2YU9H

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
molecule tags Transcription,transferase/dna-rna hybrid
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yu9H00
5M5WH 2XTIA 4JC0A 3PUWA 3NELA 4LF4Q 4A3DG 1Q86C 1Y1VG 3EIVA 1VQ5A 1FJGQ 3A5UA 4LF5Q 4GLVB 1N36L 2GVBA 1XMOL 2B63H 4JG2A 4DV0Q 1VQMA 2F52A 4X64Q 2ZJPA 1A0IA 4HJ7A 4A3JH 1YIJA 3E0EA 1KD1C 3GD7A 4GKKL 4K0KL 1OXXK 2YTVA 5EAYA 2DGYA 4GNXC 2WP8J 3RN5A 3E9IA 4YHHQ 4A3DH 2UUBL 3TREA 5IWAL 5M5YH 2LXJA 3CCUA 1GM5A 3ULPA 5ELOA 4LFBQ 3CCVA 5IYDH 4GS3A 3G48A 2OWOA 2YTYA 4C3JH 4A93H 2UXCQ 4B3SL 2B3GA 4POFA 5C0XJ 4UP9A 3J81c 4A3KG 5AJ3Q 3STBC 4JI0L 2F4VL 3I7FA 2LXKA 3J81i 3EN2A 5FJ8G 1HH2P 5FLMH 1N32L 4RMFA 1FJGL 1TWFH 3F2CA 1OXUA 2KCMA 3WWVA 2AKWB 2AWNA 3JAMi 3AFPA 1VQCA 3PGZA 4A3LG 2N78A 1UWVA 2LSSA 2XGTA 2C35B 2K75A 4O0AA 4JI8Q 4O2DA 5GQOA 4DKAC 1K3RA 3OW2A 4LF8L 4A3EG 2K5VA 5C3EG 2E5LL 3S1NH 4B3RQ 1L1OA 1M1KC 1VQLA 4NXNQ 3HOVH 1PYSB 3GTOH 1V9PA 1B8AA 1Y1WH 4WJ3M 1J6QA 5M3FG 3HFZB 4QL5A 1K73C 3DLLA 4BBRH 3CCMA 1XPRA 1HR0L 3S16H 4DAYB 4JYAQ 1WJJA 2JJQA 1PH7A 2NZHA 5C0XG 2QA4A 1JT8A 5JEAJ 4POGA 3HOZH 1WOCA 2MNAA 1AE2A 4NPSA 1N34L 2Q2HA 4AQYQ 2RCNA 1AE3A 2BA0A 3S1MH 4A3EH 4JI0Q 4OWXB 2UUAQ 1LYLA 2PI2E 4JI3Q 1X9NA 3M4PA 4A75A 1XMQL 4LFBL 1KHIA 1JJ2A 2ZM6Q 1YVCA 1UE7A 4Y52H 5HY6A 3PO3G 4GOPA 1LUZA 2BH8A 3CMAA 2YV5A 1Q12A 1TWCH 3TS0A 1KIXA 1K0RA 1SROA 3K80C 3KYHC 4JV5Q 4IFDJ 5FLMG 1PH3A 5C0XI 1Q81C 4LF6Q 4BBSG 5K36G 2OQKA 2HQLA 1HZ9A 2NVXH 1XMOQ 1SN8A 2N49A 4A3KH 3BJUA 3JAMc 1P16A 4A3MH 4A3GH 5FJ8H 1IYJB 1CKMA 5FLXc 4X65Q 1I94L 1JB7A 2WB1G 3KF6A 1X65A 2JQOA 3MEFA 4GN4B 4MZ9A 1YJNA 2E5LQ 5JEAG 3AEVA 4PZ6A 1Q7YC 2MO1A 1J5EQ 1M90C 