2YTGA

Solution structure of the c2h2 type zinc finger (region 369-401) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 369-401) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytgA01
2EMAA 2EM4A 2EMGA 2EOMA 2EOJA 1BBOA 2EM2A 2EN2A 2EM7A 2EMKA 2EQ0A 4FK5C 5KL6A 2EPAA 1KJKA 1JK2A 2LT7A 3UK3C 2YU5A 1A1FA 1Z1BA 1X6HA 2EOSA 2EPPA 2EOYA 1ZU1A 1NCSA 2DLQA 2EPXA 2LVHA 2LCEA 1B69A 2ENHA 2LO3A 5KL4A 1X5WA 2ENCA 2M9AA 1A1JA 2EL6A 4F6NA 1X3CA 2EORA 2EOXA 4WSGA 1A1GA 1ZAAC 2YTFA 2ELZA 2EOFA 2YTEA 1A1LA 2EMZA 4F2JC 2WBSA 2EM3A 1YUJA 2RPCA 2MKNA 2EL5A 2WCC3 3EPJA 2I13A 2EMYA 2YTDA 2EN6A 3EPHA 1WJPA 1A1HA 2EM0A 1A1KA 2EMLA 2J7JA 1DGCA 1A1IA 2WBUA 2CT1A 2HGHA 3EPLA 2EPZA 2EP3A 1F2IG 2R1FA 2YTIA 2YU8A 2EOQA 2EN7A 2EPCA 2EM8A 4GZNC 1X6FA 2EN3A 3VHTB 1MEYC 4R2CA 1UBDC 2JP9A 2YSPA 2LV2A 3MHSC 2WBTA 4R2DA 2DGCA 3M99B 2YRHA 2GHFA 2YTPA 2EQ1A 4R2SA 1YSAC 1X6EA 2EMCA 2EOOA 2RSIA 2YSOA 2GLIA 2YTNA 3MHHC 4F6MA 1BB8A 4R2QA 1G2FC 2CTDA 2EM9A 1YUIA 2EN1A 4R2EA 5KL5A 2MKDA 5KL3A 2A25A 2NABA 2YTGA 2EJ4A 2VRDA 2CSHA 2EQ3A 2EL4A 4IS1C 1TN9A 2EMXA 4R2RA 2EOHA 1G2DC 1RMDA 2EOZA 2E72A 2EM5A 4X9JA 4R2PA 2EOIA 2EM6A 2ELYA 2EPRA 4R2AA 2YRMA 1TF6A 2BB8A 1P47A 1TF3A 2EMFA 2ADRA 2EN4A 5KL2A 2DRPA 2EMBA 1UN6B 2JPAA 5KL7A 2EMHA 2YRKA 2YTJA 2PRTA 3EPKA 2ENAA 2EMWA 1AAYA 2MDGA 2YTQA 1JK1A 2EPUA 2EE8A 2D9HA 2DMIA 1LLMC 2EMIA 2EN8A 2EOEA 2DLKA 4IJDA 4M9VC 2YTOA 1ZR9A
chains in the Genus database with same CATH superfamily
4AQYE 2EM4A 4DV7E 2EOMA 2EM2A 2EPKX 1KYQA 2EMKA 1J5EE 1HNWE 1JK2A 2YT4A 1A1FA 3MSWA 5IV8B 1PDAA 1IBME 1GTKA 1FKAE 2DLQA 2RS6A 4BBYA 1HR0E 4B3SE 1SR9A 3H09A 5KL4A 1A1JA 4JI7E 4F6NA 1X3CA 1A1GA 4B3TE 4J8ZA 1ZAAC 5ADZA 1YPNA 3KZZA 2ELZA 2EOFA 2M7QA 1RC7A 1A1LA 4LFAE 4L8NA 4DR7E 1YUJA 2RPCA 2L3JA 2MKNA 2I13A 3EPJA 1NEIA 2L2KB 2EN6A 1WJPA 2L6MA 2B7TA 2LJHA 3C6MA 3K6QA 5IT9C 3ADLA 2VQFE 4LF7E 3EPLA 1IBLE 4K0KE 5LL6R 2YU8A 2L8TA 4X65E 2EN7A 4Q35B 3BBGA 2EM8A 3VHTB 2EN3A 