2YU9H

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yu9H00
2E2HH 3M4PA 3A5UA 1K0RA 5LMNQ 1I50H 2WB1G 4J15A 2UUBL 5C44H 3G4SA 4DR1L 3HOWG 3HOVH 4ALPA 4IPHA 3HOZG 4JI0Q 3PUZA 2XTIA 4X64Q 3UDXA 2NZOA 5AJ3Q 3BZKA 4NPSA 4B3MQ 1K83H 3Q8DA 1PHJA 1KHIA 1X3FA 3S1MH 1EQQA 4GLVB 2XGTA 3KJOA 4LF6L 1PYSB 3KF8B 5C44G 3S2HH 4BA2I 4DK3C 3HOVG 1TWGH 1BBWA 1XPUA 1B7YB 1YHBA 1BVSA 3UDFA 1RIPA 1HZCA 2AHOB 3KDFA 4R4QA 3G71A 3KF6A 2R7ZH 1LYLA 4X66L 4P75A 1QVGA 4BBSH 4R4IA 3TREA 1XNQL 4R1JA 5IP7H 5IY0A 3D31A 1NJIC 4PMWA 4GNXC 1HNXQ 3JAMi 3S14H 4YY3L 3I4OA 3OTOL 1C7YA 2V1CC 3AQQA 4C3IH 4B3TL 2JA5H 1YEZA 3GO5A 5GADC 2Q2IA 4P73A 4BBSG 5IYDH 1E1OA 2E5LQ 2PQAB 2D0PA 4JOIA 5IP7G 1YHQA 1HR0L 1PH3A 1OTCA 1QVFA 2CCZA 1IXRA 4L5RC 2GVBA 4A3GH 2JJQA 1CKMA 4A3MG 4DV5L 4A3KH 2JA5G 1QUQA 1KXLA 2Q2TA 2LSSA 1WFQA 1KRTA 3GTQH 4DR7L 4JI5Q 4KLKA 1G6PA 1N36L 3I56A 3A0JA 4K0KQ 1ASYA 4EQ5A 2NVTH 4OO1I 4QIWE 4A3GG 2DGYA 3I4MH 1SN8A 3ER0A 5C0XG 2R92H 4LF5Q 1NY4A 4A3KG 4A3DH 4GKKQ 4DAYB 1YJ9A 4B3SL 5GAGC 3J81c 3E9HA 4JI8Q 2PMZE 1PYBA 1N32Q 3BZCA 2MNAA 1K73C 3CCQA 1Q1EA 4OWWB 3HOYH 2VL6A 4JI0L 1K9MC 4YWMA 4X64L 3GTOH 3I4MG 2R92G 4H02A 4GOPA 3A74A 4A3DG 1EQRA 4YCWA 2VQFL 4A3LH 4TQUS 4A75A 3GTGH 5IYBH 4JI6Q 2N78A 3M4OH 2L15A 1JMCA 1M1KC 1WJJA 1EWIA 2YTVA 2Z0SA 4LFAQ 2UUBQ 3HOYG 4LF7L 4IFDJ 3ERSX 5JJIA 2IHEA 5M5XH 5IWAQ 2ATWA 2K5NA 1K3RA 1PVOA 4DR5Q 4A3LG 3ULPA 5IYBG 4LNQA 1U0LA 2C35B 4RMFA 1HNXL 4LF6Q 4A3IH 2RHQB 4X65L 2HIVA 4Y7NH 3PF4A 1FVIA 1IBLQ 2E2JH 3M4QA 1HR0W 1P16A 4LF4L 1EIYB 4P71A 2CWAA 3WWVA 2EQSA 3T1HL 4A3IG 1SLJA 1IL2A 3H15A 2UUAL 1VQMA 2AMCB 3OTOQ 1Q12A 2IY5B 1QVCA 3KOJA 4HJ7A 4JI5L 1L1OB 1L2FA 2OQKA 2KHJA 1Y1VG 1P8LA 5C0XI 4DR2Q 1CKNB 1HR0Q 1VQ6A 2ZJQA 3CCSA 2Z6KC 3FKIH 1VS0A 1Q86C 1L1OC 4EX5A 1HNWQ 5JJKA 4LF5L 4NB3A 3HKZG 3K0XA 3PCOB 1GVPA 1N33L 4UP8A 3GTJH 3CCMA 3JAMc 1N32L 1X9NA 1SE8A 1OXSC 2KCMA 2Y0SG 3W1GA 3OW2A 4UPAA 3KLWA 2DUDA 4BA1I 1VQDA 2MFIA 4RG1A 3FKIG 4LUVA 3RLNA 1LTLA 1TWFH 1UE5A 2K75A 3PUYA 5M3MH 1VQ4A 4IFDG 1NMFA 3RNUA 4JI6L 4BBRH 4B3SQ 1X6OA 2NVXH 1J6QA 2K5VA 4LFAL 4AYBG 4DV4L 3F2DA 3GTPH 2AKWB 1HZ9A 4OX9Q 3RZDH 1Q8KA 5IWAL 1VQ7A 3EBEA 2OTLA 1VQEA 5M3MG 1YJWA 1IBML 4DR5L 3S2DH 3J80i 2PI2E 3DM3A 1SRUA 2KHIA 4JI2Q 4BBRG 1A8VA 2VQFQ 4HJ8A 1EOVA 4DR3L 2GVAA 3M9BA 2GN5A 4DV0Q 1KC8C 4JBJA 2Q2HA 3NBHB 5GROA 3H0GH 4KI0A 1ASZA 1C9OA 2BH8A 5GQOA 2UUCQ 1IBLL 1XPRA 4LF7Q 4A3JH 4JCVE 3VDYA 3K81C 3GDEA 4GNXB 1KL9A 1YZ6A 4X62L 2K4KA 3U4ZA 2JK8A 4R4TA 3CC2A 2H5XA 1IBKL 2I5LX 1E7ZA 2RCNA 3KJPA 2YYZA 3H0GG 3TEHB 1GO3E 4JI1Q 4L5QA 4X65Q 1K8GA 1I6HH 3K7AH 4A3JG 4A3MH 1EUJA 2WB1E 4AYBE 5FLXc 2ZTEA 2ALYB 1VQNA 1NBWA 4UY8C 2R7FA 1NTGA 3E9IA 4IO9A 1OXVA 2ASBA 5IT9c 4IPGA 4MTNA 1OXXK 1UWVA 4DR2L 1X3GA 3UE1A 3T1HQ 4LF4Q 4NXNL 4DUZQ 1SFOH 2UU9Q 4POGA 4YHHL 3G48A 3EN2A 1HNWL 1S3OA 1RL2A 1WOCA 2JQOA 3GTKH 1X3EA 4C3HH 2UUAQ 3CAMA 4A4IA 5FLMH 3FHWA 3K8AA 1TXYA 3S17H 3B6YA 1UE7A 3L7ZC 4YWLA 3CCLA 4BY1H 1Q7YC 1B70B 2QEXA 4IFDI 1NMGA 5E7NA 1WCMH 3S15H 2EXDA 1LUZA 1Q46A 4JI3L 4UP9A 5FLMG 2HIXA 2CQOA 1N33Q 2JA8H 1FJGQ 2I5HA 1V9PA 4BY1G 2Q2UA 1K8AC 3GD7A 3K7UC 3FP9A 4LFCQ 1WCMG 2N49A 1HZBA 1AE3A 5M3FH 4A3FH 1J5EL 1X65A 4OX9L 2VNUD 2R93H 1EYGA 1OXTA 3CQZH 1E24A 1L1OA 4DK6C 4JI2L 2BH2A 3PO3H 5DLQE 2JA8G 4AH6A 3KFUA 1OXUA 4X6AH 1CKNA 4LUOA 4DV0L 4HJAA 1XPOA 1QZHA 1JJ2A 1JJCB 3UDGA 5JEAJ 2UUCL 4IOAA 1IZ6A 3BU2A 5M3FG 4DV4Q 2D62A 4HIOA 4A3FG 2R93G 3IRBA 1CSQA 1VQ5A 2K50A 2ZJPA 3ZJYC 4DV7Q 1JB7A 3PO3G 3ULLA 1IBMQ 1AE2A 3AYHB 3W1BA 1VQOA 4TVAB 4XTCS 3CMAA 5JJLA 1DGSA 4DR3Q 4LFBQ 4JI1L 1UEBA 4GLAC 4IPCA 1KQSA 5K36G 1X55A 4O2DA 3S1QH 3ICEA 1V43A 4OONA 2WAQG 2MO0A 1MJCA 4FDBA 1XNRL 1BBUA 2NN6G 2NVYH 4KHPL 2HHHQ 5HY6A 4X62Q 2CWPA 2R7DA 1W2BA 3AEVA 2NVQH 2A8VA 1Y1VH 3D0FA 4DUZL 1IBKQ 4JC0A 1PH1A 1HNZQ 2UU9L 1PH2A 2KCTA 3SGIA 3J80c 3J7ZC 4QQBX 1VCIA 1JE5A 3CC4A 2YV5A 4BXXH 4QGUA 4YCVA 3F2BA 1VQBA 3TQYA 2JE6I 1A0IA 2ZJRA 4GN4B 1N34Q 4A3BH 1MIUA 3HFZB 1I5FA 2IX0A 3DLLA 5HGQA 5C4JH 3TS2A 2KBNA 3CF5A 1U5KA 1XTDA 2LXJA 1PA6A 3ULJA 4NXML 4NXNQ 1PH9A 4BXXG 3EIVA 4YHHQ 4IJHA 4GNXA 3CPFA 5M5YH 1M90C 3H3VH 2WFWA 2WP8J 4A3BG 2IT1A 1FJGL 4GN3B 3RLFA 2UXBQ 5FJ8G 1YNXA 1Z47A 4GN5A 4LFCL 1KRSA 3L2PA 5C3EH 1Y14B 3I2ZA 3UE0A 3NENA 5JEAG 5ELNA 1YI2A 1QZGA 4DAMA 1AH9A 2VW9A 4MZ9A 4JI3Q 4DNIA 2JEBI 1SROA 1VQJA 3LGJA 1YITA 4YWKA 4UP7A 1XJVA 2E2IH 5IE8A 3STBC 4QY7A 4A3CH 3CW2C 5C3EG 1I94L 3J7A5 2F3IA 5IYCH 4DR4Q 1D7QA 3U4VA 2KENA 1J5EQ 4R4OA 4DV7L 1N8RC 1VQ8A 1YVCA 3U50C 4GLXA 2UXDQ 3CCJA 1I3QH 1JT8A 3PUVA 3F2CA 4JV5Q 3CMEA 1Q81C 3CC7A 3HKZE 2VUMH 3CCVA 3CCEA 5EAYA 3S1NH 4XIGS 4LFBL 2UXCL 1C0AA 4B3RL 4JI4L 4L5SA 4A3CG 1VQIA 3I7FA 2Y0SE 2NN6I 5IYCG 3T1YQ 5M5WH 2I5MX 2AWNA 4LF8Q 2QA4A 2HHHL 1SR3A 2AWOA 2BA1A 3PIPA 4HJ9A 3UDIA 5BR8Q 3RN2A 1EFWA 3HOUH 2VUMG 3M3YH 1CUKA 1HNZL 1BKBA 4DR6L 5C0XJ 1VQAA 4DPGA 1S40A 1G291 1KIXA 1CSPA 2F52A 2B63H 4JG2A 4MNOA 4AQYQ 1N34L 2F4VL 1UE6A 3PIOA 1TWCH 2OWOA 1XNRQ 3E0EA 1FGUA 2ZM6Q 3HOUG 4KHPQ 4P72A 2D0OA 4JBMA 2K14A 3CCRA 2B3GA 1XMQQ 3A5ZB 4DV6Q 2MQHA 4O0AA 2JA7H 4A93H 2B63G 3S16H 4GKJL 2K52A 1YHAA 1WI5A 2PNHA 4P74A 1KD1C 1LM0A 3TRZA 4BY7H 2UXBL 4JYAL 1H95A 3W5OA 2YU9H 2ZTCA 1Q1BA 3H3VI 1VQPA 4A93G 2JA7G 3U58A 3J81j 4NXMQ 1PV4A 3NEMA 3MEFA 3JC66 4YCUA 2N3SA 4JI7Q 4DV2Q 2R7ZG 2JEAI 4Y52H 1A63A 1HZAA 4BY7G 4PG3A 5C4XH 4LW1A 1G51A 5H1SE 2LXKA 1N9WA 2VZAA 4DR4L 1W3SA 3K80C 3PGZA 4C2MH 1MJEA 2VQEQ 1XMOQ 1Q82C 3CD6A 1VQGA 2A1AA 2Z6KA 3I55A 2UXDL 5IYDG 4JV5L 3PUWA 3PF5A 3I4NH 1HH2P 5C4XG 1PH6A 5IP9H 5LMUQ 2ID0A 4OWTB 1HJPA 1A62A 1X54A 4ME3A 3T1YL 2EIFA 2VS1A 4C3JH 1I94Q 2E8GA 4DV1L 1VQLA 4APVA 4PZ7A 4LF8L 3RR5A 1CKOA 1O7IA 5J3BA 3KDFB 4DV3Q 5GAEC 4DUYQ 1VQCA 2RHSB 3CP0A 1TWAH 3KF6B 5BR8L 5LMNL 1PH5A 3F1ZA 2OCEA 5IP9G 3MXNB 4LF9Q 3PV0A 4HIMA 2UXCQ 2NZHA 3CCUA 4B3RQ 4JI4Q 5AJ3L 4IJLA 4PZ6A 2BA0A 4AQYL 4B3ML 3OYYA 2YTYA 2MO1A 3S1RH 1PH7A 3STBD 2ZM6L 3M7NA 1V1QA 1D8LA 1XMQL 3HKSA 4DV6L 1UE1A 4QL5A 3RLOA 4AIMA 2IHFA 4DR1Q 1PH4A 1PFSA 1GKHA 4DR6Q 4HJ5A 1S72A 2R6GA 5ELOA 4DKAC 1PH8A 3PSIA 2PI2A 4JOIC 2VY3A 3RZOH 2I0QA 1B8AA 1QUQB 2F4VQ 5GAHC 2HT1A 1VQHA 1E22A 1VQ9A 1NE3A 5FJ8H 4JBKA 4GS3A 4A3EH 2A19A 4R4CA 1VQFA 4JI7L 4KHZA 4DV2L 2B29A 1MKHA 4GKJQ 2E5LL 1R9TH 2JA9A 4X66Q 4LWCA 3F8TA 4QJFA 1XNQQ 1E3PA 3GTMH 3RN5A 3S24A 3AFQA 3CXCA 2ES2A 4JYAQ 2WAQE 3G6EA 1JJGA 3M85A 1YBYA 3J81i 2HQLA 3L0OA 4A3EG 4YY3Q 1Z9FA 4POFA 4PZ8A 2VQEL 1XMOL 3I4NG 4IOCA 4B3TQ 4IPDA 2RF4A 4GOPB 3AFPA 1GM5A 1YIJA 2JA6H 2CKZB 4WJ4A 1SMXA 1IYJB 1TWHH 2FXQA 4L5TA 5LMUL 1VQKA 2QGQA 1FL0A 3PO2H 4K0KL 4OWXB 3HOXH 1KAWA 2N8NA 3GTLH 4LUZA 1T9HA 4GOPC 4JBWA 1L0WA 4GKKL 2OTJA 1GD7A 2YTXA 4DV5Q 1Y1WH 4A76A 5LMNW 4DV3L 4JI8L 4DUYL 3TS0A 3PUXA 2CFMA 3BJUA 2JA6G 1E1TA 1EIFA 4DR7Q 4LF9L 4HIKA 3PO2G 3HOWH 2ZTDA 3HOXG 1N36Q 3NELA 1WYDA 1X56A 2K5HA 4HIDA 3HOZH 3CPWA 3KYHC 1Y1WG 2PQAA 2OQ0A 4DV1Q 1YJNA 2IX1A 4OXPA 4OO1G 4WJ3M
chains in the Genus database with same CATH superfamily
2E2HH 1E2WA 2WB1G 1WD1A 1XX8A 3GTJB 2EOTA 3HOVH 4ALPA 1RCVD 4IPHA 2XTIA 2NZOA 2A6HD 4NPSA 4DGZA 2L9HA 1KHIA 3S1MH 3T53B 1EQQA 4GLVB 5C4HA 1PYSB 2OXPA 5M3MB 1RF2D 2JXMB 3KF8B 3TP7A 4XXEA 3QWNA 3UDFA 2AHOB 2E2IB 3KDFA 1QVGA 4P75A 4RGTA 4FF1A 4R4IA 3TREA 4KD4A 4UAIA 4G4KA 5KNBA 3JAMi 1II3A 3AQQA 2RDHA 5IT9E 3GO5A 4BBSG 4N9PA 1CM9A 1E1OA 3J7AF 2PQAB 4JOIA 1G8ZD 1EWHA 1OTCA 1CZWA 2K5QA 2SOBA 4L5RC 3A54A 3K6OA 2GVBA 4L6TB 4A3GH 5I2XA 4X3TA 5BN5A 4A3KH 1QUQA 2LSSA 4DR7L 1KRTA 3GTQH 5D3IB 4LMQD 5CORA 3I56A 3A0JA 2DNCA 4K0KQ 3Q23A 2NVTH 4OO1I 4DU9A 3I4MH 2R92H 5JAVA 4LF5Q 4GKKQ 4DAYB 4B3SL 4QUFA 5GAGC 2A68C 4XDXA 2QCPX 1GUNA 2IX3A 1Q8IA 2MNAA 4K5WA 1Q1EA 2F0MA 1Y8PB 2VL6A 2XN9C 1QWYA 4JI0L 3S17B 1AFPA 1DM0B 1ESFA 3A74A 4GOPA 4KHVA 4U68A 2H1EA 1WCMB 2LFNA 2XNAC 3GTGH 4JI6Q 3M4OH 4KJNA 1JMCA 2FHTA 1DD2A 2JA8B 1W6KA 3K58A 4K8IA 4A3LG 3J7AV 5IYBG 3SK8A 4F88A 2C35B 4LF6Q 2RHQB 3KLRA 3OMCA 1CTMA 1FVIA 2PO4A 4KY5A 1P16A 4P71A 2CWAA 3WWVA 1ESRA 4A3IG 3DUZA 1WTWA 1IL2A 2X69A 2UUAL 1PRTB 1ZYRD 1MD2D 1YNJD 1VQMA 3KOJA 4Q0FA 2D9UA 4JI5L 1L1OB 2OQKA 1PRTC 1G6ZA 3KF8A 1Y1VG 1P8LA 3D4WA 3CCSA 3FKIH 1VS0A 4JW0A 1L1OC 4CBVA 1HNWQ 5JJKA 3JAME 3K0XA 5AFWA 3PCOB 2L5TA 1N33L 3OPOA 3GTJH 1KLGD 3JAMc 1A6XA 1N32L 5HURA 1OXSC 2KEEA 3OW2A 3RZOB 2DUDA 4OHJA 1VQDA 4RG1A 2F3WA 4LUVA 1NCVA 2K75A 5M3MH 1VQ4A 4IFDG 3T4AC 4BBRH 2EYJA 2F3VA 1J6QA 2NYZD 1HFNA 3BVGA 1AZPA 4AYBG 1HZ9A 1TIID 3RZDH 5IWAL 1IBML 4DR5L 3J80i 3A7LA 3OOCA 1EOVA 3M9BA 2GN5A 3ERQA 4DV0Q 2Q2HA 3NBHB 2M2LA 4KV6A 2JA6B 4FP5D 1IBLL 1DOMA 4LF7Q 4DAYA 4JCVE 1ET6A 4GNXB 2A69D 3T51B 2NZ1D 2JK8A 4R4TA 1D2BA 5EQ0A 1KNEA 3D8GA 2YYZA 3H0GG 2BE5D 4A3JG 4AYBE 2R7FA 1NTGA 2MPMA 2O2LD 4IUNA 1LT4D 4POGA 3HEJA 1CA5A 5F2DA 1NR4A 5FLMH 4V190 1C48A 3FHWA 3NTHA 3S17H 3L7ZC 1UE7A 4YWLA 1HTLD 1SNOA 2B63B 4FO2A 1R4PB 5KRUA 1NMGA 1WCMH 1STHA 1WTPA 4QIWB 2MHVA 3QOJA 1SXTA 2EXDA 1Q46A 4C3HG 3SXHA 4DK1A 1VMCA 2JA8H 2PMZB 3K7UC 2N49A 2MP1A 1E24A 1L1OA 4DAVA 5IIFA 3PO3H 1MGSA 2RBMA 2F0IA 2QDLA 1XPOA 2UUCL 4ZKCB 3BU2A 4HIOA 1CSQA 1VQ5A 5G3LD 4DV7Q 1DJRD 1PDQA 1YNNC 2NN6H 4RKBA 2HCIA 1CHPD 1DGSA 3ONAB 4LFBQ 4KY6A 1GUWA 1X55A 4IZ8A 1V43A 3K0YA 4OONA 4FF4A 2WAQG 1H9JA 4FDBA 2EJGC 5CV7A 2CWPA 3E5SA 2A8VA 1Y1VH 1IBKQ 1PH1A 4QQBX 2KCTA 3J80c 4BXXH 3CC4A 2YV5A 