2YTGA

Solution structure of the c2h2 type zinc finger (region 369-401) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 369-401) of human Zinc finger protein 95 homolog
rcsb
molecule keywords Zinc finger protein 95 homolog
molecule tags Transcription
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytgA01
4X9JA 2ELYA 2EPAA 2EM2A 1A1JA 1X5WA 5KL3A 2LO3A 1LLMC 1G2FC 3EPLA 2EN7A 1YSAC 1ZAAC 2NABA 5KL7A 2EMHA 4R2RA 1DGCA 1G2DC 2YRMA 3VHTB 2BB8A 2EOQA 1AAYA 1BB8A 1A1LA 2EQ3A 2EM6A 4R2QA 2JPAA 1A1FA 4M9VC 2EN2A 2EMFA 2EL6A 2EOIA 4R2EA 2EN3A 2EPZA 2GHFA 3EPKA 2EJ4A 2EN1A 2I13A 2LV2A 2EOOA 2ENHA 1A1KA 1ZU1A 1YUJA 1YUIA 2EM4A 1MEYC 2VRDA 2WCC3 2EQ0A 2LCEA 2RSIA 2YTQA 2YTOA 2EPXA 2EM8A 2YTFA 2EOZA 2EMLA 2YTDA 2DMIA 2EMBA 4F6NA 1A1GA 2LT7A 1Z1BA 4R2AA 2EOXA 2YTEA 2YTNA 1A1HA 2EORA 1ZR9A 2EM7A 1JK2A 2YSOA 2PRTA 2GLIA 2R1FA 3M99B 2ELZA 1WJPA 4IS1C 2MDGA 2DGCA 2EM3A 2EOYA 2YTJA 1P47A 2DLQA 2EOSA 2ADRA 1X6EA 1A1IA 1JK1A 2EPUA 1KJKA 2MKDA 2JP9A 1X6HA 4R2PA 4R2SA 1TF6A 2J7JA 4F2JC 2EOEA 2A25A 2YTPA 2E72A 2EM9A 2YU5A 2EPRA 1B69A 4FK5C 2EMIA 1UBDC 2CSHA 2EE8A 2EN6A 1TN9A 4F6MA 3MHHC 2EOHA 2EM0A 2EMYA 2EOFA 2HGHA 2EL4A 2EMZA 3UK3C 2EN8A 5KL5A 2YU8A 2M9AA 2RPCA 4R2DA 2EOMA 2CTDA 2EMWA 2YTIA 5KL2A 2EPCA 1RMDA 3EPHA 2WBTA 2ENAA 2YRHA 2WBSA 2YSPA 1X3CA 2EOJA 2EP3A 5KL4A 2LVHA 1NCSA 2EMCA 2EMGA 1UN6B 1F2IG 2YRKA 2D9HA 4R2CA 2WBUA 2EMAA 2EN4A 2YTGA 4IJDA 2MKNA 1TF3A 1X6FA 3MHSC 2DLKA 1BBOA 2EMXA 2ENCA 3EPJA 2EM5A 2EMKA 2EPPA 5KL6A 2DRPA 2EQ1A 4WSGA 2EL5A 4GZNC 2CT1A
chains in the Genus database with same CATH superfamily
1X5WA 3C6MA 3EQ1A 5CFFE 5KL3A 1LLMC 3EPLA 1QNTA 1YSAC 3BGHA 4JI1E 4X64E 1SR9A 1T4OA 2BB8A 4TUIA 4DR5E 2LUQA 4RH8A 1T38A 2EN2A 4DR7E 4N4RB 1YZ9A 1UHZA 2EOIA 3EPKA 3DF6A 3HQ1A 4DUZE 1A1KA 5AC4A 3THOB 1YYOA 1XMQE 2B7TA 4MLQA 3H09A 2LCEA 5IWAE 2YTOA 4X66E 4YY3E 4X8WA 2EMLA 1IBLE 2F4VE 2EMBA 1YYKA 2EPOA 4LF6E 2YTEA 2MDRA 1RC7A 1ZR9A 2EM7A 4B3ME 4JI5E 3AUZA 4WYQB 