2YU0A

Solution structures of the paad_dapin domain of mus musculus interferon-activatable protein 205
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
GSSGSSGIVLLRGLECINKHYFSLFKSLLARDLNLERDNQEQYTTIQIANMMEEKFPADSGLGKLIEFCEEVPALRKRAEILKKERSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the PAAD_DAPIN domain of mus musculus interferon-activatable protein 205
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Interferon-activable protein 205
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2yu0A00
2G7RA 2LS7A 4A2QA 1DGNA 2NZ7A 2N7ZA 2DBGA 3MOPA 3KATA 3EZQB 1N3KA 2N80A 1WMGA 3MOPK 4A2WA 2L6AA 4O9FA 1D2ZA 2KM6A 2L9MA 1PN5A 2DBFA 4E9MA 1C15A 4O9LA 1WH4A 4RHWA 4DWNA 1E3YA 2BBRA 1A1ZA 2IB1A 2N83A 2P1HA 1CY5A 2B1WA 1UCPA 1NGRA 2N1FA 2MS7A 4O7QA 2OF5A 2O71A 1D2ZB 4UZ0A 4N1JA 3CRDA 2YU0A 3YGSC 2MB9A 2HM2Q 2YGSA 2A9IA 2N97A 2DO9A 4JUPA 3J63A 3MOPG 4IZAB 4NQKA 4RHWE 1CWWA 4LWDA 2NAQA 4IZ5E 4F42A 3EZQA 3QF2A 2NSNA 4I16A 4M9SA 4P4HA 2LWDA 2LWEA 2YQFA 4FH0A 4IZ7B 4ZBWA 4JQWA 1WXPA 1FADA 2M5VA 1YGOA 4P4HI 2MPCA 4N1LA 1E41A 4F44A 2D96A 3LQRA 2OF5H 2BBZA 1A1WA 3LQQA 4EWIA 2F1SA 2VGQA 2A5YB 1ICHA 1Z6TA 3YGSP 2DBHA 2DBDA 4M9XA 2MS8A 2N00A 4M9ZA 2KN6A 4QOBA 1DDFA 3CL3A 2YVIA 4O6XA 4N1KA 3J6JA 2GF5A 2MN4A 4D8OA 3T6PA
chains in the Genus database with same CATH superfamily
2G7RA 2LS7A 4A2QA 1DGNA 2NZ7A 2N7ZA 2DBGA 3MOPA 3KATA 3EZQB 1N3KA 2N80A 1WMGA 3MOPK 4A2WA 2L6AA 4O9FA 1D2ZA 2XV9A 2KM6A 2L9MA 1PN5A 2DBFA 4E9MA 1C15A 4O9LA 1WH4A 4RHWA 4DWNA 1E3YA 2BBRA 1A1ZA 2IB1A 2N83A 2P1HA 1CY5A 2B1WA 1UCPA 1NGRA 2N1FA 2MS7A 4O7QA 2OF5A 2O71A 1D2ZB 4UZ0A 4N1JA 3CRDA 2YU0A 3YGSC 2MB9A 2HM2Q 2YGSA 2A9IA 2N97A 2DO9A 4JUPA 3J63A 3MOPG 4IZAB 4NQKA 4RHWE 1CWWA 4LWDA 2NAQA 4IZ5E 4F42A 3EZQA 3QF2A 2NSNA 4I16A 4M9SA 4P4HA 2MJMA 2LWDA 2LWEA 2YQFA 4FH0A 4IZ7B 4ZBWA 4JQWA 1WXPA 1FADA 2M5VA 1YGOA 4P4HI 2MPCA 4N1LA 1E41A 4F44A 2D96A 3LQRA 2OF5H 2BBZA 1A1WA 3LQQA 4EWIA 2F1SA 2VGQA 2A5YB 1ICHA 1Z6TA 3YGSP 2DBHA 2DBDA 4M9XA 2MS8A 2N00A 4M9ZA 2KN6A 4QOBA 1DDFA 3CL3A 2YVIA 4O6XA 4N1KA 3J6JA 2GF5A 2MN4A 4D8OA 3T6PA
chains in the Genus database with same CATH topology
