 5L9XA 2FGCA 2VG6A 2UV8A 2BANA 3MF5A 2H9ZA 3MHYA 3QGIA 4M5DA 4WFYA 3SQGA 5L9NA 2KH9A 3KJVB 2B5JB 3TAPA 4LRFA 2MXYA 4ED5A 1G4CA 1PJ7A 1P6TA 2WVCA 4IG0B 1RHUB 1TKDA 1YRTA 1WG5A 5HMWA 1M0SA 3LP0B 2DNHA 4DSEA 2KRBA 4WP9A 2EBGA 2KM8B 4DL7A 3SDEB 3MM8B 3L95X 2IYIA 4OYWA 2LEBA 3R97A 4KHPJ 2GQCA 4OYIA 2Z30B 1WC4A 3C6TB 4CP5A 5H9EK 1X4GA 4N8OA 1RLCL 3T1YJ 2HMIB 2ASJA 2MKKA 1RKIA 4MIWA 1A6LA 2DH7A 2RU9A 4LR8A 4DV1J 1WACA 4RW7B 1OY9A 4CRJA 3GG1A 2CQBA 2OPRB 4ALZA 5HI7A 3NLCA 1VFJA 3AXMA 4IOBA 2PFDA 2HGMA 4KFBB 4OFZA 1FO1A 4RW9A 2FJXA 1SKUB 1IQTA 4RKUC 1HBNB 3AY0A 4CO4A 2CNOB 4R5PB 1UCNA 1OSDA 4DHVA 3C6UA 4N7TA 2Q3PA 2ZUAA 1N5YA 3N4WA 2AYBA 4I6YA 2R7WA 1KFSA 1UP1A 3TNVA 3ZTSA 4ZK7M 4LF7J 2BMBA 4DR5F 1H72C 1CS4A 5AXKA 4DG1A 5A8KB 2CZ9A 2JNJA 1H7XA 2VC0A 2ZBIA 3BO3A 3HO1A 1Q78A 4ID5B 2E1MC 1KVJA 3CCWA 4JI8J 3TZXA 3PXGa 4IOCQ 2HFUA 3BZQA 4MKYA 2HS0A 4FDFA 5CABA 1AZSA 3NGUA 4GKJF 5HQMA 1L3UA 4OX9J 2NSCA 2ZH2A 5JXSA 1JXLA 4M5HA 4NCGA 4YHHF 4DR6F 3D1OA 2R2SA 1PBAA 4OZ1A 4KGMA 3D66A 2KM8C 2DNRA 7FDRA 2VBXA 4X62J 4MFBB 4DBQA 4EUVA 3MCSA 2R7QA 2AJ0A 3H25A 4DSIA 4CO3A 3UDLA 1AYEA 1UEUA 1B7YB 1C1BB 1Z1ZA 2EPIA 1LW0A 4I7FB 4ZVPB 1BD6A 3V4MA 1QAYA 2V69A 4FZVA 4N47A 4YB1P 4M95A 2HFNA 3VALA 4F4WA 2P9EA 2EK1A 3OTEA 4WIQA 5KG2A 3PO5A 2XB2D 4Y65A 3DMJB 5L39A 5E3PA 5I42B 1T9WA 2RVJA 3Q0AA 3OW2R 2V9WA 1WELA 5DJBA 3JAMU 1C2PA 3MM6B 1UKUA 1WSRA 2BW2A 3DU6A 3HZGA 3ZZTA 4U7UD 1VQNS 4ILMA 2DITA 2HGNA 4KV8B 4ZLPA 5T41A 2ZH8A 3EMTA 4ED7A 2VFUA 1YJNS 1R0AA 1SC1B 3BPDA 4CO2A 4QW8A 1HNIA 1I5OB 3I9ZA 4LREA 4OQJA 4NRUA 4G1IA 2F40A 3M6XA 4HHUA 4K5SA 4PABA 4DPTA 4AL5A 2NXCA 2IM3A 4OYOA 3JSMA 3D1QA 2LYVA 5BR8J 2HSEB 3SFUA 1O6XA 3VAGA 1Q8KA 4OLPA 1NKCA 1DARA 4J9VA 4NLDA 2F4VF 2Q79A 1N36J 2DXDA 3D9BA 1PIEA 2DNQA 2DNKA 2HQ3A 2KN4A 1RT5B 5CCLA 1HR0F 4LQ9A 1PYSB 2WCXA 2YPZA 2IRUA 3HHEA 2PGCA 3MM5A 2PD1A 3PACA 3OHAA 4DUZJ 3VQTA 1FNMA 1VIOA 1RT1A 2GGPA 4ZCLA 5I3PA 3HI9A 1MMLA 3OL6A 1UJ5A 3DGPA 1N5SA 3BBBA 4TNOA 2QA2A 3QRQA 2IBKA 1T94A 5F41A 1Y10A 3I56S 2JX2A 2IVFB 4P71A 4WJBA 2ROPA 3RYLA 2XS5A 2D74B 3LW5C 2A10A 2YKQA 4LF4J 3HHLA 1HA1A 3KMSA 2ZBPA 3EXYA 2IAJA 1JLCB 3PKYA 4OYPA 