2R1FA 2ELZA 3F6HA 1PJTA 2DLQA 1P47A 4L8NA 4O5GA 1J5EE 4DR6E 1X47A 4JYAE 2ODRD 2EPNA 4R2SA 5IXMB 1ZBQA 3HPZA 2V8QB 2A25A 3KZZA 1AH5A 2YTPA 2EM9A 4BC9A 2JR1A 1NEIA 4BHCA 4X62E 1UBDC 2CSHA 4F6MA 2JOXA 4GKKE 2LE2A 2HGHA 2EMZA 2EN8A 2ODRC 1HNWE 2YU8A 2CTDA 4TUGA 2YTIA 3K6QA 5KL2A 4LFCE 2WBTA 3C4TA 1X3CA 5A6KA 4JI4E 4LF5E 2EMCA 5F3WA 1UN6B 1L4SA 2BBGA 5TSEA 2UU9E 2EMAA 4O43A 4IJDA 5A69A 1TF3A 1X6FA 5AE3A 3KZYA 2EMKA 4DR2E 2DRPA 4DV4E 1MGTA 1PKPA 4BC7A 4X65E 1EH8A 3J7AG 2R76A 4WSGA 4NHRA 3ADIA 4MLVA 4O4KA 4X9JA 4DV5E 2DMYA 2EM2A 1G2FC 2LO3A 2FV4B 3BF2A 4NZVA 4DKKA 2JYAA 2L8TA 3F6GA 1ZAAC 2JVAA 4I8OA 3VHTB 1AAYA 4Q35B 4WPYA 4M9VC 1N32E 1X48A 3J7Yp 2EL6A 5A6JA 2EN3A 2EPZA 2LMZA 4J8ZA 3T1HE 2I13A 3JTZA 2ENHA 4KWYA 1YUIA 4WFTA 5A6AA 2FTXB 2WCC3 1IBKE 2YTQA 4L5NC 1PJSA 2EM8A 2B9DA 4NXME 2DMIA 4F6NA 5FLXC 1WXRA 4DV7E 4R2AA 5BR8E 4ZYHA 2YTNA 2YWQA 3FIGA 4DV2E 2PRTA 3TQMA 1DQ3A 1WJPA 2H36X 3IWDA 1WHQA 2YTJA 4KHPE 4GKJE 1QU6A 4OX9E 1X6EA 2EPMX 1GTKA 1KJKA 2Q8UA 2MKDA 1DI2A 4AQYE 2NUGA 2J7JA 2M4IA 4ZYEA 5DNYA 2EOEA 2DB2A 2E72A 2YU5A 3BIDA 1PDAA 1XNRE 3P1XA 4O24A 1SFEA 2F8BA 2LUPB 2RSMA 3HPSA 4BHBA 1BBGA 2EOHA 2EMYA 2EPKX 2L92A 3MSWA 4JI6E 1RMDA 4DV3E 2WBSA 1WHNA 4LF9E 4NXNE 2L2NA 2V87A 2EOJA 5KL4A 4KZSA 2EMGA 5A2QC 4JI7E 2YRKA 2LTRA 4DR3E 2EN4A 2MKNA 1YYWA 1ZBTA 2IHR1 2ENCA 1EH6A 2G7HA 2EM5A 4YHHE 4B3SE 2VQFE 1N34E 2NA2A 2CT1A 3ZOQB 2ELYA 2EPAA 1A1JA 1O0WA 2YPNA 3ADLA 2EN7A 3DJWA 2NABA 3HXLA 5KL7A 1DGCA 2UUBE 5IV8B 4P78A 4P7DA 4LU9A 2HC5A 4R2EA 4HEIA 5A6BD 3VYXA 2EJ4A 2M1SA 2LV2A 4M30A 2EOOA 2HJJA 5A6BA 1ZU1A 1YUJA 2EM4A 1FKAE 1YPNA 2EWLA 2RSIA 4BBYA 4DR4E 2V83A 2EPXA 2YTFA 4F9BB 2EOZA 2YTDA 5AE1A 2LT7A 1I94E 1Z1BA 2YT4A 2EOXA 2HHHE 2I9IA 3C4BA 4LF7E 3J80C 2UXDE 3VYYA 3IWBA 3KWRA 3ECRA 5AC5A 4ZYDA 1T4LB 3THNA 3C6KA 4WX9A 4IS1C 4F9AB 1FJGE 1HNZE 2E5LE 2YZTA 2EOSA 2VE7C 4ZYGA 4DUYE 1A1IA 2V89A 2V88A 1JK1A 2JOBA 4M0VA 1TF6A 4K0KE 4WSPA 2EZ6A 2KOUA 3T1YE 4JI8E 4LF4E 4DV1E 1XMOE 