2YTGA

Solution structure of the c2h2 type zinc finger (region 369-401) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 369-401) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytgA01
1YSAC 2EN2A 2EPXA 2EM2A 3EPJA 1UBDC 2ENAA 2EORA 2EPUA 1A1FA 1BB8A 2EM5A 2CTDA 2EN1A 4R2AA 4R2PA 2HGHA 4R2EA 2DMIA 2YRKA 4R2QA 2LCEA 2DRPA 1G2FC 2LO3A 4F6MA 1A1KA 2M9AA 2JPAA 2EE8A 2EOSA 1A1HA 4X9JA 2YSOA 2EOYA 2EOHA 4IS1C 2EOEA 2EJ4A 1TF6A 2EM3A 5KL4A 1X5WA 2WBTA 1KJKA 3EPKA 3UK3C 1YUIA 2R1FA 4F6NA 2EN8A 2CT1A 2YTNA 2MDGA 2ADRA 4F2JC 3M99B 1X6EA 1AAYA 2EN6A 3VHTB 2YTGA 1NCSA 2EQ3A 2YTOA 2NABA 4WSGA 2JP9A 2YU5A 2EL4A 4R2CA 2EOIA 2YRMA 2CSHA 1UN6B 2E72A 4R2RA 2EOFA 2GHFA 2EL6A 1A1IA 1A1LA 5KL6A 2MKNA 4R2DA 1X3CA 2YTIA 2MKDA 2EOQA 2EQ1A 2EOZA 2EMBA 2EOXA 2D9HA 5KL7A 2EPRA 2EMCA 2J7JA 2ENHA 2EM9A 4FK5C 1X6FA 5KL5A 2ENCA 2EM0A 2EOJA 2YSPA 2YTPA 2EMGA 2EPPA 2WBSA 2YTFA 4M9VC 2EMXA 2I13A 1Z1BA 1JK1A 2YTEA 2YTJA 3MHSC 5KL3A 2EMHA 1TF3A 1RMDA 1YUJA 1ZR9A 1MEYC 2ELZA 2YU8A 1JK2A 1DGCA 2LT7A 2BB8A 2EMKA 2EM8A 2GLIA 2EPCA 2DLQA 2A25A 3EPLA 1P47A 1A1JA 1ZAAC 2EMFA 2EM7A 3EPHA 2EMZA 2EOMA 4GZNC 2RSIA 2WCC3 2EMWA 2VRDA 2LVHA 2EN3A 1G2DC 1F2IG 2WBUA 2RPCA 1BBOA 2EN7A 4R2SA 2EMAA 2YTQA 2EMYA 1X6HA 2ELYA 2EPZA 4IJDA 2YRHA 1ZU1A 1A1GA 2EQ0A 2YTDA 2EN4A 2EMLA 2EM4A 2EM6A 3MHHC 2DGCA 2EP3A 1LLMC 1B69A 1WJPA 2EPAA 5KL2A 2PRTA 2EOOA 2EL5A 2LV2A 2EMIA 1TN9A 2DLKA
chains in the Genus database with same CATH superfamily
1X47A 3IWCA 4LFAE 5IXMB 1A1FA 2EPUA 4YHHE 4DV6E 1WRJA 3JAMC 2UUAE 5IWAE 2NA2A 2IHR1 5AE2A 2K7IA 2NUFA 2LO3A 4F6MA 4DR2E 3BIDA 2EPOA 4X9JA 2EOYA 1T4LB 2EOEA 1BBGA 2WBTA 3THOB 4ZYDA 2RS6A 2E5LE 4F6NA 2EN8A 3IWBA 5LMNE 2L33A 3HXLA 2MDRA 2L6MA 4P7DA 2YTGA 1N36E 5AE3A 2NABA 4X62E 3MSWA 4Q28A 2EPMX 2YRMA 2LRSA 1YYKA 2CSHA 1T38A 3AUZA 3T1YE 5KL6A 1T4NA 5TSEA 3J80C 4KHPE 3J7AG 1X3CA 1IBME 5A2QC 2EOZA 4B3TE 4HEIA 1STUA 4DR1E 5ADZA 2EM9A 4FK5C 5KL5A 1GTKA 2MC5A 2EMGA 2ODRC 