1IBLQ 3KOJA 3A5ZB 3U50C 4A3GG 4FDBA 2PMZE 3CCQA 2OQ0A 4IPHA 1IZ6A 4PZ8A 2NVYH 2NZOA 3S24A 3ER0A 1B7YB 1BBWA 3HKSA 2R7FA 2AHOB 3H0GG 4P73A 2ZM6L 2VQEL 4GN5A 1X55A 3S2DH 2JEAI 4R1JA 2I0QA 2CCZA 4B3SQ 4BXXH 4WJ4A 4NB3A 3TQYA 4DUYL 4BA2I 4A4IA 2R7ZG 4DV1L 3A0JA 1J5EL 1PH4A 5IE8A 3AQQA 3NBHB 3I55A 4DV3L 2PI2A 4JI7Q 4GOPC 3HOZG 4OWTB 3S17H 2CWAA 3JC66 1YEZA 4PG3A 4MTNA 3CPWA 1IXRA 1K8AC 1QVCA 4KHZA 4X64L 1PHJA 4DV0L 1FL0A 3L0OA 1NE3A 1EYGA 4OONA 4P75A 4A76A 2A1AA 4BA1I 1N36Q 4IJHA 1OXTA 2RHSB 4BBRG 3S14H 2YTXA 4HJ8A 4R4IA 4H02A 4L5RC 2JA5H 4BY1G 3KFUA 4JOIC 4DR1L 2VS1A 2UUCQ 1Y14B 4QQBX 3FP9A 1E1TA 3PUYA 4JBWA 2YU9H 4JBMA 4LF7Q 3HOYH 3PF4A 4LUVA 4JI8L 2NVQH 1NTGA 5IYCH 1HZAA 5C4XG 1CSQA 4AQYL 5IP7H 2UXCL 2CWPA 2JA5G 2NN6I 3LGJA 5AJ3L 2F4VQ 2ZTCA 4OX9L 1LTLA 2R93H 1UEBA 3KDFB 1YHQA 1JMCA 4JI4Q 3F2DA 2PNHA 4NXMQ 1WFQA 1OXSC 1SFOH 1PVOA 4DAMA 4DR2L 2R92G 1GO3E 3T1YQ 4K0KQ 3KJOA 3TS2A 3M3YH 3S15H 4DV4Q 2KCTA 1NMGA 2K5HA 5IYDG 3L2PA 1SR3A 2K52A 4BY7H 3A74A 3KF6B 4KHPL 1E24A 2WAQE 2RF4A 1TWAH 1XTDA 3FKIG 2MQHA 3GO5A 3HKZE 2IT1A 1SLJA 1Y1WG 2QEXA 4LF5L 1XNQL 4YWKA 4IPDA 4DR4Q 4BXXG 3CCEA 3G4SA 3RZDH 2CKZB 1HZBA 3RN2A 4JCVE 3GTPH 4IOAA 4IPGA 3PIPA 4DR1Q 2B63G 3CQZH 3H0GH 2V1CC 4DUZQ 4HIDA 2ZJQA 4DV3Q 4JI7L 4B3MQ 1Q82C 3CF5A 3T1HQ 1N32Q 1EWIA 3PIOA 1IBKL 3PV0A 3SGIA 4TVAB 2UXBQ 3E9HA 1A63A 4YCWA 4IOCA 1E1OA 4LWCA 2VQFL 5LMNW 2KBNA 2I5LX 5BR8Q 1HJPA 3M85A 4YWLA 3I4MG 1PH1A 2K50A 1L1OC 4Y7NH 3BU2A 4DV6Q 3RNUA 4QY7A 1X3GA 2RHQB 2K5NA 1NJIC 2UXDL 5GADC 4IFDG 1PA6A 1PV4A 3I4MH 1QUQA 1P8LA 4KI0A 1WCMH 4X66L 5H1SE 4DR2Q 1XNRQ 2FXQA 4X6AH 2Z0SA 3FHWA 3U4ZA 1I50H 1YJ9A 2A8VA 2IHFA 1L2FA 1VQBA 3D0FA 1PH2A 3RZOH 