2G7RA 2LS7A 4A2QA 1DGNA 2NZ7A 2N7ZA 2DBGA 3MOPA 3KATA 3EZQB 1N3KA 2N80A 1WMGA 3MOPK 4A2WA 2L6AA 4O9FA 1D2ZA 2XV9A 2KM6A 2L9MA 1PN5A 2DBFA 4E9MA 1C15A 4O9LA 1WH4A 4RHWA 4DWNA 1E3YA 2BBRA 1A1ZA 2IB1A 2N83A 2P1HA 1CY5A 2B1WA 1UCPA 1NGRA 2N1FA 2MS7A 4O7QA 2OF5A 2O71A 1D2ZB 4UZ0A 4N1JA 3CRDA 2YU0A 3YGSC 2MB9A 2HM2Q 2YGSA 2A9IA 2N97A 2DO9A 4JUPA 3J63A 3MOPG 4IZAB 4NQKA 4RHWE 1CWWA 4LWDA 2NAQA 4IZ5E 4F42A 3EZQA 3QF2A 2NSNA 4I16A 4M9SA 4P4HA 2MJMA 2LWDA 2LWEA 2YQFA 4FH0A 4IZ7B 4ZBWA 4JQWA 1WXPA 1FADA 2M5VA 1YGOA 4P4HI 2MPCA 4N1LA 1E41A 4F44A 2D96A 3LQRA 2OF5H 2BBZA 1A1WA 3LQQA 4EWIA 2F1SA 2VGQA 2A5YB 1ICHA 1Z6TA 3YGSP 2DBHA 2DBDA 4M9XA 2MS8A 2N00A 4M9ZA 2KN6A 4QOBA 1DDFA 3CL3A 2YVIA 4O6XA 4N1KA 3J6JA 2GF5A 2MN4A 4D8OA 3T6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7R A;  2LS7 A;  4A2Q A;  1DGN A;  2NZ7 A;  2N7Z A;  2DBG A;  3MOP A;  3KAT A;  3EZQ B;  1N3K A;  2N80 A;  1WMG A;  3MOP K;  4A2W A;  2L6A A;  4O9F A;  1D2Z A;  2KM6 A;  2L9M A;  1PN5 A;  2DBF A;  4E9M A;  1C15 A;  4O9L A;  1WH4 A;  4RHW A;  4DWN A;  1E3Y A;  2BBR A;  1A1Z A;  2IB1 A;  2N83 A;  2P1H A;  1CY5 A;  2B1W A;  1UCP A;  1NGR A;  2N1F A;  2MS7 A;  4O7Q A;  2OF5 A;  2O71 A;  1D2Z B;  4UZ0 A;  4N1J A;  3CRD A;  2YU0 A;  3YGS C;  2MB9 A;  2HM2 Q;  2YGS A;  2A9I A;  2N97 A;  2DO9 A;  4JUP A;  3J63 A;  3MOP G;  4IZA B;  4NQK A;  4RHW E;  1CWW A;  4LWD A;  2NAQ A;  4IZ5 E;  4F42 A;  3EZQ A;  3QF2 A;  2NSN A;  4I16 A;  4M9S A;  4P4H A;  2LWD A;  2LWE A;  2YQF A;  4FH0 A;  4IZ7 B;  4ZBW A;  4JQW A;  1WXP A;  1FAD A;  2M5V A;  1YGO A;  4P4H I;  2MPC A;  4N1L A;  1E41 A;  4F44 A;  2D96 A;  3LQR A;  2OF5 H;  2BBZ A;  1A1W A;  3LQQ A;  4EWI A;  2F1S A;  2VGQ A;  2A5Y B;  1ICH A;  1Z6T A;  3YGS P;  2DBH A;  2DBD A;  4M9X A;  2MS8 A;  2N00 A;  4M9Z A;  2KN6 A;  4QOB A;  1DDF A;  3CL3 A;  2YVI A;  4O6X A;  4N1K A;  3J6J A;  2GF5 A;  2MN4 A;  4D8O A;  3T6P A; 
#chains in the Genus database with same CATH topology
