2YU9H

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yu9H00
1A8VA 4DPGA 5IP7H 5M5XH 4OO1I 1PH8A 2CKZB 1C7YA 3RNUA 5IY0A 4DK3C 2WB1E 1ASYA 4UPAA 3CMAA 1LTLA 4A3MH 4YY3Q 2UU9L 4A3BH 1J5EL 4YCUA 3KOJA 3HOXG 4JI8L 1NTGA 1E1OA 2ZJQA 5GAHC 1OXSC 1QVFA 3E9IA 3J81j 2NVQH 4R1JA 4A93G 1QZHA 3U4VA 1Z47A 4GN3B 2RF4A 2K75A 1HNXL 3RLNA 1PH7A 1SN8A 2AWNA 4DR6L 1KL9A 4JI5L 3PUWA 1H95A 4DV6Q 2NZHA 2UUBQ 4HJ5A 2F4VL 1U0LA 2H5XA 1I3QH 3IRBA 1N34L 3E0EA 1N33Q 1L1OC 4BA2I 1PH5A 2JK8A 1EQRA 3KF8B 4LWCA 1GD7A 4DV0Q 4C2MH 1LM0A 3S17H 1GO3E 2ALYB 3CCQA 1IBML 2Z6KA 4JI2Q 4LFBL 4NXNL 1HNZQ 1R9TH 2Y0SE 4AIMA 4XIGS 1IXRA 2OQ0A 3J80c 1ASZA 2VQFL 5JJKA 1XNQQ 4BY7G 5M3FH 4DV3Q 1HNWQ 3CCJA 3UE1A 1WJJA 4APVA 4X66Q 4JI7L 2OWOA 1Y14B 1SRUA 4LUOA 1I6HH 1Q1BA 2L15A 2HQLA 4DKAC 5M3MG 3PGZA 1JJ2A 2PI2A 3TEHB 2QGQA 4JV5Q 4X62Q 4JCVE 4K0KL 4X65Q 4YHHL 4DR5L 3UDIA 1S40A 4B3RQ 4BXXH 5IT9c 1JJCB 4C3HH 4DUYQ 1VS0A 2WP8J 2D0PA 2R7DA 4PG3A 4LFAL 4OX9L 4IFDG 3HOVG 1SLJA 3CP0A 4ME3A 4A3JG 1WOCA 5ELOA 4DAMA 5LMNW 1EOVA 3J81c 1MIUA 3PV0A 1QZGA 1EFWA 4LF4Q 2ES2A 1UWVA 1MKHA 2JA6H 2KENA 1V1QA 2PNHA 4DV7Q 2UXBL 5C3EG 3G48A 4PZ7A 2ZTDA 1VQ4A 4UP7A 4A3EH 2JEBI 3U50C 3J81i 4A3CH 1D7QA 1E22A 1TWAH 1HJPA 3HOUG 4UP9A 3PF5A 2NN6I 4OWTB 2VQEQ 3ULPA 3A74A 4DR7Q 1XNRL 5C44H 3G6EA 4QL5A 4YCWA 2D62A 1Q81C 2UUAQ 4HJ8A 1HZCA 2IX1A 2DUDA 3CW2C 3LGJA 4IPGA 4JI1L 4JOIA 1MJEA 4LF5Q 4LF6L 4NXMQ 1G6PA 4A3GH 4Y7NH 3HOVH 1I5FA 3AEVA 4JV5L 1FJGL 1EYGA 1Q86C 3J7A5 1V9PA 5M5YH 1YVCA 4JI4L 2JA9A 1VQDA 2I5HA 3I2ZA 4TQUS 3S16H 3BZCA 1TXYA 4DK6C 1AE3A 1YJWA 4GOPB 1Z9FA 1HH2P 1KC8C 3PO3H 2BA1A 4GN5A 5FJ8H 1CKNB 4X64Q 2OCEA 2KBNA 2PQAB 3DM3A 4J15A 4A93H 3GTQH 4TVAB 2IX0A 3HOZH 1UE1A 5E7NA 1LYLA 4P71A 4YWKA 2QA4A 2JA5G 3JAMi 4IFDJ 1VCIA 3T1HQ 2WAQE 4A3BG 3GTJH 4BY1H 2YTXA 1Q12A 1IBMQ 3HFZB 3A0JA 5C0XJ 3K7UC 5GROA 2IHFA 2JJQA 2B3GA 1VQAA 1VQIA 2CQOA 3W1GA 3T1HL 1VQPA 1JMCA 4DV1L 4LF4L 1KQSA 3S14H 4GOPC 4KI0A 3B6YA 2D0OA 1VQEA 2WFWA 2LXJA 3T1YQ 4JI6L 3VDYA 2VW9A 4X64L 1NBWA 1SR3A 1WI5A 2UUBL 1X9NA 5JEAJ 1K9MC 2CCZA 4POGA 1PH6A 3I56A 3CC2A 4POFA 2VUMH 3FP9A 2E2JH 2OQKA 1VQFA 3H3VH 1X55A 3FKIH 4NPSA 1JB7A 3K80C 3KYHC 2MNAA 1N32Q 3H0GG 4P72A 1C0AA 1IZ6A 3I4OA 4DAYB 2CWAA 2Y0SG 1YITA 5JEAG 1V43A 2LXKA 3EBEA 1EWIA 2CFMA 2VQFQ 3PF4A 4IOAA 1JE5A 1VQLA 5C4XG 4GOPA 2UUCL 3ERSX 4B3SQ 3S1RH 4JBJA 2ATWA 2FXQA 3KDFB 1CKMA 4L5RC 4BBSG 5M3MH 3OTOQ 1XMQL 2UU9Q 5IYBG 4EQ5A 5C0XG 4PMWA 1VQ6A 4A3JH 2UUCQ 5FLMH 4JBWA 4DV0L 3CCLA 1EIFA 4IJHA 3RLOA 2LSSA 2JEAI 3UE0A 4ALPA 2JA8H 3I4MG 4FDBA 3L0OA 1N34Q 3ER0A 4GNXC 1PH9A 2JA7G 2QEXA 3F2CA 4OX9Q 2Z6KC 1K73C 2Q2UA 4DUZL 1U5KA 2ZM6L 1A0IA 1EQQA 4A3CG 4HIKA 3CC4A 3PSIA 1CUKA 2XGTA 4NB3A 3KFUA 2R7FA 3CCUA 2OTLA 3I4MH 2K5VA 2I0QA 1VQBA 1G291 1L2FA 1G51A 1GKHA 4KHZA 4A4IA 4AH6A 1Y1VH 3PUZA 3KJPA 2MO1A 4QQBX 3PIPA 4YCVA 4IO9A 2ID0A 1XPOA 2E2HH 1A63A 3D0FA 1CKOA 2PI2E 5EAYA 3SGIA 1T9HA 3GTKH 1WCMH 3F1ZA 1LUZA 4IPCA 5HY6A 3PIOA 4B3ML 3HKSA 4KLKA 3GTGH 2IY5B 1CSPA 2YTVA 1HZAA 3CCSA 2A8VA 1P16A 3PUYA 1NJIC 2VQEL 1VQJA 5IYCH 3BU2A 3CPFA 1BBUA 2F3IA 2YTYA 1B70B 3WWVA 4A76A 2VS1A 4DV1Q 1HNZL 3KF6B 4JI2L 5JJLA 1UE7A 1X3EA 2K50A 3CPWA 3AFPA 2JA6G 3RZOH 1AH9A 4QIWE 2HHHQ 2HHHL 1N9WA 5FLMG 1X65A 4B3SL 1SE8A 1PH1A 4A3LG 1Y1VG 1VQ5A 2KCMA 1DGSA 3TS0A 1HR0Q 2KCTA 2WAQG 4C3JH 1XPRA 1TWFH 3GD7A 2JA5H 3CAMA 5IP7G 1O7IA 4IPDA 2R92H 4P74A 5GAEC 4AQYQ 2B63H 3PUVA 4IJLA 1HZ9A 3J80i 2BH8A 3OYYA 3PO3G 2UXDL 5J3BA 1UE5A 1N32L 1FVIA 4K0KQ 1QUQB 5C4JH 4QY7A 4AYBE 3S2DH 4L5SA 3CCRA 4DR3L 1YNXA 4L5QA 1YI2A 4GKKL 2E2IH 4KHPL 4X6AH 3RZDH 4LF6Q 3TS2A 4JI1Q 4A3DG 2VUMG 2GVBA 3PO2G 2I5LX 4RG1A 1I50H 1GVPA 3KF6A 1YBYA 1Q1EA 3M85A 4LUZA 5FJ8G 5AJ3L 1L0WA 4DV4Q 4JBKA 2K5NA 3I55A 2EIFA 5LMNL 2B63G 2AMCB 1YJ9A 4IFDI 3CXCA 3H0GH 1XMQQ 3AFQA 2K52A 4DV5Q 1KD1C 4MNOA 2E5LL 1D8LA 3HOXH 3TRZA 1I94Q 4GNXA 1VQNA 2ZTEA 5HGQA 2YU9H 1VQMA 1YZ6A 1W3SA 2PQAA 1PA6A 1XTDA 1JJGA 1J6QA 3HKZG 4UP8A 4GS3A 1S3OA 4JI5Q 1K8AC 1PV4A 4QJFA 4YWMA 1UE6A 4YHHQ 2YYZA 5IWAQ 1HNXQ 3S15H 1XMOL 1N36Q 1IBLQ 4BXXG 1KXLA 3PUXA 5BR8Q 1P8LA 4GLVB 1HR0W 2PMZE 4PZ6A 1FJGQ 2A1AA 2VL6A 2JA7H 3DLLA 4WJ3M 1X3GA 3RN5A 5IYDH 4JC0A 4A3IH 4JI8Q 4A3MG 3U4ZA 4HIOA 4JYAL 1J5EQ 2XTIA 1KIXA 4LNQA 1X56A 4JI7Q 4LF9Q 3HOWG 4OO1G 1QVCA 4BBRG 4X66L 4DUZQ 3GTPH 4AYBG 1PH4A 1HNWL 1K0RA 4DR7L 1UEBA 1XNQL 3T1YL 3S1NH 1YHBA 1KAWA 1NMGA 2R7ZH 4BY7H 4JI0Q 5C4XH 4GNXB 4H02A 2RCNA 3MXNB 4B3TL 2UXCL 4LFBQ 3EN2A 3I7FA 3E9HA 2NVXH 4MZ9A 4GLXA 2E8GA 1SROA 3K81C 4DV2Q 3OW2A 4HJ9A 3M4PA 5IP9H 3NENA 5GADC 2JQOA 4R4OA 2AWOA 1XPUA 2N3SA 1Y1WH 3JAMc 3CCVA 4DNIA 2HIXA 3K0XA 2EXDA 3D31A 4OWXB 3HKZE 3ZJYC 4HIMA 5IYBH 1E24A 2NVYH 1YJNA 4LF7Q 1QUQA 4LFAQ 4R4CA 3HOWH 1BVSA 1K3RA 4A3IG 2K5HA 2Q2IA 3GTLH 1M90C 3M3YH 3CD6A 4PZ8A 4DR5Q 2N78A 2MQHA 4X65L 1Q82C 2KHIA 3NBHB 4X62L 1PHJA 3CC7A 1PYSB 1WFQA 2C35B 3J7ZC 1A62A 1YHAA 3NEMA 1YIJA 4NXML 3CCEA 1NE3A 4LFCL 2UUAL 4DR4L 2CWPA 2V1CC 5ELNA 2VNUD 3M4QA 1YEZA 3I4NH 1XNRQ 4OXPA 2A19A 5M5WH 4B3TQ 4JI6Q 5DLQE 1FGUA 3M4OH 1CKNA 5GQOA 1PH3A 5C0XI 2BH2A 5K36G 1X6OA 4DR1Q 1E1TA 1GM5A 2ZJPA 3S1QH 3A5ZB 2K4KA 2NZOA 3PCOB 4UY8C 4IPHA 1NY4A 4DV7L 2UXBQ 1OXTA 3RR5A 3GTMH 2N8NA 4P73A 2ASBA 3EIVA 3K8AA 3K7AH 1NMFA 3G4SA 1IL2A 3HOYH 4BBRH 1XMOQ 1QVGA 1W2BA 4BBSH 4LW1A 4GKJL 4JOIC 3STBD 2F4VQ 4DUYL 5H1SE 4A3GG 2MFIA 3I4NG 4HIDA 4HJ7A 1SFOH 4DR6Q 4R4TA 3CQZH 1B7YB 4GKJQ 4JI4Q 4LF7L 3HOZG 2MO0A 2ZJRA 1KRSA 2HT1A 2IT1A 2VZAA 1VQKA 4LF5L 2Q2HA 1I94L 4A75A 1OXVA 4DV5L 4O0AA 1XJVA 4LUVA 1TWCH 3W5OA 2E5LQ 4LF8Q 4O2DA 1E7ZA 5LMNQ 1Q8KA 3S1MH 4JI0L 2UXCQ 2GN5A 4R4QA 3F8TA 1VQ9A 5LMUL 1M1KC 4LF8L 1RIPA 3MEFA 4EX5A 3F2BA 4A3FG 1VQ7A 4Y52H 4NXNQ 3H3VI 1IYJB 5C44G 2RHQB 4LFCQ 4DR4Q 3U58A 1TWGH 2NN6G 2YV5A 4R4IA 1OTCA 5GAGC 5IYCG 1EIYB 2R6GA 3UDXA 2JE6I 3AQQA 1OXXK 2R93H 3NELA 1EUJA 1X3FA 1N33L 2R92G 2VY3A 1TWHH 3STBC 3M7NA 2R7ZG 3CMEA 5IWAL 1PH2A 5C3EH 4BY1G 4B3RL 4AQYL 1VQCA 3UDFA 1IBKQ 4GN4B 1L1OA 4MTNA 1K8GA 3S2HH 4JG2A 3H15A 4A3KG 1WYDA 2WB1G 5M3FG 3W1BA 1JT8A 5IYDG 3UDGA 1BKBA 3F2DA 1B8AA 1VQOA 1CSQA 4DV2L 2BA0A 2KHJA 1K83H 4YY3L 2IHEA 4A3EG 1Q46A 1SMXA 4A3KH 4OONA 3AYHB 4DV3L 1Q7YC 4L5TA 3BJUA 4A3LH 1C9OA 3G71A 4A3FH 2B29A 1HZBA 2JA8G 1PYBA 3FKIG 1S72A 2Z0SA 4JI3L 1E3PA 4BA1I 1YHQA 1FL0A 4RMFA 4HJAA 4B3MQ 3RLFA 4LF9L 3KLWA 4JYAQ 5IP9G 3A5UA 4GLAC 3RN2A 1KHIA 4YWLA 4KHPQ 1MJCA 3HOUH 3M9BA 2R93G 4DR3Q 4GKKQ 3ICEA 3JC66 5BR8L 4WJ4A 1VQ8A 1WCMG 1N36L 1IBLL 1L1OB 3KJOA 2NVTH 2UXDQ 4DR2L 1IBKL 2DGYA 4DV6L 4QGUA 2ZTCA 2K14A 3GO5A 2AHOB 2ZM6Q 5JJIA 3GDEA 4DR2Q 4JBMA 2N49A 4XTCS 1KRTA 3PO2H 1N8RC 2EQSA 3ULJA 4A3DH 2GVAA 1BBWA 2RHSB 2I5MX 3S24A 1OXUA 3CF5A 1Y1WG 3BZKA 3ULLA 4IOCA 1VQHA 1HR0L 2OTJA 2HIVA 3HOYG 1X54A 2F52A 3Q8DA 3TQYA 2AKWB 4P75A 4OWWB 2Q2TA 1PVOA 3OTOL 3L2PA 3L7ZC 4C3IH 1PFSA 3KDFA 3FHWA 5IE8A 4JI3Q 1RL2A 5FLXc 5AJ3Q 4DV4L 3GTOH 3TREA 4DR1L 3CCMA 5LMUQ 1VQGA 1AE2A
chains in the Genus database with same CATH superfamily
1AP0A 3GV3A 5M5XH 4CDDC 2FMMA 3RNUA 1ASYA 4UPAA 3CMAA 4FF1A 1LTLA 1J8IA 4YCUA 3HOXG 3A7LA 4OIJA 1AZQA 1OXSC 3NP8A 5LL6X 2NVQH 1LT4D 3P7JA 2HUGA 3NTKA 2MGSA 1AZPA 1EL0A 2AWNA 1PRTC 1K0SA 4JI5L 2UUBQ 1XXGA 1N33Q 1LT6D 1PH5A 2JK8A 4LWCA 1EZ6A 4DV0Q 2SDFA 3S17H 1EWHA 4NDXA 3AU7A 2ALYB 1DZ1A 4ZYSA 1KNEA 4LFBL 1STEA 1HNZQ 5CV7A 4AIMA 1IXRA 1JWMD 1AN8A 4DV3Q 3Q22A 3CCJA 3R93A 4A3JB 2F0DA 1I6HH 2L15A 1JJ2A 3PGZA 4KY7A 1HHVA 3TEHB 2MUYA 1SNDA 2QGQA 1ZXTA 1R4PB 4IFDH 3AMUA 4KMUC 4X62Q 4JCVE 2K33A 3L9AX 2F4IA 2BOSA 5CV4A 1RF2D 4H44C 2WACA 4C3HH 2P5ZX 4IFDG 1TWCB 3TZDA 2C5CA 2J7ZA 1LLRD 1SLJA 3MTSA 4A3JG 3V96A 5FO8B 1MIUA 3PV0A 1EFWA 4LF4Q 2ES2A 1UWVA 4K2KA 4BY7B 1SFOB 2UXBL 1GXDC 1VQ4A 4UP7A 1GUWA 2X6LA 4RHRA 1HJPA 2WINB 3PF5A 1RTNA 4XQQA 3URYA 1XNRL 3VR3A 4QCLA 1AW7A 2DUDA 3CW2C 3LGJA 5K5PA 5C4JB 4MHEA 5CGKA 4LF5Q 4C56C 2B2WA 4LF6L 3MZ5A 1G6PA 1QWYA 1I5FA 3AEVA 1FJGL 1F2YA 3DWAA 1Q86C 3Q6SA 1K3BC 4JI4L 1TXYA 1D5ZC 1AE3A 1A2UA 1Z9FA 5J39A 1KC8C 5CC4A 5FJ8H 4X64Q 3LWEA 2KBNA 3DM3A 5FOBB 2QCPX 1UE1A 5E7NA 4YWKA 4XDXA 4DAYA 2XSCA 1TQOA 3RUZA 1VCIA 1NUCA 2WAQE 3E5SA 3TBIB 1Q12A 1IBMQ 3EJIA 1I4QA 4B9XA 1JMCA 1VQIA 3W1GA 1ENAA 3T1HL 1KQSA 4K6DA 2CW0C 2D0OA 1VQEA 3E3XA 3DMUA 3T1YQ 1GHKA 4ZKBB 4HR7B 2K6AA 3MWYW 4JVZA 1Y1WB 2F0FA 3G7LA 3HGBA 2H4OA 2E2JH 2OQKA 1VQFA 3H3VH 3FKIH 2EXZA 2LS01 5I2XA 5C4HA 4HMIA 1SE3A 3KYHC 1N32Q 5CORA 1MSHA 5JJZA 3SDZA 1RKNA 2R93B 4LAAA 1Y8NB 2A68C 4EGVA 2D5DA 3BVMA 5JEAG 2BDOA 1FYCA 3EBEA 5COYA 1LTAD 1LTRD 2XRSD 4ZLTF 3KLSX 1JR0D 1HFNA 3W2DA 1T5EA 1IYVA 2UUCL 2IPKD 1CQVA 1JE4A 1CKMA 4BBSG 3I91A 5M3MH 5CYUA 4EQ5A 5FLMH 1EIFA 4IJHA 4J8QA 2LSSA 5CR3A 3J80L 2E2HB 3S1QB 1A15A 1N34Q 2BCOA 3TP5A 4GNXC 2JA7G 1EWCA 1PZID 1T5XD 2FFKB 3KFUA 1L2FA 1G51A 3GTPB 1TKWB 1Z7TA 2E2HH 2PZTA 1I4PA 1TS5A 2L4NA 4IPCA 3SE0A 2KEDA 1BCPC 2EY6A 2QF7A 2EZVA 2EDGA 3BU2A 3CPFA 2YTYA 2F3IA 1B70B 4JI2L 1UE7A 1X3EA 2K50A 4KN7C 3K5LA 5I4DA 1STGA 5HGTA 1PH1A 4A3LG 1Y1VG 4AYBB 2PPBC 2KCTA 1XPRA 1H9RA 3SR1A 3NSWA 4IPDA 2XRQD 2ZXPA 4X3UA 5CV6A 4H13C 4IJLA 3GTOB 2B2YC 2BH8A 3PO3G 1TIID 3DWPA 4LJZC 1TY0A 4K0KQ 2ZT9C 2JP1A 2NZ1D 5KGUA 4L5SA 4DR3L 3GTMB 4GKKL 4KHPL 1CT1D 3OHXC 1SEBD 4JI1Q 1NR4A 4RWSC 2GVBA 5IGGA 1RCVD 2DY8A 4PQXA 5DNFA 4RG1A 3VA7A 4J1MA 3MFGA 2OF1A 3KF6A 4FXGC 2NVXB 