1ITPA 2MPUA 1N4LA 1S1VA 2ZM6F 4HLBA 1OJ4A 4FPIA 4H4MB 2R7OA 3OXGA 1JLAA 2KHCA 2JDJA 4I68A 3M9OB 3CC2S 2YNGB 5KFUA 4Z37A 1J5OA 3EGVA 5F9LA 2MB0B 4V1Ak 4CH1A 1AROP 2ZE2A 3CJ8A 3EGNA 2MQQA 4K8RA 3BYRA 5KFSA 3QSYB 5K14B 1R8BA 4XPCA 2PC6A 3EPGA 2EFOA 1XBWA 2F9DA 2WOMA 3BH7B 4DZDA 1CC7A 1NH8A 2XI2A 4U8VA 3KLVA 2HPUA 4J37A 1Q53A 1U7LA 1WTFA 2W24A 3TQEA 5L38A 4B9VA 4F3OA 2BE2A 2CPEA 2FJVA 3M8PA 4LSZB 3EPIA 4ZPVR 2HHHJ 3M6UA 1N34F 1HNZJ 4ED1A 2WTFA 2RJZA 3DI6B 4LRBA 5ETVA 4JI0F 5KFJA 4KKOB 4UUWA 3R9LA 2GFFA 2DGQA 4ZJOA 3ZZYA 1I94F 1D8YA 4B3TJ 1V5IB 2NR0A 3G6VA 1FDDA 3SSQA 3R2CJ 8RUCA 2Y1IA 2JWNA 3T6JA 4DFMA 4Q0BB 3RB0A 2HHSA 1LWFB 5GMEA 1T05B 1YQHA 3AAWB 1FF2A 1NH7A 2CA9A 2IVYA 3GE9A 3HDSA 3HX9A 3IR5B 4FVMA 4IH7A 4ECRA 1KD1T 2EC2A 3EVOA 3A8JA 3M7VA 4JBCA 4PG4A 4CZCA 2R8GA 3NS6A 1WD6A 1F3VA 1L3TA 4UQTA 1UMJA 4YB7A 3W5YA 5GAHI 1JIHA 5AE3A 3C66A 1FI4A 4HYKA 4H4MA 2R2UA 2QEXS 4K4UA 1F9EB 4AYBD 1GT8A 5J1EB 1RT7A 1PCAA 3CCUS 3HVRA 1N88A 3PYEA 2XTJP 4X4PA 3KDNA 3K58A 1ZZFA 2CQGA 1GX6A 2EVZA 3FJ2A 4PPDA 1NK7A 2R8KA 4KT0C 5BYRA 2COLA 5KFYA 2FJDB 4P2SA 5D77A 3DOKB 2X3GA 1RE1B 1YVFA 2XC9A 2ASYA 3E01A 2UVUA 1HFEL 3CD5A 3FCHA 3M8PB 3AJDA 3LA0A 2BQ3A 5DDPC 1DURA 5T7LB 4DX7A 3Q8SB 4JP8A 3M8QB 2CQ3A 4UY8T 1QE1A 3UE2A 3P49B 3IM9A 3MMCA 3DM2B 3MOJB 1RAIB 3AD9C 1FA0A 3ZTOA 4DV1F 3RR8A 2VG7B 4KH1B 1LWFA 2LLZA 5J2PB 2E44A 1RCOB 2O01C 2HZCA 1Y5LB 4UOGA 4ZPTR 5AT1B 1AB8A 1SH0A 3JTNA 1D9AA 2IM2A 3QWPA 4LIRA 1T03B 3NNHA 3ULHA 2LQJA 1KP6A 2JC1A 2UUCJ 3AQPA 2Y1LB 2VDIA 1VRQC 2MJUA 4OYMA 4A48A 1U2FA 2BACA 3MECB 1SJ3P 2PN6A 5ADZA 1X4FA 2AU0A 1NK6A 1LNQA 4DR5J 4KGXB 5AE1A 4FKYA 2IA0A 4A8KA 4MAKA 1FKOA 4JV0A 3R1LA 1NB7A 4IKAA 4UF4A 4Q8EA 2DK2A 3GG0A 5F0WA 1TL5A 3MCOA 1JLGA 3VCDA 5FLXU 3PR4A 3WQPA 2DCLA 1EQ0A 2OFGX 4P72A 1U48A 1MSWD 4RU2A 1TELA 2FYXA 2GHWA 5J2QB 3CEDA 4RWXA 3VWSA 3ELHA 3GCWP 4NEZA 4OZLA 4F0MA 2GC8A 1HNVA 1YX2A 4L74A 2CAJA 3B54A 4WU2A 5D6GA 2DGSA 2FPHX 2MZSA 5IT4A 2R42A 5KFXA 1WKLA 3CCZA 3Q8UA 3DGPB 2P6TA 2YKNA 2BOPA 4QIEA 3NNCA 1CEZA 3DDKA 4NPOA 4P10A 4AE5A 2HNDA 3NGSA 2CPHA 1YGYA 3V6HA 2VA2A 4XAKA 5EHHA 1FX2A 3PRVA 4WK1A 3MR7A 4XDDA 4DFJA 1PC4A 