2EMIA 4DMIA 2EE8A 3MHHC 3VK6A 2DIXA 1RQ0A 3UK3C 5KL5A 2M7QA 2DSYA 2M9AA 2RPCA 4R2DA 2EOMA 2JY9A 2CPNA 5T6JA 2EMWA 2LJHA 2EPCA 2ENAA 1IBME 2VQEE 3OTOE 2KHXA 2EP3A 2ZM6E 2LVHA 2B7VA 1F2IG 2L3CA 2D9HA 5LL6R 1EKZA 4JV5E 2L2MA 3MHSC 4B3RE 2DLKA 1IMUA 2EMXA 4LTYA 2L6MA 2NUEA 5KL6A 2EPPA 1X49A 1N3GA 4F54A 1HNXE 2EL5A 5LMUE 1UILA 4HTGA 4DR1E 2K7IA 2V86A 4JI2E 2LBSB 2EMHA 4R2RA 2L2KB 1G2DC 2YRMA 2EOQA 4WXDA 1BB8A 1T4NA 2B3TB 3RMPA 1N36E 1A1LA 4BCAA 2UUAE 2EQ3A 2EM6A 4R2QA 2JPAA 1A1FA 4F9CB 2UUCE 2EMFA 4DV0E 4JI0E 2RTXA 2UXCE 2GHFA 2GPIA 2EN1A 2MC6A 5ADZA 1MEYC 4LFBE 2VRDA 2JWOA 4Q28A 2EQ0A 2LTSA 4BMJA 2L33A 1A1GA 1T39A 4WXCA 1A1HA 2RS6A 2V85A 2EORA 2MC5A 1XNQE 3ADJA 1JK2A 2WZOA 2YSOA 1STUA 2GLIA 2N3HA 3M99B 3IWCA 2N8XA 3J81C 2MDGA 2DGCA 2EM3A 2EOYA 5AE2A 3LLHA 2N3GA 4R03A 3JU0A 2ADRA 1KYQA 2FGGA 4GEQB 2EPUA 2JXPA 3LMLA 4BS9A 3AV0A 2JP9A 1X6HA 2KONA 4R2PA 1J26A 2LJUA 5AASA 4F2JC 3JAMC 2RQLA 2NUFA 1IQOA 5LMNE 2EPRA 4B3TE 1B69A 4FK5C 4R8OA 5IT9C 1HR0E 3HTXA 3QG5C 2EN6A 1TN9A 4LF8E 2EM0A 1EH7A 2EOFA 2EL4A 2L3JA 3ADGA 4RHBB 1WRJA 1YFHA 4LFAE 1IQSA 2RS7A 4JI3E 1PJQA 3EPHA 2YRHA 4OOGC 2YSPA 1N33E 1NCSA 2UXBE 2E1MA 4R2CA 2WBUA 4DV6E 3L00A 2K4VA 2YTGA 5LLQA 2LRSA 1BBOA 1GQEA 2EPLX 3EPJA 3OMLA 3BBGA 2EQ1A 4M2ZA 4GZNC 1GZ6A 2VF1A
chains in the Genus database with same CATH topology
4X9JA 2ELYA 2EPAA 2EM2A 1A1JA 1X5WA 5KL3A 2LO3A 1LLMC 1G2FC 3EPLA 2EN7A 1YSAC 1ZAAC 2NABA 5KL7A 2EMHA 4R2RA 1DGCA 1G2DC 2YRMA 3VHTB 2BB8A 2EOQA 1AAYA 1BB8A 1A1LA 2EQ3A 2EM6A 4R2QA 2JPAA 1A1FA 4M9VC 2EN2A 2EMFA 2EL6A 2EOIA 4R2EA 2EN3A 2EPZA 2GHFA 3EPKA 2EJ4A 2EN1A 2I13A 2LV2A 2EOOA 2ENHA 1A1KA 1ZU1A 1YUJA 1YUIA 2EM4A 1MEYC 2VRDA 2WCC3 2EQ0A 2LCEA 2RSIA 2YTQA 2YTOA 2EPXA 2EM8A 2YTFA 2EOZA 2EMLA 2YTDA 2DMIA 2EMBA 4F6NA 1A1GA 2LT7A 1Z1BA 4R2AA 2EOXA 2YTEA 2YTNA 1A1HA 2EORA 1ZR9A 2EM7A 1JK2A 2YSOA 2PRTA 2GLIA 2R1FA 3M99B 2ELZA 1WJPA 4IS1C 2MDGA 2DGCA 2EM3A 2EOYA 2YTJA 1P47A 2DLQA 2EOSA 2ADRA 1X6EA 1A1IA 