2IY5B 3M7NA 2JE6I 4GKJL 4DK6C 1NMFA 2JK8A 5GAEC 2I5MX 3CPFA 3ZJYC 3U4VA 2HT1A 3BZKA 1S72A 4JBJA 5JJKA 1YHBA 1CUKA 3UDIA 3BZCA 1T9HA 2EIFA 1YHAA 1C7YA 1D7QA 2JA7G 1Q46A 3STBD 3UDFA 3GTQH 2MO0A 1VQFA 1HR0Q 2AMCB 3F2BA 4DUZL 4QJFA 4TQUS 4PZ7A 3PUZA 1QUQB 3I56A 2Q2UA 1WYDA 4A3IG 1QVGA 4LF8Q 3J7A5 2Q2TA 3M9BA 1VQJA 3TEHB 4JI5Q 4DV5Q 2HHHL 4LUZA 2NN6G 4JI3L 1X54A 1Z9FA 1OXVA 2R93G 4A3MG 4LFCQ 1UE6A 3AYHB 3K0XA 2AWOA 1G51A 3M4QA 3GTJH 1HNZL 1IBML 1IL2A 2D62A 5M3FH 2UU9L 3W1GA 4DR7Q 1YNXA 4DK3C 1N33L 5JJIA 1I6HH 4AIMA 4JV5L 4AYBG 2JA8H 4JI4L 1JJGA 4HJ5A 1V43A 1YBYA 2ZTDA 2UUBQ 4GN3B 3H3VH 5C4XH 3Q8DA 3CCJA 1GKHA 3F1ZA 4DNIA 1NBWA 2Q2IA 1VQ8A 1SRUA 4DV6L 5LMUL 1EQRA 1S40A 4OWWB 4DUYQ 1GD7A 3HOYG 2VNUD 2JA9A 4JI1L 1YJWA 1BBUA 1V1QA 2IX1A 4A3LH 3DM3A 2D0OA 1KXLA 5M3MH 2VQEQ 4A3BG 4BY1H 1X56A 3AFQA 1D8LA 3K7AH 3ULLA 3I4NG 2R7DA 1MJCA 1TWHH 1S3OA 3CW2C 3H15A 1EFWA 3PUXA 3UE0A 3UDGA 3CC2A 3K8AA 1VQ9A 3TRZA 2OTLA 3GTMH 4XIGS 4IPCA 2BH2A 4A3IH 1WCMG 3GTKH 4APVA 4A3CH 4QGUA 4R4CA 1HNWQ 1A62A 3CMEA 2HHHQ 4DV7Q 1EUJA 3PSIA 3KDFA 4OXPA 4GLAC 2L15A 5IP9H 3HOWG 1KL9A 1HNXQ 4B3TQ 1G291 2ALYB 5C4JH 4L5TA 1VQEA 1CKOA 5IT9c 4C2MH 1EIYB 5C3EH 4YCUA 3UDXA 3T1YL 4JI2L 5LMUQ 4DV1Q 4IO9A 3OTOQ 4A3BH 1EIFA 4NXML 1VQDA 3NEMA 3KF8B 1VQNA 4DV2L 3J80c 4JBKA 2CFMA 2CQOA 1N9WA 1N33Q 1VQHA 3UE1A 4DR7L 1Q1EA 4BY7G 2OTJA 3S1QH 1SMXA 4A3FH 1IBMQ 3D31A 2NVTH 3EBEA 1R9TH 4JI1Q 3RLFA 2UUAL 2E2IH 5C44G 1E22A 4DV5L 1Q8KA 4LF7L 1N34Q 4EX5A 1U0LA 4C3HH 1JJCB 5IWAQ 2GVAA 1MKHA 2UUCL 1A8VA 3ERSX 4PMWA 4GNXB 2HIVA 1K8GA 2ASBA 4GKKQ 1HNWL 1PH5A 4JI2Q 2N8NA 3G71A 4GOPB 2EXDA 2KHJA 2PQAB 3CP0A 2VQFQ 1QZGA 3GTLH 2DUDA 1W2BA 4LFAL 4MNOA 