1S9GA 1G3OA 1H6KX 4USIA 3NRBA 4C3MA 3VAHA 2ASDA 3Q83A 4NLQA 4ZVOB 3O6QA 1DZ5A 2VV5A 1WC3A 2HQFA 5J2NA 4IFYB 1X0FA 3FEYB 1HHSA 2Y8YA 1EETB 3CJKB 3HFVA 4NCAA 2DIVA 1SJ1A 2AJ1A 3UWTA 2RRBA 3P8BB 3W7BA 4DR1F 2YNGA 3PW0A 1YJ9S 5HK4A 4Y2KA 4A4JA 2QMWA 2ZOMA 2OH2A 3J81j 4CLYA 2W4DA 5IM0B 1W2IA 4J9KA 1PGZA 3DC2A 4K0KF 2XSJA 5KG7A 4LR9A 1JLGB 1TQLA 1TKZB 1X60A 1TKXB 2QE5A 2KT5A 2LEAA 2DGUA 3DNCA 1B4SA 4OZNA 3AOAA 3KUEA 1TK5A 1ZS6A 2QLXA 4ZITA 2M2BA 4KAIA 2W2QP 4WKYA 2HZAA 5CYMB 2W1BA 1TMMA 2OPSB 1PYTA 1YRUA 3PJWA 1CBKA 4PPZA 4YDXA 2CDQA 1IWGA 1JLEB 5GAEU 4FYVB 1PJ5A 1RUSA 3DRSB 4NEYA 5KT3A 3WX8A 2DH9A 2H54B 4Q0BA 3H8YA 1URRA 3CDAA 4R8UB 1N33J 1JJ4A 2CPZA 3CSKA 4OV1A 2DEIA 3N6LA 4RW8B 4ZKAA 2YQ3A 3D5MA 3MPWA 1NNDA 4ZPWR 2NYHA 2YH0A 5IC4B 5J2MB 2GQQA 1NZAA 3ZXWA 5KT5A 5A0YA 1RAOA 3OVSA 3MEGB 1SJRA 3N5FA 3PHTA 2KYZA 4R0JA 1KEKA 4FKXA 3WBZA 2YH1A 1NPKA 1Q4RA 4MIAA 2W7OA 4E0DA 1KN6A 1XTZA 1PYOB 2VG5A 4EO8A 2PMHA 4LF4F 2Q6CA 1QUVA 3FMBA 3KLEB 3QO9B 2HHWA 2KFYA 4JI6F 3GJSB 1TAUA 2DNPA 3BR8A 3MEDB 4HH1A 2RUGA 1OQ3A 2CPIA 4WYLA 3ZTRA 3RBDA 4NXMJ 2UUAJ 1NK9A 3QAEA 3W3SA 2CPJA 3LPEA 1IKWA 2HG4A 1QAIA 2YBVA 2C3PA 2FJAB 1P1TA 4QR1A 4CLUA 2JRSA 2JLEA 1RWMB 3VR1A 4O3PA 3E51A 2HVIA 3G87A 2F8MA 2B5JA 2ZH6A 1YBUA 2BJ3A 1SQEA 3TUIC 4XDCA 2ZD1A 3PEJA 3OTOF 1Z4UA 1IUJA 2FVCA 1RAGB 2HHHF 4Y2AA 3SV4A 3R6LB 5DGAA 4EYIB 4NLVA 3OJSA 2QL9B 3DRRB 1KQKA 3DRSA 2HQIA 2XYHB 3BEGB 3OFEA 4TLRA 2E1AA 2AX1A 5KAKA 2Z2ZA 1HR0J 4G3IA 2MHEA 3PHEA 3NCPA 3GZ7A 3R5AA 2GZOA 2XHWA 4IH5A 2UP1A 4NI2B 3CCES 2HLUA 2V34A 1SJFA 3Q24A 4PQUA 3EVWA 1JXEA 2HFVA 5DLGA 1U1PA 4U7UK 3K57A 3QIDA 2DIUA 2HAFA 5EWFA 4K50A 5K8PA 4L73A 5KFEA 2A18A 1K8AT 3BREA 3N0VA 4QYZK 2HURA 2AJQA 4Y2MA 5AXMA 1XEZA 5D0EA 1ZH5A 5DZ6A 2CQPA 4TYAA 2B9EA 4LBPA 2IM1A 3BYPA 1TFYA 1C0TB 2JLGA 2MLXA 5KFOA 2A2DA 5LJ3Y 1AFIA 4USVA 4K4SA 2VC1A 2X7IA 3QLHB 3MDFA 2KG1A 1F2GA 4I0WA 2CJXB 3JS9A 2KDOA 2OKQA 1WHXA 3M8WA 3KJVA 2HHVA 3D28A 1F3FA 4DU7A 3IM8A 4JV5F 2MSSA 2H5JB 2JHEA 1ZA2B 3ITHA 2R9LA 1MN9A 1GXLA 2CVEA 3MEKA 2BQRA 3HCXA 1FXRA 3AB4B 2U1AA 3MM8A 2CQ4A 2WONA 2B3TB 1IBLF 1GH8A 3EUNA 3AJ2A 1X4DA 2PA8D 2Y1RI 3T3FA 4KYZA 