1JK1A 2EPUA 1KJKA 2MKDA 2JP9A 1X6HA 4R2PA 4R2SA 1TF6A 2J7JA 4F2JC 2EOEA 2A25A 2YTPA 2E72A 2EM9A 2YU5A 2EPRA 1B69A 4FK5C 2EMIA 1UBDC 2CSHA 2EE8A 2EN6A 1TN9A 4F6MA 3MHHC 2EOHA 2EM0A 2EMYA 2EOFA 2HGHA 2EL4A 2EMZA 3UK3C 2EN8A 5KL5A 2YU8A 2M9AA 2RPCA 4R2DA 2EOMA 2CTDA 2EMWA 2YTIA 5KL2A 2EPCA 1RMDA 3EPHA 2WBTA 2ENAA 2YRHA 2WBSA 2YSPA 1X3CA 2EOJA 2EP3A 5KL4A 2LVHA 1NCSA 2EMCA 2EMGA 1UN6B 1F2IG 2YRKA 2D9HA 4R2CA 2WBUA 2EMAA 2EN4A 2YTGA 4IJDA 2MKNA 1TF3A 1X6FA 3MHSC 2DLKA 1BBOA 2EMXA 2ENCA 3EPJA 2EM5A 2EMKA 2EPPA 5KL6A 2DRPA 2EQ1A 4WSGA 2EL5A 4GZNC 2CT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9J A;  2ELY A;  2EPA A;  2EM2 A;  1A1J A;  1X5W A;  5KL3 A;  2LO3 A;  1LLM C;  1G2F C;  3EPL A;  2EN7 A;  1YSA C;  1ZAA C;  2NAB A;  5KL7 A;  2EMH A;  4R2R A;  1DGC A;  1G2D C;  2YRM A;  3VHT B;  2BB8 A;  2EOQ A;  1AAY A;  1BB8 A;  1A1L A;  2EQ3 A;  2EM6 A;  4R2Q A;  2JPA A;  1A1F A;  4M9V C;  2EN2 A;  2EMF A;  2EL6 A;  2EOI A;  4R2E A;  2EN3 A;  2EPZ A;  2GHF A;  3EPK A;  2EJ4 A;  2EN1 A;  2I13 A;  2LV2 A;  2EOO A;  2ENH A;  1A1K A;  1ZU1 A;  1YUJ A;  1YUI A;  2EM4 A;  1MEY C;  2VRD A;  2WCC 3;  2EQ0 A;  2LCE A;  2RSI A;  2YTQ A;  2YTO A;  2EPX A;  2EM8 A;  2YTF A;  2EOZ A;  2EML A;  2YTD A;  2DMI A;  2EMB A;  4F6N A;  1A1G A;  2LT7 A;  1Z1B A;  4R2A A;  2EOX A;  2YTE A;  2YTN A;  1A1H A;  2EOR A;  1ZR9 A;  2EM7 A;  1JK2 A;  2YSO A;  2PRT A;  2GLI A;  2R1F A;  3M99 B;  2ELZ A;  1WJP A;  4IS1 C;  2MDG A;  2DGC A;  2EM3 A;  2EOY A;  2YTJ A;  1P47 A;  2DLQ A;  2EOS A;  2ADR A;  1X6E A;  1A1I A;  1JK1 A;  2EPU A;  1KJK A;  2MKD A;  2JP9 A;  1X6H A;  4R2P A;  4R2S A;  1TF6 A;  2J7J A;  4F2J C;  2EOE A;  2A25 A;  2YTP A;  2E72 A;  2EM9 A;  2YU5 A;  2EPR A;  1B69 A;  4FK5 C;  2EMI A;  1UBD C;  2CSH A;  2EE8 A;  2EN6 A;  1TN9 A;  4F6M A;  3MHH C;  2EOH A;  2EM0 A;  2EMY A;  2EOF A;  2HGH A;  2EL4 A;  2EMZ A;  3UK3 C;  2EN8 A;  5KL5 A;  2YU8 A;  2M9A A;  2RPC A;  4R2D A;  2EOM