4ZYDA 4R2CA 1UBDC 4YHHE 2DB2A 2WBTA 4JI3E 3AV0A 4F54A 1XNQE 2K4VA 4OX9E 3T1HE 2MDRA 4F9AB 5AE1A 1X6EA 2EMCA 1EH7A 2MC6A 1BB8A 1WHNA 2V83A 2DMYA 4Q28A 4R2QA 2ODRC 1G2FC 2CTDA 1YUIA 2EN1A 1WXRA 3HTXA 4DV2E 4R03A 2NABA 2EJ4A 3T1YE 2B9DA 2V85A 2EL4A 2G7HA 1IMUA 1RMDA 2N3GA 3VYXA 4R2PA 2EPRA 2E5LE 4BC7A 2EN4A 2DRPA 4NXNE 2JPAA 2YTJA 2RS7A 1AAYA 2LUQA 2VF1A 1JK1A 2D9HA 3TQMA 2LJUA 1LLMC 2EN8A 2K7IA 2DLKA 4M9VC 4DR4E 2EMGA 2RSMA 4DR5E 2V8QB 4WSPA 1BBOA 2KOUA 2EWLA 2EN2A 2LTRA 2EM7A 2EQ0A 4JI8E 5A2QC 4X8WA 2JR1A 2YU5A 2F8BA 1QU6A 1X6HA 1AH5A 2FGGA 2EOYA 2V89A 3IWBA 4BHBA 2HJJA 2LVHA 2M9AA 5AE2A 5A6AA 2EPOA 4BHCA 2N8XA 2JOBA 1YFHA 1L4SA 4LFCE 2EMZA 1X49A 4F2JC 3ADGA 2EM3A 2UU9E 2EL5A 2KONA 4B3ME 2FV4B 1O0WA 1A1HA 4N4RB 4JI1E 2EM0A 3C4BA 3ADIA 2EMLA 2J7JA 1A1IA 2L3CA 3HXLA 4WYQB 3BF2A 4GKJE 1F2IG 2LTSA 2EOQA 2VE7C 2BBGA 3F6GA 4RH8A 4GZNC 1X6FA 2LRSA 1PJTA 3OTOE 4LF8E 2YSPA 2LV2A 3MHSC 5DNYA 1DQ3A 2DGCA 2YRHA 2DSYA 2GHFA 4L5NC 4R2SA 1T4OA 4LF4E 2YPNA 4WXCA 5A6BD 2RSIA 3IWDA 2YSOA 3AUZA 2L33A 2EPLX 4BCAA 1IQSA 5A6BA 2ZM6E 4WXDA 2MKDA 4ZYHA 4GKKE 5KL3A 1N33E 2RTXA 1SFEA 2E1MA 2HC5A 2CSHA 1N32E 2V86A 4IS1C 3JAMC 2EM5A 4X9JA 2V87A 2EOIA 1N3GA 2ELYA 4R2AA 1P47A 4O24A 2EMFA 5KL2A 2NUGA 1UN6B 3DJWA 4LF9E 2IHR1 1ZBQA 4RHBB 2NA2A 4TUIA 3HQ1A 5LMNE 2M1SA 2EPUA 2DMIA 3ADJA 4DUZE 4WX9A 4IJDA 5IXMB 3VK6A 3BGHA 2EMAA 4I8OA 4X62E 2HHHE 5IWAE 5AE3A 4FK5C 4DV3E 4F9BB 5KL6A 4WPYA 2LT7A 5FLXC 1N34E 2EOSA 1ZU1A 1YZ9A 2CPNA 1B69A 2ENHA 2LO3A 4BS9A 1X5WA 5TSEA 2JOXA 2YWQA 1YYKA 2EOXA 4WSGA 1BBGA 3LLHA 1X47A 4BMJA 2UUBE 1PKPA 4WFTA 2YTEA 4DR3E 2WBSA 1T38A 2WCC3 2YTDA 3HPZA 1MGTA 2DIXA 3EPHA 1RQ0A 4LF6E 4P78A 3QG5C 1A1KA 1DGCA 2M4IA 5BR8E 1T4LB 4MLVA 2WBUA 2CT1A 4M2ZA 4HTGA 2EPZA 4GEQB 2EP3A 2UXCE 2R1FA 2EPCA 3DF6A 4LU9A 2JP9A 4R2DA 3F6HA 4JI6E 2WZOA 1IQOA 1YYOA 2N3HA 2YTPA 2EQ1A 3BIDA 2L2NA 2EOOA 3THOB 5CFFE 5A6KA 2GLIA 2NUEA 2FTXB 4R8OA 2JXPA 3THNA 2ODRD 1UILA 2EM9A 1DI2A 