4GZYC 4QGUA 5KGUA 2CQAA 1PZJD 3MXGA 1QE6A 1HXYD 4GN4B 2KCNA 1N34Q 1MIUA 1I5FA 2IWHA 3BDOA 3GTOB 5HGQA 3NBHA 3LNNA 2LXJA 4JK1C 3C46A 4YHHQ 2F0NA 4GNXA 1SE2A 1M90C 4K2KA 4DFAA 2WP8J 1H9MA 3RLFA 2VXWA 2BDOA 5D3DA 4LFCL 4EVOA 3UE0A 3NENA 1QZGA 2VW9A 4A3EB 4Y7NB 4JI3Q 2JEBI 3LGJA 3MEHA 1EEFD 3STBC 3HP3A 3VYUA 3CW2C 5C3EG 1I94L 2DJFC 3D6CA 4OIKA 2H4OA 4R4OA 1VQ8A 1YVCA 3BYTB 4GLXA 5CV8A 3PUVA 3F2CA 1Q81C 1Z7TA 3CCEA 4XIGS 1VQIA 2DN8A 2EY1A 3K5OA 4NMZA 1IYVA 2AWNA 4LF8Q 1RDPD 3HOXB 4ZUJA 2VUMG 1BKBA 3JAML 2I07B 3OSOA 2B63H 4MNOA 5ISRA 3FPPA 3HOWB 3H91A 2Z4IA 1XNRQ 3E0EA 1FGUA 2RDFA 1TY0A 4P72A 1CFMA 4KHPQ 4JBMA 1QOHA 2B3GA 2IJ0A 3A5ZB 3RD4A 2Q8RE 1ML0D 1B53A 1J9OA 1S5ED 1LABA 1KD1C 2UXBL 4JYAL 4DXFA 1H95A 2QILA 1Q1BA 4A93G 3D4DA 4YCUA 1A63A 2PNRC 4IUVA 2ENBA 5KYIA 1LTBD 2LXKA 2EDGA 3NWTA 4DR4L 3K80C 3PGZA 2UXDL 1VQGA 2Z6KA 1FNVA 3S14B 1PTOF 3I4NH 3PF5A 1DONA 4PMBA 5COYA 4A3MB 2A6HC 2JA5B 2ID0A 4OWTB 1A62A 1O7LA 1X54A 3FMCA 3T1YL 1JICA 3SEBA 4H44C 1VQLA 4APVA 3RR5A 3CP0A 1PH5A 3F1ZA 5IP9G 3FVQA 3MXNB 5C5MA 4HIMA 3PQIA 3HG9A 3CCUA 2DNEA 4XQNA 4B3RQ 3NQTA 4C3JG 2BA0A 4HCEA 1I6VC 1HA5A 3NUCA 1PH7A 4R8NA 2ZM6L 3N52A 1PZID 1EEID 3K57A 4DV6L 1E2ZA 3RLOA 4DR1Q 4DR6Q 5C5LA 2K33A 3PSIA 3HOYB 1NNXA 4XQQA 1D1IA 5M3FB 4I65A 2F4VQ 5DEHA 1NE3A 2JSOA 4KD3A 4A3EH 1S5DD 5FKAC 4LJZC 3EJIA 2VB3X 1SJHD 1MKHA 4N9TA 1R9TH 1A3UA 3C1FA 4K5VA 4QJFA 3RN5A 3I90A 5EPJA 3J81i 3L0OA 1EIGA 4CKBA 2VQEL 4IOCA 2RF4A 4QCLA 1STYA 3VR5A 3S1QB 4OEMB 4WJ4A 3NTIA 1IYJB 3BDLA 4K0KL 2QGQA 3WDNA 3HOXH 2N88A 1Z6HA 1T9HA 1EQVA 1F2YA 4JBWA 1L0WA 4GKKL 2OTJA 1Y1WH 3J80L 4A76A 4DV3L 2P5ZX 1JOOA 3IL8A 5G3LF 4DUYL 2CFMA 3BJUA 3HKZB 4LF9L 1I4RA 3HOWH 2ZTDA 1N36Q 3NELA 4QUCA 1DZ1A 1X56A 5DM63 3HOZH 2Y0SB 2EYHA 2PW5A 4DV1Q 3P20A 3NE5B 3A5UA 1K0RA 1I50H 4J15A 5C44H 1WTQA 1STAA 2Z9HA 3I91A 5T1GA 4ZUIA 1WD0A 1K83H 1PHJA 1X3FA 4LAAA 1ZYRC 1YNJC 4LF6L 2R61A 1EY4A 3HOVG 5EKLA 1BBWA 1B7YB 2NVXB 1BVSA 2F0OA 3IAYA 3TP5A 5C4ZA 1XNQL 3MXNA 1HNXQ 3S14H 1MSGA 5FLXE 5KNDA 3KK7A 2PPBC 1CK1A 3S1NB 2B2TC 3WOEA 2JA5H 2WKDA 3G7LA 1J8IA 4FVMA 2D0PA 1QVFA 2WKCA 3P75A 5C0XH 3FDTA 1ENCA 1EZ8A 2K5DA 4KLKA 4XT1B 3Q6SA 4QMGA 2GA4B 4A3GG 3W3AA 4RHSA 1SN8A 1NY4A 4A3KG 2F0TA 3J81c 4FYDA 4JI8Q 1PYBA 2EYPA 3S16B 3TDQA 4YIJA 5E4XA 2A69C 3HOYH 1SNQA 4BY7B 4X64L 3I4MG 2KHSA 4H02A 4BY1B 2YU9B 2R92G 2BE5C 2B2VA 4YCWA 4K5XA 2N78A 1BR9A 1WJJA 1EWIA 2UUBQ 4LF7L 5C4XB 1CI3M 5J22A 5JJIA 1PFBA 4B9XA 1PVOA 2QW7A 4C2MB 3ULPA 2R93B 3T16A 2J7ZA 4RMFA 4RCOA 3KLSX 3NBIA 5IGDA 4ZYSA 3PF4A 1SJED 3M4QA 1S5CD 2KQ3A 1HR0W 5EJWA 1AZQA 2DJGC 1SLJA 1STEA 3H15A 1ZKOA 1SEBD 5LL6S 3OTOQ 5IGCA 1IYUA 3SK5A 1JWSD 2MJ8A 1S5FD 1AW7A 1SE3A 3S1RB 4DR2Q 5CBEE 3GQBA 1O78A 2AUKA 4M1UB 1DOLA 1U4PA 4NB3A 4X3UA 1CQVA 3CCMA 1F2ZA 2B2TA 4NKLA 3W1GA 4UPAA 4BA1I 2MFIA 4A3BB 3FKIG 3RLNA 1LTLA 1UE5A 4OL7A 3NHHA 2NVXH 2NUCA 5M5YB 2K5VA 4LFAL 2IW3A 1T5XD 1F9PA 1TR5A 1Q8KA 1RTNA 5M3MG 4BBRG 1A8VA 1B50A 2GVAA 3MZ5A 1KC8C 4JBJA 1LTGD 4KKTA 1A3TA 4KI0A 2BH8A 1TWHB 3OHXC 1CT1D 1D1KA 1PXUA 3VDYA 5EKIA 5I6WA 3PO2B 3K81C 5E3FA 3GDEA 3D3RA 5CV6A 1KL9A 2K28A 2H5XA 1IBKL 4L63B 1PTOH 3UI2A 4JI1Q 5IGFA 3R8BA 1K8GA 2WB1E 2ALYB 2CHBD 5JOBA 1OXVA 5IT9c 4MTNA 1C4QA 3ITPA 1X3GA 4LF4Q 3T1HQ 4DUZQ 4YHHL 1RL2A 2JQOA 1ONLA 3FPUB 3HOUB 5JPNC 3CRLC 1JR0D 3B6YA 1L0XB 4BY1H 5J1ZA 4IFDI 5E7NA 4CHTB 3PIP3 4K2LA 4RCNA 1BF4A 3QO2A 1SSOA 4JI3L 4UP9A 5FLMG 2HIXA 1TWGB 2WACA 5EPKA 1ILPA 1JE4A 1KLUD 2I5HA 1EL0A 1X3QA 1V9PA 2R7ZB 1K8AC 4BBSB 3GD7A 3PIO3 1WCMG 4OX9L 1X32A 5LHY1 3T13A 4A3FH 2R93H 1XXGA 5J39A 2Z8LA 4JI2L 5DLQE 2JA8G 2E76C 3KFUA 4LUOA 1QZHA 1I4GA 1JJCB 5JEAJ 1D5ZC 2F0VA 4DAPA 1I4PA 2K50A 1JB7A 3PO3G 4C1NK 3AYHB 1U4MA 3VA5A 4TVAB 5JJLA 3DEOA 1KQSA 4F87A 2EJMA 2G9HD 3KBGA 4O2DA 3TP8A 4B9WA 2MO0A 1PZKD 2KCCA 2X6LA 1XNRL 2NN6G 4O1NA 4KHPL 2HHHQ 2F4IA 2ZXPA 4X62Q 2IL8A 2WINB 3J81L 4DNTB 1D5XC 1HNZQ 2J0TD 2UU9L 1VCIA 2NB0A 1TWAB 2KEDA 2K05A 4CKEA 2JE6I 2ZJRA 2F1MA 1LTAD 2F0LA 4A3BH 2BDNA 4HSPA 3DLLA 1PFNA 4H13C 2XSCA 2CH4W 1PA6A 3ULJA 4NXNQ 4ME5A 1PH9A 4BXXG 1V1PB 4NW2A 3CPFA 5M5YH 2IT1A 1FJGL 4GN3B 3V05A 4E6IA 1MI2A 5M5XB 1YNXA 4J8QA 4GN5A 1MSHA 4KN7C 1DCZA 1AH9A 4DNIA 1SROA 1JOQA 3MAQA 4N8X1 5I4DA 2E2JB 2E2IH 3LWUA 2F0JA 4QY7A 1I4QA 1U4RA 1J5EQ 4R9WA 1SDFA 1HFGA 4ODGA 3CCJA 3CMEA 1AN8A 3M4YA 2X6GA 5EAYA 1B3AA 4B3RL 4L5SA 2A73B 3Q24A 4TRDA 4RGOS 2BA1A 2AWOA 5E4WC 1EFWA 2F0UA 3UDIA 5BR8Q 3HOUH 1JOKA 4DR6L 4CJ1B 4ZKBB 2F52A 4JG2A 4AYBB 4EGVA 2F4VL 1UE6A 2OWOA 4IUPA 2B2WC 1EY9A 1BCPD 2K14A 3CCRA 1V1OA 5ELCA 2Q8IB 3LWEA 2MQHA 4O0AA 2B63G 2F0FA 2K52A 1YHAA 1Q90A 4P74A 3GTPB 4R8IA 1EU4A 3V96A 2NTTA 3W5OA 2K32A 5FO9B 3H3VI 3K5MA 3I70A 1VQPA 3U58A 4NXMQ 1SYGA 3NEMA 3JC66 4JI7Q 1TY2A 4DV2Q 1Y69U 1U9RA 4CJ0B 4LW1A 1UAPA 4HSVA 1BXTA 2VZAA 1W3SA 1A2UA 1XMOQ 5EBDA 1Q82C 3CD6A 5IYDG 3IFDA 4JV5L 1I6HB 4RFBA 1PH6A 4C3IB 3SK4A 5LMUQ 3C2PA 1V1PA 5IT9L 4ME3A 2JN4A 2EIFA 2E8GA 4DV1L 5A2QE 1M8AA 5CMDA 1CKOA 1SFOB 4CDCC 4NDXA 2V4DA 3I4NG 1TWAH 4C3HB 1SYCA 2AQ1B 3NQIA 3PV0A 2UXCQ 2NZHA 4JI4Q 3DEPA 4AQYL 4OELB 4XYQA 2YTYA 2MO1A 3S15B 2FINB 1TU2B 1V1QA 2NBFA 3A8JE 5ELEA 2KJXA 3BZDB 1XMQL 4A3DB 2EYFA 1PH4A 2IHFA 3OIPA 1ICWA 4HJ5A 2R6GA 5ELOA 4DKAC 3MVVA 3RZOH 1K0SA 5GAHC 2HT1A 1VQHA 1BUVT 1BBXC 3CQZB 4JBKA 4DN4M 2A19A 1PMRA 2B29A 4GKJQ 2JA9A 4LWCA 1RODA 2C5CA 3BYYB 5FO8B 3S24A 2WAQE 1V8QA 5CV9A 3X3NA 3M85A 5C3XA 4A3EG 2B2WA 2HQLA 1ENAA 1Z9FA 4JPBW 2PYKA 1A2TA 1IL8A 3T56B 3AFPA 4DK0A 1YIJA 3VR4A 2JA6H 1BOSA 3P1HA 4C1NI 4OWXB 3V2TA 4HN7A 1ZEQX 4J1MA 1GD7A 2YTXA 5LMNW 4OO1H 4JI8L 1DXMA 5BN4A 1EIFA 4DR7Q 3HOXG 4HIDA 5IGGA 1F9SA 3K5LA 2Z1CA 5C4JB 3MC0B 1Y1WG 1E2VA 1PFMA 1A15A 3O13A 3M4PA 2B2YC 2RDGA 3GV6A 4KJOA 2SNMA 3G4SA 3NWSA 2UUBL 3HOWG 4RGMA 3HOZG 4JI0Q 3H3VC 3URYA 4B3MQ 2EY6A 5C3EB 2XGTA 3KJOA 5IODA 1EYCA 1Q3LA 5ELBA 1GHKA 5C44G 4B08A 4UDUC 1XPUA 2E74C 1HZCA 1LYLA 4X66L 4O42A 2ICEC 4R1JA 5IP7H 1NJIC 3A56A 3S2DB 2EY2A 4YY3L 3R2IA 3I4OA 3OTOL 4C3IH 4HMJA 4B3TL 1YEZA 5GADC 4IURA 1RKNA 5IYDH 3TN2A 5M5WB 4RKLA 1RTOA 1PH3A 2ICIA 2BCOA 4ZK9B 3ND9A 2G9DA 3M3YB 4A3MG 4DV5L 2JA5G 3W2DA 1KXLA 1WFQA 4JI5Q 3SDZA 3K7AB 1EOTA 1FYCA 3D4RA 4EQ5A 4KKUA 2DGYA 2KA7A 1S5BD 5C0XG 4IQZA 4A3DH 1YJ9A 4A93B 1N32Q 3BZCA 4HEDA 4OWWB 1Y8OB 2EVBA 1FR3A 4YWMA 3GTOH 1EQRA 4TQUS 4A75A 2HQEA 2MGSA 2Z0SA 2YTVA 2FJ2A 3HOYG 4IFDJ 3ERSX 2IHEA 5IWAQ 2K5NA 1VDZA 4DR5Q 1BDOA 4ZQ3A 4LNQA 1U0LA 2B8GA 1D6EC 1H9SB 1U4LA 2HIVA 4Y7NH 2B2YA 2K5WA 1IBLQ 1IKMA 3A55A 3I4LA 4LF4L 4C3JB 1EIYB 3T1HL 2EQSA 4HAEA 1KDCA 4FXDA 2K7VA 4XYOA 3DM1A 2AMCB 2IY5B 1QVCA 2J4XA 2F0PA 4HJ7A 1L2FA 2KHJA 1HTPA 1HR0Q 1VQ6A 1EY7A 2NVYB 4EX5A 4LF5L 3HKZG 2NVQB 4UP8A 1M4VA 2EYMA 4CGYB 5EBCA 1X9NA 1B1ZA 2KCMA 2Y0SG 3KLWA 5CGKA 1HQRD 3HS0C 2F0QA 3PUYA 5CV4A 1CQFA 1NMFA 1LT6D 3RNUA 1B3QA 4JI6L 1X6OA 1D5MC 1SYFA 1TS3A 3H6MA 4G57A 3F2DA 2AKWB 2K6AA 4J6HA 3U9OA 3E3XA 1VQ7A 1GXDC 3DWQA 3EBEA 3S2DH 1VQEA 1YJWA 2PI2E 3QG1A 3NTKA 1XWEA 3L9AX 3I72A 2VQFQ 4HR7B 5GROA 4H0LC 2UUCQ 1LV9A 1LLRD 2CW0D 1XPRA 3GTLB 1YZ6A 4X62L 1ILQA 2G5DA 2I5LX 5I2YA 1E7ZA 3QB3A 2RCNA 2RKSA 2L1BA 2MUYA 3KJPA 3TEHB 1GO3E 1I3QB 1SYDA 4X65Q 4K8JA 3K7AH 4A3MH 5FLXc 2ZTEA 1NBWA 1FGBD 4PNYA 4L8JA 3E9IA 3K59A 1OXXK 4G7ZC 3UE1A 4NXNL 3H94A 3G48A 3EN2A 1HNWL 1S3OA 1HCZA 3OMGA 2E2HB 1X3EA 1JWMD 4A4IA 4TKOB 3TP6A 3K8AA 3HOVB 2JYOA 5EPLA 3D6WA 1LTRD 1H9SA 3VYTA 1GUOA 1Q7YC 5A35A 5JPMC 2QEXA 3WOFA 3S1MB 1TWCB 1I4HA 2LMCB 2KECA 3VYSA 2CQOA 2JA7B 4BY1G 2Q2UA 1EFID 1O7ZA 2L11A 3FP9A 3NPPA 3S9WA 4LFCQ 2VNUD 1AE3A 5M3FH 2A74C 1J5EL 1X65A 1EYGA 5I9PA 1OXTA 2BH2A 5JVG3 4AH6A 1IW7D 4X6AH 4DV0L 1BCPB 3R2TA 3UDGA 2SEBD 5KIXA 4IOAA 1GJXA 1IZ6A 5LL6X 1X3PA 5DAUA 4DV4Q 4A3FG 2R93G 1LTSD 1LT5D 3IRBA 1QILA 1BCPC 2ZJPA 3ZJYC 3ULLA 1AE2A 2E2DC 4XTCS 3VR6A 2F0KA 3CMAA 4XT3B 4DR3Q 1UEBA 4GLAC 4IPCA 5K36G 3S1QH 3GTQB 5EKKA 1HUMA 3ICEA 2NVTB 2NVYH 5HY6A 1EIHA 2R7DA 4LK1C 2NVQH 3D0FA 4JC0A 2KOLA 3R93A 1JE5A 1HQMC 2M9VA 2PZTA 1A0IA 3R3OA 3HFZB 2HDLA 2KBNA 3CF5A 1XTDA 1STGA 4NXML 3M4OB 3EIVA 4EQPA 5JEAH 2WFWA 4A3BG 2UXBQ 5FJ8G 1VMPA 1WTVA 3QJYA 3VA7A 4EQNA 1KNAA 4MIUA 1YI2A 3CHBD 1OO9B 4V0BA 3KBXA 4YWKA 4UP7A 1XJVA 4A3CH 4DR4Q 5IYCH 2OT2A 3U4VA 1NAPA 3P7JA 4F8MA 4HTHA 4DV7L 1N8RC 4ZAIA 3U50C 2UXDQ 1I3QH 2EPBA 3SVMA 3CC7A 1L0YB 3CCVA 3S1NH 4LFBL 2UXCL 1C0AA 4JI4L 2F0DA 4P2CB 1HHVA 3SR1A 3I7FA 2NN6I 4TSSA 3T1YQ 2LY7A 2DY7A 1KDAA 1SR3A 3PIPA 4G7OC 1CUKA 5C0XJ 1VQAA 1G291 1CSPA 1LTTD 1HPCA 2WB1B 1N34L 3PIOA 1QNKA 1TWCH 4ULLA 1MBYA 2ZM6Q 3HOUG 2F0WA 1FD7D 1CHQD 1SYBA 3X3MA 5C3WA 4CDDC 4BBRB 4DV6Q 2JA7H 3S16H 4GKJL 2XVSA 2PNHA 1TS5A 3TRZA 4BY7H 3RZDB 1K8MA 4RAUC 4U673 2YU9H 2ZTCA 2LS01 5DM73 2K1BA 1TQOA 3J81j 1FNUA 4MHEA 1PV4A 2NTSA 3MEFA 4Y52H 2N3SA 3QR8A 2R7ZG 3S2HB 1HZAA 5C4XH 1G51A 2PZWA 3OIQA 2Q8TA 3PMFA 3VR2A 4C2MH 2VQEQ 2A1AA 2LKVA 3I55A 1HH2P 2ZT9C 2BOSA 3E0JA 5FLXL 4Q5VA 2CVRA 4IN3A 3TSSA 5K36H 1B2TA 1EY8A 1SMYD 4PZ7A 4LF8L 4UHVA 1O7IA 3EA6A 2KUMA 2QEJC 3ZYYX 4DV3Q 2L4NA 4DUYQ 3KF6B 3QIAA 2B2UC 3AB9A 1GUGA 4BWGB 4LF9Q 2ZXOA 3OW7A 4IJLA 4B3ML 1WVLA 4K14A 3OYYA 3DHQA 3S1RH 4PV1C 3M7NA 1GHJA 3HKSA 1UE1A 1F9QA 3NSWA 1S72A 3RUZA 3C3LA 2VY3A 1K28A 4X3KA 1QB5D 5FJ8H 3PO3B 4GS3A 3M7GA 3MFYA 3DXJC 5HGTA 2Z6BA 2F0SA 1GOZA 1SNMA 2M00A 5E1FA 1XNQQ 1SE4A 