1L0WA 2B63B 1UNSA 2B63G 1YJ9A 1O7YA 5JPMC 3CXCA 4DNRB 2K52A 4DV5Q 1KD1C 4MNOA 3TRZA 1D8LA 2PQEA 1O7ZA 1E2VA 3NHHA 3D3RA 4XQNA 4GNXA 1VQNA 5HGQA 2B2YA 1W3SA 1CK1A 1JJGA 1XTDA 2A73B 3HKZG 4UP8A 3S9WA 4JI5Q 4ZKCB 2L12A 3FRPB 1MHWC 1HR0W 1P8LA 1ICFB 3KBGA 2JA7H 3DLLA 2J0TD 1X3GA 3RN5A 4WJ3M 1BF4A 4JYAL 2GA4B 1X56A 1EFID 4JI7Q 1CZGA 1U4PA 2EJFC 2F0VA 4BBRG 4X66L 1Y1VB 4AYBG 1PH4A 2B39A 4G7HC 1STAA 3T1YL 1KAWA 1NMGA 2MHVA 5C4XH 4GNXB 1HA5A 2RCNA 3BDCA 4LFBQ 1TWHB 2G9HD 3OW2A 4DV2Q 4HJ9A 5IP9H 1M4VA 5GADC 4R4OA 1XPUA 2CVRA 2N3SA 2HIXA 3HKZE 4N8FA 5AFWA 3HOWB 5EKKA 5IYBH 3NBHA 3HOWH 1BVSA 1K3RA 4FF4A 4ULLA 2Q2IA 3CD6A 4DR5Q 1ET6A 1Q82C 3CC7A 3A8IE 1PYSB 2C35B 3MXUA 1D5XC 3J7ZC 1X32A 3J80E 3CCEA 1Q90A 4LFCL 2CWPA 5ELNA 1YEZA 1PYWD 1SYGA 3KK7A 4RGNA 1HCZA 5M5WH 4MIUA 4JI6Q 4CGYB 2XNAC 3M4OH 1PDQA 5GQOA 4BBSB 4B9WA 4K8JA 4C3IB 1WTOA 2NZOA 3CRLC 2WKCA 4DV7L 1OXTA 1JB3A 2EYHA 1S5DD 3NWSA 4F7XA 3EIVA 3G4SA 4BBRH 1QVGA 4BBSH 4K2LA 4LW1A 4GKJL 5CV5A 1CA6A 1S4ZA 2MFIA 4HMJA 1SFOH 4O42A 2YU9B 4JI4Q 4LF7L 5DEHA 5EGTA 4FVMA 2EE1A 2HT1A 1VQKA 1VF7A 2E5LQ 1TWCH 2PCFB 3I90A 3W5OA 1SJED 2Z8LA 2UXCQ 1TS4A 2PYKA 4Y52H 4CKBA 4UHVA 2C9OA 2V4DA 3H3VI 5T1GA 1GUGA 3Q24A 5C44G 4HN7A 4LFCQ 1TWGH 1PTOB 1FD7D 2NN6G 2YV5A 3ZYYX 4DAVA 5GAGC 2R6GA 1JORA 3X3MA 5IIFA 1X3FA 2RQXA 4L63B 3IFTA 4IUTA 1WTRA 1B50A 1JWSD 1CA5A 4B3RL 3UDFA 4GN4B 1C4QA 3S1NB 1EU4A 2WKDA 5FK9C 2IWHA 4KD3A 3H15A 2WB1G 3W1BA 1BKBA 3OIQA 1EOTA 3SK6A 2NTSA 5E4XA 2K04A 4A3LH 2D9UA 2NVTB 2B2VC 5KNBA 1E3PA 1YHQA 4B3MQ 1HQRD 5T1IA 4KD4A 3RN2A 4YWLA 1MJCA 1NSNS 3H0GB 1N36L 1IBKL 3GO5A 1S5FD 2AHOB 2KA7A 2ZM6Q 4JBMA 1KRTA 1EYAA 5M3MB 4A3DH 3OMCA 3EFXD 2E76C 3CF5A 1EY4A 3BZKA 3HZXA 2OTJA 1FGBD 3HOYG 3MEHA 3Q8DA 4KKUA 3L7ZC 1JOQA 4C3IH 1K28A 3KDFA 1B2TA 1RL2A 4K5XA 3CCMA 3SK4A 5LMUQ 1VQGA 1VQOA 5JOBA 2QW7A 1HUMA 2VB2X 3D4DA 1WD1A 3WOEA 1PH8A 4A3BB 2CKZB 1TWFB 2WB1E 4DK3C 4G7ZC 2JA5B 3ERQA 4JI8L 1NTGA 5EPLA 1DD2A 1I4HA 2A6HD 4QUCA 4A93G 1QZHA 4ZUJA 3U4VA 1Z47A 4GN3B 1HNXL 1SN8A 2K5DA 1KL9A 4NMZA 2MP1A 3I70A 2B2UA 5ELBA 4HJ5A 2F4VL 2H5XA 2JYOA 3E0EA 3J81L 3KF8B 1GD7A 2M00A 2BDNA 2O4XA 1F2MA 1MI2A 5I2YA 3R8BA 3KUPA 5FKAC 3KLSA 2F0SA 2OQ0A 5KYLA 5JJKA 1H9SA 3HOYB 1SMYD 1WJJA 2SOBA 2OWOA 1Y14B 3HOVB 5M3MG 3A7AB 4B08A 3HS0C 4F88A 1WVLA 4X65Q 4DR5L 1RTOA 1ZKOA 3UDIA 3K0YA 2R7DA 4OX9L 1H9KA 4CJ2C 2G5DA 3HRZC 1BO0A 2FHTA 2PZUA 1MKHA 1CQFA 3NUCA 1EY6A 5J22A 2KUMA 1DOLA 3FDTA 4DF7A 4A3EH 2JEBI 3U50C 5FLXE 5JAVA 5IT9E 3HOUG 5M5YB 4RCOA 1SAPA 4DR7Q 3FMCA 3G6EA 2E2IB 4YCWA 2WB1B 4JI1L 4NXMQ 4EQPA 4OO1H 4I7ZC 3DHQA 4KTAA 3SK8A 1JC7A 1D6EC 5BN5A 3J7A5 1SE4A 3I2ZA 3S16H 2R7ZB 4DK6C 4GOPB 4G7OC 2DJFC 2F0TA 4OIKA 1F2LA 3QWNA 1DM0B 1I3QB 5F2DA 4A93H 2VB3X 4PMCA 4P71A 1ENCA 2SEBD 4HEDA 1LTTD 2A6HC 4A3FB 2YTXA 3QJYA 3M4YA 3SEBA 3A0JA 5C0XJ 5GROA 3S14H 4DV1L 3S15B 1BCPF 4MTKA 1IW7C 1NBWA 2DNCA 1SYDA 1X9NA 5JEAJ 3I72A 1SBBB 4WFN3 1PH6A 1HFGA 1QNUA 3FP9A 1YNND 3I4NB 1JB7A 3K80C 3S17B 2MNAA 1LT5D 4P72A 4NW2A 1BXTA 1IZ6A 4ZAIA 4RGMA 2IL8A 3MVVA 2KCCA 1YITA 2LXKA 1TS2A 2CFMA 2AUKA 3PF4A 2KVMA 1YNJD 1VQLA 3S1RB 4XYOA 4O1NA 3A8JE 2JA8B 3S1RH 4JBJA 2ATWA 1STNA 2FXQA 3KDFB 3TDQA 3OTOQ 2L55A 1NCVA 2XWJB 5C0XG 4PMWA 2UUCQ 3A54A 4JBWA 3CCLA 2K7VA 2RA4A 4A3EB 4ALPA 2CH4A 2K5WA 2QEXA 4CDCC 4DUZL 5I6WA 2F03A 4A3CG 4UAIA 2NN6H 2XGTA 1EY0A 4X3TA 3CCUA 2K5VA 1VQBA 1B9MA 4ODGA 4A4IA 2QEJC 1KAAA 3NWTA 4A3IB 4QQBX 4YCVA 2B2WC 2ID0A 1XPOA 4R9WA 1RJTA 1CKOA 4M1UB 1T9HA 3GTKH 2KECA 3F1ZA 3PIOA 2IY5B 1HRJA 1CSPA 2YTVA 1HZAA 1VQJA 2VS1A 1HNZL 2M2LA 3KF6B 3SHLA 5EKLA 1AH9A 3AFPA 3DEOA 2JA6G 2HHHL 1N9WA 1X65A 5ELCA 4B3SL 3TS0A 1PRTD 1V1PB 5HURA 2R92H 3MAQA 4P74A 2XIWA 2F3VA 2UXDL 1UE5A 4AYBE 3S2DH 1E2WA 1DXMA 3CCRA 1YI2A 2E2IH 1JOKA 2VUMG 3OSOA 2FJ2A 1SYEA 2F0IA 1I4RA 2HDMA 3H94A 2I5LX 1I50H 2JXMB 3O13A 5JPNC 1SE2A 3IKJA 5KNDA 3BYYB 4K8IA 3J7AV 4K5VA 4LUZA 5FJ8G 4JBKA 3I55A 5LMNL 1S5CD 2E5LL 3OIPA 2NWGA 3H91A 5C5LA 1PA6A 2O5JC 3M3YB 1RD9D 1VF5C 4GS3A 1QNKA 4UDUC 1K8AC 4XXEA 2YYZA 3S15H 1HNXQ 1XMOL 1IBLQ 2OT2A 3NTHA 4DA2A 1ENFA 2PMZE 4PZ6A 1H9JA 5IYDH 1B44D 4JC0A 3K5NA 1U4RA 3Q23A 3U4ZA 1TVXA 1J5EQ 2XTIA 3VYRA 3DWQA 1KIXA 4OO1G 3I4LA 3GTPH 3OPOA 1F9RA 4FO2A 1XNQL 2F0NA 5C6AA 4L8JA 4MN3A 2LKVA 1Q8IA 3MXNB 1DOKA 3EN2A 1SXTA 3E9HA 2NVXH 4GLXA 1SROA 3QG1A 3M4PA 2BE5D 3NENA 4HAEA 2AWOA 5I6YA 2XN9C 4R8IA 4OL7A 3D31A 1E24A 2L0CA 2NVYH 3OWFA 3GQBA 4U673 1QUQA 4LFAQ 4LF7Q 2RBMA 1WTPA 1EIHA 1KDAA 3R2TA 1LO5D 1HTLD 3GTLH 4PZ8A 2N78A 4X65L 2LFNA 3NBHB 4X62L 1PHJA 3L3OC 1UAPA 3MHBA 2UUAL 2VNUD 2V1CC 2E2JB 4H7BA 4M8AA 2EJMA 4RFBA 5EKIA 2SNSA 3MC0B 5C0XI 5K36G 4DR1Q 1E1TA 1B3QA 3S1QH 4ABNA 2K4KA 1HQMC 3PCOB 2O5IC 4IPHA 3RR5A 4JK1C 2Y0SB 3NQTA 3PO2B 4H0LC 1IL2A 3K7AH 1LTID 1NMFA 4A3DB 1W2BA 2RDGA 4JOIC 3P75A 1XTCD 1IW7D 2O2LD 4R4TA 3CQZH 1DONA 1B7YB 4GKJQ 4C2MB 1KRSA 5KEEA 2VZAA 5ELFA 1PRTB 1WTQA 1GHJA 3SXHA 1I94L 4DGZA 4N8X1 1RHPA 1B53A 3BYTB 4LUVA 4O0AA 2F0KA 2NTTA 1F9PA 5LMNQ 1CI3M 4JI0L 3VR2A 3FPUB 3KBXA 5LMUL 1M1KC 3MEFA 4NXNQ 1KTKA 3J7YW 1MD2D 3K57A 1PZKD 2NVQB 1KLGD 3NELA 3RD4A 2VY3A 3STBC 3TSSA 3PQIA 4HSVA 3WDNA 5JVH3 1QB5D 3K5OA 1PH2A 1XX8A 4KJOA 5IGFA 4AQYL 1VQCA 5E3FA 1L1OA 4MTNA 1I4GA 4KK7A 1K8GA 1TY2A 3IL8A 2F0UA 4ID6A 1X3PA 2B2UC 5M3FG 4EQOA 2X6GA 3P20A 1F9SA 4X3SA 3UDGA 1SNMA 3D4RA 1B8AA 1I6VC 3F2DA 1CSQA 5JEAH 2BA0A 5EPKA 2M9VA 1Q46A 1SMXA 4QMGA 1Q7YC 3ND8A 4L5TA 4XT1B 5FO7B 3G71A 4A3FH 1PTOF 2JA8G 1ESRA 1HZBA 2ICIA 2Z6BA 4HJAA 5C4XB 4LF9L 1LTSD 2ZXRA 1OO9B 5J1ZA 1KHIA 4KHPQ 2FMCA 1VQ8A 2K32A 2K01A 4C3HB 2UXDQ 4XYQA 2AUJD 3UI2A 4DR2L 4DV6L 4QGUA 3N52A 5IGEA 4DR2Q 1QJOA 2N49A 1B1ZA 1M8AA 1PRTF 4XTCS 2GVAA 2KHSA 1KABA 3A8KE 4Q0FA 3ULLA 1HR0L 1AFPA 3TQYA 3NQIA 2RCFA 3OTOL 4J6HA 3FHWA 2EY1A 4DR1L 3NPPA 4LF8Q 1I3QH 5M5WB 1WTVA 4CBVA 3J81E 1ILQA 1C7YA 1ZYRC 3PIO3 1SSOA 4A3MH 4YY3Q 5E4WC 1J5EL 2ZJQA 1D2BA 1E1OA 5GAHC 4KKTA 3E9IA 4R1JA 1BR9A 3TN2A 1EY8A 2RF4A 2K75A 2MPMA 3A55A 5EBCA 3RLNA 3H09A 1UEAB 3PUWA 3S1MB 2NZHA 3D8GA 3IRBA 1N34L 1L1OC 2F0LA 4BA2I 3Q0AA 3IAYA 5C3WA 3K5MA 2CQAA 1GO3E 1R9TB 3HOUB 2AQ1B 1IBML 4JI2Q 4NXNL 5EBDA 1R9TH 5C3EB 1LTGD 1W6KA 1XNQQ 5A2QL 4RH6A 4QIWB 1G2SA 4X66Q 3T4AC 4JI7L 1SRUA 4N9PA 1Q1BA 2NVYB 3A56A 4JV5Q 1IL8A 4K0KL 3F2UA 4R8NA 1S40A 4B3RQ 1JJCB 4DUYQ 2WP8J 4KKSA 2D0PA 4PG3A 4LFAL 2N55A 1II3A 4ME3A 1TR5A 1WOCA 5ELOA 4DAMA 1EOVA 4RA8A 3J81c 1QZGA 3FKIB 1KDBA 2KENA 1V1QA 4DV7Q 4FF3A 4E6IA 5C3EG 1PXUA 4BWGB 5A2QE 3G48A 4PZ7A 3J81i 1STHA 1E22A 2Z4HA 2NN6I 5L37A 1Y8OB 3ULPA 2IJ0A 3A74A 2F0QA 1AEXA 2PZWA 5C44H 1K83B 1WTWA 2D62A 1SDFA 2ZXOA 1YNNC 4HJ8A 1HZCA 2RDHA 3BVGA 1EY5A 4JOIA 2RVLA 4A3GH 3HOVH 3GTGB 1QCBD 3GTJB 3T13A 4BY1B 1V9PA 5DAUA 1VQDA 3BZCA 2R92B 4KN4C 3SK5A 4GN5A 2HD3A 2PQAB 3GTQH 2IX0A 3ND9A 5G3LF 2A5HA 2QA4A 2K28A 4IFDJ 3VR6A 4A3BG 3GTJH 4BY1H 4HCSA 2IHFA 2B3GA 1VQAA 4G57A 1VQPA 3BS1A 1SMYC 3GTLB 1ZYRD 4GOPC 3H3VC 3W3AA 3VDYA 3BVZA 2VW9A 5ELDA 4XQJA 1WI5A 1SR3A 2UUBL 5M9OA 4C1NI 2CCZA 4U68A 3I8ZA 3PIP3 2AQ3B 3I56A 3CC2A 3HOZB 1QOHA 4POFA 3WOFA 1HA6A 1X55A 5BN3A 1JOOA 4NPSA 3NTIA 3H0GG 1GJXA 4Z9CB 2MJ8A 4DAYB 2CWAA 2A69C 1EYDA 1GUTA 3VYUA 4HCEA 1EWIA 2VQFQ 4IOAA 1JE5A 2Q8IB 1LT3D 5C4XG 1B4OA 4GOPA 5KRUA 1G6ZA 1CTMA 5IODA 4L5RC 2HCCA 2UU9Q 1A6XA 4A3JH 4DV0L 3RLOA 3I4MG 1CZWA 3L0OA 4FDBA 2EVBA 2LMCB 1PH9A 4OX9Q 2Q2UA 1WTXA 5CMDA 1U5KA 5M3FB 4OGQC 1A0IA 1G2TA 3PSIA 5C3XA 4NB3A 3I4MH 2OTLA 2I0QA 4AH6A 1G291 5IGDA 1GKHA 3PUZA 3PIPA 1TU2B 3RMHA 3AB9A 1WTHA 2DNEA 2G9DA 1A63A 3D0FA 2PI2E 2Z9HA 5EAYA 5E1FA 3SGIA 1WCMH 4WRDA 1LUZA 1XWEA 3HKSA 4KLKA 2RKSA 1U9RA 1P16A 1PMRA 3PUYA 2VQEL 1BUVT 3WWVA 3TP6A 1BBUA 2IX3A 3K59A 4ME5A 2WV6D 4QIWE 2HHHQ 3FEWX 1VQ5A 2KCMA 1DGSA 1SNCA 2PW5A 2WAQG 4C3JH 3GD7A 3NK9A 4A3MB 4F87A 1O7IA 5ELEA 4C3JB 1FNVA 4AQYQ 3J80i 5J3BA 1N32L 2N88A 1RODA 5EJWA 1QUQB 1EYCA 4QY7A 1DJRD 4L5QA 1KDCA 4LF6Q 3DUZA 4A3DG 1GUSA 3PO2G 4OEMB 4CJ0B 1QG7A 1GVPA 3GTKB 3OMGA 3M85A 2E74C 5AJ3L 4DV4Q 4C3IG 1EU3A 2K5NA 2X69A 2AMCB 4IFDI 1PFBA 1XMQQ 1ET9A 1CHPD 2KQ3A 2TSSA 2TMPA 2EJGC 3N6RA 2ZTEA 3CHBD 1VQMA 2PQAA 1J6QA 1XYIA 2Q8RE 1S3OA 4F8MA 1PV4A 3R2IA 1QE6A 5D14A 1UE6A 4YHHQ 2XVSA 3PUXA 2A1AA 4DXGA 4A3MG 1D5MC 1JWUD 2WAQB 4DXFA 2JSOA 1HNWL 1HUNA 1YNJC 4DR7L 1UEBA 3NE5B 2R7ZH 4BY7H 2UXCL 4H02A 4B3TL 4FF2A 2F0MA 2UU9L 1ILPA 2I07B 2E8GA 3K81C 4K5WA 4HSPA 5I9OA 2JQOA 3JAME 4DNIA 2QDBA 2EYPA 4FNFA 3K0XA 2EXDA 4OWXB 3ZJYC 5IGBA 4HIMA 4R4CA 1F9QA 3M7GA 3M3YH 4IUPA 2KCNA 3S14B 3X3NA 4QB4A 3MFYA 2KHIA 2RSNA 2ENBA 4YIJA 5BN4A 1A62A 1YHAA 3NEMA 4NXML 1NE3A 4DR4L 3I4MB 2KEEA 3EA6A 1K8MA 3I4NH 4B3TQ 4DAPA 1X6OA 4Y7NB 1EQTA 2L9HA 1GM5A 3OWEB 2CH4W 1A3VA 1NY4A 2DJGC 2EPBA 3PMFA 2UXBQ 1NR2A 2N8NA 3KF8A 5CBAE 3E0JA 4IURA 4RKBA 3STBD 2QILA 3BDLA 4NKLA 4DUYL 5H1SE 1BCPB 4HIDA 4DR6Q 3DXJC 1NNXA 3HOZG 3PO3B 2PO4A 4IUUA 2QKIC 1HXYD 1KNAA 2F0GA 1Y69U 4LF5L 4GZYC 4A75A 1TT2A 1XJVA 4DNTB 3I3CA 4O2DA 1E7ZA 1Q8KA 3S1MH 2Q8TA 2GN5A 3F8TA 3EROA 4ZQ3A 4LF8L 4ILWA 1RIPA 1E0BA 4KJNA 4NP5A 1VQ7A 5NUCA 2F0HA 5CV9A 3D4WA 4DR4Q 4R4IA 1STYA 3C1FA 1EIYB 3UDXA 3AQQA 4S3SA 1Y8PB 1N33L 2R92G 5K36H 5C3EH 3T16A 2AQ2B 1PTOH 3GV6A 4QF4A 1I50B 4A3KG 2KOLA 2F0WA 4CDFC 4YY3L 2IHEA 2E2DC 4A3EG 3S2DB 4A3KH 4OONA 3AYHB 1CM9A 4ZCKA 1C9OA 1O7LA 3LX0A 2B29A 1D1KA 1PYBA 