A;  2CTD A;  2EMW A;  2YTI A;  5KL2 A;  2EPC A;  1RMD A;  3EPH A;  2WBT A;  2ENA A;  2YRH A;  2WBS A;  2YSP A;  1X3C A;  2EOJ A;  2EP3 A;  5KL4 A;  2LVH A;  1NCS A;  2EMC A;  2EMG A;  1UN6 B;  1F2I G;  2YRK A;  2D9H A;  4R2C A;  2WBU A;  2EMA A;  2EN4 A;  2YTG A;  4IJD A;  2MKN A;  1TF3 A;  1X6F A;  3MHS C;  2DLK A;  1BBO A;  2EMX A;  2ENC A;  3EPJ A;  2EM5 A;  2EMK A;  2EPP A;  5KL6 A;  2DRP A;  2EQ1 A;  4WSG A;  2EL5 A;  4GZN C;  2CT1 A; 
#chains in the Genus database with same CATH topology
 1X5W A;  3C6M A;  3EQ1 A;  5CFF E;  5KL3 A;  1LLM C;  3EPL A;  1QNT A;  1YSA C;  3BGH A;  4JI1 E;  4X64 E;  1SR9 A;  1T4O A;  2BB8 A;  4TUI A;  4DR5 E;  2LUQ A;  4RH8 A;  1T38 A;  2EN2 A;  4DR7 E;  4N4R B;  1YZ9 A;  1UHZ A;  2EOI A;  3EPK A;  3DF6 A;  3HQ1 A;  4DUZ E;  1A1K A;  5AC4 A;  3THO B;  1YYO A;  1XMQ E;  2B7T A;  4MLQ A;  3H09 A;  2LCE A;  5IWA E;  2YTO A;  4X66 E;  4YY3 E;  4X8W A;  2EML A;  1IBL E;  2F4V E;  2EMB A;  1YYK A;  2EPO A;  4LF6 E;  2YTE A;  2MDR A;  1RC7 A;  1ZR9 A;  2EM7 A;  4B3M E;  4JI5 E;  3AUZ A;  4WYQ B;  2R1F A;  2ELZ A;  3F6H A;  1PJT A;  2DLQ A;  1P47 A;  4L8N A;  4O5G A;  1J5E E;  4DR6 E;  1X47 A;  4JYA E;  2ODR D;  2EPN A;  4R2S A;  5IXM B;  1ZBQ A;  3HPZ A;  2V8Q B;  2A25 A;  3KZZ A;  1AH5 A;  2YTP A;  2EM9 A;  4BC9 A;  2JR1 A;  1NEI A;  4BHC A;  4X62 E;  1UBD C;  2CSH A;  4F6M A;  2JOX A;  4GKK E;  2LE2 A;  2HGH A;  2EMZ A;  2EN8 A;  2ODR C;  1HNW E;  2YU8 A;  2CTD A;  4TUG A;  2YTI A;  3K6Q A;  5KL2 A;  4LFC E;  2WBT A;  3C4T A;  1X3C A;  5A6K A;  4JI4 E;  4LF5 E;  2EMC A;  5F3W A;  1UN6 B;  1L4S A;  2BBG A;  5TSE A;  2UU9 E;  2EMA A;  4O43 A;  4IJD A;  5A69 A;  1TF3 A;  1X6F A;  5AE3 A;  3KZY A;  2EMK A;  4DR2 E;  2DRP A;  4DV4 E;  1MGT A;  1PKP A;  4BC7 A;  4X65 E;  1EH8 A;  3J7A G;  2R76 A;  4WSG A;  4NHR A;  3ADI A;  4MLV A;  4O4K A;  4X9J A;  4DV5 E;  2DMY A;  2EM2 A;  1G2F C;  2LO3 A;  2FV4 B;  3BF2 A;  4NZV A;  4DKK A;  2JYA