4R2EA 3HPSA 5KL5A 4NXME 2A25A 2EQ3A 4JI5E 2LMZA 1PJQA 2EMXA 4KZSA 4R2RA 1G2DC 4KHPE 4TUGA 2L2MA 3RMPA 3LMLA 2YRMA 4DV6E 1TF3A 1EKZA 2ADRA 4M30A 2EMBA 1WRJA 2EMHA 4M0VA 2JY9A 2PRTA 4DR2E 3EQ1A 2ENAA 3FIGA 2H36X 4LFBE 4X64E 1XNRE 5AASA 2YTOA 3C6KA 2Q8UA 4YY3E 2EOJA 2KHXA 1UHZA 4JI2E 2EPAA 1KJKA 3VYYA 3JTZA 3UK3C 1PJSA 2VQEE 4DV0E 1Z1BA 2GPIA 5F3WA 2EPPA 1NCSA 2EPXA 3KWRA 4O43A 2EPNA 1IBKE 2LCEA 2ENCA 4JYAE 2EL6A 4LTYA 5AC5A 2EORA 1X48A 3J81C 2B7VA 4F9CB 4ZYEA 4X66E 1N36E 2NUFA 2UXDE 4JV5E 3C4TA 2JYAA 2YTFA 2F4VE 2MC5A 4O4KA 1J26A 4JI4E 5LMUE 2EPMX 4DUYE 2EMYA 5LLQA 2LBSB 1T4NA 4P7DA 1STUA 2UXBE 2HGHA 4MLQA 4JI0E 4BC9A 3OMLA 2YTIA 3J80C 1XMOE 1EH8A 3KZYA 4DV1E 1MEYC 2UUAE 3J7Yp 3M99B 1HNZE 4DV4E 3ZOQB 1YSAC 4KWYA 2UUCE 4DMIA 3IWCA 2YTNA 3L00A 3MHHC 4F6MA 4B3RE 4DR1E 4NZVA 1GQEA 2YTGA 2JWOA 4DR6E 2L92A 2RQLA 2VRDA 3ECRA 1TN9A 2V88A 4O5GA 1QNTA 2EOHA 2YZTA 5A69A 2EOZA 5A6JA 2E72A 2R76A 4NHRA 1ZBTA 2EM6A 1XMQE 3JU0A 3P1XA 1TF6A 2BB8A 3J7AG 2I9IA 1I94E 2JVAA 5KL7A 2LE2A 4DKKA 4LF5E 2YRKA 3EPKA 4ZYGA 2EMWA 2MDGA 1EH6A 5T6JA 2YTQA 4HEIA 1T39A 1YYWA 1GZ6A 2EE8A 1WHQA 5AC4A 2LUPB 2EZ6A 2EMIA 2B3TB 2EOEA 4DV5E 1HNXE 4OOGC 1FJGE 1ZR9A
chains in the Genus database with same CATH topology
2EMAA 2EM4A 2EMGA 2EOMA 2EOJA 1BBOA 2EM2A 2EN2A 2EM7A 2EMKA 2EQ0A 4FK5C 5KL6A 2EPAA 1KJKA 1JK2A 2LT7A 3UK3C 2YU5A 1A1FA 1Z1BA 1X6HA 2EOSA 2EPPA 2EOYA 1ZU1A 1NCSA 2DLQA 2EPXA 2LVHA 2LCEA 1B69A 2ENHA 2LO3A 5KL4A 1X5WA 2ENCA 2M9AA 1A1JA 2EL6A 4F6NA 1X3CA 2EORA 2EOXA 4WSGA 1A1GA 1ZAAC 2YTFA 2ELZA 2EOFA 2YTEA 1A1LA 2EMZA 4F2JC 2WBSA 2EM3A 1YUJA 2RPCA 2MKNA 2EL5A 2WCC3 3EPJA 2I13A 2EMYA 2YTDA 2EN6A 3EPHA 1WJPA 1A1HA 2EM0A 1A1KA 2EMLA 2J7JA 1DGCA 1A1IA 2WBUA 2CT1A 2HGHA 3EPLA 2EPZA 2EP3A 1F2IG 2R1FA 2YTIA 2YU8A 2EOQA 2EN7A 2EPCA 2EM8A 4GZNC 1X6FA 2EN3A 3VHTB 1MEYC 4R2CA 1UBDC 2JP9A 2YSPA 2LV2A 3MHSC 2WBTA 4R2DA 2DGCA 3M99B 2YRHA 2GHFA 2YTPA 2EQ1A 4R2SA 1YSAC 1X6EA 2EMCA 2EOOA 2RSIA 