2Z0SA 4JI3L 4BA1I 4RMFA 1D1IA 3RLFA 3VR5A 5IP9G 3A5UA 3M9BA 4DR3Q 4GKKQ 3JC66 4WJ4A 5ISRA 1WCMG 2L1BA 1IBLL 4OELB 1O80A 1L1OB 3KJOA 3GP7A 1BCPD 1PLFA 1S5BD 3BG3A 2NVTH 2DGYA 3DM1A 2HDLA 2ZTCA 2RSOA 3LNNA 2B2VA 3PO2H 2BE5C 2EQSA 3ULJA 5CV8A 1BBWA 1O78A 1Y1WG 1OXUA 1Q3LA 4IOCA 1G8ZD 1VQHA 3NXWA 2F52A 4P75A 2IW3A 4OWWB 5JVG3 5AJ3Q 4DV4L 3TREA 2K03A 1SNQA 3VYSA 5FLMG 1MJEA 1AE2A 1A8VA 4DPGA 5IP7H 4OO1I 1ML0D 5IY0A 1WD0A 1ESFA 4CHTB 3FVQA 4A3BH 3KOJA 3QOLA 1QVFA 3J81j 4L6TB 4DK0A 3BDOA 1G91A 2D2CC 1PH7A 4DR6L 2A68D 3NBIA 2JN4A 1SYCA 4DK1A 4DV6Q 1BBXC 3QOJA 1H95A 1U0LA 2OXPA 1B3AA 1EQRA 2EYMA 4OHJA 4C2MH 4ZUIA 4RGOS 1LM0A 3CCQA 2Z6KA 2F0OA 2Y0SE 4XIGS 2EOTA 5KIXA 3J80c 1ASZA 4DU9A 2VQFL 4BY7G 5M3FH 1HNWQ 3K7AB 1ZEQX 2SNMA 3UE1A 4APVA 3MXPA 5EPJA 2Z1CA 1V8QA 4LUOA 2K5QA 4LK1C 4DKAC 2HQLA 2PI2A 1W6JA 5TSSA 4EQNA 1A3TA 4TRDA 1V1OA 4C3HG 4YHHL 1WCMB 2A74C 4BXXH 5IT9c 1VS0A 1TWAB 1BQQT 3HOVG 2I46A 1EY7A 3CP0A 1SYFA 5LMNW 1GOZA 2KJXA 4WJWA 4RHSA 2JA6H 2PNHA 3U9SA 4K14A 4DN4M 2ZTDA 2NYZD 4A3CH 1D7QA 1TWAH 4UP9A 4OWTB 2VQEQ 3QR8A 1BDOA 2EYJA 2QDLA 4QL5A 2EY2A 3T51B 2PNRC 4IUQA 1Q81C 4A3KB 2UUAQ 5CBEE 4CKEA 2IX1A 2JA8H 4IPGA 4Y7NH 4JV5L 4KV6A 4IZ8A 1EYGA 1EY9A 5M5YH 5C4ZA 1YVCA 2F0PA 2JA9A 4TQUS 2I5HA 2CHBD 4CJ1B 1YJWA 1LABA 2CW0D 4V0BA 4X3KA 5DM63 1HH2P 4A93B 3PO3H 2BA1A 2K1BA 1CKNB 2A6EC 3EQLC 4ZK9B 2OCEA 1LV9A 4J15A 1HTPA 5A35A 3HOXB 3HOZH 4TVAB 1LYLA 3RZOB 1U4LA 2JA5G 3JAMi 1C8CA 4I65A 3T1HQ 3ONAB 3HFZB 3K7UC 1BNZA 1C48A 2JJQA 4JPBW 5KYIA 2CQOA 5C5MA 4LF4L 5IT9L 5FLXL 4KI0A 1U4MA 2FINB 3B6YA 1F77A 2WFWA 2LXJA 3D6CA 4JI6L 4BS9A 3CU7A 3K58A 1NAPA 4X64L 1K9MC 1LACA 4POGA 2R61A 1STBA 4XT3B 3GTQB 2VUMH 3IFDA 3D6WA 3OOCA 1C0AA 1PZJD 1L0XB 3I4OA 3KLRA 1R4QB 1JICA 2Y0SG 4G4KA 1V43A 4EVOA 3R3OA 4P2CB 2B8GA 1V1PA 1ONLA 2E75C 3ERSX 4B3SQ 4DFAA 3RZDB 1XMQL 1VMCA 5IYBG 1VQ6A 2LY7A 4KY5A 1EZ8A 2JEAI 1IYUA 3UE0A 1PFNA 3P1HA 3ER0A 3TMEA 3F2CA 2Z6KC 1K73C 2ZM6L 1EQQA 4HIKA 3CC4A 1FNUA 1CUKA 2R7FA 4Q5VA 3EVQA 4KHZA 3QIAA 1Y1VH 3KJPA 2MO1A 3G6JB 4IO9A 3I73A 1PFMA 3C2PA 3T56B 1GUOA 4B3ML 3GTGH 5HY6A 1PTOC 3CCSA 1H9SB 2A8VA 2PW7A 1NJIC 5IYCH 5C44B 4A76A 4DV1Q 3VYTA 5JJLA 3BZDB 3CPWA 3RZOH 1E2ZA 1DCZA 5C0XH 5EQ0A 1SE8A 1HR0Q 1UUPA 1TWFH 2B2TA 2JA5H 3CAMA 5IP7G 5GAEC 5LL6S 3MXGA 2B63H 3OW7A 3PUVA 4FXDA 1HZ9A 3OYYA 3C1EA 1FVIA 4V190 5C4JH 1FR3A 2A6ED 4FXKC 1YNXA 4TSSA 4A3GB 4KY6A 4X6AH 3RZDH 3TS2A 1I6HB 4KHVA 2F3WA 4HTHA 1YBYA 1FNWA 1B9NA 1Q1EA 1QILA 4TKOB 2L5TA 2EIFA 3H0GH 3AFQA 3HOXH 1I94Q 2YU9H 3J7AF 2VUMB 3C3LA 1YZ6A 1MSGA 3HG9A 1JCKB 3K6OA 4CKCA 4QJFA 1SYBA 4YWMA 4BXXG 5IWAQ 1KXLA 1LTBD 1N36Q 5BR8Q 3U9OA 2ICEC 4GLVB 1FJGQ 2VL6A 2XWBB 1X3QA 4C3JG 4A3IH 1GUNA 4JI8Q 4HIOA 4IUVA 4LF9Q 3HOWG 3H6MA 3S2HB 1QVCA 4DUZQ 3E6ZX 4RAUC 3M4OB 1K0RA 3JAML 2NUCA 3S1NH 3CQZB 1YHBA 5DM73 2JA6B 1K8OA 4JI0Q 5KNCA 3MA2B 3I7FA 4MZ9A 1IKMA 1J9OA 5I9PA 2EYLA 1S5ED 5IGCA 1Y1WH 3JAMc 3CCVA 4BBRB 4IQZA 1YJNA 4RCNA 2EY5A 1JQYD 1I4XA 2B2TC 4CDEC 4A3IG 4FYDA 2K5HA 1M90C 2MQHA 4QUFA 1TS3A 1HPCA 3VA5A 1WFQA 1ICWA 3HKZB 4FP5D 4I7AA 3CRKC 5M5XB 1YIJA 2DN8A 1L0YB 5IOCA 3M4QA 2PMZB 4OXPA 1XNRQ 2A19A 5DLQE 1FGUA 1CKNA 1PH3A 3S16B 2BH2A 2ZJPA 3A5ZB 1TWGB 1A3UA 3T53B 4UY8C 3LWUA 2K05A 4ZRZA 1EEFD 3GTMH 4P73A 2Z4IA 2ASBA 3K8AA 3HOYH 3MXNA 1Z6HA 1XMOQ 2L11A 2F4VQ 1DOMA 4A3GG 3I4NG 4HJ7A 2VXWA 2HCIA 2MO0A 3SVMA 3VR4A 4JW0A 2ZJRA 3TP7A 4LMQD 4C1NK 2IT1A 1SNPA 2Q2HA 1OXVA 4DV5L 4R4QA 1MBYA 1VQ9A 4PNYA 4EX5A 2B8FA 3F2BA 4A3FG 1A2TA 1IYJB 2RHQB 3U58A 4PV1C 1OTCA 5IYCG 1BOSA 4K6LA 2JE6I 2R93H 1OXXK 1EIGA 1EUJA 1TWHH 3M7NA 2F0JA 2R7ZG 3CMEA 5IWAL 2H1EA 4BY1G 2J4XA 5FO9B 2WIIB 1IBKQ 3DEPA 3FPPA 3S2HH 4JG2A 1WYDA 2OEOA 1JT8A 2EYOA 5IYDG 4PMBA 2JA7B 4DV2L 2NBFA 2KHJA 4IALA 1K83H 3HEJA 4N9TA 1CHQD 2NB0A 4DV3L 5D3DA 4RGTA 3C46A 3BJUA 2R3ZA 2RDFA 1KLUD 3FKIG 1S72A 2HQEA 5G3LD 1FL0A 4IN3A 3HP3A 3V2TA 3TZUA 3KLWA 1EEID 4JYAQ 4GLAC 3HOUH 2R93G 3ICEA 1VMPA 2F0EA 4WORA 5D3IB 5BR8L 1IKLA 2EYFA 1PTOD 2A69D 2K14A 1SJHD 5JJIA 1RDPD 3GDEA 1EQVA 1F2ZA 1VDZA 1N8RC 1MGSA 2I5MX 2RHSB 3S24A 2HIVA 4RKLA 2DY7A 1SNOA 1X54A 3V05A 3CKIB 3QO2A 1DYQA 2AKWB 5D65A 4IUNA 2Q2TA 1PVOA 3L2PA 1IHZA 1PFSA 3TP8A 4JI3Q 1CFMA 1H9MA 5LHY1 5FLXc 3GTOH 4LNQA 2F1MA 5IE8A 3QB3A 3ITPA
chains in the Genus database with same CATH topology
1A8VA 4DPGA 5IP7H 5M5XH 4OO1I 1PH8A 2CKZB 1C7YA 3RNUA 5IY0A 4DK3C 2WB1E 1ASYA 4UPAA 3CMAA 1LTLA 4A3MH 4YY3Q 2UU9L 4A3BH 1J5EL 4YCUA 3KOJA 3HOXG 4JI8L 1NTGA 1E1OA 2ZJQA 5GAHC 1OXSC 1QVFA 3E9IA 3J81j 2NVQH 4R1JA 4A93G 1QZHA 3U4VA 1Z47A 4GN3B 2RF4A 2K75A 1HNXL 3RLNA 1PH7A 1SN8A 2AWNA 4DR6L 1KL9A 4JI5L 3PUWA 1H95A 4DV6Q 2NZHA 2UUBQ 4HJ5A 2F4VL 1U0LA 2H5XA 1I3QH 3IRBA 1N34L 3E0EA 1N33Q 1L1OC 4BA2I 1PH5A 2JK8A 1EQRA 3KF8B 4LWCA 1GD7A 4DV0Q 4C2MH 1LM0A 3S17H 1GO3E 2ALYB 3CCQA 1IBML 2Z6KA 4JI2Q 4LFBL 4NXNL 1HNZQ 1R9TH 2Y0SE 4AIMA 4XIGS 1IXRA 2OQ0A 3J80c 1ASZA 2VQFL 5JJKA 1XNQQ 4BY7G 5M3FH 4DV3Q 1HNWQ 3CCJA 3UE1A 1WJJA 4APVA 4X66Q 4JI7L 2OWOA 1Y14B 1SRUA 4LUOA 1I6HH 1Q1BA 2L15A 2HQLA 4DKAC 5M3MG 3PGZA 1JJ2A 2PI2A 3TEHB 2QGQA 4JV5Q 4X62Q 4JCVE 4K0KL 4X65Q 4YHHL 4DR5L 3UDIA 1S40A 4B3RQ 4BXXH 5IT9c 1JJCB 4C3HH 4DUYQ 1VS0A 2WP8J 2D0PA 2R7DA 4PG3A 4LFAL 4OX9L 4IFDG 3HOVG 1SLJA 3CP0A 4ME3A 4A3JG 1WOCA 5ELOA 4DAMA 5LMNW 1EOVA 3J81c 1MIUA 3PV0A 1QZGA 1EFWA 4LF4Q 2ES2A 1UWVA 1MKHA 2JA6H 2KENA 1V1QA 2PNHA 4DV7Q 2UXBL 5C3EG 3G48A 4PZ7A 2ZTDA 1VQ4A 4UP7A 4A3EH 2JEBI 3U50C 3J81i 4A3CH 1D7QA 1E22A 1TWAH 1HJPA 3HOUG 4UP9A 3PF5A 2NN6I 4OWTB 2VQEQ 3ULPA 3A74A 4DR7Q 1XNRL 5C44H 3G6EA 4QL5A 4YCWA 2D62A 1Q81C 2UUAQ 4HJ8A 1HZCA 2IX1A 2DUDA 3CW2C 3LGJA 4IPGA 4JI1L 4JOIA 1MJEA 4LF5Q 4LF6L 4NXMQ 1G6PA 4A3GH 4Y7NH 3HOVH 1I5FA 3AEVA 4JV5L 1FJGL 1EYGA 1Q86C 3J7A5 1V9PA 5M5YH 1YVCA 4JI4L 2JA9A 1VQDA 2I5HA 3I2ZA 4TQUS 3S16H 3BZCA 1TXYA 4DK6C 1AE3A 1YJWA 4GOPB 1Z9FA 1HH2P 1KC8C 3PO3H 2BA1A 4GN5A 5FJ8H 1CKNB 4X64Q 2OCEA 2KBNA 2PQAB 3DM3A 4J15A 4A93H 3GTQH 4TVAB 2IX0A 3HOZH 1UE1A 5E7NA 1LYLA 4P71A 4YWKA 2QA4A 2JA5G 3JAMi 4IFDJ 1VCIA 3T1HQ 2WAQE 4A3BG 3GTJH 4BY1H 2YTXA 1Q12A 1IBMQ 3HFZB 3A0JA 5C0XJ 3K7UC 5GROA 2IHFA 2JJQA 2B3GA 1VQAA 1VQIA 2CQOA 3W1GA 3T1HL 1VQPA 1JMCA 4DV1L 4LF4L 1KQSA 3S14H 4GOPC 4KI0A 3B6YA 2D0OA 1VQEA 2WFWA 2LXJA 3T1YQ 4JI6L 3VDYA 2VW9A 4X64L 1NBWA 1SR3A 1WI5A 2UUBL 1X9NA 5JEAJ 1K9MC 2CCZA 4POGA 1PH6A 3I56A 3CC2A 4POFA 2VUMH 3FP9A 2E2JH 2OQKA 1VQFA 3H3VH 1X55A 3FKIH 4NPSA 1JB7A 3K80C 3KYHC 2MNAA 1N32Q 3H0GG 4P72A 1C0AA 1IZ6A 3I4OA 4DAYB 2CWAA 2Y0SG 1YITA 5JEAG 1V43A 2LXKA 3EBEA 1EWIA 2CFMA 2VQFQ 3PF4A 4IOAA 1JE5A 1VQLA 5C4XG 4GOPA 2UUCL 3ERSX 4B3SQ 3S1RH 4JBJA 2ATWA 2FXQA 3KDFB 1CKMA 4L5RC 4BBSG 5M3MH 3OTOQ 1XMQL 2UU9Q 5IYBG 4EQ5A 5C0XG 4PMWA 1VQ6A 4A3JH 2UUCQ 5FLMH 4JBWA 4DV0L 3CCLA 1EIFA 4IJHA 3RLOA 2LSSA 2JEAI 3UE0A 4ALPA 2JA8H 3I4MG 4FDBA 3L0OA 1N34Q 3ER0A 4GNXC 1PH9A 2JA7G 2QEXA 3F2CA 4OX9Q 2Z6KC 1K73C 2Q2UA 4DUZL 1U5KA 2ZM6L 1A0IA 1EQQA 4A3CG 4HIKA 3CC4A 3PSIA 1CUKA 2XGTA 4NB3A 3KFUA 2R7FA 3CCUA 2OTLA 3I4MH 2K5VA 2I0QA 1VQBA 1G291 1L2FA 1G51A 1GKHA 4KHZA 4A4IA 4AH6A 1Y1VH 3PUZA 3KJPA 2MO1A 4QQBX 3PIPA 4YCVA 4IO9A 2ID0A 1XPOA 2E2HH 1A63A 3D0FA 1CKOA 2PI2E 5EAYA 3SGIA 1T9HA 3GTKH 1WCMH 3F1ZA 1LUZA 4IPCA 5HY6A 3PIOA 4B3ML 3HKSA 4KLKA 3GTGH 2IY5B 1CSPA 2YTVA 1HZAA 3CCSA 2A8VA 1P16A 3PUYA 1NJIC 2VQEL 1VQJA 5IYCH 3BU2A 3CPFA 1BBUA 2F3IA 2YTYA 1B70B 3WWVA 4A76A 2VS1A 4DV1Q 1HNZL 3KF6B 4JI2L 5JJLA 1UE7A 1X3EA 2K50A 3CPWA 3AFPA 2JA6G 3RZOH 1AH9A 4QIWE 2HHHQ 2HHHL 1N9WA 5FLMG 1X65A 4B3SL 1SE8A 1PH1A 4A3LG 1Y1VG 1VQ5A 2KCMA 1DGSA 3TS0A 1HR0Q 2KCTA 2WAQG 4C3JH 1XPRA 1TWFH 3GD7A 2JA5H 3CAMA 5IP7G 1O7IA 4IPDA 2R92H 4P74A 5GAEC 4AQYQ 2B63H 3PUVA 4IJLA 1HZ9A 3J80i 2BH8A 3OYYA 3PO3G 2UXDL 5J3BA 1UE5A 1N32L 1FVIA 4K0KQ 1QUQB 5C4JH 4QY7A 4AYBE 3S2DH 4L5SA 3CCRA 4DR3L 1YNXA 4L5QA 1YI2A 4GKKL 2E2IH 4KHPL 4X6AH 3RZDH 4LF6Q 3TS2A 4JI1Q 4A3DG 2VUMG 2GVBA 3PO2G 2I5LX 4RG1A 1I50H 1GVPA 3KF6A 1YBYA 1Q1EA 3M85A 4LUZA 5FJ8G 5AJ3L 1L0WA 4DV4Q 4JBKA 2K5NA 3I55A 2EIFA 5LMNL 2B63G 2AMCB 1YJ9A 4IFDI 3CXCA 3H0GH 1XMQQ 3AFQA 2K52A 4DV5Q 1KD1C 4MNOA 2E5LL 1D8LA 3HOXH 3TRZA 1I94Q 4GNXA 1VQNA 2ZTEA 5HGQA 2YU9H 1VQMA 1YZ6A 1W3SA 2PQAA 1PA6A 1XTDA 1JJGA 1J6QA 3HKZG 4UP8A 4GS3A 1S3OA 4JI5Q 1K8AC 1PV4A 4QJFA 4YWMA 1UE6A 4YHHQ 2YYZA 5IWAQ 1HNXQ 3S15H 1XMOL 1N36Q 1IBLQ 4BXXG 1KXLA 3PUXA 5BR8Q 1P8LA 4GLVB 1HR0W 2PMZE 4PZ6A 1FJGQ 2A1AA 2VL6A 2JA7H 3DLLA 4WJ3M 1X3GA 3RN5A 5IYDH 4JC0A 4A3IH 4JI8Q 4A3MG 3U4ZA 4HIOA 4JYAL 1J5EQ 2XTIA 1KIXA 4LNQA 1X56A 4JI7Q 4LF9Q 3HOWG 4OO1G 1QVCA 4BBRG 4X66L 4DUZQ 3GTPH 4AYBG 1PH4A 1HNWL 1K0RA 4DR7L 1UEBA 1XNQL 3T1YL 3S1NH 1YHBA 1KAWA 1NMGA 2R7ZH 4BY7H 4JI0Q 5C4XH 4GNXB 4H02A 2RCNA 3MXNB 4B3TL 2UXCL 4LFBQ 3EN2A 3I7FA 3E9HA 2NVXH 4MZ9A 4GLXA 2E8GA 1SROA 3K81C 4DV2Q 3OW2A 4HJ9A 3M4PA 5IP9H 3NENA 5GADC 2JQOA 4R4OA 2AWOA 1XPUA 2N3SA 1Y1WH 3JAMc 3CCVA 4DNIA 2HIXA 3K0XA 2EXDA 3D31A 4OWXB 3HKZE 3ZJYC 4HIMA 5IYBH 1E24A 2NVYH 1YJNA 4LF7Q 1QUQA 4LFAQ 4R4CA 3HOWH 1BVSA 1K3RA 4A3IG 2K5HA 2Q2IA 3GTLH 1M90C 3M3YH 3CD6A 4PZ8A 4DR5Q 2N78A 2MQHA 4X65L 1Q82C 2KHIA 3NBHB 4X62L 1PHJA 3CC7A 1PYSB 1WFQA 2C35B 3J7ZC 1A62A 1YHAA 3NEMA 1YIJA 4NXML 3CCEA 1NE3A 4LFCL 2UUAL 4DR4L 2CWPA 2V1CC 5ELNA 2VNUD 3M4QA 1YEZA 3I4NH 1XNRQ 4OXPA 2A19A 5M5WH 4B3TQ 4JI6Q 