3CXCA 1WTOA 1JJGA 1B9NA 4POFA 5IGEA 4PZ8A 4FNFA 4A3IB 2PW7A 4RA8A 4ZRZA 4ABNA 1SMXA 1TWHH 3BVZA 3PO2H 1KAWA 2N8NA 4LUZA 1Y1VB 3AU7A 1EY0A 3PUXA 2JA6G 1EZ6A 1STNA 1FNWA 2EY5A 4KN4C 1WYDA 2K5HA 2EJFC 3KYHC 4KMUC 2PQAA 2XWJB 5DNFA 1YJNA 2IX1A 4OXPA 4OO1G 3EVQA 4WJ3M 1F9RA 1SNPA 1B44D 4QB4A 5LMNQ 4DR1L 3PUZA 2QKIC 3UDXA 4X64Q 4DA2A 5AJ3Q 3BZKA 3QOLA 1PTOD 1SYEA 3Q8DA 3FEWX 3VR3A 1Y8NB 1TWFB 3NXWA 2HCCA 3S2HH 1TVXA 4DK3C 2B2UA 4BA2I 1TWGH 1YHBA 1RIPA 4R4QA 3G71A 1JWUD 2R7ZH 3KF6A 1WTHA 4BBSH 3E6ZX 4MN3A 4DF7A 1EQTA 2XIWA 3EQLC 5IY0A 3D31A 4FXGC 4PMWA 2PQEA 4GNXC 3CKIB 5FK9C 1C7YA 2V1CC 2VB2X 5K5PA 2Q2IA 3H0GB 4P73A 2KVMA 4I7ZC 4IUQA 2E5LQ 1HA6A 5IP7G 5NUCA 1YHQA 1HR0L 4A3JB 2CCZA 5I6YA 1IXRA 1EY6A 1NR2A 2O5JC 2JJQA 2K03A 1CKMA 4C3IG 2Q2TA 5C6AA 1G6PA 3MXUA 1N36L 3L3OC 1ASYA 2DY8A 4QIWE 1TT2A 3ER0A 2CW0C 3E9HA 2PMZE 4CJ2C 3GTKB 1NUCA 1K73C 1XYIA 3CCQA 2A6ED 1K9MC 1W6JA 4A3DG 2FMCA 2VQFL 4A3LH 1F2LA 1SBBB 4OGQC 5IYBH 2L15A 1XTCD 1M1KC 1R4QB 4LFAQ 1G2SA 2I46A 4KK7A 1KTKA 1QCBD 5M5XH 2ATWA 3MXPA 1K3RA 3C1EA 4RGNA 1EYDA 4K6DA 1HNXL 4A3IH 4X65L 3I4NB 3BS1A 2E2JH 4NP5A 1C8CA 4G7HC 3IFTA 1DOKA 1STBA 3J80E 4WRDA 2AQ3B 2WAQB 1KAAA 3KLSA 5KNCA 2EYOA 3MTSA 2CH4A 1Q12A 3H09A 4XQJA 3HGBA 3DWAA 3HZXA 5C0XI 1CKNB 2ZJQA 3CRKC 2Z6KC 1Q86C 1IW7C 4S3SA 1GVPA 4IFDH 1SAPA 2O4XA 1AP0A 5CBAE 1MHWC 1ICFB 1SE8A 3I3CA 1TWFH 1LO5D 2E75C 1B4OA 5L37A 5I9OA 4ILWA 4IALA 4B3SQ 1QNUA 2RSNA 1R9TB 2RA4A 4WJWA 4DV4L 3GTPH 1KDBA 2RVLA 1JC7A 2TSSA 4KTAA 4OX9Q 2OTLA 2N55A 1G2TA 3DM3A 1SRUA 2KHIA 4JI2Q 4H7BA 4DNRB 4HJ8A 4DR3L 3GP7A 2EE1A 3H0GH 1ASZA 1C9OA 2A68D 5GQOA 1E0BA 1EYAA 1QG7A 4A3JH 5ELFA 1AEXA 2D2CC 2K4KA 3A7AB 3BVMA 3U4ZA 3CC2A 1H9RA 5FOBB 1Y1WB 4QF4A 1WTXA 4L5QA 5M9OA 1I6HH 4X3SA 2VUMB 1EUJA 1SNDA 2SNSA 1VQNA 4UY8C 2F03A 2ASBA 4RWSC 4IO9A 3HOZB 4IPGA 1UWVA 4DR2L 4FF2A 5ELDA 1JCKB 1SFOH 2UU9Q 4CDEC 1WOCA 3GTKH 1I50B 4C3HH 2UUAQ 3CAMA 5C44B 2ZXRA 1TXYA 3CCLA 1B70B 1K83B 1F2MA 3S15H 1ENFA 1DYQA 1LUZA 1HUNA 5CV5A 1BQQT 2B8FA 2XWBB 1N33Q 1FJGQ 1I4XA 2Z4HA 4Z9CB 2C9OA 4K6LA 1G91A 3SHLA 1HZBA 1PRTD 3LX0A 1B9MA 3CQZH 4DK6C 5KEEA 1JB3A 3MWYW 1OXUA 1UNSA 1CKNA 4HJAA 1JJ2A 5D14A 2QDBA 1BCPF 3NP8A 3RMHA 5M3FG 2D62A 1ET9A 1UEAB 1IBMQ 1VQOA 3W1BA 2HUGA 4CDFC 4N8FA 5JJZA 4KKSA 3SK6A 4JI1L 3G6JB 1IHZA 1JORA 5JVH3 1MJCA 3Q0AA 2JP1A 1BBUA 1W2BA 3AEVA 1TS2A 3CU7A 4DUZL 2RQXA 4M8AA 4ZCKA 1PH2A 3SGIA 5A2QL 3J7ZC 3J7YW 2F0EA 3BG3A 5D65A 4YCVA 3F2BA 1VQBA 3TQYA 2IX0A 5C4JH 3TS2A 2R3ZA 5IGBA 1U5KA 5BN3A 1SNCA 2L12A 4HCSA 4PMCA 3AMUA 4IJHA 1CA6A 3ND8A 3H3VH 1TKWB 3VYRA 3DMUA 3FRPB 3TZDA 2EZVA 1SMYC 3HRZC 1Z47A 1KRSA 3L2PA 2XRSD 5C3EH 1K3BC 1Y14B 3I2ZA 5JEAG 1RD9D 3NK9A 5ELNA 5CR3A 4DAMA 3EFXD 2K04A 4MZ9A 1VQJA 1YITA 4OIJA 5IE8A 4EQOA 3J7A5 2B2VC 2F3IA 3GTMB 1D7QA 2KENA 2L0CA 4BS9A 1JT8A 3N6RA 2HDMA 4JV5Q 4C56C 3HKZE 2VUMH 4FXKC 4A3CG 1O7YA 2XRQD 1BO0A 3K5NA 2Y0SE 5IYCG 5M5WH 4ZLTF 3OWEB 2I5MX 2QA4A 4CKCA 1CZGA 2HHHL 4HJ9A 3RN2A 3M3YH 2L55A 4PQXA 1HNZL 4DPGA 1S40A 1KIXA 2O5IC 3TZUA 4AQYQ 3MFGA 1RHPA 2D5DA 1ZXTA 1NSNS 4RHRA 1KABA 2D0OA 4WFN3 2QF7A 1XMQQ 2IPKD 4I7AA 1YNND 4A93H 1UUPA 3MA2B 3IKJA 1T5EA 1WI5A 2AUJD 1LM0A 2SDFA 3A8KE 1IKLA 3GV3A 2JA7G 2JEAI 1RJTA 5IOCA 4PG3A 1BNZA 4BY7G 5H1SE 4FF3A 4IUUA 1N9WA 1MJEA 1PTOB 2FMMA 2RCFA 5CC4A 3PUWA 5TSSA 5C4XG 1GUTA 1WTRA 5IP9H 1PTOC 1HJPA 1VF7A 5T1IA 2VS1A 4C3JH 3J81E 1I94Q 1JQYD 2RSOA 3TMEA 2OEOA 2FFKB 5EGTA 2EXZA 3SE0A 5J3BA 3KDFB 5GAEC 1VQCA 2RHSB 3KUPA 5BR8L 3F2UA 5LMNL 4A3GB 3Q22A 2OCEA 4A3KB 2AQ2B 5CYUA 2F0GA 1LTID 1LACA 2PZUA 4PZ6A 5AJ3L 4KY7A 3STBD 3OWFA 1PYWD 3I4MB 1D8LA 4RH6A 2R92B 3EROA 4QL5A 4AIMA 4WORA 1PFSA 1GKHA 1PLFA 1HRJA 3TBIB 1PH8A 4JOIC 2PI2A 4HMIA 4IUTA 2I0QA 1B8AA 1QUQB 4A3FB 1VF5C 1QJOA 1VQ9A 1E22A 1F77A 3A8IE 1O80A 1S4ZA 2WV6D 4R4CA 1EWCA 2PCFB 3GTGB 1VQFA 4JI7L 4KHZA 5FO7B 4DV2L 2E5LL 4MTKA 2TMPA 4X66Q 2B39A 3F8TA 3GTMH 1E3PA 2ES2A 3AFQA 4JYAQ 3G6EA 2K01A 1YBYA 4DXGA 4YY3Q 4JVZA 5KYLA 3I8ZA 1XMOL 3MHBA 1PRTF 4B3TQ 4IPDA 2A6EC 4GOPB 1GM5A 2CKZB 1K8OA 2A5HA 1LT3D 2FXQA 4L5TA 4F7XA 1FL0A 5LMUL 1VQKA 3GTLH 4GOPC 2HD3A 1GUSA 1TS4A 4DV5Q 1A3VA 4ID6A 3TS0A 1H9KA 1E1TA 3I73A 2NWGA 3DWPA 4HIKA 1EU3A 3PO2G 3BDCA 1EY5A 3CPWA 2F0HA 3U9SA 2OQ0A 2OF1A 2WIIB 3FKIB 2EYLA
chains in the Genus database with same CATH topology
2E2HH 3M4PA 3A5UA 1K0RA 5LMNQ 1I50H 2WB1G 4J15A 2UUBL 5C44H 3G4SA 4DR1L 3HOWG 3HOVH 4ALPA 4IPHA 3HOZG 4JI0Q 3PUZA 2XTIA 4X64Q 3UDXA 2NZOA 5AJ3Q 3BZKA 4NPSA 4B3MQ 1K83H 3Q8DA 1PHJA 1KHIA 1X3FA 3S1MH 1EQQA 4GLVB 2XGTA 3KJOA 4LF6L 1PYSB 3KF8B 5C44G 3S2HH 4BA2I 4DK3C 3HOVG 1TWGH 1BBWA 1XPUA 1B7YB 1YHBA 1BVSA 3UDFA 1RIPA 1HZCA 2AHOB 3KDFA 4R4QA 3G71A 3KF6A 2R7ZH 1LYLA 4X66L 4P75A 1QVGA 4BBSH 4R4IA 3TREA 1XNQL 4R1JA 5IP7H 5IY0A 3D31A 1NJIC 4PMWA 4GNXC 1HNXQ 3JAMi 3S14H 4YY3L 3I4OA 3OTOL 1C7YA 2V1CC 3AQQA 4C3IH 4B3TL 2JA5H 1YEZA 3GO5A 5GADC 2Q2IA 4P73A 4BBSG 5IYDH 1E1OA 2E5LQ 2PQAB 2D0PA 4JOIA 5IP7G 1YHQA 1HR0L 1PH3A 1OTCA 1QVFA 2CCZA 1IXRA 4L5RC 2GVBA 4A3GH 2JJQA 1CKMA 4A3MG 4DV5L 4A3KH 2JA5G 1QUQA 1KXLA 2Q2TA 2LSSA 1WFQA 1KRTA 3GTQH 4DR7L 4JI5Q 4KLKA 1G6PA 1N36L 3I56A 3A0JA 4K0KQ 1ASYA 4EQ5A 2NVTH 4OO1I 4QIWE 4A3GG 2DGYA 3I4MH 1SN8A 3ER0A 5C0XG 2R92H 4LF5Q 1NY4A 4A3KG 4A3DH 4GKKQ 4DAYB 1YJ9A 4B3SL 5GAGC 3J81c 3E9HA 4JI8Q 2PMZE 1PYBA 1N32Q 3BZCA 2MNAA 1K73C 3CCQA 1Q1EA 4OWWB 3HOYH 2VL6A 4JI0L 1K9MC 4YWMA 4X64L 3GTOH 3I4MG 2R92G 4H02A 4GOPA 3A74A 4A3DG 1EQRA 4YCWA 2VQFL 4A3LH 4TQUS 4A75A 3GTGH 5IYBH 4JI6Q 2N78A 3M4OH 2L15A 1JMCA 1M1KC 1WJJA 1EWIA 2YTVA 2Z0SA 4LFAQ 2UUBQ 3HOYG 4LF7L 4IFDJ 3ERSX 5JJIA 2IHEA 5M5XH 5IWAQ 2ATWA 2K5NA 1K3RA 1PVOA 4DR5Q 4A3LG 3ULPA 5IYBG 4LNQA 1U0LA 2C35B 4RMFA 1HNXL 4LF6Q 4A3IH 2RHQB 4X65L 2HIVA 4Y7NH 3PF4A 1FVIA 1IBLQ 2E2JH 3M4QA 1HR0W 1P16A 4LF4L 1EIYB 4P71A 2CWAA 3WWVA 2EQSA 3T1HL 4A3IG 1SLJA 1IL2A 3H15A 2UUAL 1VQMA 2AMCB 3OTOQ 1Q12A 2IY5B 1QVCA 3KOJA 4HJ7A 4JI5L 1L1OB 1L2FA 2OQKA 2KHJA 1Y1VG 1P8LA 5C0XI 4DR2Q 1CKNB 1HR0Q 1VQ6A 2ZJQA 3CCSA 2Z6KC 3FKIH 1VS0A 1Q86C 1L1OC 4EX5A 1HNWQ 5JJKA 4LF5L 4NB3A 3HKZG 3K0XA 3PCOB 1GVPA 1N33L 4UP8A 3GTJH 3CCMA 3JAMc 1N32L 1X9NA 1SE8A 1OXSC 2KCMA 2Y0SG 3W1GA 3OW2A 4UPAA 3KLWA 2DUDA 4BA1I 1VQDA 2MFIA 4RG1A 3FKIG 4LUVA 3RLNA 1LTLA 1TWFH 1UE5A 2K75A 3PUYA 5M3MH 1VQ4A 4IFDG 1NMFA 3RNUA 4JI6L 4BBRH 4B3SQ 1X6OA 2NVXH 1J6QA 2K5VA 4LFAL 4AYBG 4DV4L 3F2DA 3GTPH 2AKWB 1HZ9A 4OX9Q 3RZDH 1Q8KA 5IWAL 1VQ7A 3EBEA 2OTLA 1VQEA 5M3MG 1YJWA 1IBML 4DR5L 3S2DH 3J80i 2PI2E 3DM3A 1SRUA 2KHIA 4JI2Q 4BBRG 1A8VA 2VQFQ 4HJ8A 1EOVA 4DR3L 2GVAA 3M9BA 2GN5A 4DV0Q 1KC8C 4JBJA 2Q2HA 3NBHB 5GROA 3H0GH 4KI0A 1ASZA 1C9OA 2BH8A 5GQOA 2UUCQ 1IBLL 1XPRA 4LF7Q 4A3JH 4JCVE 3VDYA 3K81C 3GDEA 4GNXB 1KL9A 1YZ6A 4X62L 2K4KA 3U4ZA 2JK8A 4R4TA 3CC2A 2H5XA 1IBKL 2I5LX 1E7ZA 2RCNA 3KJPA 2YYZA 3H0GG 3TEHB 1GO3E 4JI1Q 4L5QA 4X65Q 1K8GA 1I6HH 3K7AH 4A3JG 4A3MH 1EUJA 2WB1E 4AYBE 5FLXc 2ZTEA 2ALYB 1VQNA 1NBWA 4UY8C 2R7FA 1NTGA 3E9IA 4IO9A 1OXVA 2ASBA 5IT9c 4IPGA 4MTNA 1OXXK 1UWVA 4DR2L 1X3GA 3UE1A 3T1HQ 4LF4Q 4NXNL 4DUZQ 1SFOH 2UU9Q 4POGA 4YHHL 3G48A 3EN2A 1HNWL 1S3OA 1RL2A 1WOCA 2JQOA 3GTKH 1X3EA 4C3HH 2UUAQ 3CAMA 4A4IA 5FLMH 3FHWA 3K8AA 1TXYA 3S17H 3B6YA 1UE7A 3L7ZC 4YWLA 3CCLA 4BY1H 1Q7YC 1B70B 2QEXA 4IFDI 1NMGA 5E7NA 1WCMH 3S15H 2EXDA 1LUZA 1Q46A 4JI3L 4UP9A 5FLMG 2HIXA 2CQOA 1N33Q 2JA8H 1FJGQ 2I5HA 1V9PA 4BY1G 2Q2UA 1K8AC 3GD7A 3K7UC 3FP9A 4LFCQ 1WCMG 2N49A 1HZBA 1AE3A 5M3FH 4A3FH 1J5EL 1X65A 4OX9L 2VNUD 2R93H 1EYGA 1OXTA 3CQZH 1E24A 1L1OA 4DK6C 4JI2L 2BH2A 3PO3H 5DLQE 2JA8G 4AH6A 3KFUA 1OXUA 4X6AH 1CKNA 4LUOA 4DV0L 4HJAA 1XPOA 1QZHA 1JJ2A 1JJCB 3UDGA 5JEAJ 2UUCL 4IOAA 1IZ6A 3BU2A 5M3FG 4DV4Q 2D62A 4HIOA 4A3FG 2R93G 3IRBA 1CSQA 1VQ5A 2K50A 2ZJPA 3ZJYC 4DV7Q 1JB7A 3PO3G 3ULLA 1IBMQ 1AE2A 3AYHB 3W1BA 1VQOA 4TVAB 4XTCS 3CMAA 5JJLA 1DGSA 4DR3Q 4LFBQ 4JI1L 1UEBA 4GLAC 4IPCA 1KQSA 5K36G 1X55A 4O2DA 3S1QH 3ICEA 1V43A 4OONA 2WAQG 2MO0A 1MJCA 4FDBA 1XNRL 1BBUA 2NN6G 2NVYH 4KHPL 2HHHQ 5HY6A 4X62Q 2CWPA 2R7DA 1W2BA 3AEVA 2NVQH 2A8VA 1Y1VH 3D0FA 4DUZL 1IBKQ 4JC0A 1PH1A 1HNZQ 2UU9L 1PH2A 2KCTA 3SGIA 3J80c 3J7ZC 4QQBX 1VCIA 1JE5A 3CC4A 2YV5A 4BXXH 4QGUA 4YCVA 3F2BA 1VQBA 3TQYA 2JE6I 1A0IA 2ZJRA 4GN4B 1N34Q 4A3BH 1MIUA 3HFZB 1I5FA 2IX0A 3DLLA 5HGQA 5C4JH 3TS2A 2KBNA 3CF5A 1U5KA 1XTDA 2LXJA 1PA6A 3ULJA 4NXML 4NXNQ 1PH9A 4BXXG 3EIVA 4YHHQ 4IJHA 4GNXA 3CPFA 5M5YH 1M90C 3H3VH 2WFWA 2WP8J 4A3BG 2IT1A 1FJGL 4GN3B 3RLFA 2UXBQ 5FJ8G 1YNXA 1Z47A 4GN5A 4LFCL 1KRSA 3L2PA 5C3EH 1Y14B 3I2ZA 3UE0A 3NENA 5JEAG 5ELNA 1YI2A 1QZGA 4DAMA 1AH9A 2VW9A 4MZ9A 4JI3Q 4DNIA 2JEBI 1SROA 1VQJA 3LGJA 1YITA 4YWKA 4UP7A 1XJVA 2E2IH 5IE8A 3STBC 4QY7A 4A3CH 3CW2C 5C3EG 1I94L 3J7A5 2F3IA 5IYCH 4DR4Q 1D7QA 3U4VA 2KENA 1J5EQ 4R4OA 4DV7L 1N8RC 1VQ8A 1YVCA 3U50C 4GLXA 2UXDQ 3CCJA 1I3QH 1JT8A 3PUVA 3F2CA 4JV5Q 3CMEA 1Q81C 3CC7A 3HKZE 2VUMH 3CCVA 3CCEA 5EAYA 3S1NH 4XIGS 4LFBL 2UXCL 1C0AA 4B3RL 4JI4L 4L5SA 4A3CG 1VQIA 3I7FA 2Y0SE 2NN6I 5IYCG 3T1YQ 5M5WH 2I5MX 2AWNA 4LF8Q 2QA4A 2HHHL 1SR3A 2AWOA 2BA1A 3PIPA 4HJ9A 3UDIA 5BR8Q 3RN2A 1EFWA 3HOUH 2VUMG 3M3YH 1CUKA 1HNZL 1BKBA 4DR6L 5C0XJ 1VQAA 4DPGA 1S40A 1G291 1KIXA 1CSPA 2F52A 2B63H 4JG2A 4MNOA 4AQYQ 1N34L 2F4VL 1UE6A 3PIOA 1TWCH 2OWOA 1XNRQ 3E0EA 1FGUA 2ZM6Q 3HOUG 4KHPQ 4P72A 2D0OA 4JBMA 2K14A 3CCRA 