2YSOA 2GLIA 2YTNA 3MHHC 4F6MA 1BB8A 4R2QA 1G2FC 2CTDA 2EM9A 1YUIA 2EN1A 4R2EA 5KL5A 2MKDA 5KL3A 2A25A 2NABA 2YTGA 2EJ4A 2VRDA 2CSHA 2EQ3A 2EL4A 4IS1C 1TN9A 2EMXA 4R2RA 2EOHA 1G2DC 1RMDA 2EOZA 2E72A 2EM5A 4X9JA 4R2PA 2EOIA 2EM6A 2ELYA 2EPRA 4R2AA 2YRMA 1TF6A 2BB8A 1P47A 1TF3A 2EMFA 2ADRA 2EN4A 5KL2A 2DRPA 2EMBA 1UN6B 2JPAA 5KL7A 2EMHA 2YRKA 2YTJA 2PRTA 3EPKA 2ENAA 2EMWA 1AAYA 2MDGA 2YTQA 1JK1A 2EPUA 2EE8A 2D9HA 2DMIA 1LLMC 2EMIA 2EN8A 2EOEA 2DLKA 4IJDA 4M9VC 2YTOA 1ZR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMA A;  2EM4 A;  2EMG A;  2EOM A;  2EOJ A;  1BBO A;  2EM2 A;  2EN2 A;  2EM7 A;  2EMK A;  2EQ0 A;  4FK5 C;  5KL6 A;  2EPA A;  1KJK A;  1JK2 A;  2LT7 A;  3UK3 C;  2YU5 A;  1A1F A;  1Z1B A;  1X6H A;  2EOS A;  2EPP A;  2EOY A;  1ZU1 A;  1NCS A;  2DLQ A;  2EPX A;  2LVH A;  2LCE A;  1B69 A;  2ENH A;  2LO3 A;  5KL4 A;  1X5W A;  2ENC A;  2M9A A;  1A1J A;  2EL6 A;  4F6N A;  1X3C A;  2EOR A;  2EOX A;  4WSG A;  1A1G A;  1ZAA C;  2YTF A;  2ELZ A;  2EOF A;  2YTE A;  1A1L A;  2EMZ A;  4F2J C;  2WBS A;  2EM3 A;  1YUJ A;  2RPC A;  2MKN A;  2EL5 A;  2WCC 3;  3EPJ A;  2I13 A;  2EMY A;  2YTD A;  2EN6 A;  3EPH A;  1WJP A;  1A1H A;  2EM0 A;  1A1K A;  2EML A;  2J7J A;  1DGC A;  1A1I A;  2WBU A;  2CT1 A;  2HGH A;  3EPL A;  2EPZ A;  2EP3 A;  1F2I G;  2R1F A;  2YTI A;  2YU8 A;  2EOQ A;  2EN7 A;  2EPC A;  2EM8 A;  4GZN C;  1X6F A;  2EN3 A;  3VHT B;  1MEY C;  4R2C A;  1UBD C;  2JP9 A;  2YSP A;  2LV2 A;  3MHS C;  2WBT A;  4R2D A;  2DGC A;  3M99 B;  2YRH A;  2GHF A;  2YTP A;  2EQ1 A;  4R2S A;  1YSA C;  1X6E A;  2EMC A;  2EOO A;  2RSI A;  2YSO A;  2GLI A;  2YTN A;  3MHH C;  4F6M A;  1BB8 A;  4R2Q A;  1G2F C;  2CTD A;  2EM9 A;  1YUI A;  2EN1 A;  4R2E A;  5KL5 A;  2MKD A;  5KL3 A;  2A25 A;  2NAB A;  2YTG A;  2EJ4 A;  2VRD A;  2CSH A;  2EQ3 A;  2EL4 A;  4IS1 C;  1TN9 A;  2EMX A;  4R2R A;  2EOH A;  1G2D C;  1RMD A;  2EOZ A;  2E72 A;  2EM5 A;  4X9J A;  4R2P A;  2EOI