5DLQE 1FGUA 3M4OH 1CKNA 5GQOA 1PH3A 5C0XI 2BH2A 5K36G 1X6OA 4DR1Q 1E1TA 1GM5A 2ZJPA 3S1QH 3A5ZB 2K4KA 2NZOA 3PCOB 4UY8C 4IPHA 1NY4A 4DV7L 2UXBQ 1OXTA 3RR5A 3GTMH 2N8NA 4P73A 2ASBA 3EIVA 3K8AA 3K7AH 1NMFA 3G4SA 1IL2A 3HOYH 4BBRH 1XMOQ 1QVGA 1W2BA 4BBSH 4LW1A 4GKJL 4JOIC 3STBD 2F4VQ 4DUYL 5H1SE 4A3GG 2MFIA 3I4NG 4HIDA 4HJ7A 1SFOH 4DR6Q 4R4TA 3CQZH 1B7YB 4GKJQ 4JI4Q 4LF7L 3HOZG 2MO0A 2ZJRA 1KRSA 2HT1A 2IT1A 2VZAA 1VQKA 4LF5L 2Q2HA 1I94L 4A75A 1OXVA 4DV5L 4O0AA 1XJVA 4LUVA 1TWCH 3W5OA 2E5LQ 4LF8Q 4O2DA 1E7ZA 5LMNQ 1Q8KA 3S1MH 4JI0L 2UXCQ 2GN5A 4R4QA 3F8TA 1VQ9A 5LMUL 1M1KC 4LF8L 1RIPA 3MEFA 4EX5A 3F2BA 4A3FG 1VQ7A 4Y52H 4NXNQ 3H3VI 1IYJB 5C44G 2RHQB 4LFCQ 4DR4Q 3U58A 1TWGH 2NN6G 2YV5A 4R4IA 1OTCA 5GAGC 5IYCG 1EIYB 2R6GA 3UDXA 2JE6I 3AQQA 1OXXK 2R93H 3NELA 1EUJA 1X3FA 1N33L 2R92G 2VY3A 1TWHH 3STBC 3M7NA 2R7ZG 3CMEA 5IWAL 1PH2A 5C3EH 4BY1G 4B3RL 4AQYL 1VQCA 3UDFA 1IBKQ 4GN4B 1L1OA 4MTNA 1K8GA 3S2HH 4JG2A 3H15A 4A3KG 1WYDA 2WB1G 5M3FG 3W1BA 1JT8A 5IYDG 3UDGA 1BKBA 3F2DA 1B8AA 1VQOA 1CSQA 4DV2L 2BA0A 2KHJA 1K83H 4YY3L 2IHEA 4A3EG 1Q46A 1SMXA 4A3KH 4OONA 3AYHB 4DV3L 1Q7YC 4L5TA 3BJUA 4A3LH 1C9OA 3G71A 4A3FH 2B29A 1HZBA 2JA8G 1PYBA 3FKIG 1S72A 2Z0SA 4JI3L 1E3PA 4BA1I 1YHQA 1FL0A 4RMFA 4HJAA 4B3MQ 3RLFA 4LF9L 3KLWA 4JYAQ 5IP9G 3A5UA 4GLAC 3RN2A 1KHIA 4YWLA 4KHPQ 1MJCA 3HOUH 3M9BA 2R93G 4DR3Q 4GKKQ 3ICEA 3JC66 5BR8L 4WJ4A 1VQ8A 1WCMG 1N36L 1IBLL 1L1OB 3KJOA 2NVTH 2UXDQ 4DR2L 1IBKL 2DGYA 4DV6L 4QGUA 2ZTCA 2K14A 3GO5A 2AHOB 2ZM6Q 5JJIA 3GDEA 4DR2Q 4JBMA 2N49A 4XTCS 1KRTA 3PO2H 1N8RC 2EQSA 3ULJA 4A3DH 2GVAA 1BBWA 2RHSB 2I5MX 3S24A 1OXUA 3CF5A 1Y1WG 3BZKA 3ULLA 4IOCA 1VQHA 1HR0L 2OTJA 2HIVA 3HOYG 1X54A 2F52A 3Q8DA 3TQYA 2AKWB 4P75A 4OWWB 2Q2TA 1PVOA 3OTOL 3L2PA 3L7ZC 4C3IH 1PFSA 3KDFA 3FHWA 5IE8A 4JI3Q 1RL2A 5FLXc 5AJ3Q 4DV4L 3GTOH 3TREA 4DR1L 3CCMA 5LMUQ 1VQGA 1AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8V A;  4DPG A;  5IP7 H;  5M5X H;  4OO1 I;  1PH8 A;  2CKZ B;  1C7Y A;  3RNU A;  5IY0 A;  4DK3 C;  2WB1 E;  1ASY A;  4UPA A;  3CMA A;  1LTL A;  4A3M H;  4YY3 Q;  2UU9 L;  4A3B H;  1J5E L;  4YCU A;  3KOJ A;  3HOX G;  4JI8 L;  1NTG A;  1E1O A;  2ZJQ A;  5GAH C;  1OXS C;  1QVF A;  3E9I A;  3J81 j;  2NVQ H;  4R1J A;  4A93 G;  1QZH A;  3U4V A;  1Z47 A;  4GN3 B;  2RF4 A;  2K75 A;  1HNX L;  3RLN A;  1PH7 A;  1SN8 A;  2AWN A;  4DR6 L;  1KL9 A;  4JI5 L;  3PUW A;  1H95 A;  4DV6 Q;  2NZH A;  2UUB Q;  4HJ5 A;  2F4V L;  1U0L A;  2H5X A;  1I3Q H;  3IRB A;  1N34 L;  3E0E A;  1N33 Q;  1L1O C;  4BA2 I;  1PH5 A;  2JK8 A;  1EQR A;  3KF8 B;  4LWC A;  1GD7 A;  4DV0 Q;  4C2M H;  1LM0 A;  3S17 H;  1GO3 E;  2ALY B;  3CCQ A;  1IBM L;  2Z6K A;  4JI2 Q;  4LFB L;  4NXN L;  1HNZ Q;  1R9T H;  2Y0S E;  4AIM A;  4XIG S;  1IXR A;  2OQ0 A;  3J80 c;  1ASZ A;  2VQF L;  5JJK A;  1XNQ Q;  4BY7 G;  5M3F H;  4DV3 Q;  1HNW Q;  3CCJ A;  3UE1 A;  1WJJ A;  4APV A;  4X66 Q;  4JI7 L;  2OWO A;  1Y14 B;  1SRU A;  4LUO A;  1I6H H;  1Q1B A;  2L15 A;  2HQL A;  4DKA C;  5M3M G;  3PGZ A;  1JJ2 A;  2PI2 A;  3TEH B;  2QGQ A;  4JV5 Q;  4X62 Q;  4JCV E;  4K0K L;  4X65 Q;  4YHH L;  4DR5 L;  3UDI A;  1S40 A;  4B3R Q;  4BXX H;  5IT9 c;  1JJC B;  4C3H H;  4DUY Q;  1VS0 A;  2WP8 J;  2D0P A;  2R7D A;  4PG3 A;  4LFA L;  4OX9 L;  4IFD G;  3HOV G;  1SLJ A;  3CP0 A;  4ME3 A;  4A3J G;  1WOC A;  5ELO A;  4DAM A;  5LMN W;  1EOV A;  3J81 c;  1MIU A;  3PV0 A;  1QZG A;  1EFW A;  4LF4 Q;  2ES2 A;  1UWV A;  1MKH A;  2JA6 H;  2KEN A;  1V1Q A;  2PNH A;  4DV7 Q;  2UXB L;  5C3E G;  3G48 A;  4PZ7 A;  2ZTD A;  1VQ4 A;  4UP7 A;  4A3E H;  2JEB I;  3U50 C;  3J81 i;  4A3C H;  1D7Q A;  1E22 A;  1TWA H;  1HJP A;  3HOU G;  4UP9 A;  3PF5 A;  2NN6 I;  4OWT B;  2VQE Q;  3ULP A;  3A74 A;  4DR7 Q;  1XNR L;  5C44 H;  3G6E A;  4QL5 A;  4YCW A;  2D62 A;  1Q81 C;  2UUA Q;  4HJ8 A;  1HZC A;  2IX1 A;  2DUD A;  3CW2 C;  3LGJ A;  4IPG A;  4JI1 L;  4JOI A;  1MJE A;  4LF5 Q;  4LF6 L;  4NXM Q;  1G6P A;  4A3G H;  4Y7N H;  3HOV H;  1I5F A;  3AEV A;  4JV5 L;  1FJG L;  1EYG A;  1Q86 C;  3J7A 5;  1V9P A;  5M5Y H;  1YVC A;  4JI4 L;  2JA9 A;  1VQD A;  2I5H A;  3I2Z A;  4TQU S;  3S16 H;  3BZC A;  1TXY A;  4DK6 C;  1AE3 A;  1YJW A;  4GOP B;  1Z9F A;  1HH2 P;  1KC8 C;  3PO3 H;  2BA1 A;  4GN5 A;  5FJ8 H;  1CKN B;  4X64 Q;  2OCE A;  2KBN A;  2PQA B;  3DM3 A;  4J15 A;  4A93 H;  3GTQ H;  4TVA B;  2IX0 A;  3HOZ H;  1UE1 A;  5E7N A;  1LYL A;  4P71 A;  4YWK A;  2QA4 A;  2JA5 G;  3JAM i;  4IFD J;  1VCI A;  3T1H Q;  2WAQ E;  4A3B G;  3GTJ H;  4BY1 H;  2YTX A;  1Q12 A;  1IBM Q;  3HFZ B;  3A0J A;  5C0X J;  3K7U C;  5GRO A;  2IHF A;  2JJQ A;  2B3G A;  1VQA A;  1VQI A;  2CQO A;  3W1G A;  3T1H L;  1VQP A;  1JMC A;  4DV1 L;  4LF4 L;  1KQS A;  3S14 H;  4GOP C;  4KI0 A;  3B6Y A;  2D0O A;  1VQE A;  2WFW A;  2LXJ A;  3T1Y Q;  4JI6 L;  3VDY A;  2VW9 A;  4X64 L;  1NBW A;  1SR3 A;  1WI5 A;  2UUB L;  1X9N A;  5JEA J;  1K9M C;  2CCZ A;  4POG A;  1PH6 A;  3I56 A;  3CC2 A;  4POF A;  2VUM H;  3FP9 A;  2E2J H;  2OQK A;  1VQF A;  3H3V H;  1X55 A;  3FKI H;  4NPS A;  1JB7 A;  3K80 C;  3KYH C;  2MNA A;  1N32 Q;  3H0G G;  4P72 A;  1C0A A;  1IZ6 A;  3I4O A;  4DAY B;  2CWA A;  2Y0S G;  1YIT A;  5JEA G;  1V43 A;  2LXK A;  3EBE A;  1EWI A;  2CFM A;  2VQF Q;  3PF4 A;  4IOA A;  1JE5 A;  1VQL A;  5C4X G;  4GOP A;  2UUC L;  3ERS X;  4B3S Q;  3S1R H;  4JBJ A;  2ATW A;  2FXQ A;  3KDF B;  1CKM A;  4L5R C;  4BBS G;  5M3M H;  3OTO Q;  1XMQ L;  2UU9 Q;  5IYB G;  4EQ5 A;  5C0X G;  4PMW A;  1VQ6 A;  4A3J H;  2UUC Q;  5FLM H;  4JBW A;  4DV0 L;  3CCL A;  1EIF A;  4IJH A;  3RLO A;  2LSS A;  2JEA I;  3UE0 A;  4ALP A;  2JA8 H;  3I4M G;  4FDB A;  3L0O A;  1N34 Q;  3ER0 A;  4GNX C;  1PH9 A;  2JA7 G;  2QEX A;  3F2C A;  4OX9 Q;  2Z6K C;  1K73 C;  2Q2U A;  4DUZ L;  1U5K A;  2ZM6 L;  1A0I A;  1EQQ A;  4A3C G;  4HIK A;  3CC4 A;  3PSI A;  1CUK A;  2XGT A;  4NB3 A;  3KFU A;  2R7F A;  3CCU A;  2OTL A;  3I4M H;  2K5V A;  2I0Q A;  1VQB A;  1G29 1;  1L2F A;  1G51 A;  1GKH A;  4KHZ A;  4A4I A;  4AH6 A;  1Y1V H;  3PUZ A;  3KJP A;  2MO1 A;  4QQB X;  3PIP A;  4YCV A;  4IO9 A;  2ID0 A;  1XPO A;  2E2H H;  1A63 A;  3D0F A;  1CKO A;  2PI2 E;  5EAY A;  3SGI A;  1T9H A;  3GTK H;  1WCM H;  3F1Z A;  1LUZ A;  4IPC A;  5HY6 A;  3PIO A;  4B3M L;  3HKS A;  4KLK A;  3GTG H;  2IY5 B;  1CSP A;  2YTV A;  1HZA A;  3CCS A;  2A8V A;  1P16 A;  3PUY A;  1NJI C;  2VQE L;  1VQJ A;  5IYC H;  3BU2 A;  3CPF A;  1BBU A;  2F3I A;  2YTY A;  1B70 B;  3WWV A;  4A76 A;  2VS1 A;  4DV1 Q;  1HNZ L;  3KF6 B;  4JI2 L;  5JJL A;  1UE7 A;  1X3E A;  2K50 A;  3CPW A;  3AFP A;  2JA6 G;  3RZO H;  1AH9 A;  4QIW E;  2HHH Q;  2HHH L;  1N9W A;  5FLM G;  1X65 A;  4B3S L;  1SE8 A;  1PH1 A;  4A3L G;  1Y1V G;  1VQ5 A;  2KCM A;  1DGS A;  3TS0 A;  1HR0 Q;  2KCT A;  2WAQ G;  4C3J H;  1XPR A;  1TWF H;  3GD7 A;  2JA5 H;  3CAM A;  5IP7 G;  1O7I A;  4IPD A;  2R92 H;  4P74 A;  5GAE C;  4AQY Q;  2B63 H;  3PUV A;  4IJL A;  1HZ9 A;  3J80 i;  2BH8 A;  3OYY A;  3PO3 G;  2UXD L;  5J3B A;  1UE5 A;  1N32 L;  1FVI A;  4K0K Q;  1QUQ B;  5C4J H;  4QY7 A;  4AYB E;  3S2D H;  4L5S A;  3CCR A;  4DR3 L;  1YNX A;  4L5Q A;  1YI2 A;  4GKK L;  2E2I H;  4KHP L;  4X6A H;  3RZD H;  4LF6 Q;  3TS2 A;  4JI1 Q;  4A3D G;  2VUM G;  2GVB A;  3PO2 G;  2I5L X;  4RG1 A;  1I50 H;  1GVP A;  3KF6 A;  1YBY A;  1Q1E A;  3M85 A;  4LUZ A;  5FJ8 G;  5AJ3 L;  1L0W A;  4DV4 Q;  4JBK A;  2K5N A;  3I55 A;  2EIF A;  5LMN L;  2B63 G;  2AMC B;  1YJ9 A;  4IFD I;  3CXC A;  3H0G H;  1XMQ Q;  3AFQ A;  2K52 A;  4DV5 Q;  1KD1 C;  4MNO A;  2E5L L;  1D8L A;  3HOX H;  3TRZ A;  1I94 Q;  4GNX A;  1VQN A;  2ZTE A;  5HGQ A;  2YU9 H;  1VQM A;  1YZ6 A;  1W3S A;  2PQA A;  1PA6 A;  1XTD A;  1JJG A;  1J6Q A;  3HKZ G;  4UP8 A;  4GS3 A;  1S3O A;  4JI5 Q;  1K8A C;  1PV4 A;  4QJF A;  4YWM A;  1UE6 A;  4YHH Q;  2YYZ A;  5IWA Q;  1HNX Q;  3S15 H;  1XMO L;  1N36 Q;  1IBL Q;  4BXX G;  1KXL A;  3PUX A;  5BR8 Q;  1P8L A;  4GLV B;  1HR0 W;  2PMZ E;  4PZ6 A;  1FJG Q;  2A1A A;  2VL6 A;  2JA7 H;  3DLL A;  4WJ3 M;  1X3G A;  3RN5 A;  5IYD H;  4JC0 A;  4A3I H;  4JI8 Q;  4A3M G;  3U4Z A;  4HIO A;  4JYA L;  1J5E Q;  2XTI A;  1KIX A;  4LNQ A;  1X56 A;  4JI7 Q;  4LF9 Q;  3HOW G;  4OO1 G;  1QVC A;  4BBR G;  4X66 L;  4DUZ Q;  3GTP H;  4AYB G;  1PH4 A;  1HNW L;  1K0R A;  4DR7 L;  1UEB A;  1XNQ L;  3T1Y L;  3S1N H;  1YHB A;  1KAW A;  1NMG A;  2R7Z H;  4BY7 H;  4JI0 Q;  5C4X H;  4GNX B;  4H02 A;  2RCN A;  3MXN B;  4B3T L;  2UXC L;  4LFB Q;  3EN2 A;  3I7F A;  3E9H A;  2NVX H;  4MZ9 A;  4GLX A;  2E8G A;  1SRO A;  3K81 C;  4DV2 Q;  3OW2 A;  4HJ9 A;  3M4P A;  5IP9 H;  3NEN A;  5GAD C;  2JQO A;  4R4O A;  2AWO A;  1XPU A;  2N3S A;  1Y1W H;  3JAM c;  3CCV A;  4DNI A;  2HIX A;  3K0X A;  2EXD A;  3D31 A;  4OWX B;  3HKZ E;  3ZJY C;  4HIM A;  5IYB H;  1E24 A;  2NVY H;  1YJN A;  4LF7 Q;  1QUQ A;  4LFA Q;  4R4C A;  3HOW H;  1BVS A;  1K3R A;  4A3I G;  2K5H A;  2Q2I A;  3GTL H;  1M90 C;  3M3Y H;  3CD6 A;  4PZ8 A;  4DR5 Q;  2N78 A;  2MQH A;  4X65 L;  1Q82 C;  2KHI A;  3NBH B;  4X62 L;  1PHJ A;  3CC7 A;  1PYS B;  1WFQ A;  2C35 B;  3J7Z C;  1A62 A;  1YHA A;  3NEM A;  1YIJ A;  4NXM L;  3CCE A;  1NE3 A;  4LFC L;  2UUA L;  4DR4 L;  2CWP A;  2V1C C;  5ELN A;  2VNU D;  3M4Q