2YTPA 2EPPA 3J81C 4GKKE 4M9VC 2EMXA 1PKPA 2VQEE 1SFEA 5F3WA 2YTJA 2UXBE 2UXCE 1YUJA 1IQSA 1MEYC 1ZBTA 5A6KA 4B3SE 1X49A 1DQ3A 3JTZA 4O4KA 4YY3E 2GLIA 3HTXA 2EMZA 4LF6E 2YPNA 4B3ME 2RSIA 3VYYA 2B7VA 1KYQA 4LF7E 4R2SA 2YTQA 4DV0E 2EMYA 4DV5E 2YRHA 2EQ0A 2EN4A 4L8NA 2LUQA 1N32E 1N3GA 1XMQE 4X64E 5A69A 1LLMC 2DGCA 2UUCE 4DR6E 1WJPA 2PRTA 2UU9E 2EOOA 2LV2A 1YSAC 2EN2A 4LU9A 1QNTA 2EPXA 4B3RE 2EM2A 4WSPA 1PJSA 3EPJA 2I9IA 1UBDC 4M2ZA 2EORA 1BB8A 4F54A 2EN1A 4JI6E 2NUEA 3P1XA 3IWDA 4DV1E 5DNYA 2HGHA 2YRKA 4R2QA 2V85A 1G2FC 1N33E 1O0WA 1T39A 2M9AA 3BF2A 2V8QB 4OOGC 2EOHA 3RMPA 1TF6A 2LTRA 1YUIA 2R1FA 2CT1A 2YTNA 4DV2E 2EN6A 5BR8E 4N4RB 3J7Yp 4WSGA 2DSYA 2JWOA 4R2CA 1IMUA 1UN6B 2CPNA 4R2RA 2L3JA 2GHFA 2EL6A 3ADJA 2K4VA 2MKNA 1EH8A 3KZYA 2KHXA 2L2MA 2EOQA 2EQ1A 2EOXA 2KONA 2J7JA 2V83A 1X6FA 1EKZA 2ENCA 4DV4E 2EOJA 3OTOE 1EH6A 1Z1BA 2YTEA 4BC7A 3HPSA 2L2NA 5KL3A 4JI3E 2EMHA 3ADIA 4R03A 4DV3E 2YU8A 4NZVA 1DGCA 2LT7A 4NXME 3KZZA 2HC5A 2EM8A 2V87A 1UHZA 1HNZE 2A25A 2G7HA 5AASA 3EPLA 5A6AA 4O5GA 1ZBQA 4TUGA 1ZAAC 1SR9A 3EPHA 4F9CB 5LMUE 1WHQA 1PJTA 3OMLA 4O24A 2WCC3 3THNA 2LVHA 3ECRA 2RPCA 3F6HA 4JYAE 2LJUA 2EMAA 2VQFE 2ELYA 2EPZA 2E1MA 3FIGA 2EMLA 5LL6R 2EM4A 4LFCE 2EM6A 1YPNA 5FLXC 2L92A 3DJWA 1IBKE 1FKAE 2F4VE 1FJGE 2L8TA 2UXDE 2F8BA 1UILA 1EH7A 1GQEA 2DLKA 4LTYA 1YZ9A 2FTXB 2ENAA 2EM5A 2CTDA 4OX9E 3C6KA 4R2PA 2GPIA 2N8XA 1YYWA 2DMIA 2LJHA 2N3HA 3VK6A 4ZYHA 3LMLA 4BMJA 1YFHA 4I8OA 2EE8A 2EOSA 2YSOA 3C6MA 2ODRD 1GZ6A 4IS1C 4JI2E 2EJ4A 2EM3A 1X5WA 1HNXE 1KJKA 3EPKA 3UK3C 2MDGA 5LLQA 2ADRA 5AE1A 3M99B 4F2JC 1AAYA 4AQYE 3L00A 4DR7E 2EQ3A 2EWLA 2JOXA 2YU5A 4RHBB 1PDAA 2RS7A 2E72A 1A1IA 1A1LA 2N3GA 4R2DA 2VE7C 4LF4E 3T1HE 2D9HA 5KL7A 1IBLE 2EPRA 1WHNA 3JU0A 4DUZE 2EPLX 2ENHA 2LMZA 3BGHA 2EM0A 1HNWE 4P78A 4JI4E 4K0KE 2VF1A 5AC4A 2Q8UA 4KWYA 2KOUA 4ZYGA 5A6JA 1J5EE 1ZR9A 1I94E 5IV8B 5AC5A 5IT9C 3K6QA 3ZOQB 2DB2A 2EMKA 1N34E 2DLQA 2JOBA 4LF5E 4WFTA 2JR1A 4F9AB 