2B3GA 1XMQQ 3A5ZB 4DV6Q 2MQHA 4O0AA 2JA7H 4A93H 2B63G 3S16H 4GKJL 2K52A 1YHAA 1WI5A 2PNHA 4P74A 1KD1C 1LM0A 3TRZA 4BY7H 2UXBL 4JYAL 1H95A 3W5OA 2YU9H 2ZTCA 1Q1BA 3H3VI 1VQPA 4A93G 2JA7G 3U58A 3J81j 4NXMQ 1PV4A 3NEMA 3MEFA 3JC66 4YCUA 2N3SA 4JI7Q 4DV2Q 2R7ZG 2JEAI 4Y52H 1A63A 1HZAA 4BY7G 4PG3A 5C4XH 4LW1A 1G51A 5H1SE 2LXKA 1N9WA 2VZAA 4DR4L 1W3SA 3K80C 3PGZA 4C2MH 1MJEA 2VQEQ 1XMOQ 1Q82C 3CD6A 1VQGA 2A1AA 2Z6KA 3I55A 2UXDL 5IYDG 4JV5L 3PUWA 3PF5A 3I4NH 1HH2P 5C4XG 1PH6A 5IP9H 5LMUQ 2ID0A 4OWTB 1HJPA 1A62A 1X54A 4ME3A 3T1YL 2EIFA 2VS1A 4C3JH 1I94Q 2E8GA 4DV1L 1VQLA 4APVA 4PZ7A 4LF8L 3RR5A 1CKOA 1O7IA 5J3BA 3KDFB 4DV3Q 5GAEC 4DUYQ 1VQCA 2RHSB 3CP0A 1TWAH 3KF6B 5BR8L 5LMNL 1PH5A 3F1ZA 2OCEA 5IP9G 3MXNB 4LF9Q 3PV0A 4HIMA 2UXCQ 2NZHA 3CCUA 4B3RQ 4JI4Q 5AJ3L 4IJLA 4PZ6A 2BA0A 4AQYL 4B3ML 3OYYA 2YTYA 2MO1A 3S1RH 1PH7A 3STBD 2ZM6L 3M7NA 1V1QA 1D8LA 1XMQL 3HKSA 4DV6L 1UE1A 4QL5A 3RLOA 4AIMA 2IHFA 4DR1Q 1PH4A 1PFSA 1GKHA 4DR6Q 4HJ5A 1S72A 2R6GA 5ELOA 4DKAC 1PH8A 3PSIA 2PI2A 4JOIC 2VY3A 3RZOH 2I0QA 1B8AA 1QUQB 2F4VQ 5GAHC 2HT1A 1VQHA 1E22A 1VQ9A 1NE3A 5FJ8H 4JBKA 4GS3A 4A3EH 2A19A 4R4CA 1VQFA 4JI7L 4KHZA 4DV2L 2B29A 1MKHA 4GKJQ 2E5LL 1R9TH 2JA9A 4X66Q 4LWCA 3F8TA 4QJFA 1XNQQ 1E3PA 3GTMH 3RN5A 3S24A 3AFQA 3CXCA 2ES2A 4JYAQ 2WAQE 3G6EA 1JJGA 3M85A 1YBYA 3J81i 2HQLA 3L0OA 4A3EG 4YY3Q 1Z9FA 4POFA 4PZ8A 2VQEL 1XMOL 3I4NG 4IOCA 4B3TQ 4IPDA 2RF4A 4GOPB 3AFPA 1GM5A 1YIJA 2JA6H 2CKZB 4WJ4A 1SMXA 1IYJB 1TWHH 2FXQA 4L5TA 5LMUL 1VQKA 2QGQA 1FL0A 3PO2H 4K0KL 4OWXB 3HOXH 1KAWA 2N8NA 3GTLH 4LUZA 1T9HA 4GOPC 4JBWA 1L0WA 4GKKL 2OTJA 1GD7A 2YTXA 4DV5Q 1Y1WH 4A76A 5LMNW 4DV3L 4JI8L 4DUYL 3TS0A 3PUXA 2CFMA 3BJUA 2JA6G 1E1TA 1EIFA 4DR7Q 4LF9L 4HIKA 3PO2G 3HOWH 2ZTDA 3HOXG 1N36Q 3NELA 1WYDA 1X56A 2K5HA 4HIDA 3HOZH 3CPWA 3KYHC 1Y1WG 2PQAA 2OQ0A 4DV1Q 1YJNA 2IX1A 4OXPA 4OO1G 4WJ3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H H;  3M4P A;  3A5U A;  1K0R A;  5LMN Q;  1I50 H;  2WB1 G;  4J15 A;  2UUB L;  5C44 H;  3G4S A;  4DR1 L;  3HOW G;  3HOV H;  4ALP A;  4IPH A;  3HOZ G;  4JI0 Q;  3PUZ A;  2XTI A;  4X64 Q;  3UDX A;  2NZO A;  5AJ3 Q;  3BZK A;  4NPS A;  4B3M Q;  1K83 H;  3Q8D A;  1PHJ A;  1KHI A;  1X3F A;  3S1M H;  1EQQ A;  4GLV B;  2XGT A;  3KJO A;  4LF6 L;  1PYS B;  3KF8 B;  5C44 G;  3S2H H;  4BA2 I;  4DK3 C;  3HOV G;  1TWG H;  1BBW A;  1XPU A;  1B7Y B;  1YHB A;  1BVS A;  3UDF A;  1RIP A;  1HZC A;  2AHO B;  3KDF A;  4R4Q A;  3G71 A;  3KF6 A;  2R7Z H;  1LYL A;  4X66 L;  4P75 A;  1QVG A;  4BBS H;  4R4I A;  3TRE A;  1XNQ L;  4R1J A;  5IP7 H;  5IY0 A;  3D31 A;  1NJI C;  4PMW A;  4GNX C;  1HNX Q;  3JAM i;  3S14 H;  4YY3 L;  3I4O A;  3OTO L;  1C7Y A;  2V1C C;  3AQQ A;  4C3I H;  4B3T L;  2JA5 H;  1YEZ A;  3GO5 A;  5GAD C;  2Q2I A;  4P73 A;  4BBS G;  5IYD H;  1E1O A;  2E5L Q;  2PQA B;  2D0P A;  4JOI A;  5IP7 G;  1YHQ A;  1HR0 L;  1PH3 A;  1OTC A;  1QVF A;  2CCZ A;  1IXR A;  4L5R C;  2GVB A;  4A3G H;  2JJQ A;  1CKM A;  4A3M G;  4DV5 L;  4A3K H;  2JA5 G;  1QUQ A;  1KXL A;  2Q2T A;  2LSS A;  1WFQ A;  1KRT A;  3GTQ H;  4DR7 L;  4JI5 Q;  4KLK A;  1G6P A;  1N36 L;  3I56 A;  3A0J A;  4K0K Q;  1ASY A;  4EQ5 A;  2NVT H;  4OO1 I;  4QIW E;  4A3G G;  2DGY A;  3I4M H;  1SN8 A;  3ER0 A;  5C0X G;  2R92 H;  4LF5 Q;  1NY4 A;  4A3K G;  4A3D H;  4GKK Q;  4DAY B;  1YJ9 A;  4B3S L;  5GAG C;  3J81 c;  3E9H A;  4JI8 Q;  2PMZ E;  1PYB A;  1N32 Q;  3BZC A;  2MNA A;  1K73 C;  3CCQ A;  1Q1E A;  4OWW B;  3HOY H;  2VL6 A;  4JI0 L;  1K9M C;  4YWM A;  4X64 L;  3GTO H;  3I4M G;  2R92 G;  4H02 A;  4GOP A;  3A74 A;  4A3D G;  1EQR A;  4YCW A;  2VQF L;  4A3L H;  4TQU S;  4A75 A;  3GTG H;  5IYB H;  4JI6 Q;  2N78 A;  3M4O H;  2L15 A;  1JMC A;  1M1K C;  1WJJ A;  1EWI A;  2YTV A;  2Z0S A;  4LFA Q;  2UUB Q;  3HOY G;  4LF7 L;  4IFD J;  3ERS X;  5JJI A;  2IHE A;  5M5X H;  5IWA Q;  2ATW A;  2K5N A;  1K3R A;  1PVO A;  4DR5 Q;  4A3L G;  3ULP A;  5IYB G;  4LNQ A;  1U0L A;  2C35 B;  4RMF A;  1HNX L;  4LF6 Q;  4A3I H;  2RHQ B;  4X65 L;  2HIV A;  4Y7N H;  3PF4 A;  1FVI A;  1IBL Q;  2E2J H;  3M4Q A;  1HR0 W;  1P16 A;  4LF4 L;  1EIY B;  4P71 A;  2CWA A;  3WWV A;  2EQS A;  3T1H L;  4A3I G;  1SLJ A;  1IL2 A;  3H15 A;  2UUA L;  1VQM A;  2AMC B;  3OTO Q;  1Q12 A;  2IY5 B;  1QVC A;  3KOJ A;  4HJ7 A;  4JI5 L;  1L1O B;  1L2F A;  2OQK A;  2KHJ A;  1Y1V G;  1P8L A;  5C0X I;  4DR2 Q;  1CKN B;  1HR0 Q;  1VQ6 A;  2ZJQ A;  3CCS A;  2Z6K C;  3FKI H;  1VS0 A;  1Q86 C;  1L1O C;  4EX5 A;  1HNW Q;  5JJK A;  4LF5 L;  4NB3 A;  3HKZ G;  3K0X A;  3PCO B;  1GVP A;  1N33 L;  4UP8 A;  3GTJ H;  3CCM A;  3JAM c;  1N32 L;  1X9N A;  1SE8 A;  1OXS C;  2KCM A;  2Y0S G;  3W1G A;  3OW2 A;  4UPA A;  3KLW A;  2DUD A;  4BA1 I;  1VQD A;  2MFI A;  4RG1 A;  3FKI G;  4LUV A;  3RLN A;  1LTL A;  1TWF H;  1UE5 A;  2K75 A;  3PUY A;  5M3M H;  1VQ4 A;  4IFD G;  1NMF A;  3RNU A;  4JI6 L;  4BBR H;  4B3S Q;  1X6O A;  2NVX H;  1J6Q A;  2K5V A;  4LFA L;  4AYB G;  4DV4 L;  3F2D A;  3GTP H;  2AKW B;  1HZ9 A;  4OX9 Q;  3RZD H;  1Q8K A;  5IWA L;  1VQ7 A;  3EBE A;  2OTL A;  1VQE A;  5M3M G;  1YJW A;  1IBM L;  4DR5 L;  3S2D H;  3J80 i;  2PI2 E;  3DM3 A;  1SRU A;  2KHI A;  4JI2 Q;  4BBR G;  1A8V A;  2VQF Q;  4HJ8 A;  1EOV A;  4DR3 L;  2GVA A;  3M9B A;  2GN5 A;  4DV0 Q;  1KC8 C;  4JBJ A;  2Q2H A;  3NBH B;  5GRO A;  3H0G H;  4KI0 A;  1ASZ A;  1C9O A;  2BH8 A;  5GQO A;  2UUC Q;  1IBL L;  1XPR A;  4LF7 Q;  4A3J H;  4JCV E;  3VDY A;  3K81 C;  3GDE A;  4GNX B;  1KL9 A;  1YZ6 A;  4X62 L;  2K4K A;  3U4Z A;  2JK8 A;  4R4T A;  3CC2 A;  2H5X A;  1IBK L;  2I5L X;  1E7Z A;  2RCN A;  3KJP A;  2YYZ A;  3H0G G;  3TEH B;  1GO3 E;  4JI1 Q;  4L5Q A;  4X65 Q;  1K8G A;  1I6H H;  3K7A H;  4A3J G;  4A3M H;  1EUJ A;  2WB1 E;  4AYB E;  5FLX c;  2ZTE A;  2ALY B;  1VQN A;  1NBW A;  4UY8 C;  2R7F A;  1NTG A;  3E9I A;  4IO9 A;  1OXV A;  2ASB A;  5IT9 c;  4IPG A;  4MTN A;  1OXX K;  1UWV A;  4DR2 L;  1X3G A;  3UE1 A;  3T1H Q;  4LF4 Q;  4NXN L;  4DUZ Q;  1SFO H;  2UU9 Q;  4POG A;  4YHH L;  3G48 A;  3EN2 A;  1HNW L;  1S3O A;  1RL2 A;  1WOC A;  2JQO A;  3GTK H;  1X3E A;  4C3H H;  2UUA Q;  3CAM A;  4A4I A;  5FLM H;  3FHW A;  3K8A A;  1TXY A;  3S17 H;  3B6Y A;  1UE7 A;  3L7Z C;  4YWL A;  3CCL A;  4BY1 H;  1Q7Y C;  1B70 B;  2QEX A;  4IFD I;  1NMG A;  5E7N A;  1WCM H;  3S15 H;  2EXD A;  1LUZ A;  1Q46 A;  4JI3 L;  4UP9 A;  5FLM G;  2HIX A;  2CQO A;  1N33 Q;  2JA8 H;  1FJG Q;  2I5H A;  1V9P A;  4BY1 G;  2Q2U A;  1K8A C;  3GD7 A;  3K7U C;  3FP9 A;  4LFC Q;  1WCM G;  2N49 A;  1HZB A;  1AE3 A;  5M3F H;  4A3F H;  1J5E L;  1X65 A;  4OX9 L;  2VNU D;  2R93 H;  1EYG A;  1OXT A;  3CQZ H;  1E24 A;  1L1O A;  4DK6 C;  4JI2 L;  2BH2 A;  3PO3 H;  5DLQ E;  2JA8 G;  4AH6 A;  3KFU A;  1OXU A;  4X6A H;  1CKN A;  4LUO A;  4DV0 L;  4HJA A;  1XPO A;  1QZH A;  1JJ2 A;  1JJC B;  3UDG A;  5JEA J;  2UUC L;  4IOA A;  1IZ6 A;  3BU2 A;  5M3F G;  4DV4 Q;  2D62 A;  4HIO A;  4A3F G;  2R93 G;  3IRB A;  1CSQ A;  1VQ5 A;  2K50 A;  2ZJP A;  3ZJY C;  4DV7 Q;  1JB7 A;  3PO3 G;  3ULL A;  1IBM Q;  1AE2 A;  3AYH B;  3W1B A;  1VQO A;  4TVA B;  4XTC S;  3CMA A;  5JJL A;  1DGS A;  4DR3 Q;  4LFB Q;  4JI1 L;  1UEB A;  4GLA C;  4IPC A;  1KQS A;  5K36 G;  1X55 A;  4O2D A;  3S1Q H;  3ICE A;  1V43 A;  4OON A;  2WAQ G;  2MO0 A;  1MJC A;  4FDB A;  1XNR L;  1BBU A;  2NN6 G;  2NVY H;  4KHP L;  2HHH Q;  5HY6 A;  4X62 Q;  2CWP A;  2R7D A;  1W2B A;  3AEV A;  2NVQ H;  2A8V A;  1Y1V H;  3D0F A;  4DUZ L;  1IBK Q;  4JC0 A;  1PH1 A;  1HNZ Q;  2UU9 L;  1PH2 A;  2KCT A;  3SGI A;  3J80 c;  3J7Z C;  4QQB X;  1VCI A;  1JE5 A;  3CC4 A;  2YV5 A;  4BXX H;  4QGU A;  4YCV A;  3F2B A;  1VQB A;  3TQY A;  2JE6 I;  1A0I A;  2ZJR A;  4GN4 B;  1N34 Q;  4A3B H;  1MIU A;  3HFZ B;  1I5F A;  2IX0 A;  3DLL A;  5HGQ A;  5C4J H;  3TS2 A;  2KBN A;  3CF5 A;  1U5K A;  1XTD A;  2LXJ A;  1PA6 A;  3ULJ A;  4NXM L;  4NXN Q;  1PH9 A;  4BXX G;  3EIV A;  4YHH Q;  4IJH A;  4GNX A;  3CPF A;  5M5Y H;  1M90 C;  3H3V H;  2WFW A;  2WP8 J;  4A3B G;  2IT1 A;  1FJG L;  4GN3 B;  3RLF A;  2UXB Q;  5FJ8 G;  1YNX A;  1Z47 A;  4GN5 A;  4LFC L;  1KRS A;  3L2P A;  5C3E H;  1Y14 B;  3I2Z A;  3UE0 A;  3NEN A;  5JEA G;  5ELN A;  1YI2 A;  1QZG A;  4DAM A;  1AH9 A;  2VW9 A;  4MZ9 A;  4JI3 Q;  4DNI A;  2JEB I;  1SRO A;  1VQJ A;  3LGJ A;  1YIT A;  4YWK A;  4UP7 A;  1XJV A;  2E2I H;  5IE8 A;  3STB C;  4QY7 A;  4A3C H;  3CW2 C;  5C3E G;  1I94 L;  3J7A 5;  2F3I A;  5IYC H;  4DR4 Q;  1D7Q A;  3U4V A;  2KEN A;  1J5E Q;  4R4O A;  4DV7 L;  1N8R C;  1VQ8 A;  1YVC A;  3U50 C;  4GLX A;  2UXD Q;  3CCJ A;  1I3Q H;  1JT8 A;  3PUV A;  3F2C A;  4JV5 Q;  3CME A;  1Q81 C;  3CC7 A;  3HKZ E;  2VUM H;  3CCV A;  3CCE A;  5EAY A;  3S1N H;  4XIG S;  4LFB L;  2UXC L;  1C0A A;  4B3R L;  4JI4 L;  4L5S A;  4A3C G;  1VQI A;  3I7F A;  2Y0S E;  2NN6 I;  5IYC G;  3T1Y Q;  5M5W H;  2I5M X;  2AWN A;  4LF8 Q;  2QA4 A;  2HHH L;  1SR3 A;  2AWO A;  2BA1 A;  3PIP A;  4HJ9 A;  3UDI A;  5BR8 Q;  3RN2 A;  1EFW A;  3HOU H;  2VUM G;  3M3Y H;  1CUK A;  1HNZ L;  1BKB A;  4DR6 L;  5C0X J;  1VQA A;  4DPG A;  1S40 A;  1G29 1;  1KIX A;  1CSP A;  2F52 A;  2B63 H;  4JG2 A;  4MNO A;  4AQY Q;  1N34 L;  2F4V L;  1UE6 A;  3PIO A;  1TWC H;  2OWO A;  1XNR Q;  3E0E