A;  1YEZ A;  3I4N H;  1XNR Q;  4OXP A;  2A19 A;  5M5W H;  4B3T Q;  4JI6 Q;  5DLQ E;  1FGU A;  3M4O H;  1CKN A;  5GQO A;  1PH3 A;  5C0X I;  2BH2 A;  5K36 G;  1X6O A;  4DR1 Q;  1E1T A;  1GM5 A;  2ZJP A;  3S1Q H;  3A5Z B;  2K4K A;  2NZO A;  3PCO B;  4UY8 C;  4IPH A;  1NY4 A;  4DV7 L;  2UXB Q;  1OXT A;  3RR5 A;  3GTM H;  2N8N A;  4P73 A;  2ASB A;  3EIV A;  3K8A A;  3K7A H;  1NMF A;  3G4S A;  1IL2 A;  3HOY H;  4BBR H;  1XMO Q;  1QVG A;  1W2B A;  4BBS H;  4LW1 A;  4GKJ L;  4JOI C;  3STB D;  2F4V Q;  4DUY L;  5H1S E;  4A3G G;  2MFI A;  3I4N G;  4HID A;  4HJ7 A;  1SFO H;  4DR6 Q;  4R4T A;  3CQZ H;  1B7Y B;  4GKJ Q;  4JI4 Q;  4LF7 L;  3HOZ G;  2MO0 A;  2ZJR A;  1KRS A;  2HT1 A;  2IT1 A;  2VZA A;  1VQK A;  4LF5 L;  2Q2H A;  1I94 L;  4A75 A;  1OXV A;  4DV5 L;  4O0A A;  1XJV A;  4LUV A;  1TWC H;  3W5O A;  2E5L Q;  4LF8 Q;  4O2D A;  1E7Z A;  5LMN Q;  1Q8K A;  3S1M H;  4JI0 L;  2UXC Q;  2GN5 A;  4R4Q A;  3F8T A;  1VQ9 A;  5LMU L;  1M1K C;  4LF8 L;  1RIP A;  3MEF A;  4EX5 A;  3F2B A;  4A3F G;  1VQ7 A;  4Y52 H;  4NXN Q;  3H3V I;  1IYJ B;  5C44 G;  2RHQ B;  4LFC Q;  4DR4 Q;  3U58 A;  1TWG H;  2NN6 G;  2YV5 A;  4R4I A;  1OTC A;  5GAG C;  5IYC G;  1EIY B;  2R6G A;  3UDX A;  2JE6 I;  3AQQ A;  1OXX K;  2R93 H;  3NEL A;  1EUJ A;  1X3F A;  1N33 L;  2R92 G;  2VY3 A;  1TWH H;  3STB C;  3M7N A;  2R7Z G;  3CME A;  5IWA L;  1PH2 A;  5C3E H;  4BY1 G;  4B3R L;  4AQY L;  1VQC A;  3UDF A;  1IBK Q;  4GN4 B;  1L1O A;  4MTN A;  1K8G A;  3S2H H;  4JG2 A;  3H15 A;  4A3K G;  1WYD A;  2WB1 G;  5M3F G;  3W1B A;  1JT8 A;  5IYD G;  3UDG A;  1BKB A;  3F2D A;  1B8A A;  1VQO A;  1CSQ A;  4DV2 L;  2BA0 A;  2KHJ A;  1K83 H;  4YY3 L;  2IHE A;  4A3E G;  1Q46 A;  1SMX A;  4A3K H;  4OON A;  3AYH B;  4DV3 L;  1Q7Y C;  4L5T A;  3BJU A;  4A3L H;  1C9O A;  3G71 A;  4A3F H;  2B29 A;  1HZB A;  2JA8 G;  1PYB A;  3FKI G;  1S72 A;  2Z0S A;  4JI3 L;  1E3P A;  4BA1 I;  1YHQ A;  1FL0 A;  4RMF A;  4HJA A;  4B3M Q;  3RLF A;  4LF9 L;  3KLW A;  4JYA Q;  5IP9 G;  3A5U A;  4GLA C;  3RN2 A;  1KHI A;  4YWL A;  4KHP Q;  1MJC A;  3HOU H;  3M9B A;  2R93 G;  4DR3 Q;  4GKK Q;  3ICE A;  3JC6 6;  5BR8 L;  4WJ4 A;  1VQ8 A;  1WCM G;  1N36 L;  1IBL L;  1L1O B;  3KJO A;  2NVT H;  2UXD Q;  4DR2 L;  1IBK L;  2DGY A;  4DV6 L;  4QGU A;  2ZTC A;  2K14 A;  3GO5 A;  2AHO B;  2ZM6 Q;  5JJI A;  3GDE A;  4DR2 Q;  4JBM A;  2N49 A;  4XTC S;  1KRT A;  3PO2 H;  1N8R C;  2EQS A;  3ULJ A;  4A3D H;  2GVA A;  1BBW A;  2RHS B;  2I5M X;  3S24 A;  1OXU A;  3CF5 A;  1Y1W G;  3BZK A;  3ULL A;  4IOC A;  1VQH A;  1HR0 L;  2OTJ A;  2HIV A;  3HOY G;  1X54 A;  2F52 A;  3Q8D A;  3TQY A;  2AKW B;  4P75 A;  4OWW B;  2Q2T A;  1PVO A;  3OTO L;  3L2P A;  3L7Z C;  4C3I H;  1PFS A;  3KDF A;  3FHW A;  5IE8 A;  4JI3 Q;  1RL2 A;  5FLX c;  5AJ3 Q;  4DV4 L;  3GTO H;  3TRE A;  4DR1 L;  3CCM A;  5LMU Q;  1VQG A;  1AE2 A; 
#chains in the Genus database with same CATH topology
 1AP0 A;  3GV3 A;  5M5X H;  4CDD C;  2FMM A;  3RNU A;  1ASY A;  4UPA A;  3CMA A;  4FF1 A;  1LTL A;  1J8I A;  4YCU A;  3HOX G;  3A7L A;  4OIJ A;  1AZQ A;  1OXS C;  3NP8 A;  5LL6 X;  2NVQ H;  1LT4 D;  3P7J A;  2HUG A;  3NTK A;  2MGS A;  1AZP A;  1EL0 A;  2AWN A;  1PRT C;  1K0S A;  4JI5 L;  2UUB Q;  1XXG A;  1N33 Q;  1LT6 D;  1PH5 A;  2JK8 A;  4LWC A;  1EZ6 A;  4DV0 Q;  2SDF A;  3S17 H;  1EWH A;  4NDX A;  3AU7 A;  2ALY B;  1DZ1 A;  4ZYS A;  1KNE A;  4LFB L;  1STE A;  1HNZ Q;  5CV7 A;  4AIM A;  1IXR A;  1JWM D;  1AN8 A;  4DV3 Q;  3Q22 A;  3CCJ A;  3R93 A;  4A3J B;  2F0D A;  1I6H H;  2L15 A;  1JJ2 A;  3PGZ A;  4KY7 A;  1HHV A;  3TEH B;  2MUY A;  1SND A;  2QGQ A;  1ZXT A;  1R4P B;  4IFD H;  3AMU A;  4KMU C;  4X62 Q;  4JCV E;  2K33 A;  3L9A X;  2F4I A;  2BOS A;  5CV4 A;  1RF2 D;  4H44 C;  2WAC A;  4C3H H;  2P5Z X;  4IFD G;  1TWC B;  3TZD A;  2C5C A;  2J7Z A;  1LLR D;  1SLJ A;  3MTS A;  4A3J G;  3V96 A;  5FO8 B;  1MIU A;  3PV0 A;  1EFW A;  4LF4 Q;  2ES2 A;  1UWV A;  4K2K A;  4BY7 B;  1SFO B;  2UXB L;  1GXD C;  1VQ4 A;  4UP7 A;  1GUW A;  2X6L A;  4RHR A;  1HJP A;  2WIN B;  3PF5 A;  1RTN A;  4XQQ A;  3URY A;  1XNR L;  3VR3 A;  4QCL A;  1AW7 A;  2DUD A;  3CW2 C;  3LGJ A;  5K5P A;  5C4J B;  4MHE A;  5CGK A;  4LF5 Q;  4C56 C;  2B2W A;  4LF6 L;  3MZ5 A;  1G6P A;  1QWY A;  1I5F A;  3AEV A;  1FJG L;  1F2Y A;  3DWA A;  1Q86 C;  3Q6S A;  1K3B C;  4JI4 L;  1TXY A;  1D5Z C;  1AE3 A;  1A2U A;  1Z9F A;  5J39 A;  1KC8 C;  5CC4 A;  5FJ8 H;  4X64 Q;  3LWE A;  2KBN A;  3DM3 A;  5FOB B;  2QCP X;  1UE1 A;  5E7N A;  4YWK A;  4XDX A;  4DAY A;  2XSC A;  1TQO A;  3RUZ A;  1VCI A;  1NUC A;  2WAQ E;  3E5S A;  3TBI B;  1Q12 A;  1IBM Q;  3EJI A;  1I4Q A;  4B9X A;  1JMC A;  1VQI A;  3W1G A;  1ENA A;  3T1H L;  1KQS A;  4K6D A;  2CW0 C;  2D0O A;  1VQE A;  3E3X A;  3DMU A;  3T1Y Q;  1GHK A;  4ZKB B;  4HR7 B;  2K6A A;  3MWY W;  4JVZ A;  1Y1W B;  2F0F A;  3G7L A;  3HGB A;  2H4O A;  2E2J H;  2OQK A;  1VQF A;  3H3V H;  3FKI H;  2EXZ A;  2LS0 1;  5I2X A;  5C4H A;  4HMI A;  1SE3 A;  3KYH C;  1N32 Q;  5COR A;  1MSH A;  5JJZ A;  3SDZ A;  1RKN A;  2R93 B;  4LAA A;  1Y8N B;  2A68 C;  4EGV A;  2D5D A;  3BVM A;  5JEA G;  2BDO A;  1FYC A;  3EBE A;  5COY A;  1LTA D;  1LTR D;  2XRS D;  4ZLT F;  3KLS X;  1JR0 D;  1HFN A;  3W2D A;  1T5E A;  1IYV A;  2UUC L;  2IPK D;  1CQV A;  1JE4 A;  1CKM A;  4BBS G;  3I91 A;  5M3M H;  5CYU A;  4EQ5 A;  5FLM H;  1EIF A;  4IJH A;  4J8Q A;  2LSS A;  5CR3 A;  3J80 L;  2E2H B;  3S1Q B;  1A15 A;  1N34 Q;  2BCO A;  3TP5 A;  4GNX C;  2JA7 G;  1EWC A;  1PZI D;  1T5X D;  2FFK B;  3KFU A;  1L2F A;  1G51 A;  3GTP B;  1TKW B;  1Z7T A;  2E2H H;  2PZT A;  1I4P A;  1TS5 A;  2L4N A;  4IPC A;  3SE0 A;  2KED A;  1BCP C;  2EY6 A;  2QF7 A;  2EZV A;  2EDG A;  3BU2 A;  3CPF A;  2YTY A;  2F3I A;  1B70 B;  4JI2 L;  1UE7 A;  1X3E A;  2K50 A;  4KN7 C;  3K5L A;  5I4D A;  1STG A;  5HGT A;  1PH1 A;  4A3L G;  1Y1V G;  4AYB B;  2PPB C;  2KCT A;  1XPR A;  1H9R A;  3SR1 A;  3NSW A;  4IPD A;  2XRQ D;  2ZXP A;  4X3U A;  5CV6 A;  4H13 C;  4IJL A;  3GTO B;  2B2Y C;  2BH8 A;  3PO3 G;  1TII D;  3DWP A;  4LJZ C;  1TY0 A;  4K0K Q;  2ZT9 C;  2JP1 A;  2NZ1 D;  5KGU A;  4L5S A;  4DR3 L;  3GTM B;  4GKK L;  4KHP L;  1CT1 D;  3OHX C;  1SEB D;  4JI1 Q;  1NR4 A;  4RWS C;  2GVB A;  5IGG A;  1RCV D;  2DY8 A;  4PQX A;  5DNF A;  4RG1 A;  3VA7 A;  4J1M A;  3MFG A;  2OF1 A;  3KF6 A;  4FXG C;  2NVX B;  1L0W A;  2B63 B;  1UNS A;  2B63 G;  1YJ9 A;  1O7Y A;  5JPM C;  3CXC A;  4DNR B;  2K52 A;  4DV5 Q;  1KD1 C;  4MNO A;  3TRZ A;  1D8L A;  2PQE A;  1O7Z A;  1E2V A;  3NHH A;  3D3R A;  4XQN A;  4GNX A;  1VQN A;  5HGQ A;  2B2Y A;  1W3S A;  1CK1 A;  1JJG A;  1XTD A;  2A73 B;  3HKZ G;  4UP8 A;  3S9W A;  4JI5 Q;  4ZKC B;  2L12 A;  3FRP B;  1MHW C;  1HR0 W;  1P8L A;  1ICF B;  3KBG A;  2JA7 H;  3DLL A;  2J0T D;  1X3G A;  3RN5 A;  4WJ3 M;  1BF4 A;  4JYA L;  2GA4 B;  1X56 A;  1EFI D;  4JI7 Q;  1CZG A;  1U4P A;  2EJF C;  2F0V A;  4BBR G;  4X66 L;  1Y1V B;  4AYB G;  1PH4 A;  2B39 A;  4G7H C;  1STA A;  3T1Y L;  1KAW A;  1NMG A;  2MHV A;  5C4X H;  4GNX B;  1HA5 A;  2RCN A;  3BDC A;  4LFB Q;  1TWH B;  2G9H D;  3OW2 A;  4DV2 Q;  4HJ9 A;  5IP9 H;  1M4V A;  5GAD C;  4R4O A;  1XPU A;  2CVR A;  2N3S A;  2HIX A;  3HKZ E;  4N8F A;  5AFW A;  3HOW B;  5EKK A;  5IYB H;  3NBH A;  3HOW H;  1BVS A;  1K3R A;  4FF4 A;  4ULL A;  2Q2I A;  3CD6 A;  4DR5 Q;  1ET6 A;  1Q82 C;  3CC7 A;  3A8I E;  1PYS B;  2C35 B;  3MXU A;  1D5X C;  3J7Z C;  1X32 A;  3J80 E;  3CCE A;  1Q90 A;  4LFC L;  2CWP A;  5ELN A;  1YEZ A;  1PYW D;  1SYG A;  3KK7 A;  4RGN A;  1HCZ A;  5M5W H;  4MIU A;  4JI6 Q;  4CGY B;  2XNA C;  3M4O H;  1PDQ A;  5GQO A;  4BBS B;  4B9W A;  4K8J A;  4C3I B;  1WTO A;  2NZO A;  3CRL C;  2WKC A;  4DV7 L;  1OXT A;  1JB3 A;  2EYH A;  1S5D D;  3NWS A;  4F7X A;  3EIV A;  3G4S A;  4BBR H;  1QVG A;  4BBS H;  4K2L A;  4LW1 A;  4GKJ L;  5CV5 A;  1CA6 A;  1S4Z A;  2MFI A;  4HMJ A;  1SFO H;  4O42 A;  2YU9 B;  4JI4 Q;  4LF7 L;  5DEH A;  5EGT A;  4FVM A;  2EE1 A;  2HT1 A;  1VQK A;  1VF7 A;  2E5L Q;  1TWC H;  2PCF B;  3I90 A;  3W5O A;  1SJE D;  2Z8L A;  2UXC Q;  1TS4 A;  2PYK A;  4Y52 H;  4CKB A;  4UHV A;  2C9O A;  2V4D A;  3H3V I;  5T1G A;  1GUG A;  3Q24 A;  5C44 G;  4HN7 A;  4LFC Q;  1TWG H;  1PTO B;  1FD7 D;  2NN6 G;  2YV5 A;  3ZYY X;  4DAV A;  5GAG C;  2R6G A;  1JOR A;  3X3M A;  5IIF A;  1X3F A;  2RQX A;  4L63 B;  3IFT A;  4IUT A;  1WTR A;  1B50 A;  1JWS D;  1CA5 A;  4B3R L;  3UDF A;  4GN4 B;  1C4Q A;  3S1N B;  1EU4 A;  2WKD A;  5FK9 C;  2IWH A;  4KD3 A;  3H15 A;  2WB1 G;  3W1B A;  1BKB A;  3OIQ A;  1EOT A;  3SK6 A;  2NTS A;  5E4X A;  2K04 A;  4A3L H;  2D9U A;  2NVT B;  2B2V C;  5KNB A;  1E3P A;  1YHQ A;  4B3M Q;  1HQR D;  5T1I A;  4KD4 A;  3RN2 A;  4YWL A;  1MJC A;  1NSN S;  3H0G B;  1N36 L;  1IBK L;  3GO5 A;  1S5F D;  2AHO B;  2KA7 A;  2ZM6 Q;  4JBM A;  1KRT A;  1EYA A;  5M3M B;  4A3D H;  3OMC A;  3EFX D;  2E76 C;  3CF5 A;  1EY4 A;  3BZK A;  3HZX A;  2OTJ A;  1FGB D;  3HOY G;  3MEH A;  3Q8D A;  4KKU A;  3L7Z C;  1JOQ A;  4C3I H;  1K28 A;  3KDF A;  1B2T A;  1RL2 A;  4K5X A;  3CCM A;  3SK4 A;  5LMU Q;  1VQG A;  1VQO A;  5JOB A;  2QW7 A;  1HUM A;  2VB2 X;  3D4D A;  1WD1 A;  3WOE A;  1PH8 A;  