4ZPCA 3GV8B 3OSNA 2ZVSA 1KLNA 1BWEA 3HULA 2C2ZB 2YKNB 2HQGA 1SBRA 1F0XA 1UZHA 2C42A 1QJHA 2M9KA 1PAEX 2XMVA 2VFRA 1SH3A 4MYUA 2MQOA 4NCGB 1ZYQA 2VKRA 2PIIA 3JTOA 1WEZA 1RTJA 2KG0A 2NXUA 3A4TA 1KRPA 3CWJA 3GYXB 5C24B 3W60A 1RYRA 2GQ2A 2QN6B 2VFVA 3MTJA 3VGTA 1YITS 2HHXA 2Y8WA 2DY9A 5J2MA 2QMXA 3R3TA 3BGLA 2XY5A 3V81B 1T9VA 5D3GB 4O3SA 1HBNA 1KFDA 5F8IA 2WVFA 4JI5F 3IR6B 1EETA 1C1BA 4NL5A 4J9NA 2BR0A 1KVIA 2KVIA 2OI2A 2VPXB 3OTCA 1VDHA 1VK8A 3TVYA 3UVJB 2W9CB 3PW2A 4W4MA 2ATCB 2OLWA 4G1QB 4OI6A 5LSRA 4XK8C 5MAOA 5LMNF 1YJWS 3B4DA 4YOEA 1AUSL 1S1WB 4JI7J 1IKXB 4LUBA 5L8RC 1VQMS 2LA6A 1BGXT 5A8WA 3CPWR 4CLSA 1XNQJ 2GIQA 3GYNA 1TKXA 3HVAA 3KYLA 4ZHRB 1RU1A 4NMXA 4JV1A 3ETMA 1VI7A 5DG8A 2XNRA 1EAYC 2BM0A 2EKYA 1I51B 3ETOA 3FKBA 4M5DB 2DGTA 2M70A 3A1YG 4IDKB 5LOQA 3MFIA 2VHGA 2NZCA 5L1LA 4DQQA 4IYQA 2X1BA 4LF9J 4HL9A 4B9SA 3LP0A 1MN7A 4IG3A 1VRUB 2U2FA 2EC0A 1YK9A 1NJYA 1GK8A 4WPAA 4GKKF 4ZP6A 1U1RA 2D1CA 4QU7A 3T5HA 1B64A 1WWHA 5CCMA 4I2PA 1S0MA 4U6PA 3B8HA 4LBIA 2XCPA 1EX8A 3TWZA 1DQAA 1NKBA 4DV4J 3J7YU 3GR0A 2QLJB 5A0YB 1LWCA 2AV5A 3EE3A 1U2RA 2BM1A 1GFWB 2L08A 2YTCA 1F6TA 3F56A 2HAIA 4ZP8A 2NS1B 2XGQA 1A9NB 4JI2J 2UXBJ 4A8WA 5GAEI 4ZCIA 2ERRA 2B7BB 3BN7A 1O51A 2G9OA 3MMBB 4TVAB 5U47A 3ILOA 1HHTP 1FJ7A 1MMNA 1IKYA 3QIPB 4ENOA 4EGLA 4QJVA 3OD2A 5DGBA 1L5UA 5B0FA 2ACYA 1RWKB 3NCQA 3DGVA 4HDHA 1TVRB 1Y00A 4PG8A 2HHTA 3KLIA 3DFEA 2DXFA 2HFZA 1UFWA 2ZC4A 1NHVA 4MTPA 4O3RA 1JLAB 1Y3JA 5DM6Q 2DGVA 2K06A 5CYJA 1FK9B 5F3ZA 4ZVRB 3KK1B 3KUGA 3ENAA 2HFSA 4F50A 1DY3A 1WORA 2VL1A 4PYDA 4RWWA 4L3NA 4C48A 4B3MJ 2VOPA 3I0RA 4AXIA 4NOHA 4M1KA 5KFQA 3D0GE 4YFUA 4LRAA 1R3NA 5E2QA 2CG4A 4RBTA 4J9RA 4PWDB 3DRPA 1RT6B 3HP6A 4DPYA 4F4AA 5LJ5Y 4DS5A 1XWLA 3W66A 1ELOA 2J6UA 4QIFA 1N32J 1Q95G 2OAUA 1RTHB 3THVA 1GX5A 1TMJA 4PCQA 2I5JA 3U1NA 3G4SS 5A76A 2DPIA 2JEGA 4F36A 2EFVA 5HBMB 4NYOA 4RUBA 3D2WA 1RSCA 4ZJQA 2J9EA 1TL7A 2KRRA 2CKWA 1R7IA 2EFNA 2G0CA 2ZOGA 3FZBA 4UUXA 2XZDB 1CJKB 4ZVSB 3PDNA 2L48A 1NJIT 1U45A 3L4BC 1QSYA 3CJQA 3CNQP 3FK4A 3M2UB 5KFZA 1R6YA 1T0TV 3GSIA 3QBCA 2W9AA 1IKYB 1KHVA 1S99A 3PY8A 3QZ8A 3IWNC 5KFAA 2E1RA 4NCBA 2XMJA 2AMCB 3TW0A 