A;  1FGU A;  2ZM6 Q;  3HOU G;  4KHP Q;  4P72 A;  2D0O A;  4JBM A;  2K14 A;  3CCR A;  2B3G A;  1XMQ Q;  3A5Z B;  4DV6 Q;  2MQH A;  4O0A A;  2JA7 H;  4A93 H;  2B63 G;  3S16 H;  4GKJ L;  2K52 A;  1YHA A;  1WI5 A;  2PNH A;  4P74 A;  1KD1 C;  1LM0 A;  3TRZ A;  4BY7 H;  2UXB L;  4JYA L;  1H95 A;  3W5O A;  2YU9 H;  2ZTC A;  1Q1B A;  3H3V I;  1VQP A;  4A93 G;  2JA7 G;  3U58 A;  3J81 j;  4NXM Q;  1PV4 A;  3NEM A;  3MEF A;  3JC6 6;  4YCU A;  2N3S A;  4JI7 Q;  4DV2 Q;  2R7Z G;  2JEA I;  4Y52 H;  1A63 A;  1HZA A;  4BY7 G;  4PG3 A;  5C4X H;  4LW1 A;  1G51 A;  5H1S E;  2LXK A;  1N9W A;  2VZA A;  4DR4 L;  1W3S A;  3K80 C;  3PGZ A;  4C2M H;  1MJE A;  2VQE Q;  1XMO Q;  1Q82 C;  3CD6 A;  1VQG A;  2A1A A;  2Z6K A;  3I55 A;  2UXD L;  5IYD G;  4JV5 L;  3PUW A;  3PF5 A;  3I4N H;  1HH2 P;  5C4X G;  1PH6 A;  5IP9 H;  5LMU Q;  2ID0 A;  4OWT B;  1HJP A;  1A62 A;  1X54 A;  4ME3 A;  3T1Y L;  2EIF A;  2VS1 A;  4C3J H;  1I94 Q;  2E8G A;  4DV1 L;  1VQL A;  4APV A;  4PZ7 A;  4LF8 L;  3RR5 A;  1CKO A;  1O7I A;  5J3B A;  3KDF B;  4DV3 Q;  5GAE C;  4DUY Q;  1VQC A;  2RHS B;  3CP0 A;  1TWA H;  3KF6 B;  5BR8 L;  5LMN L;  1PH5 A;  3F1Z A;  2OCE A;  5IP9 G;  3MXN B;  4LF9 Q;  3PV0 A;  4HIM A;  2UXC Q;  2NZH A;  3CCU A;  4B3R Q;  4JI4 Q;  5AJ3 L;  4IJL A;  4PZ6 A;  2BA0 A;  4AQY L;  4B3M L;  3OYY A;  2YTY A;  2MO1 A;  3S1R H;  1PH7 A;  3STB D;  2ZM6 L;  3M7N A;  1V1Q A;  1D8L A;  1XMQ L;  3HKS A;  4DV6 L;  1UE1 A;  4QL5 A;  3RLO A;  4AIM A;  2IHF A;  4DR1 Q;  1PH4 A;  1PFS A;  1GKH A;  4DR6 Q;  4HJ5 A;  1S72 A;  2R6G A;  5ELO A;  4DKA C;  1PH8 A;  3PSI A;  2PI2 A;  4JOI C;  2VY3 A;  3RZO H;  2I0Q A;  1B8A A;  1QUQ B;  2F4V Q;  5GAH C;  2HT1 A;  1VQH A;  1E22 A;  1VQ9 A;  1NE3 A;  5FJ8 H;  4JBK A;  4GS3 A;  4A3E H;  2A19 A;  4R4C A;  1VQF A;  4JI7 L;  4KHZ A;  4DV2 L;  2B29 A;  1MKH A;  4GKJ Q;  2E5L L;  1R9T H;  2JA9 A;  4X66 Q;  4LWC A;  3F8T A;  4QJF A;  1XNQ Q;  1E3P A;  3GTM H;  3RN5 A;  3S24 A;  3AFQ A;  3CXC A;  2ES2 A;  4JYA Q;  2WAQ E;  3G6E A;  1JJG A;  3M85 A;  1YBY A;  3J81 i;  2HQL A;  3L0O A;  4A3E G;  4YY3 Q;  1Z9F A;  4POF A;  4PZ8 A;  2VQE L;  1XMO L;  3I4N G;  4IOC A;  4B3T Q;  4IPD A;  2RF4 A;  4GOP B;  3AFP A;  1GM5 A;  1YIJ A;  2JA6 H;  2CKZ B;  4WJ4 A;  1SMX A;  1IYJ B;  1TWH H;  2FXQ A;  4L5T A;  5LMU L;  1VQK A;  2QGQ A;  1FL0 A;  3PO2 H;  4K0K L;  4OWX B;  3HOX H;  1KAW A;  2N8N A;  3GTL H;  4LUZ A;  1T9H A;  4GOP C;  4JBW A;  1L0W A;  4GKK L;  2OTJ A;  1GD7 A;  2YTX A;  4DV5 Q;  1Y1W H;  4A76 A;  5LMN W;  4DV3 L;  4JI8 L;  4DUY L;  3TS0 A;  3PUX A;  2CFM A;  3BJU A;  2JA6 G;  1E1T A;  1EIF A;  4DR7 Q;  4LF9 L;  4HIK A;  3PO2 G;  3HOW H;  2ZTD A;  3HOX G;  1N36 Q;  3NEL A;  1WYD A;  1X56 A;  2K5H A;  4HID A;  3HOZ H;  3CPW A;  3KYH C;  1Y1W G;  2PQA A;  2OQ0 A;  4DV1 Q;  1YJN A;  2IX1 A;  4OXP A;  4OO1 G;  4WJ3 M; 
#chains in the Genus database with same CATH topology
 2E2H H;  1E2W A;  2WB1 G;  1WD1 A;  1XX8 A;  3GTJ B;  2EOT A;  3HOV H;  4ALP A;  1RCV D;  4IPH A;  2XTI A;  2NZO A;  2A6H D;  4NPS A;  4DGZ A;  2L9H A;  1KHI A;  3S1M H;  3T53 B;  1EQQ A;  4GLV B;  5C4H A;  1PYS B;  2OXP A;  5M3M B;  1RF2 D;  2JXM B;  3KF8 B;  3TP7 A;  4XXE A;  3QWN A;  3UDF A;  2AHO B;  2E2I B;  3KDF A;  1QVG A;  4P75 A;  4RGT A;  4FF1 A;  4R4I A;  3TRE A;  4KD4 A;  4UAI A;  4G4K A;  5KNB A;  3JAM i;  1II3 A;  3AQQ A;  2RDH A;  5IT9 E;  3GO5 A;  4BBS G;  4N9P A;  1CM9 A;  1E1O A;  3J7A F;  2PQA B;  4JOI A;  1G8Z D;  1EWH A;  1OTC A;  1CZW A;  2K5Q A;  2SOB A;  4L5R C;  3A54 A;  3K6O A;  2GVB A;  4L6T B;  4A3G H;  5I2X A;  4X3T A;  5BN5 A;  4A3K H;  1QUQ A;  2LSS A;  4DR7 L;  1KRT A;  3GTQ H;  5D3I B;  4LMQ D;  5COR A;  3I56 A;  3A0J A;  2DNC A;  4K0K Q;  3Q23 A;  2NVT H;  4OO1 I;  4DU9 A;  3I4M H;  2R92 H;  5JAV A;  4LF5 Q;  4GKK Q;  4DAY B;  4B3S L;  4QUF A;  5GAG C;  2A68 C;  4XDX A;  2QCP X;  1GUN A;  2IX3 A;  1Q8I A;  2MNA A;  4K5W A;  1Q1E A;  2F0M A;  1Y8P B;  2VL6 A;  2XN9 C;  1QWY A;  4JI0 L;  3S17 B;  1AFP A;  1DM0 B;  1ESF A;  3A74 A;  4GOP A;  4KHV A;  4U68 A;  2H1E A;  1WCM B;  2LFN A;  2XNA C;  3GTG H;  4JI6 Q;  3M4O H;  4KJN A;  1JMC A;  2FHT A;  1DD2 A;  2JA8 B;  1W6K A;  3K58 A;  4K8I A;  4A3L G;  3J7A V;  5IYB G;  3SK8 A;  4F88 A;  2C35 B;  4LF6 Q;  2RHQ B;  3KLR A;  3OMC A;  1CTM A;  1FVI A;  2PO4 A;  4KY5 A;  1P16 A;  4P71 A;  2CWA A;  3WWV A;  1ESR A;  4A3I G;  3DUZ A;  1WTW A;  1IL2 A;  2X69 A;  2UUA L;  1PRT B;  1ZYR D;  1MD2 D;  1YNJ D;  1VQM A;  3KOJ A;  4Q0F A;  2D9U A;  4JI5 L;  1L1O B;  2OQK A;  1PRT C;  1G6Z A;  3KF8 A;  1Y1V G;  1P8L A;  3D4W A;  3CCS A;  3FKI H;  1VS0 A;  4JW0 A;  1L1O C;  4CBV A;  1HNW Q;  5JJK A;  3JAM E;  3K0X A;  5AFW A;  3PCO B;  2L5T A;  1N33 L;  3OPO A;  3GTJ H;  1KLG D;  3JAM c;  1A6X A;  1N32 L;  5HUR A;  1OXS C;  2KEE A;  3OW2 A;  3RZO B;  2DUD A;  4OHJ A;  1VQD A;  4RG1 A;  2F3W A;  4LUV A;  1NCV A;  2K75 A;  5M3M H;  1VQ4 A;  4IFD G;  3T4A C;  4BBR H;  2EYJ A;  2F3V A;  1J6Q A;  2NYZ D;  1HFN A;  3BVG A;  1AZP A;  4AYB G;  1HZ9 A;  1TII D;  3RZD H;  5IWA L;  1IBM L;  4DR5 L;  3J80 i;  3A7L A;  3OOC A;  1EOV A;  3M9B A;  2GN5 A;  3ERQ A;  4DV0 Q;  2Q2H A;  3NBH B;  2M2L A;  4KV6 A;  2JA6 B;  4FP5 D;  1IBL L;  1DOM A;  4LF7 Q;  4DAY A;  4JCV E;  1ET6 A;  4GNX B;  2A69 D;  3T51 B;  2NZ1 D;  2JK8 A;  4R4T A;  1D2B A;  5EQ0 A;  1KNE A;  3D8G A;  2YYZ A;  3H0G G;  2BE5 D;  4A3J G;  4AYB E;  2R7F A;  1NTG A;  2MPM A;  2O2L D;  4IUN A;  1LT4 D;  4POG A;  3HEJ A;  1CA5 A;  5F2D A;  1NR4 A;  5FLM H;  4V19 0;  1C48 A;  3FHW A;  3NTH A;  3S17 H;  3L7Z C;  1UE7 A;  4YWL A;  1HTL D;  1SNO A;  2B63 B;  4FO2 A;  1R4P B;  5KRU A;  1NMG A;  1WCM H;  1STH A;  1WTP A;  4QIW B;  2MHV A;  3QOJ A;  1SXT A;  2EXD A;  1Q46 A;  4C3H G;  3SXH A;  4DK1 A;  1VMC A;  2JA8 H;  2PMZ B;  3K7U C;  2N49 A;  2MP1 A;  1E24 A;  1L1O A;  4DAV A;  5IIF A;  3PO3 H;  1MGS A;  2RBM A;  2F0I A;  2QDL A;  1XPO A;  2UUC L;  4ZKC B;  3BU2 A;  4HIO A;  1CSQ A;  1VQ5 A;  5G3L D;  4DV7 Q;  1DJR D;  1PDQ A;  1YNN C;  2NN6 H;  4RKB A;  2HCI A;  1CHP D;  1DGS A;  3ONA B;  4LFB Q;  4KY6 A;  1GUW A;  1X55 A;  4IZ8 A;  1V43 A;  3K0Y A;  4OON A;  4FF4 A;  2WAQ G;  1H9J A;  4FDB A;  2EJG C;  5CV7 A;  2CWP A;  3E5S A;  2A8V A;  1Y1V H;  1IBK Q;  1PH1 A;  4QQB X;  2KCT A;  3J80 c;  4BXX H;  3CC4 A;  2YV5 A;  4GZY C;  4QGU A;  5KGU A;  2CQA A;  1PZJ D;  3MXG A;  1QE6 A;  1HXY D;  4GN4 B;  2KCN A;  1N34 Q;  1MIU A;  1I5F A;  2IWH A;  3BDO A;  3GTO B;  5HGQ A;  3NBH A;  3LNN A;  2LXJ A;  4JK1 C;  3C46 A;  4YHH Q;  2F0N A;  4GNX A;  1SE2 A;  1M90 C;  4K2K A;  4DFA A;  2WP8 J;  1H9M A;  3RLF A;  2VXW A;  2BDO A;  5D3D A;  4LFC L;  4EVO A;  3UE0 A;  3NEN A;  1QZG A;  2VW9 A;  4A3E B;  4Y7N B;  4JI3 Q;  2JEB I;  3LGJ A;  3MEH A;  1EEF D;  3STB C;  3HP3 A;  3VYU A;  3CW2 C;  5C3E G;  1I94 L;  2DJF C;  3D6C A;  4OIK A;  2H4O A;  4R4O A;  1VQ8 A;  1YVC A;  3BYT B;  4GLX A;  5CV8 A;  3PUV A;  3F2C A;  1Q81 C;  1Z7T A;  3CCE A;  4XIG S;  1VQI A;  2DN8 A;  2EY1 A;  3K5O A;  4NMZ A;  1IYV A;  2AWN A;  4LF8 Q;  1RDP D;  3HOX B;  4ZUJ A;  2VUM G;  1BKB A;  3JAM L;  2I07 B;  3OSO A;  2B63 H;  4MNO A;  5ISR A;  3FPP A;  3HOW B;  3H91 A;  2Z4I A;  1XNR Q;  3E0E A;  1FGU A;  2RDF A;  1TY0 A;  4P72 A;  1CFM A;  4KHP Q;  4JBM A;  1QOH A;  2B3G A;  2IJ0 A;  3A5Z B;  3RD4 A;  2Q8R E;  1ML0 D;  1B53 A;  1J9O A;  1S5E D;  1LAB A;  1KD1 C;  2UXB L;  4JYA L;  4DXF A;  1H95 A;  2QIL A;  1Q1B A;  4A93 G;  3D4D A;  4YCU A;  1A63 A;  2PNR C;  4IUV A;  2ENB A;  5KYI A;  1LTB D;  2LXK A;  2EDG A;  3NWT A;  4DR4 L;  3K80 C;  3PGZ A;  2UXD L;  1VQG A;  2Z6K A;  1FNV A;  3S14 B;  1PTO F;  3I4N H;  3PF5 A;  1DON A;  4PMB A;  5COY A;  4A3M B;  2A6H C;  2JA5 B;  2ID0 A;  4OWT B;  1A62 A;  1O7L A;  1X54 A;  3FMC A;  3T1Y L;  1JIC A;  3SEB A;  4H44 C;  1VQL A;  4APV A;  3RR5 A;  3CP0 A;  1PH5 A;  3F1Z A;  5IP9 G;  3FVQ A;  3MXN B;  5C5M A;  4HIM A;  3PQI A;  3HG9 A;  3CCU A;  2DNE A;  4XQN A;  4B3R Q;  3NQT A;  4C3J G;  2BA0 A;  4HCE A;  1I6V C;  1HA5 A;  3NUC A;  1PH7 A;  4R8N A;  2ZM6 L;  3N52 A;  1PZI D;  1EEI D;  3K57 A;  4DV6 L;  1E2Z A;  3RLO A;  4DR1 Q;  4DR6 Q;  5C5L A;  2K33 A;  3PSI A;  3HOY B;  1NNX A;  4XQQ A;  1D1I A;  5M3F B;  4I65 A;  2F4V Q;  5DEH A;  1NE3 A;  2JSO A;  4KD3 A;  4A3E H;  1S5D D;  5FKA C;  4LJZ C;  3EJI A;  2VB3 X;  1SJH D;  1MKH A;  4N9T A;  1R9T H;  1A3U A;  3C1F A;  4K5V A;  4QJF A;  3RN5 A;  3I90 A;  5EPJ A;  3J81 i;  3L0O A;  1EIG A;  4CKB A;  2VQE L;  4IOC A;  2RF4 A;  4QCL A;  1STY A;  3VR5 A;  3S1Q B;  4OEM B;  4WJ4 A;  3NTI A;  1IYJ B;  3BDL A;  4K0K L;  2QGQ A;  3WDN A;  3HOX H;  2N88 A;  1Z6H A;  1T9H A;  1EQV A;  1F2Y A;  4JBW A;  1L0W A;  4GKK L;  2OTJ A;  1Y1W H;  3J80 L;  4A76 A;  4DV3 L;  2P5Z X;  1JOO A;  3IL8 A;  5G3L F;  4DUY L;  2CFM A;  3BJU A;  3HKZ B;  4LF9 L;  1I4R A;  3HOW H;  2ZTD A;  1N36 Q;  3NEL A;  4QUC A;  1DZ1 A;  1X56 A;  5DM6 3;  3HOZ H;  2Y0S B;  2EYH A;  2PW5 A;  4DV1 Q;  3P20 A;  3NE5 B;  3A5U A;  1K0R A;  1I50 H;  4J15 A;  5C44 H;  1WTQ A;  1STA A;  2Z9H A;  3I91 A;  5T1G A;  4ZUI A;  1WD0 A;  1K83 H;  1PHJ A;  1X3F A;  