4A3B B;  2CKZ B;  1TWF B;  2WB1 E;  4DK3 C;  4G7Z C;  2JA5 B;  3ERQ A;  4JI8 L;  1NTG A;  5EPL A;  1DD2 A;  1I4H A;  2A6H D;  4QUC A;  4A93 G;  1QZH A;  4ZUJ A;  3U4V A;  1Z47 A;  4GN3 B;  1HNX L;  1SN8 A;  2K5D A;  1KL9 A;  4NMZ A;  2MP1 A;  3I70 A;  2B2U A;  5ELB A;  4HJ5 A;  2F4V L;  2H5X A;  2JYO A;  3E0E A;  3J81 L;  3KF8 B;  1GD7 A;  2M00 A;  2BDN A;  2O4X A;  1F2M A;  1MI2 A;  5I2Y A;  3R8B A;  3KUP A;  5FKA C;  3KLS A;  2F0S A;  2OQ0 A;  5KYL A;  5JJK A;  1H9S A;  3HOY B;  1SMY D;  1WJJ A;  2SOB A;  2OWO A;  1Y14 B;  3HOV B;  5M3M G;  3A7A B;  4B08 A;  3HS0 C;  4F88 A;  1WVL A;  4X65 Q;  4DR5 L;  1RTO A;  1ZKO A;  3UDI A;  3K0Y A;  2R7D A;  4OX9 L;  1H9K A;  4CJ2 C;  2G5D A;  3HRZ C;  1BO0 A;  2FHT A;  2PZU A;  1MKH A;  1CQF A;  3NUC A;  1EY6 A;  5J22 A;  2KUM A;  1DOL A;  3FDT A;  4DF7 A;  4A3E H;  2JEB I;  3U50 C;  5FLX E;  5JAV A;  5IT9 E;  3HOU G;  5M5Y B;  4RCO A;  1SAP A;  4DR7 Q;  3FMC A;  3G6E A;  2E2I B;  4YCW A;  2WB1 B;  4JI1 L;  4NXM Q;  4EQP A;  4OO1 H;  4I7Z C;  3DHQ A;  4KTA A;  3SK8 A;  1JC7 A;  1D6E C;  5BN5 A;  3J7A 5;  1SE4 A;  3I2Z A;  3S16 H;  2R7Z B;  4DK6 C;  4GOP B;  4G7O C;  2DJF C;  2F0T A;  4OIK A;  1F2L A;  3QWN A;  1DM0 B;  1I3Q B;  5F2D A;  4A93 H;  2VB3 X;  4PMC A;  4P71 A;  1ENC A;  2SEB D;  4HED A;  1LTT D;  2A6H C;  4A3F B;  2YTX A;  3QJY A;  3M4Y A;  3SEB A;  3A0J A;  5C0X J;  5GRO A;  3S14 H;  4DV1 L;  3S15 B;  1BCP F;  4MTK A;  1IW7 C;  1NBW A;  2DNC A;  1SYD A;  1X9N A;  5JEA J;  3I72 A;  1SBB B;  4WFN 3;  1PH6 A;  1HFG A;  1QNU A;  3FP9 A;  1YNN D;  3I4N B;  1JB7 A;  3K80 C;  3S17 B;  2MNA A;  1LT5 D;  4P72 A;  4NW2 A;  1BXT A;  1IZ6 A;  4ZAI A;  4RGM A;  2IL8 A;  3MVV A;  2KCC A;  1YIT A;  2LXK A;  1TS2 A;  2CFM A;  2AUK A;  3PF4 A;  2KVM A;  1YNJ D;  1VQL A;  3S1R B;  4XYO A;  4O1N A;  3A8J E;  2JA8 B;  3S1R H;  4JBJ A;  2ATW A;  1STN A;  2FXQ A;  3KDF B;  3TDQ A;  3OTO Q;  2L55 A;  1NCV A;  2XWJ B;  5C0X G;  4PMW A;  2UUC Q;  3A54 A;  4JBW A;  3CCL A;  2K7V A;  2RA4 A;  4A3E B;  4ALP A;  2CH4 A;  2K5W A;  2QEX A;  4CDC C;  4DUZ L;  5I6W A;  2F03 A;  4A3C G;  4UAI A;  2NN6 H;  2XGT A;  1EY0 A;  4X3T A;  3CCU A;  2K5V A;  1VQB A;  1B9M A;  4ODG A;  4A4I A;  2QEJ C;  1KAA A;  3NWT A;  4A3I B;  4QQB X;  4YCV A;  2B2W C;  2ID0 A;  1XPO A;  4R9W A;  1RJT A;  1CKO A;  4M1U B;  1T9H A;  3GTK H;  2KEC A;  3F1Z A;  3PIO A;  2IY5 B;  1HRJ A;  1CSP A;  2YTV A;  1HZA A;  1VQJ A;  2VS1 A;  1HNZ L;  2M2L A;  3KF6 B;  3SHL A;  5EKL A;  1AH9 A;  3AFP A;  3DEO A;  2JA6 G;  2HHH L;  1N9W A;  1X65 A;  5ELC A;  4B3S L;  3TS0 A;  1PRT D;  1V1P B;  5HUR A;  2R92 H;  3MAQ A;  4P74 A;  2XIW A;  2F3V A;  2UXD L;  1UE5 A;  4AYB E;  3S2D H;  1E2W A;  1DXM A;  3CCR A;  1YI2 A;  2E2I H;  1JOK A;  2VUM G;  3OSO A;  2FJ2 A;  1SYE A;  2F0I A;  1I4R A;  2HDM A;  3H94 A;  2I5L X;  1I50 H;  2JXM B;  3O13 A;  5JPN C;  1SE2 A;  3IKJ A;  5KND A;  3BYY B;  4K8I A;  3J7A V;  4K5V A;  4LUZ A;  5FJ8 G;  4JBK A;  3I55 A;  5LMN L;  1S5C D;  2E5L L;  3OIP A;  2NWG A;  3H91 A;  5C5L A;  1PA6 A;  2O5J C;  3M3Y B;  1RD9 D;  1VF5 C;  4GS3 A;  1QNK A;  4UDU C;  1K8A C;  4XXE A;  2YYZ A;  3S15 H;  1HNX Q;  1XMO L;  1IBL Q;  2OT2 A;  3NTH A;  4DA2 A;  1ENF A;  2PMZ E;  4PZ6 A;  1H9J A;  5IYD H;  1B44 D;  4JC0 A;  3K5N A;  1U4R A;  3Q23 A;  3U4Z A;  1TVX A;  1J5E Q;  2XTI A;  3VYR A;  3DWQ A;  1KIX A;  4OO1 G;  3I4L A;  3GTP H;  3OPO A;  1F9R A;  4FO2 A;  1XNQ L;  2F0N A;  5C6A A;  4L8J A;  4MN3 A;  2LKV A;  1Q8I A;  3MXN B;  1DOK A;  3EN2 A;  1SXT A;  3E9H A;  2NVX H;  4GLX A;  1SRO A;  3QG1 A;  3M4P A;  2BE5 D;  3NEN A;  4HAE A;  2AWO A;  5I6Y A;  2XN9 C;  4R8I A;  4OL7 A;  3D31 A;  1E24 A;  2L0C A;  2NVY H;  3OWF A;  3GQB A;  4U67 3;  1QUQ A;  4LFA Q;  4LF7 Q;  2RBM A;  1WTP A;  1EIH A;  1KDA A;  3R2T A;  1LO5 D;  1HTL D;  3GTL H;  4PZ8 A;  2N78 A;  4X65 L;  2LFN A;  3NBH B;  4X62 L;  1PHJ A;  3L3O C;  1UAP A;  3MHB A;  2UUA L;  2VNU D;  2V1C C;  2E2J B;  4H7B A;  4M8A A;  2EJM A;  4RFB A;  5EKI A;  2SNS A;  3MC0 B;  5C0X I;  5K36 G;  4DR1 Q;  1E1T A;  1B3Q A;  3S1Q H;  4ABN A;  2K4K A;  1HQM C;  3PCO B;  2O5I C;  4IPH A;  3RR5 A;  4JK1 C;  2Y0S B;  3NQT A;  3PO2 B;  4H0L C;  1IL2 A;  3K7A H;  1LTI D;  1NMF A;  4A3D B;  1W2B A;  2RDG A;  4JOI C;  3P75 A;  1XTC D;  1IW7 D;  2O2L D;  4R4T A;  3CQZ H;  1DON A;  1B7Y B;  4GKJ Q;  4C2M B;  1KRS A;  5KEE A;  2VZA A;  5ELF A;  1PRT B;  1WTQ A;  1GHJ A;  3SXH A;  1I94 L;  4DGZ A;  4N8X 1;  1RHP A;  1B53 A;  3BYT B;  4LUV A;  4O0A A;  2F0K A;  2NTT A;  1F9P A;  5LMN Q;  1CI3 M;  4JI0 L;  3VR2 A;  3FPU B;  3KBX A;  5LMU L;  1M1K C;  3MEF A;  4NXN Q;  1KTK A;  3J7Y W;  1MD2 D;  3K57 A;  1PZK D;  2NVQ B;  1KLG D;  3NEL A;  3RD4 A;  2VY3 A;  3STB C;  3TSS A;  3PQI A;  4HSV A;  3WDN A;  5JVH 3;  1QB5 D;  3K5O A;  1PH2 A;  1XX8 A;  4KJO A;  5IGF A;  4AQY L;  1VQC A;  5E3F A;  1L1O A;  4MTN A;  1I4G A;  4KK7 A;  1K8G A;  1TY2 A;  3IL8 A;  2F0U A;  4ID6 A;  1X3P A;  2B2U C;  5M3F G;  4EQO A;  2X6G A;  3P20 A;  1F9S A;  4X3S A;  3UDG A;  1SNM A;  3D4R A;  1B8A A;  1I6V C;  3F2D A;  1CSQ A;  5JEA H;  2BA0 A;  5EPK A;  2M9V A;  1Q46 A;  1SMX A;  4QMG A;  1Q7Y C;  3ND8 A;  4L5T A;  4XT1 B;  5FO7 B;  3G71 A;  4A3F H;  1PTO F;  2JA8 G;  1ESR A;  1HZB A;  2ICI A;  2Z6B A;  4HJA A;  5C4X B;  4LF9 L;  1LTS D;  2ZXR A;  1OO9 B;  5J1Z A;  1KHI A;  4KHP Q;  2FMC A;  1VQ8 A;  2K32 A;  2K01 A;  4C3H B;  2UXD Q;  4XYQ A;  2AUJ D;  3UI2 A;  4DR2 L;  4DV6 L;  4QGU A;  3N52 A;  5IGE A;  4DR2 Q;  1QJO A;  2N49 A;  1B1Z A;  1M8A A;  1PRT F;  4XTC S;  2GVA A;  2KHS A;  1KAB A;  3A8K E;  4Q0F A;  3ULL A;  1HR0 L;  1AFP A;  3TQY A;  3NQI A;  2RCF A;  3OTO L;  4J6H A;  3FHW A;  2EY1 A;  4DR1 L;  3NPP A;  4LF8 Q;  1I3Q H;  5M5W B;  1WTV A;  4CBV A;  3J81 E;  1ILQ A;  1C7Y A;  1ZYR C;  3PIO 3;  1SSO A;  4A3M H;  4YY3 Q;  5E4W C;  1J5E L;  2ZJQ A;  1D2B A;  1E1O A;  5GAH C;  4KKT A;  3E9I A;  4R1J A;  1BR9 A;  3TN2 A;  1EY8 A;  2RF4 A;  2K75 A;  2MPM A;  3A55 A;  5EBC A;  3RLN A;  3H09 A;  1UEA B;  3PUW A;  3S1M B;  2NZH A;  3D8G A;  3IRB A;  1N34 L;  1L1O C;  2F0L A;  4BA2 I;  3Q0A A;  3IAY A;  5C3W A;  3K5M A;  2CQA A;  1GO3 E;  1R9T B;  3HOU B;  2AQ1 B;  1IBM L;  4JI2 Q;  4NXN L;  5EBD A;  1R9T H;  5C3E B;  1LTG D;  1W6K A;  1XNQ Q;  5A2Q L;  4RH6 A;  4QIW B;  1G2S A;  4X66 Q;  3T4A C;  4JI7 L;  1SRU A;  4N9P A;  1Q1B A;  2NVY B;  3A56 A;  4JV5 Q;  1IL8 A;  4K0K L;  3F2U A;  4R8N A;  1S40 A;  4B3R Q;  1JJC B;  4DUY Q;  2WP8 J;  4KKS A;  2D0P A;  4PG3 A;  4LFA L;  2N55 A;  1II3 A;  4ME3 A;  1TR5 A;  1WOC A;  5ELO A;  4DAM A;  1EOV A;  4RA8 A;  3J81 c;  1QZG A;  3FKI B;  1KDB A;  2KEN A;  1V1Q A;  4DV7 Q;  4FF3 A;  4E6I A;  5C3E G;  1PXU A;  4BWG B;  5A2Q E;  3G48 A;  4PZ7 A;  3J81 i;  1STH A;  1E22 A;  2Z4H A;  2NN6 I;  5L37 A;  1Y8O B;  3ULP A;  2IJ0 A;  3A74 A;  2F0Q A;  1AEX A;  2PZW A;  5C44 H;  1K83 B;  1WTW A;  2D62 A;  1SDF A;  2ZXO A;  1YNN C;  4HJ8 A;  1HZC A;  2RDH A;  3BVG A;  1EY5 A;  4JOI A;  2RVL A;  4A3G H;  3HOV H;  3GTG B;  1QCB D;  3GTJ B;  3T13 A;  4BY1 B;  1V9P A;  5DAU A;  1VQD A;  3BZC A;  2R92 B;  4KN4 C;  3SK5 A;  4GN5 A;  2HD3 A;  2PQA B;  3GTQ H;  2IX0 A;  3ND9 A;  5G3L F;  2A5H A;  2QA4 A;  2K28 A;  4IFD J;  3VR6 A;  4A3B G;  3GTJ H;  4BY1 H;  4HCS A;  2IHF A;  2B3G A;  1VQA A;  4G57 A;  1VQP A;  3BS1 A;  1SMY C;  3GTL B;  1ZYR D;  4GOP C;  3H3V C;  3W3A A;  3VDY A;  3BVZ A;  2VW9 A;  5ELD A;  4XQJ A;  1WI5 A;  1SR3 A;  2UUB L;  5M9O A;  4C1N I;  2CCZ A;  4U68 A;  3I8Z A;  3PIP 3;  2AQ3 B;  3I56 A;  3CC2 A;  3HOZ B;  1QOH A;  4POF A;  3WOF A;  1HA6 A;  1X55 A;  5BN3 A;  1JOO A;  4NPS A;  3NTI A;  3H0G G;  1GJX A;  4Z9C B;  2MJ8 A;  4DAY B;  2CWA A;  2A69 C;  1EYD A;  1GUT A;  3VYU A;  4HCE A;  1EWI A;  2VQF Q;  4IOA A;  1JE5 A;  2Q8I B;  1LT3 D;  5C4X G;  1B4O A;  4GOP A;  5KRU A;  1G6Z A;  1CTM A;  5IOD A;  4L5R C;  2HCC A;  2UU9 Q;  1A6X A;  4A3J H;  4DV0 L;  3RLO A;  3I4M G;  1CZW A;  3L0O A;  4FDB A;  2EVB A;  2LMC B;  1PH9 A;  4OX9 Q;  2Q2U A;  1WTX A;  5CMD A;  1U5K A;  5M3F B;  4OGQ C;  1A0I A;  1G2T A;  3PSI A;  5C3X A;  4NB3 A;  3I4M H;  2OTL A;  2I0Q A;  4AH6 A;  1G29 1;  5IGD A;  1GKH A;  3PUZ A;  3PIP A;  1TU2 B;  3RMH A;  3AB9 A;  1WTH A;  2DNE A;  2G9D A;  1A63 A;  3D0F A;  2PI2 E;  2Z9H A;  5EAY A;  5E1F A;  3SGI A;  1WCM H;  4WRD A;  1LUZ A;  1XWE A;  3HKS A;  4KLK A;  2RKS A;  1U9R A;  1P16 A;  1PMR A;  3PUY A;  2VQE L;  1BUV T;  3WWV A;  3TP6 A;  1BBU A;  2IX3 A;  3K59 A;  4ME5 A;  2WV6 D;  4QIW E;  2HHH Q;  3FEW X;  1VQ5 A;  2KCM A;  1DGS A;  1SNC A;  2PW5 A;  2WAQ G;  4C3J H;  3GD7 A;  3NK9 A;  4A3M B;  4F87 A;  1O7I A;  5ELE A;  4C3J B;  1FNV A;  4AQY Q;  3J80 i;  5J3B A;  1N32 L;  2N88 A;  1ROD A;  5EJW A;  1QUQ B;  1EYC A;  4QY7 A;  1DJR D;  4L5Q A;  1KDC A;  4LF6 Q;  3DUZ A;  4A3D G;  1GUS A;  3PO2 G;  4OEM B;  4CJ0 B;  1QG7 A;  1GVP A;  3GTK B;  3OMG A;  3M85 A;  2E74 C;  5AJ3 L;  4DV4 Q;  4C3I G;  1EU3 A;  2K5N A;  2X69 A;  2AMC B;  4IFD I;  1PFB A;  1XMQ Q;  1ET9 A;  1CHP D;  2KQ3 A;  2TSS A;  2TMP A;  2EJG C;  3N6R A;  2ZTE A;  3CHB D;  1VQM A;  2PQA