2WBMA 4U67Q 2OPQA 2I0XA 3GV5B 3D3BJ 4LRCA 1TVRA 3F73A 3KLIB 5K5MA 1FRKA 2HWTA 2RSQA 5F3TA 4NXNF 2F3JA 4X66F 3BV8A 2DR5A 4QCLA 4HHJA 4NLPA 2HVEA 3Q8YA 1J5EJ 3ISNC 1UEKA 3NWGA 4TU8A 3MPDA 4NE9C 2LU1A 1AXQA 4KH0B 2WVDA 4GVBA 3JQMA 2B51A 2K7KA 3DLKA 3LOUA 2UUAF 1KOHA 1PC5A 3V6JA 3MCNA 1G2EA 4WCEQ 1HBUA 1OSCA 3SSRA 3CJTA 1IN0A 4ES2A 1UPPA 2RMLA 2XLIA 1XNRF 1YWXA 1RT6A 1T95A 4Q44A 4X4SA 1UVNA 2D41A 1PSDA 3ENVA 3BGFA 3I5AA 3VVUA 4RUHA 3CD6S 2B4PA 4ZJLA 3I31A 1TTHB 3LP1B 1KTQA 2PMWA 4MH8A 2JC0A 2I5JB 3L09A 3CVKA 1WOSA 3MMCB 2DNOA 3EICA 4KSEB 3SCLE 3QGHA 2V2QA 4EU0A 5BXIA 4TXSA 5B08A 2EK6A 3BKUA 3LQVA 4ZPAA 2ZJRQ 4F4YA 3MM9B 1N33F 2VB6A 2ADCA 4F0HA 2UXBF 3KG1A 3OL9A 1D09B 2E5JA 4CTAA 3RRKA 3R2DJ 4RL1A 3W8GA 4O3QA 1QVGR 3PYGA 2XMAA 1FCAA 1RAFB 3CJ3A 3HHLB 3WZ0A 4HTJA 1OQ6A 1IKXA 1YZ6A 5AXNA 1S0VA 4K4VA 2HHUA 4ELUA 2HW3A 1PO6A 2APOA 2BJ1A 1XMOJ 2OIHA 3R7SB 2GMLA 2ZZMA 3HVWA 1FRLA 3I0SA 4P75A 1RP5A 5K8MA 1FD2A 2HS4A 2Q1LA 5D4NA 2GIRA 2B8PA 3FSYA 2OEMA 3L9ZA 4O0NA 4DSFA 1TL3A 3AB2B 5ETRA 1TV6A 5H1SV 1M90T 1WKKA 3ZZ0A 2N3OA 4M8LA 1U24A 2FDNA 3AD8C 2UU9F 1ZM9A 2VDHA 3QNWB 3M8QA 1RBOB 9RUBA 1H7WA 1NK8A 1SKWA 5I4MA 3CW2C 4QIWD 5J2QA 1IWAA 4DR4J 2A2CA 3RAMA 3GTYX 2BKPA 1D9FA 4KKOA 3OFGA 5D4OA 1SC4B 1VQYA 5EX0A 2V9KA 1HHQA 3LUYA 3R8YA 3TAMA 1S6QA 4CYUB 3S8SA 4C9DA 3IGVA 2EWHA 3CXCR 2RDJA 2PI4A 3PW5A 3D54A 4GC6A 2D9PA 3DLBA 1XMBA 3O2IA 2KI2A 4FF1A 1R31A 2J7WA 4XIUA 1T9UA 3AQOA 3M05A 2AEMA 4IH6A 4NZ0A 2RF2A 3QIPA 1X0PA 3H5SA 1FFWB 3IBCB 3R5BA 2A6MA 3OPKA 2K1RA 1K44A 4A8YA 2UUCF 4NLXA 5IWAF 1OWXA 2WHOA 5KOXA 2HWHA 5CH7B 1MWQA 1UL3A 4FYWB 1VQ5S 1HD0A 3B4MA 1S79A 1Q7LB 2RUSA 4M5NA 2QO3A 4RW6A 1S9EB 4K4YA 1M1KT 1S76D 1CG2A 3HVTA 4QWBA 4CI0B 4EI2A 3FEZA 2RQCA 3TI0A 3KK3B 1IQZA 2M5YA 4DR2F 2XMTA 2ZBRA 1V6HA 1VS3A 5BR8F 1HW9A 2AZ1A 4ECQA 1TL3B 2D69A 1O0PA 2FJBB 2FZGB 3LANA 3WIUA 4M5KA 1NM2A 1XNQF 1CULB 4FXDA 4DV7J 1UZDA 3J7ZT 1RTDB 4ZLJA 2IYGA 1PILA 2JEFA 2N7YA 3KJQB 3OTDA 4FPRA 3DRPB 1JX4A 2ZWOA 1HNXJ 1G1XA 3LAKA 4WZQA 2E5LJ 1T9TA 3SI8A 1XC9A 1VIXA 4A47A 2ZJPQ 4DL5A 2XO6A 4ECVA 2ILZA 3LP2A 4N77A 3SEOA 3PVXA 2I2YA 3H59A 4B08A 3GIKA 1MWYA 2YX1A 3TAMB 