4A3JG 4J15A 4HIMA 1HNXL 2KHIA 1Z47A 3CD6A 1NY4A 3PO3H 2Y0SE 4B3ML 3CAMA 4DV7L 5ELNA 4X62L 3CCSA 2JA8G 2K14A 1VQ7A 1Y1VH 2B29A 1B70B 4DPGA 3M4OH 1O7IA 3H3VI 1YI2A 1K9MC 1SE8A 3CXCA 4OO1I 4B3RL 3U58A 1PH6A 1XNQQ 3I2ZA 1UE1A 2KENA 4UY8C 1K83H 1DGSA 2R6GA 3VDYA 3ICEA 1VQPA 2ES2A 1VQIA 2I5HA 4IJLA 1X3EA 4DR5L 4UP7A 4UP8A 2E2JH 4OO1G 1FVIA 4LF9L 1RL2A 4DR6L 1UE5A 3GTGH 2ZTEA 2VW9A 1G6PA 2A19A 1GVPA 2UXBL 4LNQA 3CCRA 5IP7G 3T1HL 1CSPA 5GROA 4JYAL 1U5KA 1KRTA 4YWMA 4EQ5A 4A3FG 2HIXA 3OYYA 3HOVG 3NENA 4DR3L 2UXDQ 1E3PA 1OTCA 1YITA 2WAQG 2Z6KA 3RR5A 2N3SA 1PH8A 2R7ZH 1FGUA 3K81C 3MXNB 4ME3A 4LUOA 4LFCL 4LFAQ 4NXNL 2ZJRA 1CKNA 4L5QA 3PUVA 4AYBE 1IBKQ 4JI5L 2JA6H 3RLOA 3G6EA 1N8RC 4HIOA 5E7NA 5J3BA 1QZHA 3W1BA 2E2HH 3PO2H 2Y0SG 1VQ4A 1EOVA 3W5OA 4YY3L 4DV4L 1VQ6A 3FKIH 1W3SA 3IRBA 1PYBA 1ASYA 5IP9G 4R4QA 3HOWH 5DLQE 3GDEA 4A93G 2WFWA 1XMQQ 3CC4A 1MIUA 4A3CG 2IHEA 1L0WA 1XJVA 2BA1A 2JEBI 4R4OA 5IYBG 4KHPQ 4LW1A 3B6YA 2ATWA 3HOUG 3L7ZC 3CC7A 4DR5Q 2VY3A 4C3IH 1WI5A 5HGQA 1VQAA 4DR3Q 3S2HH 3ULJA 3I4NH 1MJEA 2JA6G 1AH9A 5M3MG 2IX0A 2Z6KC 3J81j 4OX9Q 2QGQA 4YHHL 1QVFA 1HR0W 4DR6Q 1PFSA 5LMNQ 1I5FA 2VUMH 4KLKA 4YCVA 2UU9Q 4B3TL 4IFDI 1HNZQ 1VS0A 5GAHC 2EQSA 2WB1E 1VCIA 4R4TA 2YYZA 3KLWA 3K7UC 4RG1A 1EQQA 4LF4L 4P71A 5GAGC 3I4OA 1XPOA 2PQAA 1L1OB 3HKZG 4UPAA 1KAWA 4LF6L 1ASZA 4YY3Q 1VQKA 2VZAA 2OCEA 1X6OA 1H95A 1I3QH 1KQSA 4JI6Q 4X65L 3PCOB 1I94Q 2R92H 1HZCA 1CKNB 4BBSH 3CCLA 2D0PA 4ALPA 4DR4L 4GKJQ 2E8GA 3PO2G 4P72A 1X3FA 2K4KA 4AH6A 3KJPA 2H5XA 3HOXG 4LF9Q 1VQGA 2VUMG 2MFIA 1TWGH 4GNXA 2JA7H 4XTCS 1JE5A 1KC8C 1XPUA 2ID0A 4X66Q 1XNRL 1BVSA 1E7ZA 5IYCG 5LMNL 1Q1BA 1C9OA 3HOXH 4GLXA 4HJAA 1LM0A 2VL6A 1TXYA 3J80i 3OTOL 1IBLL 2GN5A 1PH9A 1C0AA 3PF5A 5BR8L 4L5SA 4X62Q 1RIPA 3HOUH 3S1RH 5JJLA 5IYBH 4QIWE 5IY0A 4JOIA 1VQOA 1KRSA 3F8TA 4HIKA 4HJ9A 3J7ZC 4DV2Q 4JI6L 3RLNA 4P74A 1BKBA 2F3IA 1YZ6A 5C44H 5M5XH