A;  1J6Q A;  1XYI A;  2Q8R E;  1S3O A;  4F8M A;  1PV4 A;  3R2I A;  1QE6 A;  5D14 A;  1UE6 A;  4YHH Q;  2XVS A;  3PUX A;  2A1A A;  4DXG A;  4A3M G;  1D5M C;  1JWU D;  2WAQ B;  4DXF A;  2JSO A;  1HNW L;  1HUN A;  1YNJ C;  4DR7 L;  1UEB A;  3NE5 B;  2R7Z H;  4BY7 H;  2UXC L;  4H02 A;  4B3T L;  4FF2 A;  2F0M A;  2UU9 L;  1ILP A;  2I07 B;  2E8G A;  3K81 C;  4K5W A;  4HSP A;  5I9O A;  2JQO A;  3JAM E;  4DNI A;  2QDB A;  2EYP A;  4FNF A;  3K0X A;  2EXD A;  4OWX B;  3ZJY C;  5IGB A;  4HIM A;  4R4C A;  1F9Q A;  3M7G A;  3M3Y H;  4IUP A;  2KCN A;  3S14 B;  3X3N A;  4QB4 A;  3MFY A;  2KHI A;  2RSN A;  2ENB A;  4YIJ A;  5BN4 A;  1A62 A;  1YHA A;  3NEM A;  4NXM L;  1NE3 A;  4DR4 L;  3I4M B;  2KEE A;  3EA6 A;  1K8M A;  3I4N H;  4B3T Q;  4DAP A;  1X6O A;  4Y7N B;  1EQT A;  2L9H A;  1GM5 A;  3OWE B;  2CH4 W;  1A3V A;  1NY4 A;  2DJG C;  2EPB A;  3PMF A;  2UXB Q;  1NR2 A;  2N8N A;  3KF8 A;  5CBA E;  3E0J A;  4IUR A;  4RKB A;  3STB D;  2QIL A;  3BDL A;  4NKL A;  4DUY L;  5H1S E;  1BCP B;  4HID A;  4DR6 Q;  3DXJ C;  1NNX A;  3HOZ G;  3PO3 B;  2PO4 A;  4IUU A;  2QKI C;  1HXY D;  1KNA A;  2F0G A;  1Y69 U;  4LF5 L;  4GZY C;  4A75 A;  1TT2 A;  1XJV A;  4DNT B;  3I3C A;  4O2D A;  1E7Z A;  1Q8K A;  3S1M H;  2Q8T A;  2GN5 A;  3F8T A;  3ERO A;  4ZQ3 A;  4LF8 L;  4ILW A;  1RIP A;  1E0B A;  4KJN A;  4NP5 A;  1VQ7 A;  5NUC A;  2F0H A;  5CV9 A;  3D4W A;  4DR4 Q;  4R4I A;  1STY A;  3C1F A;  1EIY B;  3UDX A;  3AQQ A;  4S3S A;  1Y8P B;  1N33 L;  2R92 G;  5K36 H;  5C3E H;  3T16 A;  2AQ2 B;  1PTO H;  3GV6 A;  4QF4 A;  1I50 B;  4A3K G;  2KOL A;  2F0W A;  4CDF C;  4YY3 L;  2IHE A;  2E2D C;  4A3E G;  3S2D B;  4A3K H;  4OON A;  3AYH B;  1CM9 A;  4ZCK A;  1C9O A;  1O7L A;  3LX0 A;  2B29 A;  1D1K A;  1PYB A;  2Z0S A;  4JI3 L;  4BA1 I;  4RMF A;  1D1I A;  3RLF A;  3VR5 A;  5IP9 G;  3A5U A;  3M9B A;  4DR3 Q;  4GKK Q;  3JC6 6;  4WJ4 A;  5ISR A;  1WCM G;  2L1B A;  1IBL L;  4OEL B;  1O80 A;  1L1O B;  3KJO A;  3GP7 A;  1BCP D;  1PLF A;  1S5B D;  3BG3 A;  2NVT H;  2DGY A;  3DM1 A;  2HDL A;  2ZTC A;  2RSO A;  3LNN A;  2B2V A;  3PO2 H;  2BE5 C;  2EQS A;  3ULJ A;  5CV8 A;  1BBW A;  1O78 A;  1Y1W G;  1OXU A;  1Q3L A;  4IOC A;  1G8Z D;  1VQH A;  3NXW A;  2F52 A;  4P75 A;  2IW3 A;  4OWW B;  5JVG 3;  5AJ3 Q;  4DV4 L;  3TRE A;  2K03 A;  1SNQ A;  3VYS A;  5FLM G;  1MJE A;  1AE2 A;  1A8V A;  4DPG A;  5IP7 H;  4OO1 I;  1ML0 D;  5IY0 A;  1WD0 A;  1ESF A;  4CHT B;  3FVQ A;  4A3B H;  3KOJ A;  3QOL A;  1QVF A;  3J81 j;  4L6T B;  4DK0 A;  3BDO A;  1G91 A;  2D2C C;  1PH7 A;  4DR6 L;  2A68 D;  3NBI A;  2JN4 A;  1SYC A;  4DK1 A;  4DV6 Q;  1BBX C;  3QOJ A;  1H95 A;  1U0L A;  2OXP A;  1B3A A;  1EQR A;  2EYM A;  4OHJ A;  4C2M H;  4ZUI A;  4RGO S;  1LM0 A;  3CCQ A;  2Z6K A;  2F0O A;  2Y0S E;  4XIG S;  2EOT A;  5KIX A;  3J80 c;  1ASZ A;  4DU9 A;  2VQF L;  4BY7 G;  5M3F H;  1HNW Q;  3K7A B;  1ZEQ X;  2SNM A;  3UE1 A;  4APV A;  3MXP A;  5EPJ A;  2Z1C A;  1V8Q A;  4LUO A;  2K5Q A;  4LK1 C;  4DKA C;  2HQL A;  2PI2 A;  1W6J A;  5TSS A;  4EQN A;  1A3T A;  4TRD A;  1V1O A;  4C3H G;  4YHH L;  1WCM B;  2A74 C;  4BXX H;  5IT9 c;  1VS0 A;  1TWA B;  1BQQ T;  3HOV G;  2I46 A;  1EY7 A;  3CP0 A;  1SYF A;  5LMN W;  1GOZ A;  2KJX A;  4WJW A;  4RHS A;  2JA6 H;  2PNH A;  3U9S A;  4K14 A;  4DN4 M;  2ZTD A;  2NYZ D;  4A3C H;  1D7Q A;  1TWA H;  4UP9 A;  4OWT B;  2VQE Q;  3QR8 A;  1BDO A;  2EYJ A;  2QDL A;  4QL5 A;  2EY2 A;  3T51 B;  2PNR C;  4IUQ A;  1Q81 C;  4A3K B;  2UUA Q;  5CBE E;  4CKE A;  2IX1 A;  2JA8 H;  4IPG A;  4Y7N H;  4JV5 L;  4KV6 A;  4IZ8 A;  1EYG A;  1EY9 A;  5M5Y H;  5C4Z A;  1YVC A;  2F0P A;  2JA9 A;  4TQU S;  2I5H A;  2CHB D;  4CJ1 B;  1YJW A;  1LAB A;  2CW0 D;  4V0B A;  4X3K A;  5DM6 3;  1HH2 P;  4A93 B;  3PO3 H;  2BA1 A;  2K1B A;  1CKN B;  2A6E C;  3EQL C;  4ZK9 B;  2OCE A;  1LV9 A;  4J15 A;  1HTP A;  5A35 A;  3HOX B;  3HOZ H;  4TVA B;  1LYL A;  3RZO B;  1U4L A;  2JA5 G;  3JAM i;  1C8C A;  4I65 A;  3T1H Q;  3ONA B;  3HFZ B;  3K7U C;  1BNZ A;  1C48 A;  2JJQ A;  4JPB W;  5KYI A;  2CQO A;  5C5M A;  4LF4 L;  5IT9 L;  5FLX L;  4KI0 A;  1U4M A;  2FIN B;  3B6Y A;  1F77 A;  2WFW A;  2LXJ A;  3D6C A;  4JI6 L;  4BS9 A;  3CU7 A;  3K58 A;  1NAP A;  4X64 L;  1K9M C;  1LAC A;  4POG A;  2R61 A;  1STB A;  4XT3 B;  3GTQ B;  2VUM H;  3IFD A;  3D6W A;  3OOC A;  1C0A A;  1PZJ D;  1L0X B;  3I4O A;  3KLR A;  1R4Q B;  1JIC A;  2Y0S G;  4G4K A;  1V43 A;  4EVO A;  3R3O A;  4P2C B;  2B8G A;  1V1P A;  1ONL A;  2E75 C;  3ERS X;  4B3S Q;  4DFA A;  3RZD B;  1XMQ L;  1VMC A;  5IYB G;  1VQ6 A;  2LY7 A;  4KY5 A;  1EZ8 A;  2JEA I;  1IYU A;  3UE0 A;  1PFN A;  3P1H A;  3ER0 A;  3TME A;  3F2C A;  2Z6K C;  1K73 C;  2ZM6 L;  1EQQ A;  4HIK A;  3CC4 A;  1FNU A;  1CUK A;  2R7F A;  4Q5V A;  3EVQ A;  4KHZ A;  3QIA A;  1Y1V H;  3KJP A;  2MO1 A;  3G6J B;  4IO9 A;  3I73 A;  1PFM A;  3C2P A;  3T56 B;  1GUO A;  4B3M L;  3GTG H;  5HY6 A;  1PTO C;  3CCS A;  1H9S B;  2A8V A;  2PW7 A;  1NJI C;  5IYC H;  5C44 B;  4A76 A;  4DV1 Q;  3VYT A;  5JJL A;  3BZD B;  3CPW A;  3RZO H;  1E2Z A;  1DCZ A;  5C0X H;  5EQ0 A;  1SE8 A;  1HR0 Q;  1UUP A;  1TWF H;  2B2T A;  2JA5 H;  3CAM A;  5IP7 G;  5GAE C;  5LL6 S;  3MXG A;  2B63 H;  3OW7 A;  3PUV A;  4FXD A;  1HZ9 A;  3OYY A;  3C1E A;  1FVI A;  4V19 0;  5C4J H;  1FR3 A;  2A6E D;  4FXK C;  1YNX A;  4TSS A;  4A3G B;  4KY6 A;  4X6A H;  3RZD H;  3TS2 A;  1I6H B;  4KHV A;  2F3W A;  4HTH A;  1YBY A;  1FNW A;  1B9N A;  1Q1E A;  1QIL A;  4TKO B;  2L5T A;  2EIF A;  3H0G H;  3AFQ A;  3HOX H;  1I94 Q;  2YU9 H;  3J7A F;  2VUM B;  3C3L A;  1YZ6 A;  1MSG A;  3HG9 A;  1JCK B;  3K6O A;  4CKC A;  4QJF A;  1SYB A;  4YWM A;  4BXX G;  5IWA Q;  1KXL A;  1LTB D;  1N36 Q;  5BR8 Q;  3U9O A;  2ICE C;  4GLV B;  1FJG Q;  2VL6 A;  2XWB B;  1X3Q A;  4C3J G;  4A3I H;  1GUN A;  4JI8 Q;  4HIO A;  4IUV A;  4LF9 Q;  3HOW G;  3H6M A;  3S2H B;  1QVC A;  4DUZ Q;  3E6Z X;  4RAU C;  3M4O B;  1K0R A;  3JAM L;  2NUC A;  3S1N H;  3CQZ B;  1YHB A;  5DM7 3;  2JA6 B;  1K8O A;  4JI0 Q;  5KNC A;  3MA2 B;  3I7F A;  4MZ9 A;  1IKM A;  1J9O A;  5I9P A;  2EYL A;  1S5E D;  5IGC A;  1Y1W H;  3JAM c;  3CCV A;  4BBR B;  4IQZ A;  1YJN A;  4RCN A;  2EY5 A;  1JQY D;  1I4X A;  2B2T C;  4CDE C;  4A3I G;  4FYD A;  2K5H A;  1M90 C;  2MQH A;  4QUF A;  1TS3 A;  1HPC A;  3VA5 A;  1WFQ A;  1ICW A;  3HKZ B;  4FP5 D;  4I7A A;  3CRK C;  5M5X B;  1YIJ A;  2DN8 A;  1L0Y B;  5IOC A;  3M4Q A;  2PMZ B;  4OXP A;  1XNR Q;  2A19 A;  5DLQ E;  1FGU A;  1CKN A;  1PH3 A;  3S16 B;  2BH2 A;  2ZJP A;  3A5Z B;  1TWG B;  1A3U A;  3T53 B;  4UY8 C;  3LWU A;  2K05 A;  4ZRZ A;  1EEF D;  3GTM H;  4P73 A;  2Z4I A;  2ASB A;  3K8A A;  3HOY H;  3MXN A;  1Z6H A;  1XMO Q;  2L11 A;  2F4V Q;  1DOM A;  4A3G G;  3I4N G;  4HJ7 A;  2VXW A;  2HCI A;  2MO0 A;  3SVM A;  3VR4 A;  4JW0 A;  2ZJR A;  3TP7 A;  4LMQ D;  4C1N K;  2IT1 A;  1SNP A;  2Q2H A;  1OXV A;  4DV5 L;  4R4Q A;  1MBY A;  1VQ9 A;  4PNY A;  4EX5 A;  2B8F A;  3F2B A;  4A3F G;  1A2T A;  1IYJ B;  2RHQ B;  3U58 A;  4PV1 C;  1OTC A;  5IYC G;  1BOS A;  4K6L A;  2JE6 I;  2R93 H;  1OXX K;  1EIG A;  1EUJ A;  1TWH H;  3M7N A;  2F0J A;  2R7Z G;  3CME A;  5IWA L;  2H1E A;  4BY1 G;  2J4X A;  5FO9 B;  2WII B;  1IBK Q;  3DEP A;  3FPP A;  3S2H H;  4JG2 A;  1WYD A;  2OEO A;  1JT8 A;  2EYO A;  5IYD G;  4PMB A;  2JA7 B;  4DV2 L;  2NBF A;  2KHJ A;  4IAL A;  1K83 H;  3HEJ A;  4N9T A;  1CHQ D;  2NB0 A;  4DV3 L;  5D3D A;  4RGT A;  3C46 A;  3BJU A;  2R3Z A;  2RDF A;  1KLU D;  3FKI G;  1S72 A;  2HQE A;  5G3L D;  1FL0 A;  4IN3 A;  3HP3 A;  3V2T A;  3TZU A;  3KLW A;  1EEI D;  4JYA Q;  4GLA C;  3HOU H;  2R93 G;  3ICE A;  1VMP A;  2F0E A;  4WOR A;  5D3I B;  5BR8 L;  1IKL A;  2EYF A;  1PTO D;  2A69 D;  2K14 A;  1SJH D;  5JJI A;  1RDP D;  3GDE A;  1EQV A;  1F2Z A;  1VDZ A;  1N8R C;  1MGS A;  2I5M X;  2RHS B;  3S24 A;  2HIV A;  4RKL A;  2DY7 A;  1SNO A;  1X54 A;  3V05 A;  3CKI B;  3QO2 A;  1DYQ A;  2AKW B;  5D65 A;  4IUN A;  2Q2T A;  1PVO A;  3L2P A;  1IHZ A;  1PFS A;  3TP8 A;  4JI3 Q;  1CFM A;  1H9M A;  5LHY 1;  5FLX c;  3GTO H;  4LNQ A;  2F1M A;  5IE8 A;  3QB3 A;  3ITP A; 
#chains in the Genus database with same CATH homology