5HBMA 5HVHA 2UUBJ 1A0OB 4B9UA 3CJSA 3GIMA 3GFXA 4DSJA 2D3OR 4Y28C 1WC1A 2LQ9A 5A6WA 4JI5J 4DL3A 3WX4A 2C28A 5B0CA 3M2UA 4RNMA 1B3TA 2F63A 4PG6A 5E41A 1V3RA 2RHQB 2V2VA 3BJYA 2OPQB 2E5IA 1GMWA 3JQJA 1G6BA 2CJ9A 4WIIA 2PMZD 1WHVA 2B0GA 2VG5B 2OGUA 2X1GA 1FD8A 4F4ZA 1RABB 2AD9A 2V67A 1YJTA 2LEPA 4GVBB 4WF9Q 4OI4A 2BRLA 1BQNA 5CZXA 1F2HA 1RT2B 4L3KA 4JI1J 1KQGB 5DS7A 2XM3A 2HHPA 4IG0A 1U8WA 4NWBA 1BE4A 2ZBCA 4WFZA 3CD7A 4TQSA 3FSIA 4ATNA 4U96A 1GAOA 5KFNA 1X5TA 3NOCA 3IC1A 2NCKL 3PRBA 1BQMB 3LP1A 2KZMA 1WHYA 3HJVA 3X1LB 1HBOA 3NKYA 3QSIA 3QT7A 2MKSA 3TVKA 1JMTA 2QJ3A 5HANA 3PJXA 5AE2A 2N4DA 3KFWX 1N5QA 4UZCA 4QZVB 4C3LA 5HO4A 3IA0A 2XMWA 1K0TA 3K7RA 2LDYA 1JKHA 3MR6A 3T1YF 3D0IE 2DBBA 1WF0A 2FHJA 3TP2A 2C1EB 4DCOB 4F67A 2FZCB 3CCRS 3T1HJ 1LOUA 2XSFA 5C2CA 1YRXA 5D0RA 4NZ7A 4IO1A 2G2ZA 1SKSA 2KKHA 3MI7X 3HSDA 5ETKA 4HR2A 4YR3A 2VQEF 2W01A 2W2PP 4B9TA 1JK9B 4PKDB 1H3DA 3RW7A 4CH7A 1WSVA 1ZM4A 1P9YA 1LFPA 2H48B 5B0GA 4Y0FA 1WG4A 3HPOA 2EG2A 4DI6A 2ZVIA 4MK7A 2FVRA 5F8HA 3UD4P 1XMQF 3C19A 3AD7C 1REGX 5B0AA 1D3WA 1HMVA 2WVEA 1CC8A 4QQBA 2LXIA 2DNZA 1KQFB 2DVIA 1BLUA 2CADA 5IQ6A 3RB4A 1DTTA 3OTBA 2OPPB 2R8JA 2GO8A 1IJEB 4EFAC 2WB1D 1IR0A 4GVLA 4TY9A 2MY7A 5C5JA 2F4VJ 4KJIA 4MT1A 2XYPB 4OJHA 2IA6A 1NPPA 2POKA 2VD3A 3F41A 1AA1B 3UO0A 2MZRA 5IT0A 4OZ0A 4NA2A 2AEFA 2DRDA 3ENWA 3MWBA 1JJ2R 4MKBA 3UNGC 3MURP 1F9FA 5F8MA 1BUXA 2GO9A 2P5VA 2UUBF 4R8UA 1TL1B 2DTJA 3MMJA 4HI2A 4OYAA 5LSLA 3VAMA 1FWKA 5FDLA 3G8QA 4ZVEA 2ATLA 1FNXH 3AT1B 4FNHA 3HLUA 2CJBA 4OV6A 5K8OA 5D4PA 3MXHP 5E3RA 4J9LA 2RQKA 2UUTA 1Q5VA 3OHBA 1SCJB 1QTNB 2J9DA 2AIRB 3FGVA 3CO9A 5KOWA 4C3KA
chains in the Genus database with same CATH topology
2EBEA 3KLFB 3NMRA 4JOUA 2AJ4A 4FF4A 2FVQA 2W9CA 4DX8H 3M2RA 3M6WA 5KFPA 4YEAA 1DRZA 4B3OB 4LMZA 1CSJA 1S1WA 4QR0A 1HI0P 2RB7A 1BY9A 3CCSS 3DLJA 1U6FA 4ECUA 3LPYA 3R27A 5CYQB 4A8FA 2Y1JA 1LFWA 4I64A 3CCTA 1ZTTA 3NS5A 1NJWA 5BJRA 1RKJA 4RU9A 1U1NA 4TY8A 3DLLQ 2LA4A 1LW2A 4OI0A 2O66A 3PV8A 3LP2B 1Q81T 3DLEB 1XR5A 5DO2A 2KJVA 4PKDB 3A8EA 3OQ2A 3Q2SC 1HL6A 2QSFA 2B6AB 2CQ2A 2YX7A 4ED8A 1CPZA 3X3UA 4ZA1A 2OTJS 4ED3A 3THTA 1JB0C 4USJC 2R7XA 