4LAA A;  1ZYR C;  1YNJ C;  4LF6 L;  2R61 A;  1EY4 A;  3HOV G;  5EKL A;  1BBW A;  1B7Y B;  2NVX B;  1BVS A;  2F0O A;  3IAY A;  3TP5 A;  5C4Z A;  1XNQ L;  3MXN A;  1HNX Q;  3S14 H;  1MSG A;  5FLX E;  5KND A;  3KK7 A;  2PPB C;  1CK1 A;  3S1N B;  2B2T C;  3WOE A;  2JA5 H;  2WKD A;  3G7L A;  1J8I A;  4FVM A;  2D0P A;  1QVF A;  2WKC A;  3P75 A;  5C0X H;  3FDT A;  1ENC A;  1EZ8 A;  2K5D A;  4KLK A;  4XT1 B;  3Q6S A;  4QMG A;  2GA4 B;  4A3G G;  3W3A A;  4RHS A;  1SN8 A;  1NY4 A;  4A3K G;  2F0T A;  3J81 c;  4FYD A;  4JI8 Q;  1PYB A;  2EYP A;  3S16 B;  3TDQ A;  4YIJ A;  5E4X A;  2A69 C;  3HOY H;  1SNQ A;  4BY7 B;  4X64 L;  3I4M G;  2KHS A;  4H02 A;  4BY1 B;  2YU9 B;  2R92 G;  2BE5 C;  2B2V A;  4YCW A;  4K5X A;  2N78 A;  1BR9 A;  1WJJ A;  1EWI A;  2UUB Q;  4LF7 L;  5C4X B;  1CI3 M;  5J22 A;  5JJI A;  1PFB A;  4B9X A;  1PVO A;  2QW7 A;  4C2M B;  3ULP A;  2R93 B;  3T16 A;  2J7Z A;  4RMF A;  4RCO A;  3KLS X;  3NBI A;  5IGD A;  4ZYS A;  3PF4 A;  1SJE D;  3M4Q A;  1S5C D;  2KQ3 A;  1HR0 W;  5EJW A;  1AZQ A;  2DJG C;  1SLJ A;  1STE A;  3H15 A;  1ZKO A;  1SEB D;  5LL6 S;  3OTO Q;  5IGC A;  1IYU A;  3SK5 A;  1JWS D;  2MJ8 A;  1S5F D;  1AW7 A;  1SE3 A;  3S1R B;  4DR2 Q;  5CBE E;  3GQB A;  1O78 A;  2AUK A;  4M1U B;  1DOL A;  1U4P A;  4NB3 A;  4X3U A;  1CQV A;  3CCM A;  1F2Z A;  2B2T A;  4NKL A;  3W1G A;  4UPA A;  4BA1 I;  2MFI A;  4A3B B;  3FKI G;  3RLN A;  1LTL A;  1UE5 A;  4OL7 A;  3NHH A;  2NVX H;  2NUC A;  5M5Y B;  2K5V A;  4LFA L;  2IW3 A;  1T5X D;  1F9P A;  1TR5 A;  1Q8K A;  1RTN A;  5M3M G;  4BBR G;  1A8V A;  1B50 A;  2GVA A;  3MZ5 A;  1KC8 C;  4JBJ A;  1LTG D;  4KKT A;  1A3T A;  4KI0 A;  2BH8 A;  1TWH B;  3OHX C;  1CT1 D;  1D1K A;  1PXU A;  3VDY A;  5EKI A;  5I6W A;  3PO2 B;  3K81 C;  5E3F A;  3GDE A;  3D3R A;  5CV6 A;  1KL9 A;  2K28 A;  2H5X A;  1IBK L;  4L63 B;  1PTO H;  3UI2 A;  4JI1 Q;  5IGF A;  3R8B A;  1K8G A;  2WB1 E;  2ALY B;  2CHB D;  5JOB A;  1OXV A;  5IT9 c;  4MTN A;  1C4Q A;  3ITP A;  1X3G A;  4LF4 Q;  3T1H Q;  4DUZ Q;  4YHH L;  1RL2 A;  2JQO A;  1ONL A;  3FPU B;  3HOU B;  5JPN C;  3CRL C;  1JR0 D;  3B6Y A;  1L0X B;  4BY1 H;  5J1Z A;  4IFD I;  5E7N A;  4CHT B;  3PIP 3;  4K2L A;  4RCN A;  1BF4 A;  3QO2 A;  1SSO A;  4JI3 L;  4UP9 A;  5FLM G;  2HIX A;  1TWG B;  2WAC A;  5EPK A;  1ILP A;  1JE4 A;  1KLU D;  2I5H A;  1EL0 A;  1X3Q A;  1V9P A;  2R7Z B;  1K8A C;  4BBS B;  3GD7 A;  3PIO 3;  1WCM G;  4OX9 L;  1X32 A;  5LHY 1;  3T13 A;  4A3F H;  2R93 H;  1XXG A;  5J39 A;  2Z8L A;  4JI2 L;  5DLQ E;  2JA8 G;  2E76 C;  3KFU A;  4LUO A;  1QZH A;  1I4G A;  1JJC B;  5JEA J;  1D5Z C;  2F0V A;  4DAP A;  1I4P A;  2K50 A;  1JB7 A;  3PO3 G;  4C1N K;  3AYH B;  1U4M A;  3VA5 A;  4TVA B;  5JJL A;  3DEO A;  1KQS A;  4F87 A;  2EJM A;  2G9H D;  3KBG A;  4O2D A;  3TP8 A;  4B9W A;  2MO0 A;  1PZK D;  2KCC A;  2X6L A;  1XNR L;  2NN6 G;  4O1N A;  4KHP L;  2HHH Q;  2F4I A;  2ZXP A;  4X62 Q;  2IL8 A;  2WIN B;  3J81 L;  4DNT B;  1D5X C;  1HNZ Q;  2J0T D;  2UU9 L;  1VCI A;  2NB0 A;  1TWA B;  2KED A;  2K05 A;  4CKE A;  2JE6 I;  2ZJR A;  2F1M A;  1LTA D;  2F0L A;  4A3B H;  2BDN A;  4HSP A;  3DLL A;  1PFN A;  4H13 C;  2XSC A;  2CH4 W;  1PA6 A;  3ULJ A;  4NXN Q;  4ME5 A;  1PH9 A;  4BXX G;  1V1P B;  4NW2 A;  3CPF A;  5M5Y H;  2IT1 A;  1FJG L;  4GN3 B;  3V05 A;  4E6I A;  1MI2 A;  5M5X B;  1YNX A;  4J8Q A;  4GN5 A;  1MSH A;  4KN7 C;  1DCZ A;  1AH9 A;  4DNI A;  1SRO A;  1JOQ A;  3MAQ A;  4N8X 1;  5I4D A;  2E2J B;  2E2I H;  3LWU A;  2F0J A;  4QY7 A;  1I4Q A;  1U4R A;  1J5E Q;  4R9W A;  1SDF A;  1HFG A;  4ODG A;  3CCJ A;  3CME A;  1AN8 A;  3M4Y A;  2X6G A;  5EAY A;  1B3A A;  4B3R L;  4L5S A;  2A73 B;  3Q24 A;  4TRD A;  4RGO S;  2BA1 A;  2AWO A;  5E4W C;  1EFW A;  2F0U A;  3UDI A;  5BR8 Q;  3HOU H;  1JOK A;  4DR6 L;  4CJ1 B;  4ZKB B;  2F52 A;  4JG2 A;  4AYB B;  4EGV A;  2F4V L;  1UE6 A;  2OWO A;  4IUP A;  2B2W C;  1EY9 A;  1BCP D;  2K14 A;  3CCR A;  1V1O A;  5ELC A;  2Q8I B;  3LWE A;  2MQH A;  4O0A A;  2B63 G;  2F0F A;  2K52 A;  1YHA A;  1Q90 A;  4P74 A;  3GTP B;  4R8I A;  1EU4 A;  3V96 A;  2NTT A;  3W5O A;  2K32 A;  5FO9 B;  3H3V I;  3K5M A;  3I70 A;  1VQP A;  3U58 A;  4NXM Q;  1SYG A;  3NEM A;  3JC6 6;  4JI7 Q;  1TY2 A;  4DV2 Q;  1Y69 U;  1U9R A;  4CJ0 B;  4LW1 A;  1UAP A;  4HSV A;  1BXT A;  2VZA A;  1W3S A;  1A2U A;  1XMO Q;  5EBD A;  1Q82 C;  3CD6 A;  5IYD G;  3IFD A;  4JV5 L;  1I6H B;  4RFB A;  1PH6 A;  4C3I B;  3SK4 A;  5LMU Q;  3C2P A;  1V1P A;  5IT9 L;  4ME3 A;  2JN4 A;  2EIF A;  2E8G A;  4DV1 L;  5A2Q E;  1M8A A;  5CMD A;  1CKO A;  1SFO B;  4CDC C;  4NDX A;  2V4D A;  3I4N G;  1TWA H;  4C3H B;  1SYC A;  2AQ1 B;  3NQI A;  3PV0 A;  2UXC Q;  2NZH A;  4JI4 Q;  3DEP A;  4AQY L;  4OEL B;  4XYQ A;  2YTY A;  2MO1 A;  3S15 B;  2FIN B;  1TU2 B;  1V1Q A;  2NBF A;  3A8J E;  5ELE A;  2KJX A;  3BZD B;  1XMQ L;  4A3D B;  2EYF A;  1PH4 A;  2IHF A;  3OIP A;  1ICW A;  4HJ5 A;  2R6G A;  5ELO A;  4DKA C;  3MVV A;  3RZO H;  1K0S A;  5GAH C;  2HT1 A;  1VQH A;  1BUV T;  1BBX C;  3CQZ B;  4JBK A;  4DN4 M;  2A19 A;  1PMR A;  2B29 A;  4GKJ Q;  2JA9 A;  4LWC A;  1ROD A;  2C5C A;  3BYY B;  5FO8 B;  3S24 A;  2WAQ E;  1V8Q A;  5CV9 A;  3X3N A;  3M85 A;  5C3X A;  4A3E G;  2B2W A;  2HQL A;  1ENA A;  1Z9F A;  4JPB W;  2PYK A;  1A2T A;  1IL8 A;  3T56 B;  3AFP A;  4DK0 A;  1YIJ A;  3VR4 A;  2JA6 H;  1BOS A;  3P1H A;  4C1N I;  4OWX B;  3V2T A;  4HN7 A;  1ZEQ X;  4J1M A;  1GD7 A;  2YTX A;  5LMN W;  4OO1 H;  4JI8 L;  1DXM A;  5BN4 A;  1EIF A;  4DR7 Q;  3HOX G;  4HID A;  5IGG A;  1F9S A;  3K5L A;  2Z1C A;  5C4J B;  3MC0 B;  1Y1W G;  1E2V A;  1PFM A;  1A15 A;  3O13 A;  3M4P A;  2B2Y C;  2RDG A;  3GV6 A;  4KJO A;  2SNM A;  3G4S A;  3NWS A;  2UUB L;  3HOW G;  4RGM A;  3HOZ G;  4JI0 Q;  3H3V C;  3URY A;  4B3M Q;  2EY6 A;  5C3E B;  2XGT A;  3KJO A;  5IOD A;  1EYC A;  1Q3L A;  5ELB A;  1GHK A;  5C44 G;  4B08 A;  4UDU C;  1XPU A;  2E74 C;  1HZC A;  1LYL A;  4X66 L;  4O42 A;  2ICE C;  4R1J A;  5IP7 H;  1NJI C;  3A56 A;  3S2D B;  2EY2 A;  4YY3 L;  3R2I A;  3I4O A;  3OTO L;  4C3I H;  4HMJ A;  4B3T L;  1YEZ A;  5GAD C;  4IUR A;  1RKN A;  5IYD H;  3TN2 A;  5M5W B;  4RKL A;  1RTO A;  1PH3 A;  2ICI A;  2BCO A;  4ZK9 B;  3ND9 A;  2G9D A;  3M3Y B;  4A3M G;  4DV5 L;  2JA5 G;  3W2D A;  1KXL A;  1WFQ A;  4JI5 Q;  3SDZ A;  3K7A B;  1EOT A;  1FYC A;  3D4R A;  4EQ5 A;  4KKU A;  2DGY A;  2KA7 A;  1S5B D;  5C0X G;  4IQZ A;  4A3D H;  1YJ9 A;  4A93 B;  1N32 Q;  3BZC A;  4HED A;  4OWW B;  1Y8O B;  2EVB A;  1FR3 A;  4YWM A;  3GTO H;  1EQR A;  4TQU S;  4A75 A;  2HQE A;  2MGS A;  2Z0S A;  2YTV A;  2FJ2 A;  3HOY G;  4IFD J;  3ERS X;  2IHE A;  5IWA Q;  2K5N A;  1VDZ A;  4DR5 Q;  1BDO A;  4ZQ3 A;  4LNQ A;  1U0L A;  2B8G A;  1D6E C;  1H9S B;  1U4L A;  2HIV A;  4Y7N H;  2B2Y A;  2K5W A;  1IBL Q;  1IKM A;  3A55 A;  3I4L A;  4LF4 L;  4C3J B;  1EIY B;  3T1H L;  2EQS A;  4HAE A;  1KDC A;  4FXD A;  2K7V A;  4XYO A;  3DM1 A;  2AMC B;  2IY5 B;  1QVC A;  2J4X A;  2F0P A;  4HJ7 A;  1L2F A;  2KHJ A;  1HTP A;  1HR0 Q;  1VQ6 A;  1EY7 A;  2NVY B;  4EX5 A;  4LF5 L;  3HKZ G;  2NVQ B;  4UP8 A;  1M4V A;  2EYM A;  4CGY B;  5EBC A;  1X9N A;  1B1Z A;  2KCM A;  2Y0S G;  3KLW A;  5CGK A;  1HQR D;  3HS0 C;  2F0Q A;  3PUY A;  5CV4 A;  1CQF A;  1NMF A;  1LT6 D;  3RNU A;  1B3Q A;  4JI6 L;  1X6O A;  1D5M C;  1SYF A;  1TS3 A;  3H6M A;  4G57 A;  3F2D A;  2AKW B;  2K6A A;  4J6H A;  3U9O A;  3E3X A;  1VQ7 A;  1GXD C;  3DWQ A;  3EBE A;  3S2D H;  1VQE A;  1YJW A;  2PI2 E;  3QG1 A;  3NTK A;  1XWE A;  3L9A X;  3I72 A;  2VQF Q;  4HR7 B;  5GRO A;  4H0L C;  2UUC Q;  1LV9 A;  1LLR D;  2CW0 D;  1XPR A;  3GTL B;  1YZ6 A;  4X62 L;  1ILQ A;  2G5D A;  2I5L X;  5I2Y A;  1E7Z A;  3QB3 A;  2RCN A;  2RKS A;  2L1B A;  2MUY A;  3KJP A;  3TEH B;  1GO3 E;  1I3Q B;  1SYD A;  4X65 Q;  4K8J A;  3K7A H;  4A3M H;  5FLX c;  2ZTE A;  1NBW A;  1FGB D;  4PNY A;  4L8J A;  3E9I A;  3K59 A;  1OXX K;  4G7Z C;  3UE1 A;  4NXN L;  3H94 A;  3G48 A;  3EN2 A;  1HNW L;  1S3O A;  1HCZ A;  3OMG A;  2E2H B;  1X3E A;  1JWM D;  4A4I A;  4TKO B;  3TP6 A;  3K8A A;  3HOV B;  2JYO A;  5EPL A;  3D6W A;  1LTR D;  1H9S A;  3VYT A;  1GUO A;  1Q7Y C;  5A35 A;  5JPM C;  2QEX A;  3WOF A;  3S1M B;  1TWC B;  1I4H A;  2LMC B;  2KEC A;  3VYS A;  2CQO A;  2JA7 B;  4BY1 G;  2Q2U A;  1EFI D;  1O7Z A;  2L11 A;  3FP9 A;  3NPP A;  3S9W A;  4LFC Q;  2VNU D;  1AE3 A;  5M3F H;  2A74 C;  1J5E L;  1X65 A;  1EYG A;  5I9P A;  1OXT A;  2BH2 A;  5JVG 3;  4AH6 A;  1IW7 D;  4X6A H;  4DV0 L;  1BCP B;  3R2T A;  3UDG A;  2SEB D;  5KIX A;  4IOA A;  1GJX A;  1IZ6 A;  5LL6 X;  1X3P A;  5DAU A;  4DV4 Q;  4A3F G;  2R93 G;  1LTS D;  1LT5 D;  3IRB A;  1QIL A;  1BCP C;  2ZJP A;  3ZJY C;  3ULL A;  1AE2 A;  2E2D C;  4XTC S;  3VR6 A;  2F0K A;  3CMA A;  4XT3 B;  4DR3 Q;  1UEB A;  4GLA C;  4IPC A;  5K36 G;  3S1Q H;  3GTQ B;  5EKK A;  1HUM A;  3ICE A;  2NVT B;  2NVY H;  5HY6 A;  1EIH A;  2R7D A;  4LK1 C;  2NVQ H;  3D0F A;  4JC0 A;  2KOL A;  3R93 A;  1JE5 A;  1HQM C;  2M9V A;  2PZT A;  1A0I A;  3R3O A;  3HFZ B;  2HDL A;  2KBN A;  3CF5 A;  1XTD A;  1STG A;  4NXM L;  3M4O B;  3EIV A;  4EQP A;  5JEA H;  2WFW A;  4A3B G;  2UXB Q;  5FJ8 G;  1VMP A;  1WTV