A;  2EM6 A;  2ELY A;  2EPR A;  4R2A A;  2YRM A;  1TF6 A;  2BB8 A;  1P47 A;  1TF3 A;  2EMF A;  2ADR A;  2EN4 A;  5KL2 A;  2DRP A;  2EMB A;  1UN6 B;  2JPA A;  5KL7 A;  2EMH A;  2YRK A;  2YTJ A;  2PRT A;  3EPK A;  2ENA A;  2EMW A;  1AAY A;  2MDG A;  2YTQ A;  1JK1 A;  2EPU A;  2EE8 A;  2D9H A;  2DMI A;  1LLM C;  2EMI A;  2EN8 A;  2EOE A;  2DLK A;  4IJD A;  4M9V C;  2YTO A;  1ZR9 A; 
#chains in the Genus database with same CATH topology
 4AQY E;  2EM4 A;  4DV7 E;  2EOM A;  2EM2 A;  2EPK X;  1KYQ A;  2EMK A;  1J5E E;  1HNW E;  1JK2 A;  2YT4 A;  1A1F A;  3MSW A;  5IV8 B;  1PDA A;  1IBM E;  1GTK A;  1FKA E;  2DLQ A;  2RS6 A;  4BBY A;  1HR0 E;  4B3S E;  1SR9 A;  3H09 A;  5KL4 A;  1A1J A;  4JI7 E;  4F6N A;  1X3C A;  1A1G A;  4B3T E;  4J8Z A;  1ZAA C;  5ADZ A;  1YPN A;  3KZZ A;  2ELZ A;  2EOF A;  2M7Q A;  1RC7 A;  1A1L A;  4LFA E;  4L8N A;  4DR7 E;  1YUJ A;  2RPC A;  2L3J A;  2MKN A;  2I13 A;  3EPJ A;  1NEI A;  2L2K B;  2EN6 A;  1WJP A;  2L6M A;  2B7T A;  2LJH A;  3C6M A;  3K6Q A;  5IT9 C;  3ADL A;  2VQF E;  4LF7 E;  3EPL A;  1IBL E;  4K0K E;  5LL6 R;  2YU8 A;  2L8T A;  4X65 E;  2EN7 A;  4Q35 B;  3BBG A;  2EM8 A;  3VHT B;  2EN3 A;  4ZYD A;  4R2C A;  1UBD C;  4YHH E;  2DB2 A;  2WBT A;  4JI3 E;  3AV0 A;  4F54 A;  1XNQ E;  2K4V A;  4OX9 E;  3T1H E;  2MDR A;  4F9A B;  5AE1 A;  1X6E A;  2EMC A;  1EH7 A;  2MC6 A;  1BB8 A;  1WHN A;  2V83 A;  2DMY A;  4Q28 A;  4R2Q A;  2ODR C;  1G2F C;  2CTD A;  1YUI A;  2EN1 A;  1WXR A;  3HTX A;  4DV2 E;  4R03 A;  2NAB A;  2EJ4 A;  3T1Y E;  2B9D A;  2V85 A;  2EL4 A;  2G7H A;  1IMU A;  1RMD A;  2N3G A;  3VYX A;  4R2P A;  2EPR A;  2E5L E;  4BC7 A;  2EN4 A;  2DRP A;  4NXN E;  2JPA A;  2YTJ A;  2RS7 A;  1AAY A;  2LUQ A;  2VF1 A;  1JK1 A;  2D9H A;  3TQM A;  2LJU A;  1LLM C;  2EN8 A;  2K7I A;  2DLK A;  4M9V C;  4DR4 E;  2EMG A;  2RSM A;  4DR5 E;  2V8Q B;  4WSP A;  1BBO A;  2KOU A;  2EWL A;  2EN2 A;  2LTR A;  2EM7 A;  2EQ0 A;  4JI8 