4BBYA 3BBGA 2EM7A 3VYXA 4RH8A 2LTSA 4GZNC 2EMWA 2DMYA 2EN3A 1G2DC 4WYQB 1F2IG 1NEIA 4M0VA 1A1GA 4TUIA 3ADGA 4WX9A 4LF9E 2B9DA 4NXNE 2YTDA 1PJQA 4LFBE 4DR3E 4R8OA 2V86A 3MHHC 1J26A 2YWQA 2B3TB 1B69A 4JV5E 2B7TA 2EL5A 4DUYE 2LE2A 1WXRA 4JI7E 4HTGA 2HJJA 2HHHE 2V88A 2L3CA 2ZM6E 1XMOE 4DKKA 1X48A 4DMIA 1DI2A 4R2AA 2WZOA 2UUBE 2RTXA 4R2EA 3LLHA 1QU6A 2LCEA 2DRPA 4BCAA 3TQMA 4DR4E 4J8ZA 2JXPA 4ZYEA 4DV7E 1A1KA 2JPAA 4Q35B 4GEQB 1A1HA 4JI1E 2DIXA 4LF8E 2H36X 5KL4A 2EZ6A 4M30A 3HPZA 1L4SA 3ADLA 1X6EA 3VHTB 4DR5E 4MLQA 3EQ1A 2L2KB 1NCSA 3C4TA 2YTOA 2JP9A 2EL4A 2V89A 3KWRA 2EOIA 2EPNA 4JI8E 1RQ0A 2BBGA 2EOFA 1RC7A 2M4IA 4L5NC 2YTIA 2MKDA 2JYAA 3H09A 2EMBA 1IQOA 2EMCA 1T4OA 2YSPA 4F9BB 2WBSA 2YTFA 2I13A 1JK1A 4X8WA 2JY9A 3MHSC 1RMDA 5T6JA 4BC9A 1YYOA 3F6GA 5A6BA 2RQLA 2ELZA 4WXDA 2M1SA 1XNRE 1JK2A 4BS9A 2BB8A 2FGGA 2M7QA 2EPCA 2RSMA 4WPYA 3C4BA 1P47A 1A1JA 2EMFA 4BHCA 2EOMA 3AV0A 5A6BD 4WXCA 4GKJE 1XNQE 2VRDA 2EPKX 4NHRA 2FV4B 1MGTA 1AH5A 2R76A 3HQ1A 4MLVA 5CFFE 2WBUA 1BBOA 2EN7A 4X65E 1X6HA 2MC6A 4IJDA 1ZU1A 1HR0E 2NUGA 2JVAA 3QG5C 2YT4A 4JI5E 4BHBA 2EP3A 2LBSB 4JI0E 4O43A 3DF6A 2EPAA 4X66E 5KL2A 4KZSA 2LUPB 1TN9A 2EMIA 2YZTA 1TF3A
chains in the Genus database with same CATH topology
1YSAC 2EN2A 2EPXA 2EM2A 3EPJA 1UBDC 2ENAA 2EORA 2EPUA 1A1FA 1BB8A 2EM5A 2CTDA 2EN1A 4R2AA 4R2PA 2HGHA 4R2EA 2DMIA 2YRKA 4R2QA 2LCEA 2DRPA 1G2FC 2LO3A 4F6MA 1A1KA 2M9AA 2JPAA 2EE8A 2EOSA 1A1HA 4X9JA 2YSOA 2EOYA 2EOHA 4IS1C 2EOEA 2EJ4A 1TF6A 2EM3A 5KL4A 1X5WA 2WBTA 1KJKA 3EPKA 3UK3C 1YUIA 2R1FA 4F6NA 2EN8A 2CT1A 2YTNA 2MDGA 2ADRA 4F2JC 3M99B 1X6EA 1AAYA 2EN6A 3VHTB 2YTGA 1NCSA 2EQ3A 2YTOA 2NABA 4WSGA 2JP9A 2YU5A 2EL4A 4R2CA 2EOIA 2YRMA 2CSHA 1UN6B 2E72A 4R2RA 2EOFA 2GHFA 2EL6A 1A1IA 1A1LA 5KL6A 2MKNA 4R2DA 1X3CA 2YTIA 2MKDA 2EOQA 2EQ1A 2EOZA 2EMBA 2EOXA 2D9HA 5KL7A 2EPRA 2EMCA 2J7JA 2ENHA 2EM9A 4FK5C 1X6FA 5KL5A 2ENCA 2EM0A 2EOJA 2YSPA 2YTPA 2EMGA 2EPPA 2WBSA 2YTFA 4M9VC 2EMXA 