1NRKA 2LQ5A 5M2RA 3WC2A 4BHQA 3CMES 4EWTA 4JI3F 7FD1A 2RKIB 4L72B 2L41A 3ONQA 3FZ2A 4HH0A 2CJKA 4KC5A 3FSXA 2I1RA 3KNGA 3MOZA 1CVJA 4ECYA 3I87A 3QLHA 2F8HA 2HNYA 1BQNB 1HI1A 3H4DA 1VC5A 1ULRA 3RB3A 1S7HA 1TR0A 3K5PA 5K8NA 3MR3A 2V5HG 2YKMB 2JVOA 4J5OA 4LJMA 4ZPBA 2ASLA 2MKHA 2JJ4D 2HIQA 1HBOB 4X84A 5GAGU 4LSNB 4M94A 2ROGA 5IXUA 2AQ4A 5C25A 2YWGA 1LQ9A 4MFBA 4QPXA 2HS3A 3J7YI 2J7KA 4DR4F 4NLOA 3S01A 3VAIA 2Z8QA 1XR6A 3UR3C 3CJ2A 1R43A 2RKIA 2GV1A 4PG7A 1MW7A 1TKTA 3PM9A 4U9RA 3B82A 3HT3A 4ES3A 3DMJA 5CQGA 3NP5A 3OR1A 3I6PA 2RIJA 3K2YA 4Q2LA 5JVGQ 4DN9A 1GTEA 5LT5A 2J7UA 2YWHA 1S0OA 4KV8A 3M32B 4OHZA 3SQGB 1FK9A 4K2XA 4DDFA 2DD8S 3DCAA 4ID8A 3M9NB 4C8LA 2XI3A 1FDAA 3I96A 2Z0GA 4QOTA 3TARA 2J6SA 3PKMA 3Q2TC 4YOEA 2DHGA 1REVA 4OLOA 2FTRA 3UDCA 3ZZOA 1LKZA 1MWZA 1MU2A 4BC7A 5FD1A 5KT2A 4GO7X 4F4XA 2XY7A 3TVZA 2I9SA 1RTHA 1HBMB 3RTVA 4RNNA 3PR5B 4NMLA 2CYYA 2V4JB 2WW8A 3UQSA 3POTA 1C4CA 2R7RA 2JEIA 3LWLA 4V19X 4DV6F 2DGWA 4X64F 1UFLA 2KYXA 6FD1A 1S49A 3BQ0A 1I6JA 2B7CB 2ZH1A 1X4EA 4LF6F 2XMUA 3KHGA 1HW8A 3ZZRA 1N5YB 5H9EJ 3HJFA 3SSSA 4K4TA 5SUHA 1Z2LA 2R7UA 1C4AA 2SXLA 2YNFB 1WEYA 1VOMA 3OXFA 4P7TA 4DG1B 3EZ5A 4TKTA 3GQCA 5HLFA 3MTKA 5HN0A 4X65F 4QIVA 3T19A 4ECXA 5M2PA 1SKRA 1E6YB 2ZE2B 3M6VA 5D4LA 2QV6A 5KFMA 2DR8A 2M88A 2PEHA 2ZH4A 2O5DA 1HPZA 1KS2A 1OO0B 4LFBF 3EZUA 2RRAA 2VUGA 1N36F 3FNNA 3VZHA 3US5A 1U25A 3LALA 2D3ZA 1Q79A 2OTLS 4CO1A 2MJNA 4PG5A 2PA3A 2O67A 4EBDA 1N6QA 1VQ8S 2QA1A 2W7AA 2AW0A 3L3CA 3N28A 2HWIA 1QUPA 4YMEA 3BGRA 3T9NA 6FDRA 3NMAA 3MM7A 3T1HF 1TAQA 4NRTA 1QY7A 4MK8A 3VQSA 4K4WA 4DFPA 2RU3A 3RBEA 5E0OA 2OSQA 2UZAA 3K8VA 1X8DA 2AYEA 1YJRA 3TA1A 1FRIA 1UWBA 2MGZA 3M8RA 1SUQB 5C42B 3UW1A 2XLKA 3O44A 3G6XA 3MUTP 4QYRA 4UW2A 3C2PA 1DJ0A 4FS2A 1RISA 2VPYB 1S6PB 2CQDA 4D3GA 4DL6A 4NXMF 2KO1A 2V8GA 1U4BA 1DAXA 3ENQA 4CT9A 1KC8T 3DOLB 4KR0B 3JSMB 4OHYA 1JLQA 3W2VB 4LT6A 3U1LA 3U7JA 1U6BA 4L6V3 3ISZA 1P27B 1FEHA 2N4CA 2MZQA 2NUUG 1FRHA 3BGUA 5GMKa 1UVJA 5C25B 4ERDA 1QE1B 4ILLA 1RT1B 2GGPB 3LF0A 3CJ4A 4C2MA 1N6QB 1UEVA 1UA0A 5IT9Y 4ECSA 1DHMA 3LGMA 3IRXB 1S97A 3I32A 2LU2A 4KQZA 4PXBA 4OL8A 4X62F 4OI1A 2XZWA 1WEXA 3I9V9 