E;  5A2Q C;  4X8W A;  2JR1 A;  2YU5 A;  2F8B A;  1QU6 A;  1X6H A;  1AH5 A;  2FGG A;  2EOY A;  2V89 A;  3IWB A;  4BHB A;  2HJJ A;  2LVH A;  2M9A A;  5AE2 A;  5A6A A;  2EPO A;  4BHC A;  2N8X A;  2JOB A;  1YFH A;  1L4S A;  4LFC E;  2EMZ A;  1X49 A;  4F2J C;  3ADG A;  2EM3 A;  2UU9 E;  2EL5 A;  2KON A;  4B3M E;  2FV4 B;  1O0W A;  1A1H A;  4N4R B;  4JI1 E;  2EM0 A;  3C4B A;  3ADI A;  2EML A;  2J7J A;  1A1I A;  2L3C A;  3HXL A;  4WYQ B;  3BF2 A;  4GKJ E;  1F2I G;  2LTS A;  2EOQ A;  2VE7 C;  2BBG A;  3F6G A;  4RH8 A;  4GZN C;  1X6F A;  2LRS A;  1PJT A;  3OTO E;  4LF8 E;  2YSP A;  2LV2 A;  3MHS C;  5DNY A;  1DQ3 A;  2DGC A;  2YRH A;  2DSY A;  2GHF A;  4L5N C;  4R2S A;  1T4O A;  4LF4 E;  2YPN A;  4WXC A;  5A6B D;  2RSI A;  3IWD A;  2YSO A;  3AUZ A;  2L33 A;  2EPL X;  4BCA A;  1IQS A;  5A6B A;  2ZM6 E;  4WXD A;  2MKD A;  4ZYH A;  4GKK E;  5KL3 A;  1N33 E;  2RTX A;  1SFE A;  2E1M A;  2HC5 A;  2CSH A;  1N32 E;  2V86 A;  4IS1 C;  3JAM C;  2EM5 A;  4X9J A;  2V87 A;  2EOI A;  1N3G A;  2ELY A;  4R2A A;  1P47 A;  4O24 A;  2EMF A;  5KL2 A;  2NUG A;  1UN6 B;  3DJW A;  4LF9 E;  2IHR 1;  1ZBQ A;  4RHB B;  2NA2 A;  4TUI A;  3HQ1 A;  5LMN E;  2M1S A;  2EPU A;  2DMI A;  3ADJ A;  4DUZ E;  4WX9 A;  4IJD A;  5IXM B;  3VK6 A;  3BGH A;  2EMA A;  4I8O A;  4X62 E;  2HHH E;  5IWA E;  5AE3 A;  4FK5 C;  4DV3 E;  4F9B B;  5KL6 A;  4WPY A;  2LT7 A;  5FLX C;  1N34 E;  2EOS A;  1ZU1 A;  1YZ9 A;  2CPN A;  1B69 A;  2ENH A;  2LO3 A;  4BS9 A;  1X5W A;  5TSE A;  2JOX A;  2YWQ A;  1YYK A;  2EOX A;  4WSG A;  1BBG A;  3LLH A;  1X47 A;  4BMJ A;  2UUB E;  1PKP A;  4WFT A;  2YTE A;  4DR3 E;  2WBS A;  1T38 A;  2WCC 3;  2YTD A;  3HPZ A;  1MGT A;  2DIX A;  3EPH A;  1RQ0 A;  4LF6 E;  4P78 A;  3QG5 C;  1A1K A;  1DGC A;  2M4I A;  5BR8 E;  1T4L B;  4MLV A;  2WBU A;  2CT1 A;  4M2Z A;  4HTG A;  2EPZ A;  4GEQ B;  2EP3 A;  2UXC E;  2R1F A;  2EPC A;  3DF6 A;  4LU9 A;  2JP9 A;  4R2D A;  3F6H A;  4JI6 E;  