2I13A 1Z1BA 1JK1A 2YTEA 2YTJA 3MHSC 5KL3A 2EMHA 1TF3A 1RMDA 1YUJA 1ZR9A 1MEYC 2ELZA 2YU8A 1JK2A 1DGCA 2LT7A 2BB8A 2EMKA 2EM8A 2GLIA 2EPCA 2DLQA 2A25A 3EPLA 1P47A 1A1JA 1ZAAC 2EMFA 2EM7A 3EPHA 2EMZA 2EOMA 4GZNC 2RSIA 2WCC3 2EMWA 2VRDA 2LVHA 2EN3A 1G2DC 1F2IG 2WBUA 2RPCA 1BBOA 2EN7A 4R2SA 2EMAA 2YTQA 2EMYA 1X6HA 2ELYA 2EPZA 4IJDA 2YRHA 1ZU1A 1A1GA 2EQ0A 2YTDA 2EN4A 2EMLA 2EM4A 2EM6A 3MHHC 2DGCA 2EP3A 1LLMC 1B69A 1WJPA 2EPAA 5KL2A 2PRTA 2EOOA 2EL5A 2LV2A 2EMIA 1TN9A 2DLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSA C;  2EN2 A;  2EPX A;  2EM2 A;  3EPJ A;  1UBD C;  2ENA A;  2EOR A;  2EPU A;  1A1F A;  1BB8 A;  2EM5 A;  2CTD A;  2EN1 A;  4R2A A;  4R2P A;  2HGH A;  4R2E A;  2DMI A;  2YRK A;  4R2Q A;  2LCE A;  2DRP A;  1G2F C;  2LO3 A;  4F6M A;  1A1K A;  2M9A A;  2JPA A;  2EE8 A;  2EOS A;  1A1H A;  4X9J A;  2YSO A;  2EOY A;  2EOH A;  4IS1 C;  2EOE A;  2EJ4 A;  1TF6 A;  2EM3 A;  5KL4 A;  1X5W A;  2WBT A;  1KJK A;  3EPK A;  3UK3 C;  1YUI A;  2R1F A;  4F6N A;  2EN8 A;  2CT1 A;  2YTN A;  2MDG A;  2ADR A;  4F2J C;  3M99 B;  1X6E A;  1AAY A;  2EN6 A;  3VHT B;  2YTG A;  1NCS A;  2EQ3 A;  2YTO A;  2NAB A;  4WSG A;  2JP9 A;  2YU5 A;  2EL4 A;  4R2C A;  2EOI A;  2YRM A;  2CSH A;  1UN6 B;  2E72 A;  4R2R A;  2EOF A;  2GHF A;  2EL6 A;  1A1I A;  1A1L A;  5KL6 A;  2MKN A;  4R2D A;  1X3C A;  2YTI A;  2MKD A;  2EOQ A;  2EQ1 A;  2EOZ A;  2EMB A;  2EOX A;  2D9H A;  5KL7 A;  2EPR A;  2EMC A;  2J7J A;  2ENH A;  2EM9 A;  4FK5 C;  1X6F A;  5KL5 A;  2ENC A;  2EM0 A;  2EOJ A;  2YSP A;  2YTP A;  2EMG A;  2EPP A;  2WBS A;  2YTF A;  4M9V C;  2EMX A;  2I13 A;  1Z1B A;  1JK1 A;  2YTE A;  2YTJ A;  3MHS C;  5KL3 A;  2EMH A;  1TF3 A;  1RMD A;  1YUJ A;  1ZR9 A;  1MEY C;  2ELZ A;  2YU8 A;  1JK2 A;  1DGC A;  2LT7 A;  2BB8 A;  2EMK A;  2EM8 A;  2GLI A;  2EPC A;  2DLQ A;  2A25 A;  3EPL A;  1P47 A;  1A1J A;  1ZAA C;  2EMF A;  2EM7 A;  3EPH A;  2EMZ A;  2EOM A;  4GZN C;  2RSI A;  2WCC 