 2G7R A;  2LS7 A;  4A2Q A;  1DGN A;  2NZ7 A;  2N7Z A;  2DBG A;  3MOP A;  3KAT A;  3EZQ B;  1N3K A;  2N80 A;  1WMG A;  3MOP K;  4A2W A;  2L6A A;  4O9F A;  1D2Z A;  2XV9 A;  2KM6 A;  2L9M A;  1PN5 A;  2DBF A;  4E9M A;  1C15 A;  4O9L A;  1WH4 A;  4RHW A;  4DWN A;  1E3Y A;  2BBR A;  1A1Z A;  2IB1 A;  2N83 A;  2P1H A;  1CY5 A;  2B1W A;  1UCP A;  1NGR A;  2N1F A;  2MS7 A;  4O7Q A;  2OF5 A;  2O71 A;  1D2Z B;  4UZ0 A;  4N1J A;  3CRD A;  2YU0 A;  3YGS C;  2MB9 A;  2HM2 Q;  2YGS A;  2A9I A;  2N97 A;  2DO9 A;  4JUP A;  3J63 A;  3MOP G;  4IZA B;  4NQK A;  4RHW E;  1CWW A;  4LWD A;  2NAQ A;  4IZ5 E;  4F42 A;  3EZQ A;  3QF2 A;  2NSN A;  4I16 A;  4M9S A;  4P4H A;  2MJM A;  2LWD A;  2LWE A;  2YQF A;  4FH0 A;  4IZ7 B;  4ZBW A;  4JQW A;  1WXP A;  1FAD A;  2M5V A;  1YGO A;  4P4H I;  2MPC A;  4N1L A;  1E41 A;  4F44 A;  2D96 A;  3LQR A;  2OF5 H;  2BBZ A;  1A1W A;  3LQQ A;  4EWI A;  2F1S A;  2VGQ A;  2A5Y B;  1ICH A;  1Z6T A;  3YGS P;  2DBH A;  2DBD A;  4M9X A;  2MS8 A;  2N00 A;  4M9Z A;  2KN6 A;  4QOB A;  1DDF A;  3CL3 A;  2YVI A;  4O6X A;  4N1K A;  3J6J A;  2GF5 A;  2MN4 A;  4D8O A;  3T6P A; 
#chains in the Genus database with same CATH homology
 2G7R A;  2LS7 A;  4A2Q A;  1DGN A;  2NZ7 A;  2N7Z A;  2DBG A;  3MOP A;  3KAT A;  3EZQ B;  1N3K A;  2N80 A;  1WMG A;  3MOP K;  4A2W A;  2L6A A;  4O9F A;  1D2Z A;  2XV9 A;  2KM6 A;  2L9M A;  1PN5 A;  2DBF A;  4E9M A;  1C15 A;  4O9L A;  1WH4 A;  4RHW A;  4DWN A;  1E3Y A;  2BBR A;  1A1Z A;  2IB1 A;  2N83 A;  2P1H A;  1CY5 A;  2B1W A;  1UCP A;  1NGR A;  2N1F A;  2MS7 A;  4O7Q A;  2OF5 A;  2O71 A;  1D2Z B;  4UZ0 A;  4N1J A;  3CRD A;  2YU0 A;  3YGS C;  2MB9 A;  2HM2 Q;  2YGS A;  2A9I A;  2N97 A;  2DO9 A;  4JUP A;  3J63 A;  3MOP G;  4IZA B;  4NQK A;  4RHW E;  1CWW A;  4LWD A;  2NAQ A;  4IZ5 E;  4F42 A;  3EZQ A;  3QF2 A;  2NSN A;  4I16 A;  4M9S A;  4P4H A;  2MJM A;  2LWD A;  2LWE A;  2YQF A;  4FH0 A;  4IZ7 B;  4ZBW A;  4JQW A;  1WXP A;  1FAD A;  2M5V A;  1YGO A;  4P4H I;  2MPC A;  4N1L A;  1E41 A;  4F44 A;  2D96 A;  3LQR A;  2OF5 H;  2BBZ A;  1A1W A;  3LQQ A;  4EWI A;  2F1S A;  2VGQ A;  2A5Y B;  1ICH A;  1Z6T A;  3YGS P;  2DBH A;  2DBD A;  4M9X A;  2MS8 A;  2N00 A;  4M9Z A;  2KN6 A;  4QOB A;  1DDF A;  3CL3 A;  2YVI A;  4O6X A;  4N1K A;  3J6J A;  2GF5 A;  2MN4 A;  4D8O A;  3T6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...