A;  3QJY A;  3VA7 A;  4EQN A;  1KNA A;  4MIU A;  1YI2 A;  3CHB D;  1OO9 B;  4V0B A;  3KBX A;  4YWK A;  4UP7 A;  1XJV A;  4A3C H;  4DR4 Q;  5IYC H;  2OT2 A;  3U4V A;  1NAP A;  3P7J A;  4F8M A;  4HTH A;  4DV7 L;  1N8R C;  4ZAI A;  3U50 C;  2UXD Q;  1I3Q H;  2EPB A;  3SVM A;  3CC7 A;  1L0Y B;  3CCV A;  3S1N H;  4LFB L;  2UXC L;  1C0A A;  4JI4 L;  2F0D A;  4P2C B;  1HHV A;  3SR1 A;  3I7F A;  2NN6 I;  4TSS A;  3T1Y Q;  2LY7 A;  2DY7 A;  1KDA A;  1SR3 A;  3PIP A;  4G7O C;  1CUK A;  5C0X J;  1VQA A;  1G29 1;  1CSP A;  1LTT D;  1HPC A;  2WB1 B;  1N34 L;  3PIO A;  1QNK A;  1TWC H;  4ULL A;  1MBY A;  2ZM6 Q;  3HOU G;  2F0W A;  1FD7 D;  1CHQ D;  1SYB A;  3X3M A;  5C3W A;  4CDD C;  4BBR B;  4DV6 Q;  2JA7 H;  3S16 H;  4GKJ L;  2XVS A;  2PNH A;  1TS5 A;  3TRZ A;  4BY7 H;  3RZD B;  1K8M A;  4RAU C;  4U67 3;  2YU9 H;  2ZTC A;  2LS0 1;  5DM7 3;  2K1B A;  1TQO A;  3J81 j;  1FNU A;  4MHE A;  1PV4 A;  2NTS A;  3MEF A;  4Y52 H;  2N3S A;  3QR8 A;  2R7Z G;  3S2H B;  1HZA A;  5C4X H;  1G51 A;  2PZW A;  3OIQ A;  2Q8T A;  3PMF A;  3VR2 A;  4C2M H;  2VQE Q;  2A1A A;  2LKV A;  3I55 A;  1HH2 P;  2ZT9 C;  2BOS A;  3E0J A;  5FLX L;  4Q5V A;  2CVR A;  4IN3 A;  3TSS A;  5K36 H;  1B2T A;  1EY8 A;  1SMY D;  4PZ7 A;  4LF8 L;  4UHV A;  1O7I A;  3EA6 A;  2KUM A;  2QEJ C;  3ZYY X;  4DV3 Q;  2L4N A;  4DUY Q;  3KF6 B;  3QIA A;  2B2U C;  3AB9 A;  1GUG A;  4BWG B;  4LF9 Q;  2ZXO A;  3OW7 A;  4IJL A;  4B3M L;  1WVL A;  4K14 A;  3OYY A;  3DHQ A;  3S1R H;  4PV1 C;  3M7N A;  1GHJ A;  3HKS A;  1UE1 A;  1F9Q A;  3NSW A;  1S72 A;  3RUZ A;  3C3L A;  2VY3 A;  1K28 A;  4X3K A;  1QB5 D;  5FJ8 H;  3PO3 B;  4GS3 A;  3M7G A;  3MFY A;  3DXJ C;  5HGT A;  2Z6B A;  2F0S A;  1GOZ A;  1SNM A;  2M00 A;  5E1F A;  1XNQ Q;  1SE4 A;  3CXC A;  1WTO A;  1JJG A;  1B9N A;  4POF A;  5IGE A;  4PZ8 A;  4FNF A;  4A3I B;  2PW7 A;  4RA8 A;  4ZRZ A;  4ABN A;  1SMX A;  1TWH H;  3BVZ A;  3PO2 H;  1KAW A;  2N8N A;  4LUZ A;  1Y1V B;  3AU7 A;  1EY0 A;  3PUX A;  2JA6 G;  1EZ6 A;  1STN A;  1FNW A;  2EY5 A;  4KN4 C;  1WYD A;  2K5H A;  2EJF C;  3KYH C;  4KMU C;  2PQA A;  2XWJ B;  5DNF A;  1YJN A;  2IX1 A;  4OXP A;  4OO1 G;  3EVQ A;  4WJ3 M;  1F9R A;  1SNP A;  1B44 D;  4QB4 A;  5LMN Q;  4DR1 L;  3PUZ A;  2QKI C;  3UDX A;  4X64 Q;  4DA2 A;  5AJ3 Q;  3BZK A;  3QOL A;  1PTO D;  1SYE A;  3Q8D A;  3FEW X;  3VR3 A;  1Y8N B;  1TWF B;  3NXW A;  2HCC A;  3S2H H;  1TVX A;  4DK3 C;  2B2U A;  4BA2 I;  1TWG H;  1YHB A;  1RIP A;  4R4Q A;  3G71 A;  1JWU D;  2R7Z H;  3KF6 A;  1WTH A;  4BBS H;  3E6Z X;  4MN3 A;  4DF7 A;  1EQT A;  2XIW A;  3EQL C;  5IY0 A;  3D31 A;  4FXG C;  4PMW A;  2PQE A;  4GNX C;  3CKI B;  5FK9 C;  1C7Y A;  2V1C C;  2VB2 X;  5K5P A;  2Q2I A;  3H0G B;  4P73 A;  2KVM A;  4I7Z C;  4IUQ A;  2E5L Q;  1HA6 A;  5IP7 G;  5NUC A;  1YHQ A;  1HR0 L;  4A3J B;  2CCZ A;  5I6Y A;  1IXR A;  1EY6 A;  1NR2 A;  2O5J C;  2JJQ A;  2K03 A;  1CKM A;  4C3I G;  2Q2T A;  5C6A A;  1G6P A;  3MXU A;  1N36 L;  3L3O C;  1ASY A;  2DY8 A;  4QIW E;  1TT2 A;  3ER0 A;  2CW0 C;  3E9H A;  2PMZ E;  4CJ2 C;  3GTK B;  1NUC A;  1K73 C;  1XYI A;  3CCQ A;  2A6E D;  1K9M C;  1W6J A;  4A3D G;  2FMC A;  2VQF L;  4A3L H;  1F2L A;  1SBB B;  4OGQ C;  5IYB H;  2L15 A;  1XTC D;  1M1K C;  1R4Q B;  4LFA Q;  1G2S A;  2I46 A;  4KK7 A;  1KTK A;  1QCB D;  5M5X H;  2ATW A;  3MXP A;  1K3R A;  3C1E A;  4RGN A;  1EYD A;  4K6D A;  1HNX L;  4A3I H;  4X65 L;  3I4N B;  3BS1 A;  2E2J H;  4NP5 A;  1C8C A;  4G7H C;  3IFT A;  1DOK A;  1STB A;  3J80 E;  4WRD A;  2AQ3 B;  2WAQ B;  1KAA A;  3KLS A;  5KNC A;  2EYO A;  3MTS A;  2CH4 A;  1Q12 A;  3H09 A;  4XQJ A;  3HGB A;  3DWA A;  3HZX A;  5C0X I;  1CKN B;  2ZJQ A;  3CRK C;  2Z6K C;  1Q86 C;  1IW7 C;  4S3S A;  1GVP A;  4IFD H;  1SAP A;  2O4X A;  1AP0 A;  5CBA E;  1MHW C;  1ICF B;  1SE8 A;  3I3C A;  1TWF H;  1LO5 D;  2E75 C;  1B4O A;  5L37 A;  5I9O A;  4ILW A;  4IAL A;  4B3S Q;  1QNU A;  2RSN A;  1R9T B;  2RA4 A;  4WJW A;  4DV4 L;  3GTP H;  1KDB A;  2RVL A;  1JC7 A;  2TSS A;  4KTA A;  4OX9 Q;  2OTL A;  2N55 A;  1G2T A;  3DM3 A;  1SRU A;  2KHI A;  4JI2 Q;  4H7B A;  4DNR B;  4HJ8 A;  4DR3 L;  3GP7 A;  2EE1 A;  3H0G H;  1ASZ A;  1C9O A;  2A68 D;  5GQO A;  1E0B A;  1EYA A;  1QG7 A;  4A3J H;  5ELF A;  1AEX A;  2D2C C;  2K4K A;  3A7A B;  3BVM A;  3U4Z A;  3CC2 A;  1H9R A;  5FOB B;  1Y1W B;  4QF4 A;  1WTX A;  4L5Q A;  5M9O A;  1I6H H;  4X3S A;  2VUM B;  1EUJ A;  1SND A;  2SNS A;  1VQN A;  4UY8 C;  2F03 A;  2ASB A;  4RWS C;  4IO9 A;  3HOZ B;  4IPG A;  1UWV A;  4DR2 L;  4FF2 A;  5ELD A;  1JCK B;  1SFO H;  2UU9 Q;  4CDE C;  1WOC A;  3GTK H;  1I50 B;  4C3H H;  2UUA Q;  3CAM A;  5C44 B;  2ZXR A;  1TXY A;  3CCL A;  1B70 B;  1K83 B;  1F2M A;  3S15 H;  1ENF A;  1DYQ A;  1LUZ A;  1HUN A;  5CV5 A;  1BQQ T;  2B8F A;  2XWB B;  1N33 Q;  1FJG Q;  1I4X A;  2Z4H A;  4Z9C B;  2C9O A;  4K6L A;  1G91 A;  3SHL A;  1HZB A;  1PRT D;  3LX0 A;  1B9M A;  3CQZ H;  4DK6 C;  5KEE A;  1JB3 A;  3MWY W;  1OXU A;  1UNS A;  1CKN A;  4HJA A;  1JJ2 A;  5D14 A;  2QDB A;  1BCP F;  3NP8 A;  3RMH A;  5M3F G;  2D62 A;  1ET9 A;  1UEA B;  1IBM Q;  1VQO A;  3W1B A;  2HUG A;  4CDF C;  4N8F A;  5JJZ A;  4KKS A;  3SK6 A;  4JI1 L;  3G6J B;  1IHZ A;  1JOR A;  5JVH 3;  1MJC A;  3Q0A A;  2JP1 A;  1BBU A;  1W2B A;  3AEV A;  1TS2 A;  3CU7 A;  4DUZ L;  2RQX A;  4M8A A;  4ZCK A;  1PH2 A;  3SGI A;  5A2Q L;  3J7Z C;  3J7Y W;  2F0E A;  3BG3 A;  5D65 A;  4YCV A;  3F2B A;  1VQB A;  3TQY A;  2IX0 A;  5C4J H;  3TS2 A;  2R3Z A;  5IGB A;  1U5K A;  5BN3 A;  1SNC A;  2L12 A;  4HCS A;  4PMC A;  3AMU A;  4IJH A;  1CA6 A;  3ND8 A;  3H3V H;  1TKW B;  3VYR A;  3DMU A;  3FRP B;  3TZD A;  2EZV A;  1SMY C;  3HRZ C;  1Z47 A;  1KRS A;  3L2P A;  2XRS D;  5C3E H;  1K3B C;  1Y14 B;  3I2Z A;  5JEA G;  1RD9 D;  3NK9 A;  5ELN A;  5CR3 A;  4DAM A;  3EFX D;  2K04 A;  4MZ9 A;  1VQJ A;  1YIT A;  4OIJ A;  5IE8 A;  4EQO A;  3J7A 5;  2B2V C;  2F3I A;  3GTM B;  1D7Q A;  2KEN A;  2L0C A;  4BS9 A;  1JT8 A;  3N6R A;  2HDM A;  4JV5 Q;  4C56 C;  3HKZ E;  2VUM H;  4FXK C;  4A3C G;  1O7Y A;  2XRQ D;  1BO0 A;  3K5N A;  2Y0S E;  5IYC G;  5M5W H;  4ZLT F;  3OWE B;  2I5M X;  2QA4 A;  4CKC A;  1CZG A;  2HHH L;  4HJ9 A;  3RN2 A;  3M3Y H;  2L55 A;  4PQX A;  1HNZ L;  4DPG A;  1S40 A;  1KIX A;  2O5I C;  3TZU A;  4AQY Q;  3MFG A;  1RHP A;  2D5D A;  1ZXT A;  1NSN S;  4RHR A;  1KAB A;  2D0O A;  4WFN 3;  2QF7 A;  1XMQ Q;  2IPK D;  4I7A A;  1YNN D;  4A93 H;  1UUP A;  3MA2 B;  3IKJ A;  1T5E A;  1WI5 A;  2AUJ D;  1LM0 A;  2SDF A;  3A8K E;  1IKL A;  3GV3 A;  2JA7 G;  2JEA I;  1RJT A;  5IOC A;  4PG3 A;  1BNZ A;  4BY7 G;  5H1S E;  4FF3 A;  4IUU A;  1N9W A;  1MJE A;  1PTO B;  2FMM A;  2RCF A;  5CC4 A;  3PUW A;  5TSS A;  5C4X G;  1GUT A;  1WTR A;  5IP9 H;  1PTO C;  1HJP A;  1VF7 A;  5T1I A;  2VS1 A;  4C3J H;  3J81 E;  1I94 Q;  1JQY D;  2RSO A;  3TME A;  2OEO A;  2FFK B;  5EGT A;  2EXZ A;  3SE0 A;  5J3B A;  3KDF B;  5GAE C;  1VQC A;  2RHS B;  3KUP A;  5BR8 L;  3F2U A;  5LMN L;  4A3G B;  3Q22 A;  2OCE A;  4A3K B;  2AQ2 B;  5CYU A;  2F0G A;  1LTI D;  1LAC A;  2PZU A;  4PZ6 A;  5AJ3 L;  4KY7 A;  3STB D;  3OWF A;  1PYW D;  3I4M B;  1D8L A;  4RH6 A;  2R92 B;  3ERO A;  4QL5 A;  4AIM A;  4WOR A;  1PFS A;  1GKH A;  1PLF A;  1HRJ A;  3TBI B;  1PH8 A;  4JOI C;  2PI2 A;  4HMI A;  4IUT A;  2I0Q A;  1B8A A;  1QUQ B;  4A3F B;  1VF5 C;  1QJO A;  1VQ9 A;  1E22 A;  1F77 A;  3A8I E;  1O80 A;  1S4Z A;  2WV6 D;  4R4C A;  1EWC A;  2PCF B;  3GTG B;  1VQF A;  4JI7 L;  4KHZ A;  5FO7 B;  4DV2 L;  2E5L L;  4MTK A;  2TMP A;  4X66 Q;  2B39 A;  3F8T A;  3GTM H;  1E3P A;  2ES2 A;  3AFQ A;  4JYA Q;  3G6E A;  2K01 A;  1YBY A;  4DXG A;  4YY3 Q;  4JVZ A;  5KYL A;  3I8Z A;  1XMO L;  3MHB A;  1PRT F;  4B3T Q;  4IPD A;  2A6E C;  4GOP B;  1GM5 A;  2CKZ B;  1K8O A;  2A5H A;  1LT3 D;  2FXQ A;  4L5T A;  4F7X A;  1FL0 A;  5LMU L;  1VQK A;  3GTL H;  4GOP C;  2HD3 A;  1GUS A;  1TS4 A;  4DV5 Q;  1A3V A;  4ID6 A;  3TS0 A;  1H9K A;  1E1T A;  3I73 A;  2NWG A;  3DWP A;  4HIK A;  1EU3 A;  3PO2 G;  3BDC A;  1EY5 A;  3CPW A;  2F0H A;  3U9S A;  2OQ0 A;  2OF1 A;  2WII B;  3FKI B;  2EYL A; 
#chains in the Genus database with same CATH homology