3;  2EMW A;  2VRD A;  2LVH A;  2EN3 A;  1G2D C;  1F2I G;  2WBU A;  2RPC A;  1BBO A;  2EN7 A;  4R2S A;  2EMA A;  2YTQ A;  2EMY A;  1X6H A;  2ELY A;  2EPZ A;  4IJD A;  2YRH A;  1ZU1 A;  1A1G A;  2EQ0 A;  2YTD A;  2EN4 A;  2EML A;  2EM4 A;  2EM6 A;  3MHH C;  2DGC A;  2EP3 A;  1LLM C;  1B69 A;  1WJP A;  2EPA A;  5KL2 A;  2PRT A;  2EOO A;  2EL5 A;  2LV2 A;  2EMI A;  1TN9 A;  2DLK A; 
#chains in the Genus database with same CATH topology
 1X47 A;  3IWC A;  4LFA E;  5IXM B;  1A1F A;  2EPU A;  4YHH E;  4DV6 E;  1WRJ A;  3JAM C;  2UUA E;  5IWA E;  2NA2 A;  2IHR 1;  5AE2 A;  2K7I A;  2NUF A;  2LO3 A;  4F6M A;  4DR2 E;  3BID A;  2EPO A;  4X9J A;  2EOY A;  1T4L B;  2EOE A;  1BBG A;  2WBT A;  3THO B;  4ZYD A;  2RS6 A;  2E5L E;  4F6N A;  2EN8 A;  3IWB A;  5LMN E;  2L33 A;  3HXL A;  2MDR A;  2L6M A;  4P7D A;  2YTG A;  1N36 E;  5AE3 A;  2NAB A;  4X62 E;  3MSW A;  4Q28 A;  2EPM X;  2YRM A;  2LRS A;  1YYK A;  2CSH A;  1T38 A;  3AUZ A;  3T1Y E;  5KL6 A;  1T4N A;  5TSE A;  3J80 C;  4KHP E;  3J7A G;  1X3C A;  1IBM E;  5A2Q C;  2EOZ A;  4B3T E;  4HEI A;  1STU A;  4DR1 E;  5ADZ A;  2EM9 A;  4FK5 C;  5KL5 A;  1GTK A;  2MC5 A;  2EMG A;  2ODR C;  2YTP A;  2EPP A;  3J81 C;  4GKK E;  4M9V C;  2EMX A;  1PKP A;  2VQE E;  1SFE A;  5F3W A;  2YTJ A;  2UXB E;  2UXC E;  1YUJ A;  1IQS A;  1MEY C;  1ZBT A;  5A6K A;  4B3S E;  1X49 A;  1DQ3 A;  3JTZ A;  4O4K A;  4YY3 E;  2GLI A;  3HTX A;  2EMZ A;  4LF6 E;  2YPN A;  4B3M E;  2RSI A;  3VYY A;  2B7V A;  1KYQ A;  4LF7 E;  4R2S A;  2YTQ A;  4DV0 E;  2EMY A;  4DV5 E;  2YRH A;  2EQ0 A;  2EN4 A;  4L8N A;  2LUQ A;  1N32 E;  1N3G A;  1XMQ E;  4X64 E;  5A69 A;  1LLM C;  2DGC A;  2UUC E;  4DR6 E;  1WJP A;  2PRT A;  2UU9 E;  2EOO A;  2LV2 A;  1YSA C;  2EN2 A;  4LU9 A;  1QNT A;  2EPX A;  4B3R E;  2EM2 A;  4WSP A;  1PJS A;  3EPJ A;  2I9I A;  1UBD C;  4M2Z A;  2EOR A;  1BB8 A;  4F54 A;  2EN1 A;  4JI6 E;  2NUE A;  3P1X A;  3IWD A;  4DV1 E;  5DNY