A;  2L8T A;  3F6G A;  1ZAA C;  2JVA A;  4I8O A;  3VHT B;  1AAY A;  4Q35 B;  4WPY A;  4M9V C;  1N32 E;  1X48 A;  3J7Y p;  2EL6 A;  5A6J A;  2EN3 A;  2EPZ A;  2LMZ A;  4J8Z A;  3T1H E;  2I13 A;  3JTZ A;  2ENH A;  4KWY A;  1YUI A;  4WFT A;  5A6A A;  2FTX B;  2WCC 3;  1IBK E;  2YTQ A;  4L5N C;  1PJS A;  2EM8 A;  2B9D A;  4NXM E;  2DMI A;  4F6N A;  5FLX C;  1WXR A;  4DV7 E;  4R2A A;  5BR8 E;  4ZYH A;  2YTN A;  2YWQ A;  3FIG A;  4DV2 E;  2PRT A;  3TQM A;  1DQ3 A;  1WJP A;  2H36 X;  3IWD A;  1WHQ A;  2YTJ A;  4KHP E;  4GKJ E;  1QU6 A;  4OX9 E;  1X6E A;  2EPM X;  1GTK A;  1KJK A;  2Q8U A;  2MKD A;  1DI2 A;  4AQY E;  2NUG A;  2J7J A;  2M4I A;  4ZYE A;  5DNY A;  2EOE A;  2DB2 A;  2E72 A;  2YU5 A;  3BID A;  1PDA A;  1XNR E;  3P1X A;  4O24 A;  1SFE A;  2F8B A;  2LUP B;  2RSM A;  3HPS A;  4BHB A;  1BBG A;  2EOH A;  2EMY A;  2EPK X;  2L92 A;  3MSW A;  4JI6 E;  1RMD A;  4DV3 E;  2WBS A;  1WHN A;  4LF9 E;  4NXN E;  2L2N A;  2V87 A;  2EOJ A;  5KL4 A;  4KZS A;  2EMG A;  5A2Q C;  4JI7 E;  2YRK A;  2LTR A;  4DR3 E;  2EN4 A;  2MKN A;  1YYW A;  1ZBT A;  2IHR 1;  2ENC A;  1EH6 A;  2G7H A;  2EM5 A;  4YHH E;  4B3S E;  2VQF E;  1N34 E;  2NA2 A;  2CT1 A;  3ZOQ B;  2ELY A;  2EPA A;  1A1J A;  1O0W A;  2YPN A;  3ADL A;  2EN7 A;  3DJW A;  2NAB A;  3HXL A;  5KL7 A;  1DGC A;  2UUB E;  5IV8 B;  4P78 A;  4P7D A;  4LU9 A;  2HC5 A;  4R2E A;  4HEI A;  5A6B D;  3VYX A;  2EJ4 A;  2M1S A;  2LV2 A;  4M30 A;  2EOO A;  2HJJ A;  5A6B A;  1ZU1 A;  1YUJ A;  2EM4 A;  1FKA E;  1YPN A;  2EWL A;  2RSI A;  4BBY A;  4DR4 E;  2V83 A;  2EPX A;  2YTF A;  4F9B B;  2EOZ A;  2YTD A;  5AE1 A;  2LT7 A;  1I94 E;  1Z1B A;  2YT4 A;  2EOX A;  2HHH E;  2I9I A;  3C4B A;  4LF7 E;  3J80 C;  2UXD E;  3VYY A;  3IWB A;  3KWR A;  3ECR A;  5AC5 A;  4ZYD A;  1T4L B;  3THN A;  3C6K A;  4WX9 A;  4IS1 C;  4F9A B;  1FJG E;  1HNZ E;  2E5L E;  2YZT A;  2EOS A;  2VE7 C;  4ZYG A;  4DUY E;  1A1I A;  2V89 A;  2V88 A;  1JK1 A;  2JOB A;  4M0V