 2E2H H;  3M4P A;  3A5U A;  1K0R A;  5LMN Q;  1I50 H;  2WB1 G;  4J15 A;  2UUB L;  5C44 H;  3G4S A;  4DR1 L;  3HOW G;  3HOV H;  4ALP A;  4IPH A;  3HOZ G;  4JI0 Q;  3PUZ A;  2XTI A;  4X64 Q;  3UDX A;  2NZO A;  5AJ3 Q;  3BZK A;  4NPS A;  4B3M Q;  1K83 H;  3Q8D A;  1PHJ A;  1KHI A;  1X3F A;  3S1M H;  1EQQ A;  4GLV B;  2XGT A;  3KJO A;  4LF6 L;  1PYS B;  3KF8 B;  5C44 G;  3S2H H;  4BA2 I;  4DK3 C;  3HOV G;  1TWG H;  1BBW A;  1XPU A;  1B7Y B;  1YHB A;  1BVS A;  3UDF A;  1RIP A;  1HZC A;  2AHO B;  3KDF A;  4R4Q A;  3G71 A;  3KF6 A;  2R7Z H;  1LYL A;  4X66 L;  4P75 A;  1QVG A;  4BBS H;  4R4I A;  3TRE A;  1XNQ L;  4R1J A;  5IP7 H;  5IY0 A;  3D31 A;  1NJI C;  4PMW A;  4GNX C;  1HNX Q;  3JAM i;  3S14 H;  4YY3 L;  3I4O A;  3OTO L;  1C7Y A;  2V1C C;  3AQQ A;  4C3I H;  4B3T L;  2JA5 H;  1YEZ A;  3GO5 A;  5GAD C;  2Q2I A;  4P73 A;  4BBS G;  5IYD H;  1E1O A;  2E5L Q;  2PQA B;  2D0P A;  4JOI A;  5IP7 G;  1YHQ A;  1HR0 L;  1PH3 A;  1OTC A;  1QVF A;  2CCZ A;  1IXR A;  4L5R C;  2GVB A;  4A3G H;  2JJQ A;  1CKM A;  4A3M G;  4DV5 L;  4A3K H;  2JA5 G;  1QUQ A;  1KXL A;  2Q2T A;  2LSS A;  1WFQ A;  1KRT A;  3GTQ H;  4DR7 L;  4JI5 Q;  4KLK A;  1G6P A;  1N36 L;  3I56 A;  3A0J A;  4K0K Q;  1ASY A;  4EQ5 A;  2NVT H;  4OO1 I;  4QIW E;  4A3G G;  2DGY A;  3I4M H;  1SN8 A;  3ER0 A;  5C0X G;  2R92 H;  4LF5 Q;  1NY4 A;  4A3K G;  4A3D H;  4GKK Q;  4DAY B;  1YJ9 A;  4B3S L;  5GAG C;  3J81 c;  3E9H A;  4JI8 Q;  2PMZ E;  1PYB A;  1N32 Q;  3BZC A;  2MNA A;  1K73 C;  3CCQ A;  1Q1E A;  4OWW B;  3HOY H;  2VL6 A;  4JI0 L;  1K9M C;  4YWM A;  4X64 L;  3GTO H;  3I4M G;  2R92 G;  4H02 A;  4GOP A;  3A74 A;  4A3D G;  1EQR A;  4YCW A;  2VQF L;  4A3L H;  4TQU S;  4A75 A;  3GTG H;  5IYB H;  4JI6 Q;  2N78 A;  3M4O H;  2L15 A;  1JMC A;  1M1K C;  1WJJ A;  1EWI A;  2YTV A;  2Z0S A;  4LFA Q;  2UUB Q;  3HOY G;  4LF7 L;  4IFD J;  3ERS X;  5JJI A;  2IHE A;  5M5X H;  5IWA Q;  2ATW A;  2K5N A;  1K3R A;  1PVO A;  4DR5 Q;  4A3L G;  3ULP A;  5IYB G;  4LNQ A;  1U0L A;  2C35 B;  4RMF A;  1HNX L;  4LF6 Q;  4A3I H;  2RHQ B;  4X65 L;  2HIV A;  4Y7N H;  3PF4 A;  1FVI A;  1IBL Q;  2E2J H;  3M4Q A;  1HR0 W;  1P16 A;  4LF4 L;  1EIY B;  4P71 A;  2CWA A;  3WWV A;  2EQS A;  3T1H L;  4A3I G;  1SLJ A;  1IL2 A;  3H15 A;  2UUA L;  1VQM A;  2AMC B;  3OTO Q;  1Q12 A;  2IY5 B;  1QVC A;  3KOJ A;  4HJ7 A;  4JI5 L;  1L1O B;  1L2F A;  2OQK A;  2KHJ A;  1Y1V G;  1P8L A;  5C0X I;  4DR2 Q;  1CKN B;  1HR0 Q;  1VQ6 A;  2ZJQ A;  3CCS A;  2Z6K C;  3FKI H;  1VS0 A;  1Q86 C;  1L1O C;  4EX5 A;  1HNW Q;  5JJK A;  4LF5 L;  4NB3 A;  3HKZ G;  3K0X A;  3PCO B;  1GVP A;  1N33 L;  4UP8 A;  3GTJ H;  3CCM A;  3JAM c;  1N32 L;  1X9N A;  1SE8 A;  1OXS C;  2KCM A;  2Y0S G;  3W1G A;  3OW2 A;  4UPA A;  3KLW A;  2DUD A;  4BA1 I;  1VQD A;  2MFI A;  4RG1 A;  3FKI G;  4LUV A;  3RLN A;  1LTL A;  1TWF H;  1UE5 A;  2K75 A;  3PUY A;  5M3M H;  1VQ4 A;  4IFD G;  1NMF A;  3RNU A;  4JI6 L;  4BBR H;  4B3S Q;  1X6O A;  2NVX H;  1J6Q A;  2K5V A;  4LFA L;  4AYB G;  4DV4 L;  3F2D A;  3GTP H;  2AKW B;  1HZ9 A;  4OX9 Q;  3RZD H;  1Q8K A;  5IWA L;  1VQ7 A;  3EBE A;  2OTL A;  1VQE A;  5M3M G;  1YJW A;  1IBM L;  4DR5 L;  3S2D H;  3J80 i;  2PI2 E;  3DM3 A;  1SRU A;  2KHI A;  4JI2 Q;  4BBR G;  1A8V A;  2VQF Q;  4HJ8 A;  1EOV A;  4DR3 L;  2GVA A;  3M9B A;  2GN5 A;  4DV0 Q;  1KC8 C;  4JBJ A;  2Q2H A;  3NBH B;  5GRO A;  3H0G H;  4KI0 A;  1ASZ A;  1C9O A;  2BH8 A;  5GQO A;  2UUC Q;  1IBL L;  1XPR A;  4LF7 Q;  4A3J H;  4JCV E;  3VDY A;  3K81 C;  3GDE A;  4GNX B;  1KL9 A;  1YZ6 A;  4X62 L;  2K4K A;  3U4Z A;  2JK8 A;  4R4T A;  3CC2 A;  2H5X A;  1IBK L;  2I5L X;  1E7Z A;  2RCN A;  3KJP A;  2YYZ A;  3H0G G;  3TEH B;  1GO3 E;  4JI1 Q;  4L5Q A;  4X65 Q;  1K8G A;  1I6H H;  3K7A H;  4A3J G;  4A3M H;  1EUJ A;  2WB1 E;  4AYB E;  5FLX c;  2ZTE A;  2ALY B;  1VQN A;  1NBW A;  4UY8 C;  2R7F A;  1NTG A;  3E9I A;  4IO9 A;  1OXV A;  2ASB A;  5IT9 c;  4IPG A;  4MTN A;  1OXX K;  1UWV A;  4DR2 L;  1X3G A;  3UE1 A;  3T1H Q;  4LF4 Q;  4NXN L;  4DUZ Q;  1SFO H;  2UU9 Q;  4POG A;  4YHH L;  3G48 A;  3EN2 A;  1HNW L;  1S3O A;  1RL2 A;  1WOC A;  2JQO A;  3GTK H;  1X3E A;  4C3H H;  2UUA Q;  3CAM A;  4A4I A;  5FLM H;  3FHW A;  3K8A A;  1TXY A;  3S17 H;  3B6Y A;  1UE7 A;  3L7Z C;  4YWL A;  3CCL A;  4BY1 H;  1Q7Y C;  1B70 B;  2QEX A;  4IFD I;  1NMG A;  5E7N A;  1WCM H;  3S15 H;  2EXD A;  1LUZ A;  1Q46 A;  4JI3 L;  4UP9 A;  5FLM G;  2HIX A;  2CQO A;  1N33 Q;  2JA8 H;  1FJG Q;  2I5H A;  1V9P A;  4BY1 G;  2Q2U A;  1K8A C;  3GD7 A;  3K7U C;  3FP9 A;  4LFC Q;  1WCM G;  2N49 A;  1HZB A;  1AE3 A;  5M3F H;  4A3F H;  1J5E L;  1X65 A;  4OX9 L;  2VNU D;  2R93 H;  1EYG A;  1OXT A;  3CQZ H;  1E24 A;  1L1O A;  4DK6 C;  4JI2 L;  2BH2 A;  3PO3 H;  5DLQ E;  2JA8 G;  4AH6 A;  3KFU A;  1OXU A;  4X6A H;  1CKN A;  4LUO A;  4DV0 L;  4HJA A;  1XPO A;  1QZH A;  1JJ2 A;  1JJC B;  3UDG A;  5JEA J;  2UUC L;  4IOA A;  1IZ6 A;  3BU2 A;  5M3F G;  4DV4 Q;  2D62 A;  4HIO A;  4A3F G;  2R93 G;  3IRB A;  1CSQ A;  1VQ5 A;  2K50 A;  2ZJP A;  3ZJY C;  4DV7 Q;  1JB7 A;  3PO3 G;  3ULL A;  1IBM Q;  1AE2 A;  3AYH B;  3W1B A;  1VQO A;  4TVA B;  4XTC S;  3CMA A;  5JJL A;  1DGS A;  4DR3 Q;  4LFB Q;  4JI1 L;  1UEB A;  4GLA C;  4IPC A;  1KQS A;  5K36 G;  1X55 A;  4O2D A;  3S1Q H;  3ICE A;  1V43 A;  4OON A;  2WAQ G;  2MO0 A;  1MJC A;  4FDB A;  1XNR L;  1BBU A;  2NN6 G;  2NVY H;  4KHP L;  2HHH Q;  5HY6 A;  4X62 Q;  2CWP A;  2R7D A;  1W2B A;  3AEV A;  2NVQ H;  2A8V A;  1Y1V H;  3D0F A;  4DUZ L;  1IBK Q;  4JC0 A;  1PH1 A;  1HNZ Q;  2UU9 L;  1PH2 A;  2KCT A;  3SGI A;  3J80 c;  3J7Z C;  4QQB X;  1VCI A;  1JE5 A;  3CC4 A;  2YV5 A;  4BXX H;  4QGU A;  4YCV A;  3F2B A;  1VQB A;  3TQY A;  2JE6 I;  1A0I A;  2ZJR A;  4GN4 B;  1N34 Q;  4A3B H;  1MIU A;  3HFZ B;  1I5F A;  2IX0 A;  3DLL A;  5HGQ A;  5C4J H;  3TS2 A;  2KBN A;  3CF5 A;  1U5K A;  1XTD A;  2LXJ A;  1PA6 A;  3ULJ A;  4NXM L;  4NXN Q;  1PH9 A;  4BXX G;  3EIV A;  4YHH Q;  4IJH A;  4GNX A;  3CPF A;  5M5Y H;  1M90 C;  3H3V H;  2WFW A;  2WP8 J;  4A3B G;  2IT1 A;  1FJG L;  4GN3 B;  3RLF A;  2UXB Q;  5FJ8 G;  1YNX A;  1Z47 A;  4GN5 A;  4LFC L;  1KRS A;  3L2P A;  5C3E H;  1Y14 B;  3I2Z A;  3UE0 A;  3NEN A;  5JEA G;  5ELN A;  1YI2 A;  1QZG A;  4DAM A;  1AH9 A;  2VW9 A;  4MZ9 A;  4JI3 Q;  4DNI A;  2JEB I;  1SRO A;  1VQJ A;  3LGJ A;  1YIT A;  4YWK A;  4UP7 A;  1XJV A;  2E2I H;  5IE8 A;  3STB C;  4QY7 A;  4A3C H;  3CW2 C;  5C3E G;  1I94 L;  3J7A 5;  2F3I A;  5IYC H;  4DR4 Q;  1D7Q A;  3U4V A;  2KEN A;  1J5E Q;  4R4O A;  4DV7 L;  1N8R C;  1VQ8 A;  1YVC A;  3U50 C;  4GLX A;  2UXD Q;  3CCJ A;  1I3Q H;  1JT8 A;  3PUV A;  3F2C A;  4JV5 Q;  3CME A;  1Q81 C;  3CC7 A;  3HKZ E;  2VUM H;  3CCV A;  3CCE A;  5EAY A;  3S1N H;  4XIG S;  4LFB L;  2UXC L;  1C0A A;  4B3R L;  4JI4 L;  4L5S A;  4A3C G;  1VQI A;  3I7F A;  2Y0S E;  2NN6 I;  5IYC G;  3T1Y Q;  5M5W H;  2I5M X;  2AWN A;  4LF8 Q;  2QA4 A;  2HHH L;  1SR3 A;  2AWO A;  2BA1 A;  3PIP A;  4HJ9 A;  3UDI A;  5BR8 Q;  3RN2 A;  1EFW A;  3HOU H;  2VUM G;  3M3Y H;  1CUK A;  1HNZ L;  1BKB A;  4DR6 L;  5C0X J;  1VQA A;  4DPG A;  1S40 A;  1G29 1;  1KIX A;  1CSP A;  2F52 A;  2B63 H;  4JG2 A;  4MNO A;  4AQY Q;  1N34 L;  2F4V L;  1UE6 A;  3PIO A;  1TWC H;  2OWO A;  1XNR Q;  3E0E A;  1FGU A;  2ZM6 Q;  3HOU G;  4KHP Q;  4P72 A;  2D0O A;  4JBM A;  2K14 A;  3CCR A;  2B3G A;  1XMQ Q;  3A5Z B;  4DV6 Q;  2MQH A;  4O0A A;  2JA7 H;  4A93 H;  2B63 G;  3S16 H;  4GKJ L;  2K52 A;  1YHA A;  1WI5 A;  2PNH A;  4P74 A;  1KD1 C;  1LM0 A;  3TRZ A;  4BY7 H;  2UXB L;  4JYA L;  1H95 A;  3W5O A;  2YU9 H;  2ZTC A;  1Q1B A;  3H3V I;  1VQP A;  4A93 G;  2JA7 G;  3U58 A;  3J81 j;  4NXM Q;  1PV4 A;  3NEM A;  3MEF A;  3JC6 6;  4YCU A;  2N3S A;  4JI7 Q;  4DV2 Q;  2R7Z G;  2JEA I;  4Y52 H;  1A63 A;  1HZA A;  4BY7 G;  4PG3 A;  5C4X H;  4LW1 A;  1G51 A;  5H1S E;  2LXK A;  1N9W A;  2VZA A;  4DR4 L;  1W3S A;  3K80 C;  3PGZ A;  4C2M H;  1MJE A;  2VQE Q;  1XMO Q;  1Q82 C;  3CD6 A;  1VQG A;  2A1A A;  2Z6K A;  3I55 A;  2UXD L;  5IYD G;  4JV5 L;  3PUW A;  3PF5 A;  3I4N H;  1HH2 P;  5C4X G;  1PH6 A;  5IP9 H;  5LMU Q;  2ID0 A;  4OWT B;  1HJP A;  1A62 A;  1X54 A;  4ME3 A;  3T1Y L;  2EIF A;  2VS1 A;  4C3J H;  1I94 Q;  2E8G A;  4DV1 L;  1VQL A;  4APV A;  4PZ7 A;  4LF8 L;  3RR5 A;  1CKO A;  1O7I A;  5J3B A;  3KDF B;  4DV3 Q;  5GAE C;  4DUY Q;  1VQC A;  2RHS B;  3CP0 A;  1TWA H;  3KF6 B;  5BR8 L;  5LMN L;  1PH5 A;  3F1Z A;  2OCE A;  5IP9 G;  3MXN B;  4LF9 Q;  3PV0 A;  4HIM A;  2UXC Q;  2NZH A;  3CCU A;  4B3R Q;  4JI4 Q;  5AJ3 L;  4IJL A;  4PZ6 A;  2BA0 A;  4AQY L;  4B3M L;  3OYY A;  2YTY A;  2MO1 A;  3S1R H;  1PH7 A;  3STB D;  2ZM6 L;  3M7N A;  1V1Q A;  1D8L A;  1XMQ L;  3HKS A;  4DV6 L;  1UE1 A;  4QL5 A;  3RLO A;  4AIM A;  2IHF A;  4DR1 Q;  1PH4 A;  1PFS A;  1GKH A;  4DR6 Q;  4HJ5 A;  1S72 A;  2R6G A;  5ELO A;  4DKA C;  1PH8 A;  3PSI A;  2PI2 A;  4JOI C;  2VY3 A;  3RZO H;  2I0Q A;  1B8A A;  1QUQ B;  2F4V Q;  5GAH C;  2HT1 A;  1VQH A;  1E22 A;  1VQ9 A;  1NE3 A;  5FJ8 H;  4JBK A;  4GS3 A;  4A3E H;  2A19 A;  4R4C A;  1VQF A;  4JI7 L;  4KHZ A;  4DV2 L;  2B29 A;  1MKH A;  4GKJ Q;  2E5L L;  1R9T H;  2JA9 A;  4X66 Q;  4LWC A;  3F8T A;  4QJF A;  1XNQ Q;  1E3P A;  3GTM H;  3RN5 A;  3S24 A;  3AFQ A;  3CXC A;  2ES2 A;  4JYA Q;  2WAQ E;  3G6E A;  1JJG A;  3M85 A;  1YBY A;  3J81 i;  2HQL A;  3L0O A;  4A3E G;  4YY3 Q;  1Z9F A;  4POF A;  4PZ8 A;  2VQE L;  1XMO L;  3I4N G;  4IOC A;  4B3T Q;  4IPD A;  2RF4 A;  4GOP B;  3AFP A;  1GM5 A;  1YIJ A;  2JA6 H;  2CKZ B;  4WJ4 A;  1SMX A;  1IYJ B;  1TWH H;  2FXQ A;  4L5T A;  5LMU L;  1VQK A;  2QGQ A;  1FL0 A;  3PO2 H;  4K0K L;  4OWX B;  3HOX H;  1KAW A;  2N8N A;  3GTL H;  4LUZ A;  1T9H A;  4GOP C;  4JBW A;  1L0W A;  4GKK L;  2OTJ A;  1GD7 A;  2YTX A;  4DV5 Q;  1Y1W H;  4A76 A;  5LMN W;  4DV3 L;  4JI8 L;  4DUY L;  3TS0 A;  3PUX A;  2CFM A;  3BJU A;  2JA6 G;  1E1T A;  1EIF A;  4DR7 Q;  4LF9 L;  4HIK A;  3PO2 G;  3HOW H;  2ZTD A;  3HOX G;  1N36 Q;  3NEL A;  1WYD A;  1X56 A;  2K5H A;  4HID A;  3HOZ H;  3CPW A;  3KYH C;  1Y1W G;  2PQA A;  2OQ0 A;  4DV1 Q;  1YJN A;  2IX1 A;  4OXP A;  4OO1 G;  4WJ3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...