A;  2HGH A;  2YRK A;  4R2Q A;  2V85 A;  1G2F C;  1N33 E;  1O0W A;  1T39 A;  2M9A A;  3BF2 A;  2V8Q B;  4OOG C;  2EOH A;  3RMP A;  1TF6 A;  2LTR A;  1YUI A;  2R1F A;  2CT1 A;  2YTN A;  4DV2 E;  2EN6 A;  5BR8 E;  4N4R B;  3J7Y p;  4WSG A;  2DSY A;  2JWO A;  4R2C A;  1IMU A;  1UN6 B;  2CPN A;  4R2R A;  2L3J A;  2GHF A;  2EL6 A;  3ADJ A;  2K4V A;  2MKN A;  1EH8 A;  3KZY A;  2KHX A;  2L2M A;  2EOQ A;  2EQ1 A;  2EOX A;  2KON A;  2J7J A;  2V83 A;  1X6F A;  1EKZ A;  2ENC A;  4DV4 E;  2EOJ A;  3OTO E;  1EH6 A;  1Z1B A;  2YTE A;  4BC7 A;  3HPS A;  2L2N A;  5KL3 A;  4JI3 E;  2EMH A;  3ADI A;  4R03 A;  4DV3 E;  2YU8 A;  4NZV A;  1DGC A;  2LT7 A;  4NXM E;  3KZZ A;  2HC5 A;  2EM8 A;  2V87 A;  1UHZ A;  1HNZ E;  2A25 A;  2G7H A;  5AAS A;  3EPL A;  5A6A A;  4O5G A;  1ZBQ A;  4TUG A;  1ZAA C;  1SR9 A;  3EPH A;  4F9C B;  5LMU E;  1WHQ A;  1PJT A;  3OML A;  4O24 A;  2WCC 3;  3THN A;  2LVH A;  3ECR A;  2RPC A;  3F6H A;  4JYA E;  2LJU A;  2EMA A;  2VQF E;  2ELY A;  2EPZ A;  2E1M A;  3FIG A;  2EML A;  5LL6 R;  2EM4 A;  4LFC E;  2EM6 A;  1YPN A;  5FLX C;  2L92 A;  3DJW A;  1IBK E;  1FKA E;  2F4V E;  1FJG E;  2L8T A;  2UXD E;  2F8B A;  1UIL A;  1EH7 A;  1GQE A;  2DLK A;  4LTY A;  1YZ9 A;  2FTX B;  2ENA A;  2EM5 A;  2CTD A;  4OX9 E;  3C6K A;  4R2P A;  2GPI A;  2N8X A;  1YYW A;  2DMI A;  2LJH A;  2N3H A;  3VK6 A;  4ZYH A;  3LML A;  4BMJ A;  1YFH A;  4I8O A;  2EE8 A;  2EOS A;  2YSO A;  3C6M A;  2ODR D;  1GZ6 A;  4IS1 C;  4JI2 E;  2EJ4 A;  2EM3 A;  1X5W A;  1HNX E;  1KJK A;  3EPK A;  3UK3 C;  2MDG A;  5LLQ A;  2ADR A;  5AE1 A;  3M99 B;  4F2J C;  1AAY A;  4AQY E;  3L00 A;  4DR7 E;  2EQ3 A;  2EWL A;  2JOX A;  2YU5 A;  4RHB B;  1PDA A;  2RS7 A;  2E72 A;  1A1I A;  1A1L A;  2N3G A;  4R2D A;  2VE7 C;  4LF4 E;  3T1H E;  2D9H A;  5KL7 A;  1IBL E;  2EPR A;  1WHN A;  3JU0 A;  4DUZ E;  2EPL X;  2ENH A;  2LMZ A;  3BGH A;  2EM0 A;  1HNW E;  4P78 A;  4JI4 E;  4K0K E;  2VF1 A;  5AC4 A;  