1U09A 3MM9A 2VA3A 1U26A 2NPFA 2DRBA 4B17A 3HHDA 4CTAB 2KXFA 3QZ7A 1NK0A 2ZKTA 4RW6B 2JEJA 1Y7PA 2D3UA 4TU9A 4B9NA 1H98A 5I3UA 2E9TA 4WFAQ 5KFLA 3K5NA 4PQUB 3BS9A 5K9FA 2UUWA 4JI8F 2EFPA 3TYTA 4QWAA 2JLFA 2FHJD 4PUOB 2WOMB 1E6VA 3Q22A 2C3UA 1IKWB 3CTRA 4ZVGA 3KLGA 4A8XA 4ED2A 4DV7F 2X1AA 2MDAA 2IBOA 4ED0A 2BDPA 5BYSA 1CLFA 1FDNA 1HNVB 1C1CB 4QPTA 4EBCA 1QAXA 2HNZA 3FDSA 4FBUA 2CJAA 2DGOA 3POTB 2W8KA 1W25A 4IQMA 3FVYA 1LV5A 1QSLA 3IG1B 3IRXA 2HVZA 3SMZA 4MMOA 4MIBA 3ZFVA 4OJ3A 3IS9A 1GTHA 1BC6A 4YY3F 5GAHU 1Y5NB 2FHMA 3NGKA 2VODA 1IXKA 1P9QC 3HHKA 3SCKE 3U02A 5KG4A 1QVGR 2B4OA 2W25A 1M5HA 2IRYA 2J8AA 1IJFB 4I1TA 1FE0A 3DRXA 4R0EA 1NKEA 3OLAA 3GIJA 4C7QA 3SYZA 1E6YA 1NK5A 3M4XA 1S1UA 4A46A 5IM0A 2VQFF 2BA9A 3PNIA 3HHLC 3TANA 2KTQA 2XMMA 2UXDF 1TKZA 1FJEB 1U1QA 2BJEA 2B4UA 2DCUB 2M52A 4DQRA 4B9MA 4J9MA 5IQQA 2DNGA 3KMQA 1WHWA 5EGYA 2V4QA 1V3SA 3FFIB 3PFOA 2Z4PA 4CH0S 4R25A 1OS5A 2J0XA 2VFSA 2PDAA 3MD3A 2E66A 5THWA 1QM9A 5HMYA 2VPWB 3KKFA 3R5CA 2CPXA 3MM7B 2ABYA 1HNZF 1HWUA 2B9WA 1N5VA 1S1TA 3TUJC 3S1TA 3T9ZA 1BQXA 3UI3A 3N6NA 4EYHB 2FIUA 3DYAA 3E3XA 2DNNA 1U47A 1Q7YT 1FTRA 2E9ZA 4ED6A 3AHPA 4KRWA 3OSPA 4PQAA 1S48A 1Y4ZB 4H4KA 2KT2A 2NLWA 5KT7A 4QWEA 4KTQA 2QA4G 3NBPB 3GILA 1S1XB 4CNYA 4X4VA 1S10A 1EP4A 2B56A 5LXYA 4AQYF 1R89A 1H38A 1RQ0A 3Q8QB 3DOMA 4C8YA 2KJWA 2XG8A 2CZ4A 3CB4A 4ID5A 3KK2A 3J7Z5 4ES1A 1ZPVA 4BWJA 1KR4A 3UFCX 1S9FA 2RQ4A 2XS7A 2YNHA 1ZM3A 2DO0A 2CIMA 1MROA 1R8HA 3DU5A 5B0BA 3CC7S 2WB4A 2GHPA 1TZ0A 2KT3A 1U8SA 4B3TF 4LF8F 1SH2A 2B4VA 2OMOA 3M1VA 1N5TA 2QT7A 4WFXA 1R8CA 4RZRA 3V6KA 1N54B 4IFYA 2LCWA 2BYCA 4Y00A 1B0VA 2E5GA 4ZOSA 5I3UB 4FBTA 3PIOQ 2RS2A 4K59A 5GAGI 2ZH7A 2JZ5A 4B3OA 3H5XA 4O4GB 3J80Y 4DL4A 2VFTA 5I42A 2R7SA 4GKKF 2CFXA 1U1KA 3JAMY 3PX4A 4LIWA 4IRDA 3BSCA 4LFCF 4ZP7A 4M63A 1ZZNA 2JFKA 1ZOTA 2NPIA 3DHWC 4AXJA 1HWIA 2BUNA 1DQ9A 3KK1A 4A8SA 1TL4A 1M5VC 1VQ9S 4MYTA 3CUNA 4JI1F 1N48A 1R8AA 4K4XA 1T3NA 1X5PA 2FLLA 1Y0HA 3K5OA 4B3MF 2B6AA 3OBIA 1MROB 2V0NA 3VZIA 3OJUA 5A2QY 4N8NA 5F8JA 1RT5A 5CD4H 3HKZD 3DXBA 5C24A 4DSKA 4LFAF 1RT4A 4QBUA 5IZHA 4DV2F 3V6DA 2BBEA 2R8IA 1KONA 4OHVA 2FVSA 1SL1A 3V81A 5FDL