2WZO A;  1IQO A;  1YYO A;  2N3H A;  2YTP A;  2EQ1 A;  3BID A;  2L2N A;  2EOO A;  3THO B;  5CFF E;  5A6K A;  2GLI A;  2NUE A;  2FTX B;  4R8O A;  2JXP A;  3THN A;  2ODR D;  1UIL A;  2EM9 A;  1DI2 A;  4R2E A;  3HPS A;  5KL5 A;  4NXM E;  2A25 A;  2EQ3 A;  4JI5 E;  2LMZ A;  1PJQ A;  2EMX A;  4KZS A;  4R2R A;  1G2D C;  4KHP E;  4TUG A;  2L2M A;  3RMP A;  3LML A;  2YRM A;  4DV6 E;  1TF3 A;  1EKZ A;  2ADR A;  4M30 A;  2EMB A;  1WRJ A;  2EMH A;  4M0V A;  2JY9 A;  2PRT A;  4DR2 E;  3EQ1 A;  2ENA A;  3FIG A;  2H36 X;  4LFB E;  4X64 E;  1XNR E;  5AAS A;  2YTO A;  3C6K A;  2Q8U A;  4YY3 E;  2EOJ A;  2KHX A;  1UHZ A;  4JI2 E;  2EPA A;  1KJK A;  3VYY A;  3JTZ A;  3UK3 C;  1PJS A;  2VQE E;  4DV0 E;  1Z1B A;  2GPI A;  5F3W A;  2EPP A;  1NCS A;  2EPX A;  3KWR A;  4O43 A;  2EPN A;  1IBK E;  2LCE A;  2ENC A;  4JYA E;  2EL6 A;  4LTY A;  5AC5 A;  2EOR A;  1X48 A;  3J81 C;  2B7V A;  4F9C B;  4ZYE A;  4X66 E;  1N36 E;  2NUF A;  2UXD E;  4JV5 E;  3C4T A;  2JYA A;  2YTF A;  2F4V E;  2MC5 A;  4O4K A;  1J26 A;  4JI4 E;  5LMU E;  2EPM X;  4DUY E;  2EMY A;  5LLQ A;  2LBS B;  1T4N A;  4P7D A;  1STU A;  2UXB E;  2HGH A;  4MLQ A;  4JI0 E;  4BC9 A;  3OML A;  2YTI A;  3J80 C;  1XMO E;  1EH8 A;  3KZY A;  4DV1 E;  1MEY C;  2UUA E;  3J7Y p;  3M99 B;  1HNZ E;  4DV4 E;  3ZOQ B;  1YSA C;  4KWY A;  2UUC E;  4DMI A;  3IWC A;  2YTN A;  3L00 A;  3MHH C;  4F6M A;  4B3R E;  4DR1 E;  4NZV A;  1GQE A;  2YTG A;  2JWO A;  4DR6 E;  2L92 A;  2RQL A;  2VRD A;  3ECR A;  1TN9 A;  2V88 A;  4O5G A;  1QNT A;  2EOH A;  2YZT A;  5A69 A;  2EOZ A;  5A6J A;  2E72 A;  2R76 A;  4NHR A;  1ZBT A;  2EM6 A;  1XMQ E;  3JU0 A;  3P1X A;  1TF6 A;  2BB8 A;  3J7A G;  2I9I A;  1I94 E;  2JVA A;  5KL7 A;  2LE2 A;  4DKK A;  4LF5 E;  2YRK A;  3EPK A;  4ZYG A;  2EMW A;  2MDG A;  1EH6 A;  5T6J A;  2YTQ A;  4HEI A;  1T39 A;  1YYW A;  1GZ6 A;  2EE8 A;  1WHQ A;  5AC4 A;  2LUP B;  2EZ6 A;  2EMI A;  2B3T B;  2EOE A;  4DV5 E;  1HNX E;  4OOG C;  1FJG E;  1ZR9 A; 