2Q8U A;  4KWY A;  2KOU A;  4ZYG A;  5A6J A;  1J5E E;  1ZR9 A;  1I94 E;  5IV8 B;  5AC5 A;  5IT9 C;  3K6Q A;  3ZOQ B;  2DB2 A;  2EMK A;  1N34 E;  2DLQ A;  2JOB A;  4LF5 E;  4WFT A;  2JR1 A;  4F9A B;  4BBY A;  3BBG A;  2EM7 A;  3VYX A;  4RH8 A;  2LTS A;  4GZN C;  2EMW A;  2DMY A;  2EN3 A;  1G2D C;  4WYQ B;  1F2I G;  1NEI A;  4M0V A;  1A1G A;  4TUI A;  3ADG A;  4WX9 A;  4LF9 E;  2B9D A;  4NXN E;  2YTD A;  1PJQ A;  4LFB E;  4DR3 E;  4R8O A;  2V86 A;  3MHH C;  1J26 A;  2YWQ A;  2B3T B;  1B69 A;  4JV5 E;  2B7T A;  2EL5 A;  4DUY E;  2LE2 A;  1WXR A;  4JI7 E;  4HTG A;  2HJJ A;  2HHH E;  2V88 A;  2L3C A;  2ZM6 E;  1XMO E;  4DKK A;  1X48 A;  4DMI A;  1DI2 A;  4R2A A;  2WZO A;  2UUB E;  2RTX A;  4R2E A;  3LLH A;  1QU6 A;  2LCE A;  2DRP A;  4BCA A;  3TQM A;  4DR4 E;  4J8Z A;  2JXP A;  4ZYE A;  4DV7 E;  1A1K A;  2JPA A;  4Q35 B;  4GEQ B;  1A1H A;  4JI1 E;  2DIX A;  4LF8 E;  2H36 X;  5KL4 A;  2EZ6 A;  4M30 A;  3HPZ A;  1L4S A;  3ADL A;  1X6E A;  3VHT B;  4DR5 E;  4MLQ A;  3EQ1 A;  2L2K B;  1NCS A;  3C4T A;  2YTO A;  2JP9 A;  2EL4 A;  2V89 A;  3KWR A;  2EOI A;  2EPN A;  4JI8 E;  1RQ0 A;  2BBG A;  2EOF A;  1RC7 A;  2M4I A;  4L5N C;  2YTI A;  2MKD A;  2JYA A;  3H09 A;  2EMB A;  1IQO A;  2EMC A;  1T4O A;  2YSP A;  4F9B B;  2WBS A;  2YTF A;  2I13 A;  1JK1 A;  4X8W A;  2JY9 A;  3MHS C;  1RMD A;  5T6J A;  4BC9 A;  1YYO A;  3F6G A;  5A6B A;  2RQL A;  2ELZ A;  4WXD A;  2M1S A;  1XNR E;  1JK2 A;  4BS9 A;  2BB8 A;  2FGG A;  2M7Q A;  2EPC A;  2RSM A;  4WPY A;  3C4B A;  1P47 A;  1A1J A;  2EMF A;  4BHC A;  2EOM A;  3AV0 A;  5A6B D;  4WXC A;  4GKJ E;  1XNQ E;  2VRD A;  2EPK X;  4NHR A;  2FV4 B;  1MGT A;  1AH5 A;  2R76 A;  3HQ1 A;  4MLV A;  5CFF E;  2WBU A;  1BBO A;  2EN7 A;  4X65 E;  1X6H A;  2MC6 A;  4IJD A;  1ZU1 A;  1HR0 E;  2NUG A;  2JVA A;  3QG5 C;  2YT4 A;  4JI5 E;  4BHB A;  2EP3 A;  2LBS B;  4JI0 E;  4O43 A;  3DF6 A;  2EPA A;  4X66 E;  5KL2 A;  4KZS A;  2LUP B;  1TN9 A;  2EMI A;  2YZT A;  1TF3 A; 