A;  1TF6 A;  4K0K E;  4WSP A;  2EZ6 A;  2KOU A;  3T1Y E;  4JI8 E;  4LF4 E;  4DV1 E;  1XMO E;  2EMI A;  4DMI A;  2EE8 A;  3MHH C;  3VK6 A;  2DIX A;  1RQ0 A;  3UK3 C;  5KL5 A;  2M7Q A;  2DSY A;  2M9A A;  2RPC A;  4R2D A;  2EOM A;  2JY9 A;  2CPN A;  5T6J A;  2EMW A;  2LJH A;  2EPC A;  2ENA A;  1IBM E;  2VQE E;  3OTO E;  2KHX A;  2EP3 A;  2ZM6 E;  2LVH A;  2B7V A;  1F2I G;  2L3C A;  2D9H A;  5LL6 R;  1EKZ A;  4JV5 E;  2L2M A;  3MHS C;  4B3R E;  2DLK A;  1IMU A;  2EMX A;  4LTY A;  2L6M A;  2NUE A;  5KL6 A;  2EPP A;  1X49 A;  1N3G A;  4F54 A;  1HNX E;  2EL5 A;  5LMU E;  1UIL A;  4HTG A;  4DR1 E;  2K7I A;  2V86 A;  4JI2 E;  2LBS B;  2EMH A;  4R2R A;  2L2K B;  1G2D C;  2YRM A;  2EOQ A;  4WXD A;  1BB8 A;  1T4N A;  2B3T B;  3RMP A;  1N36 E;  1A1L A;  4BCA A;  2UUA E;  2EQ3 A;  2EM6 A;  4R2Q A;  2JPA A;  1A1F A;  4F9C B;  2UUC E;  2EMF A;  4DV0 E;  4JI0 E;  2RTX A;  2UXC E;  2GHF A;  2GPI A;  2EN1 A;  2MC6 A;  5ADZ A;  1MEY C;  4LFB E;  2VRD A;  2JWO A;  4Q28 A;  2EQ0 A;  2LTS A;  4BMJ A;  2L33 A;  1A1G A;  1T39 A;  4WXC A;  1A1H A;  2RS6 A;  2V85 A;  2EOR A;  2MC5 A;  1XNQ E;  3ADJ A;  1JK2 A;  2WZO A;  2YSO A;  1STU A;  2GLI A;  2N3H A;  3M99 B;  3IWC A;  2N8X A;  3J81 C;  2MDG A;  2DGC A;  2EM3 A;  2EOY A;  5AE2 A;  3LLH A;  2N3G A;  4R03 A;  3JU0 A;  2ADR A;  1KYQ A;  2FGG A;  4GEQ B;  2EPU A;  2JXP A;  3LML A;  4BS9 A;  3AV0 A;  2JP9 A;  1X6H A;  2KON A;  4R2P A;  1J26 A;  2LJU A;  5AAS A;  4F2J C;  3JAM C;  2RQL A;  2NUF A;  1IQO A;  5LMN E;  2EPR A;  4B3T E;  1B69 A;  4FK5 C;  4R8O A;  5IT9 C;  1HR0 E;  3HTX A;  3QG5 C;  2EN6 A;  1TN9 A;  4LF8 E;  2EM0 A;  1EH7 A;  2EOF A;  2EL4 A;  2L3J A;  3ADG A;  4RHB B;  1WRJ A;  1YFH A;  4LFA E;  1IQS A;  2RS7 A;  4JI3 E;  1PJQ A;  3EPH A;  2YRH A;  4OOG C;  2YSP A;  1N33 E;  1NCS A;  2UXB E;  2E1M A;  4R2C A;  2WBU A;  4DV6 E;  3L00 A;  2K4V A;  2YTG A;  5LLQ A;  2LRS A;  1BBO A;  1GQE A;  2EPL X;  3EPJ A;  3OML A;  3BBG A;  2EQ1 A;  4M2Z A;  4GZN C;  1GZ6 A;  2VF1 A; 