#chains in the Genus database with same CATH homology
 2EMA A;  2EM4 A;  2EMG A;  2EOM A;  2EOJ A;  1BBO A;  2EM2 A;  2EN2 A;  2EM7 A;  2EMK A;  2EQ0 A;  4FK5 C;  5KL6 A;  2EPA A;  1KJK A;  1JK2 A;  2LT7 A;  3UK3 C;  2YU5 A;  1A1F A;  1Z1B A;  1X6H A;  2EOS A;  2EPP A;  2EOY A;  1ZU1 A;  1NCS A;  2DLQ A;  2EPX A;  2LVH A;  2LCE A;  1B69 A;  2ENH A;  2LO3 A;  5KL4 A;  1X5W A;  2ENC A;  2M9A A;  1A1J A;  2EL6 A;  4F6N A;  1X3C A;  2EOR A;  2EOX A;  4WSG A;  1A1G A;  1ZAA C;  2YTF A;  2ELZ A;  2EOF A;  2YTE A;  1A1L A;  2EMZ A;  4F2J C;  2WBS A;  2EM3 A;  1YUJ A;  2RPC A;  2MKN A;  2EL5 A;  2WCC 3;  3EPJ A;  2I13 A;  2EMY A;  2YTD A;  2EN6 A;  3EPH A;  1WJP A;  1A1H A;  2EM0 A;  1A1K A;  2EML A;  2J7J A;  1DGC A;  1A1I A;  2WBU A;  2CT1 A;  2HGH A;  3EPL A;  2EPZ A;  2EP3 A;  1F2I G;  2R1F A;  2YTI A;  2YU8 A;  2EOQ A;  2EN7 A;  2EPC A;  2EM8 A;  4GZN C;  1X6F A;  2EN3 A;  3VHT B;  1MEY C;  4R2C A;  1UBD C;  2JP9 A;  2YSP A;  2LV2 A;  3MHS C;  2WBT A;  4R2D A;  2DGC A;  3M99 B;  2YRH A;  2GHF A;  2YTP A;  2EQ1 A;  4R2S A;  1YSA C;  1X6E A;  2EMC A;  2EOO A;  2RSI A;  2YSO A;  2GLI A;  2YTN A;  3MHH C;  4F6M A;  1BB8 A;  4R2Q A;  1G2F C;  2CTD A;  2EM9 A;  1YUI A;  2EN1 A;  4R2E A;  5KL5 A;  2MKD A;  5KL3 A;  2A25 A;  2NAB A;  2YTG A;  2EJ4 A;  2VRD A;  2CSH A;  2EQ3 A;  2EL4 A;  4IS1 C;  1TN9 A;  2EMX A;  4R2R A;  2EOH A;  1G2D C;  1RMD A;  2EOZ A;  2E72 A;  2EM5 A;  4X9J A;  4R2P A;  2EOI A;  2EM6 A;  2ELY A;  2EPR A;  4R2A A;  2YRM A;  1TF6 A;  2BB8 A;  1P47 A;  1TF3 A;  2EMF A;  2ADR A;  2EN4 A;  5KL2 A;  2DRP A;  2EMB A;  1UN6 B;  2JPA A;  5KL7 A;  2EMH A;  2YRK A;  2YTJ A;  2PRT A;  3EPK A;  2ENA A;  2EMW A;  1AAY A;  2MDG A;  2YTQ A;  1JK1 A;  2EPU A;  2EE8 A;  2D9H A;  2DMI A;  1LLM C;  2EMI A;  2EN8 A;  2EOE A;  2DLK A;  4IJD A;  4M9V C;  2YTO A;  1ZR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...