#chains in the Genus database with same CATH homology
 1YSA C;  2EN2 A;  2EPX A;  2EM2 A;  3EPJ A;  1UBD C;  2ENA A;  2EOR A;  2EPU A;  1A1F A;  1BB8 A;  2EM5 A;  2CTD A;  2EN1 A;  4R2A A;  4R2P A;  2HGH A;  4R2E A;  2DMI A;  2YRK A;  4R2Q A;  2LCE A;  2DRP A;  1G2F C;  2LO3 A;  4F6M A;  1A1K A;  2M9A A;  2JPA A;  2EE8 A;  2EOS A;  1A1H A;  4X9J A;  2YSO A;  2EOY A;  2EOH A;  4IS1 C;  2EOE A;  2EJ4 A;  1TF6 A;  2EM3 A;  5KL4 A;  1X5W A;  2WBT A;  1KJK A;  3EPK A;  3UK3 C;  1YUI A;  2R1F A;  4F6N A;  2EN8 A;  2CT1 A;  2YTN A;  2MDG A;  2ADR A;  4F2J C;  3M99 B;  1X6E A;  1AAY A;  2EN6 A;  3VHT B;  2YTG A;  1NCS A;  2EQ3 A;  2YTO A;  2NAB A;  4WSG A;  2JP9 A;  2YU5 A;  2EL4 A;  4R2C A;  2EOI A;  2YRM A;  2CSH A;  1UN6 B;  2E72 A;  4R2R A;  2EOF A;  2GHF A;  2EL6 A;  1A1I A;  1A1L A;  5KL6 A;  2MKN A;  4R2D A;  1X3C A;  2YTI A;  2MKD A;  2EOQ A;  2EQ1 A;  2EOZ A;  2EMB A;  2EOX A;  2D9H A;  5KL7 A;  2EPR A;  2EMC A;  2J7J A;  2ENH A;  2EM9 A;  4FK5 C;  1X6F A;  5KL5 A;  2ENC A;  2EM0 A;  2EOJ A;  2YSP A;  2YTP A;  2EMG A;  2EPP A;  2WBS A;  2YTF A;  4M9V C;  2EMX A;  2I13 A;  1Z1B A;  1JK1 A;  2YTE A;  2YTJ A;  3MHS C;  5KL3 A;  2EMH A;  1TF3 A;  1RMD A;  1YUJ A;  1ZR9 A;  1MEY C;  2ELZ A;  2YU8 A;  1JK2 A;  1DGC A;  2LT7 A;  2BB8 A;  2EMK A;  2EM8 A;  2GLI A;  2EPC A;  2DLQ A;  2A25 A;  3EPL A;  1P47 A;  1A1J A;  1ZAA C;  2EMF A;  2EM7 A;  3EPH A;  2EMZ A;  2EOM A;  4GZN C;  2RSI A;  2WCC 3;  2EMW A;  2VRD A;  2LVH A;  2EN3 A;  1G2D C;  1F2I G;  2WBU A;  2RPC A;  1BBO A;  2EN7 A;  4R2S A;  2EMA A;  2YTQ A;  2EMY A;  1X6H A;  2ELY A;  2EPZ A;  4IJD A;  2YRH A;  1ZU1 A;  1A1G A;  2EQ0 A;  2YTD A;  2EN4 A;  2EML A;  2EM4 A;  2EM6 A;  3MHH C;  2DGC A;  2EP3 A;  1LLM C;  1B69 A;  1WJP A;  2EPA A;  5KL2 A;  2PRT A;  2EOO A;  2EL5 A;  2LV2 A;  2EMI A;  1TN9 A;  2DLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...