#chains in the Genus database with same CATH homology
 4X9J A;  2ELY A;  2EPA A;  2EM2 A;  1A1J A;  1X5W A;  5KL3 A;  2LO3 A;  1LLM C;  1G2F C;  3EPL A;  2EN7 A;  1YSA C;  1ZAA C;  2NAB A;  5KL7 A;  2EMH A;  4R2R A;  1DGC A;  1G2D C;  2YRM A;  3VHT B;  2BB8 A;  2EOQ A;  1AAY A;  1BB8 A;  1A1L A;  2EQ3 A;  2EM6 A;  4R2Q A;  2JPA A;  1A1F A;  4M9V C;  2EN2 A;  2EMF A;  2EL6 A;  2EOI A;  4R2E A;  2EN3 A;  2EPZ A;  2GHF A;  3EPK A;  2EJ4 A;  2EN1 A;  2I13 A;  2LV2 A;  2EOO A;  2ENH A;  1A1K A;  1ZU1 A;  1YUJ A;  1YUI A;  2EM4 A;  1MEY C;  2VRD A;  2WCC 3;  2EQ0 A;  2LCE A;  2RSI A;  2YTQ A;  2YTO A;  2EPX A;  2EM8 A;  2YTF A;  2EOZ A;  2EML A;  2YTD A;  2DMI A;  2EMB A;  4F6N A;  1A1G A;  2LT7 A;  1Z1B A;  4R2A A;  2EOX A;  2YTE A;  2YTN A;  1A1H A;  2EOR A;  1ZR9 A;  2EM7 A;  1JK2 A;  2YSO A;  2PRT A;  2GLI A;  2R1F A;  3M99 B;  2ELZ A;  1WJP A;  4IS1 C;  2MDG A;  2DGC A;  2EM3 A;  2EOY A;  2YTJ A;  1P47 A;  2DLQ A;  2EOS A;  2ADR A;  1X6E A;  1A1I A;  1JK1 A;  2EPU A;  1KJK A;  2MKD A;  2JP9 A;  1X6H A;  4R2P A;  4R2S A;  1TF6 A;  2J7J A;  4F2J C;  2EOE A;  2A25 A;  2YTP A;  2E72 A;  2EM9 A;  2YU5 A;  2EPR A;  1B69 A;  4FK5 C;  2EMI A;  1UBD C;  2CSH A;  2EE8 A;  2EN6 A;  1TN9 A;  4F6M A;  3MHH C;  2EOH A;  2EM0 A;  2EMY A;  2EOF A;  2HGH A;  2EL4 A;  2EMZ A;  3UK3 C;  2EN8 A;  5KL5 A;  2YU8 A;  2M9A A;  2RPC A;  4R2D A;  2EOM A;  2CTD A;  2EMW A;  2YTI A;  5KL2 A;  2EPC A;  1RMD A;  3EPH A;  2WBT A;  2ENA A;  2YRH A;  2WBS A;  2YSP A;  1X3C A;  2EOJ A;  2EP3 A;  5KL4 A;  2LVH A;  1NCS A;  2EMC A;  2EMG A;  1UN6 B;  1F2I G;  2YRK A;  2D9H A;  4R2C A;  2WBU A;  2EMA A;  2EN4 A;  2YTG A;  4IJD A;  2MKN A;  1TF3 A;  1X6F A;  3MHS C;  2DLK A;  1BBO A;  2EMX A;  2ENC A;  3EPJ A;  2EM5 A;  2EMK A;  2EPP A;  5KL6 A;  2DRP A;  2EQ1 A;  4WSG A;  2EL5 A;  4GZN C;  2CT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...