 1A8V A;  4DPG A;  5IP7 H;  5M5X H;  4OO1 I;  1PH8 A;  2CKZ B;  1C7Y A;  3RNU A;  5IY0 A;  4DK3 C;  2WB1 E;  1ASY A;  4UPA A;  3CMA A;  1LTL A;  4A3M H;  4YY3 Q;  2UU9 L;  4A3B H;  1J5E L;  4YCU A;  3KOJ A;  3HOX G;  4JI8 L;  1NTG A;  1E1O A;  2ZJQ A;  5GAH C;  1OXS C;  1QVF A;  3E9I A;  3J81 j;  2NVQ H;  4R1J A;  4A93 G;  1QZH A;  3U4V A;  1Z47 A;  4GN3 B;  2RF4 A;  2K75 A;  1HNX L;  3RLN A;  1PH7 A;  1SN8 A;  2AWN A;  4DR6 L;  1KL9 A;  4JI5 L;  3PUW A;  1H95 A;  4DV6 Q;  2NZH A;  2UUB Q;  4HJ5 A;  2F4V L;  1U0L A;  2H5X A;  1I3Q H;  3IRB A;  1N34 L;  3E0E A;  1N33 Q;  1L1O C;  4BA2 I;  1PH5 A;  2JK8 A;  1EQR A;  3KF8 B;  4LWC A;  1GD7 A;  4DV0 Q;  4C2M H;  1LM0 A;  3S17 H;  1GO3 E;  2ALY B;  3CCQ A;  1IBM L;  2Z6K A;  4JI2 Q;  4LFB L;  4NXN L;  1HNZ Q;  1R9T H;  2Y0S E;  4AIM A;  4XIG S;  1IXR A;  2OQ0 A;  3J80 c;  1ASZ A;  2VQF L;  5JJK A;  1XNQ Q;  4BY7 G;  5M3F H;  4DV3 Q;  1HNW Q;  3CCJ A;  3UE1 A;  1WJJ A;  4APV A;  4X66 Q;  4JI7 L;  2OWO A;  1Y14 B;  1SRU A;  4LUO A;  1I6H H;  1Q1B A;  2L15 A;  2HQL A;  4DKA C;  5M3M G;  3PGZ A;  1JJ2 A;  2PI2 A;  3TEH B;  2QGQ A;  4JV5 Q;  4X62 Q;  4JCV E;  4K0K L;  4X65 Q;  4YHH L;  4DR5 L;  3UDI A;  1S40 A;  4B3R Q;  4BXX H;  5IT9 c;  1JJC B;  4C3H H;  4DUY Q;  1VS0 A;  2WP8 J;  2D0P A;  2R7D A;  4PG3 A;  4LFA L;  4OX9 L;  4IFD G;  3HOV G;  1SLJ A;  3CP0 A;  4ME3 A;  4A3J G;  1WOC A;  5ELO A;  4DAM A;  5LMN W;  1EOV A;  3J81 c;  1MIU A;  3PV0 A;  1QZG A;  1EFW A;  4LF4 Q;  2ES2 A;  1UWV A;  1MKH A;  2JA6 H;  2KEN A;  1V1Q A;  2PNH A;  4DV7 Q;  2UXB L;  5C3E G;  3G48 A;  4PZ7 A;  2ZTD A;  1VQ4 A;  4UP7 A;  4A3E H;  2JEB I;  3U50 C;  3J81 i;  4A3C H;  1D7Q A;  1E22 A;  1TWA H;  1HJP A;  3HOU G;  4UP9 A;  3PF5 A;  2NN6 I;  4OWT B;  2VQE Q;  3ULP A;  3A74 A;  4DR7 Q;  1XNR L;  5C44 H;  3G6E A;  4QL5 A;  4YCW A;  2D62 A;  1Q81 C;  2UUA Q;  4HJ8 A;  1HZC A;  2IX1 A;  2DUD A;  3CW2 C;  3LGJ A;  4IPG A;  4JI1 L;  4JOI A;  1MJE A;  4LF5 Q;  4LF6 L;  4NXM Q;  1G6P A;  4A3G H;  4Y7N H;  3HOV H;  1I5F A;  3AEV A;  4JV5 L;  1FJG L;  1EYG A;  1Q86 C;  3J7A 5;  1V9P A;  5M5Y H;  1YVC A;  4JI4 L;  2JA9 A;  1VQD A;  2I5H A;  3I2Z A;  4TQU S;  3S16 H;  3BZC A;  1TXY A;  4DK6 C;  1AE3 A;  1YJW A;  4GOP B;  1Z9F A;  1HH2 P;  1KC8 C;  3PO3 H;  2BA1 A;  4GN5 A;  5FJ8 H;  1CKN B;  4X64 Q;  2OCE A;  2KBN A;  2PQA B;  3DM3 A;  4J15 A;  4A93 H;  3GTQ H;  4TVA B;  2IX0 A;  3HOZ H;  1UE1 A;  5E7N A;  1LYL A;  4P71 A;  4YWK A;  2QA4 A;  2JA5 G;  3JAM i;  4IFD J;  1VCI A;  3T1H Q;  2WAQ E;  4A3B G;  3GTJ H;  4BY1 H;  2YTX A;  1Q12 A;  1IBM Q;  3HFZ B;  3A0J A;  5C0X J;  3K7U C;  5GRO A;  2IHF A;  2JJQ A;  2B3G A;  1VQA A;  1VQI A;  2CQO A;  3W1G A;  3T1H L;  1VQP A;  1JMC A;  4DV1 L;  4LF4 L;  1KQS A;  3S14 H;  4GOP C;  4KI0 A;  3B6Y A;  2D0O A;  1VQE A;  2WFW A;  2LXJ A;  3T1Y Q;  4JI6 L;  3VDY A;  2VW9 A;  4X64 L;  1NBW A;  1SR3 A;  1WI5 A;  2UUB L;  1X9N A;  5JEA J;  1K9M C;  2CCZ A;  4POG A;  1PH6 A;  3I56 A;  3CC2 A;  4POF A;  2VUM H;  3FP9 A;  2E2J H;  2OQK A;  1VQF A;  3H3V H;  1X55 A;  3FKI H;  4NPS A;  1JB7 A;  3K80 C;  3KYH C;  2MNA A;  1N32 Q;  3H0G G;  4P72 A;  1C0A A;  1IZ6 A;  3I4O A;  4DAY B;  2CWA A;  2Y0S G;  1YIT A;  5JEA G;  1V43 A;  2LXK A;  3EBE A;  1EWI A;  2CFM A;  2VQF Q;  3PF4 A;  4IOA A;  1JE5 A;  1VQL A;  5C4X G;  4GOP A;  2UUC L;  3ERS X;  4B3S Q;  3S1R H;  4JBJ A;  2ATW A;  2FXQ A;  3KDF B;  1CKM A;  4L5R C;  4BBS G;  5M3M H;  3OTO Q;  1XMQ L;  2UU9 Q;  5IYB G;  4EQ5 A;  5C0X G;  4PMW A;  1VQ6 A;  4A3J H;  2UUC Q;  5FLM H;  4JBW A;  4DV0 L;  3CCL A;  1EIF A;  4IJH A;  3RLO A;  2LSS A;  2JEA I;  3UE0 A;  4ALP A;  2JA8 H;  3I4M G;  4FDB A;  3L0O A;  1N34 Q;  3ER0 A;  4GNX C;  1PH9 A;  2JA7 G;  2QEX A;  3F2C A;  4OX9 Q;  2Z6K C;  1K73 C;  2Q2U A;  4DUZ L;  1U5K A;  2ZM6 L;  1A0I A;  1EQQ A;  4A3C G;  4HIK A;  3CC4 A;  3PSI A;  1CUK A;  2XGT A;  4NB3 A;  3KFU A;  2R7F A;  3CCU A;  2OTL A;  3I4M H;  2K5V A;  2I0Q A;  1VQB A;  1G29 1;  1L2F A;  1G51 A;  1GKH A;  4KHZ A;  4A4I A;  4AH6 A;  1Y1V H;  3PUZ A;  3KJP A;  2MO1 A;  4QQB X;  3PIP A;  4YCV A;  4IO9 A;  2ID0 A;  1XPO A;  2E2H H;  1A63 A;  3D0F A;  1CKO A;  2PI2 E;  5EAY A;  3SGI A;  1T9H A;  3GTK H;  1WCM H;  3F1Z A;  1LUZ A;  4IPC A;  5HY6 A;  3PIO A;  4B3M L;  3HKS A;  4KLK A;  3GTG H;  2IY5 B;  1CSP A;  2YTV A;  1HZA A;  3CCS A;  2A8V A;  1P16 A;  3PUY A;  1NJI C;  2VQE L;  1VQJ A;  5IYC H;  3BU2 A;  3CPF A;  1BBU A;  2F3I A;  2YTY A;  1B70 B;  3WWV A;  4A76 A;  2VS1 A;  4DV1 Q;  1HNZ L;  3KF6 B;  4JI2 L;  5JJL A;  1UE7 A;  1X3E A;  2K50 A;  3CPW A;  3AFP A;  2JA6 G;  3RZO H;  1AH9 A;  4QIW E;  2HHH Q;  2HHH L;  1N9W A;  5FLM G;  1X65 A;  4B3S L;  1SE8 A;  1PH1 A;  4A3L G;  1Y1V G;  1VQ5 A;  2KCM A;  1DGS A;  3TS0 A;  1HR0 Q;  2KCT A;  2WAQ G;  4C3J H;  1XPR A;  1TWF H;  3GD7 A;  2JA5 H;  3CAM A;  5IP7 G;  1O7I A;  4IPD A;  2R92 H;  4P74 A;  5GAE C;  4AQY Q;  2B63 H;  3PUV A;  4IJL A;  1HZ9 A;  3J80 i;  2BH8 A;  3OYY A;  3PO3 G;  2UXD L;  5J3B A;  1UE5 A;  1N32 L;  1FVI A;  4K0K Q;  1QUQ B;  5C4J H;  4QY7 A;  4AYB E;  3S2D H;  4L5S A;  3CCR A;  4DR3 L;  1YNX A;  4L5Q A;  1YI2 A;  4GKK L;  2E2I H;  4KHP L;  4X6A H;  3RZD H;  4LF6 Q;  3TS2 A;  4JI1 Q;  4A3D G;  2VUM G;  2GVB A;  3PO2 G;  2I5L X;  4RG1 A;  1I50 H;  1GVP A;  3KF6 A;  1YBY A;  1Q1E A;  3M85 A;  4LUZ A;  5FJ8 G;  5AJ3 L;  1L0W A;  4DV4 Q;  4JBK A;  2K5N A;  3I55 A;  2EIF A;  5LMN L;  2B63 G;  2AMC B;  1YJ9 A;  4IFD I;  3CXC A;  3H0G H;  1XMQ Q;  3AFQ A;  2K52 A;  4DV5 Q;  1KD1 C;  4MNO A;  2E5L L;  1D8L A;  3HOX H;  3TRZ A;  1I94 Q;  4GNX A;  1VQN A;  2ZTE A;  5HGQ A;  2YU9 H;  1VQM A;  1YZ6 A;  1W3S A;  2PQA A;  1PA6 A;  1XTD A;  1JJG A;  1J6Q A;  3HKZ G;  4UP8 A;  4GS3 A;  1S3O A;  4JI5 Q;  1K8A C;  1PV4 A;  4QJF A;  4YWM A;  1UE6 A;  4YHH Q;  2YYZ A;  5IWA Q;  1HNX Q;  3S15 H;  1XMO L;  1N36 Q;  1IBL Q;  4BXX G;  1KXL A;  3PUX A;  5BR8 Q;  1P8L A;  4GLV B;  1HR0 W;  2PMZ E;  4PZ6 A;  1FJG Q;  2A1A A;  2VL6 A;  2JA7 H;  3DLL A;  4WJ3 M;  1X3G A;  3RN5 A;  5IYD H;  4JC0 A;  4A3I H;  4JI8 Q;  4A3M G;  3U4Z A;  4HIO A;  4JYA L;  1J5E Q;  2XTI A;  1KIX A;  4LNQ A;  1X56 A;  4JI7 Q;  4LF9 Q;  3HOW G;  4OO1 G;  1QVC A;  4BBR G;  4X66 L;  4DUZ Q;  3GTP H;  4AYB G;  1PH4 A;  1HNW L;  1K0R A;  4DR7 L;  1UEB A;  1XNQ L;  3T1Y L;  3S1N H;  1YHB A;  1KAW A;  1NMG A;  2R7Z H;  4BY7 H;  4JI0 Q;  5C4X H;  4GNX B;  4H02 A;  2RCN A;  3MXN B;  4B3T L;  2UXC L;  4LFB Q;  3EN2 A;  3I7F A;  3E9H A;  2NVX H;  4MZ9 A;  4GLX A;  2E8G A;  1SRO A;  3K81 C;  4DV2 Q;  3OW2 A;  4HJ9 A;  3M4P A;  5IP9 H;  3NEN A;  5GAD C;  2JQO A;  4R4O A;  2AWO A;  1XPU A;  2N3S A;  1Y1W H;  3JAM c;  3CCV A;  4DNI A;  2HIX A;  3K0X A;  2EXD A;  3D31 A;  4OWX B;  3HKZ E;  3ZJY C;  4HIM A;  5IYB H;  1E24 A;  2NVY H;  1YJN A;  4LF7 Q;  1QUQ A;  4LFA Q;  4R4C A;  3HOW H;  1BVS A;  1K3R A;  4A3I G;  2K5H A;  2Q2I A;  3GTL H;  1M90 C;  3M3Y H;  3CD6 A;  4PZ8 A;  4DR5 Q;  2N78 A;  2MQH A;  4X65 L;  1Q82 C;  2KHI A;  3NBH B;  4X62 L;  1PHJ A;  3CC7 A;  1PYS B;  1WFQ A;  2C35 B;  3J7Z C;  1A62 A;  1YHA A;  3NEM A;  1YIJ A;  4NXM L;  3CCE A;  1NE3 A;  4LFC L;  2UUA L;  4DR4 L;  2CWP A;  2V1C C;  5ELN A;  2VNU D;  3M4Q A;  1YEZ A;  3I4N H;  1XNR Q;  4OXP A;  2A19 A;  5M5W H;  4B3T Q;  4JI6 Q;  5DLQ E;  1FGU A;  3M4O H;  1CKN A;  5GQO A;  1PH3 A;  5C0X I;  2BH2 A;  5K36 G;  1X6O A;  4DR1 Q;  1E1T A;  1GM5 A;  2ZJP A;  3S1Q H;  3A5Z B;  2K4K A;  2NZO A;  3PCO B;  4UY8 C;  4IPH A;  1NY4 A;  4DV7 L;  2UXB Q;  1OXT A;  3RR5 A;  3GTM H;  2N8N A;  4P73 A;  2ASB A;  3EIV A;  3K8A A;  3K7A H;  1NMF A;  3G4S A;  1IL2 A;  3HOY H;  4BBR H;  1XMO Q;  1QVG A;  1W2B A;  4BBS H;  4LW1 A;  4GKJ L;  4JOI C;  3STB D;  2F4V Q;  4DUY L;  5H1S E;  4A3G G;  2MFI A;  3I4N G;  4HID A;  4HJ7 A;  1SFO H;  4DR6 Q;  4R4T A;  3CQZ H;  1B7Y B;  4GKJ Q;  4JI4 Q;  4LF7 L;  3HOZ G;  2MO0 A;  2ZJR A;  1KRS A;  2HT1 A;  2IT1 A;  2VZA A;  1VQK A;  4LF5 L;  2Q2H A;  1I94 L;  4A75 A;  1OXV A;  4DV5 L;  4O0A A;  1XJV A;  4LUV A;  1TWC H;  3W5O A;  2E5L Q;  4LF8 Q;  4O2D A;  1E7Z A;  5LMN Q;  1Q8K A;  3S1M H;  4JI0 L;  2UXC Q;  2GN5 A;  4R4Q A;  3F8T A;  1VQ9 A;  5LMU L;  1M1K C;  4LF8 L;  1RIP A;  3MEF A;  4EX5 A;  3F2B A;  4A3F G;  1VQ7 A;  4Y52 H;  4NXN Q;  3H3V I;  1IYJ B;  5C44 G;  2RHQ B;  4LFC Q;  4DR4 Q;  3U58 A;  1TWG H;  2NN6 G;  2YV5 A;  4R4I A;  1OTC A;  5GAG C;  5IYC G;  1EIY B;  2R6G A;  3UDX A;  2JE6 I;  3AQQ A;  1OXX K;  2R93 H;  3NEL A;  1EUJ A;  1X3F A;  1N33 L;  2R92 G;  2VY3 A;  1TWH H;  3STB C;  3M7N A;  2R7Z G;  3CME A;  5IWA L;  1PH2 A;  5C3E H;  4BY1 G;  4B3R L;  4AQY L;  1VQC A;  3UDF A;  1IBK Q;  4GN4 B;  1L1O A;  4MTN A;  1K8G A;  3S2H H;  4JG2 A;  3H15 A;  4A3K G;  1WYD A;  2WB1 G;  5M3F G;  3W1B A;  1JT8 A;  5IYD G;  3UDG A;  1BKB A;  3F2D A;  1B8A A;  1VQO A;  1CSQ A;  4DV2 L;  2BA0 A;  2KHJ A;  1K83 H;  4YY3 L;  2IHE A;  4A3E G;  1Q46 A;  1SMX A;  4A3K H;  4OON A;  3AYH B;  4DV3 L;  1Q7Y C;  4L5T A;  3BJU A;  4A3L H;  1C9O A;  3G71 A;  4A3F H;  2B29 A;  1HZB A;  2JA8 G;  1PYB A;  3FKI G;  1S72 A;  2Z0S A;  4JI3 L;  1E3P A;  4BA1 I;  1YHQ A;  1FL0 A;  4RMF A;  4HJA A;  4B3M Q;  3RLF A;  4LF9 L;  3KLW A;  4JYA Q;  5IP9 G;  3A5U A;  4GLA C;  3RN2 A;  1KHI A;  4YWL A;  4KHP Q;  1MJC A;  3HOU H;  3M9B A;  2R93 G;  4DR3 Q;  4GKK Q;  3ICE A;  3JC6 6;  5BR8 L;  4WJ4 A;  1VQ8 A;  1WCM G;  1N36 L;  1IBL L;  1L1O B;  3KJO A;  2NVT H;  2UXD Q;  4DR2 L;  1IBK L;  2DGY A;  4DV6 L;  4QGU A;  2ZTC A;  2K14 A;  3GO5 A;  2AHO B;  2ZM6 Q;  5JJI A;  3GDE A;  4DR2 Q;  4JBM A;  2N49 A;  4XTC S;  1KRT A;  3PO2 H;  1N8R C;  2EQS A;  3ULJ A;  4A3D H;  2GVA A;  1BBW A;  2RHS B;  2I5M X;  3S24 A;  1OXU A;  3CF5 A;  1Y1W G;  3BZK A;  3ULL A;  4IOC A;  1VQH A;  1HR0 L;  2OTJ A;  2HIV A;  3HOY G;  1X54 A;  2F52 A;  3Q8D A;  3TQY A;  2AKW B;  4P75 A;  4OWW B;  2Q2T A;  1PVO A;  3OTO L;  3L2P A;  3L7Z C;  4C3I H;  1PFS A;  3KDF A;  3FHW A;  5IE8 A;  4JI3 Q;  1RL2 A;  5FLX c;  5AJ3 Q;  4DV4 L;  3GTO H;  3TRE A;  4DR1 L;  3CCM A;  5LMU Q;  1VQG A;  1AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...