chains in the Genus database with same CATH superfamily
2HD3A 3KBGA 1EL0A 3PUWA 3NELA 1F2YA 4F88A 1EWCA 1B2TA 4K5VA 1EYAA 3FMCA 4GLVB 2PO4A 2BCOA 1N36L 4I65A 4JG2A 4X64Q 1YIJA 5EPLA 4GKKL 3QG1A 1Y8PB 3P7JA 4KMUC 3RN5A 2KHSA 5JEAH 4YHHQ 2MHVA 1GM5A 4LFBQ 5IYDH 3UI2A 2OWOA 1K0SA 1PXUA 2B3GA 4JI0L 5C0XJ 5AJ3Q 3H6MA 3J81i 1HH2P 4XYQA 4RMFA 2AKWB 2AWNA 1VQCA 2EY1A 4A3LG 1BBXC 3JAML 5E3FA 3ND8A 3URYA 2K5VA 5C3EG 2E5LL 3S1NH 4B3RQ 1YNJC 3GTOH 1V9PA 1H9SA 5F2DA 1B8AA 4ZLTF 3OPOA 1CQFA 3CCMA 3DEPA 1XPRA 3S16H 2F0SA 1LABA 2B8FA 2QA4A 1V1OA 5CV9A 2EYMA 1AE2A 2F4IA 1LYLA 1SJHD 3M4PA 4A75A 1XMQL 2BDNA 1BOSA 2ZM6Q 1UE7A 1GUTA 3VYSA 4JV5Q 3V05A 1SROA 4HSPA 4FXGC 4IFDJ 1PH3A 5K36G 1ZXTA 2Q8TA 2I07B 1PZJD 3BJUA 5CV6A 3JAMc 1P16A 4A3MH 2K6AA 3P1HA 4KY5A 2RDFA 3S15B 3KF6A 4GN4B 2JQOA 1HNWQ 5EQ0A 1J5EQ 1IBLQ 2PW5A 1SYDA 5L37A 4IPHA 1IZ6A 5CORA 2ZXOA 1NAPA 1A2UA 2RVLA 3S2DH 2CCZA 2YU9B 4X3KA 1I4GA 5FOBB 1KTKA 2J4XA 3T4AC 4E6IA 1D2BA 1FD7D 3FEWX 3M4YA 4IQZA 4A4IA 3A0JA 4DV1L 1J5EL 3EA6A 5IE8A 3AQQA 4DV3L 1PH4A 2PI2A 4IUNA 4QB4A 4GOPC 1SNMA 3R2IA 4OWTB 4N9TA 3S17H 4PG3A 3CPWA 1IXRA 1QVCA 1VF5C 3CRKC 1NE3A 2A1AA 2PNRC 4BBRG 4A3EB 4L5RC 2X6GA 1JR0D 2UUCQ 1BXTA 3FP9A 2F0VA 4LF7Q 1HA6A 4JI8L 5IYCH 5C4XG 1EFID 1LTRD 1LTLA 3GTQB 5K5PA 5C3WA 4JI4Q 1HPCA 1HA5A 5EBDA 3F2DA 1PVOA 2R92G 1CFMA 3M3YH 1R4PB 1NMGA 2EYLA 3L2PA 2K52A 2SNMA 3A74A 4KHPL 2SOBA 1E24A 4B3RL 1Y1WG 1DOMA 3FKIG 4G7HC 2PPBC 2QEXA 4LF5L 3H91A 3GTPB 4X3TA 5KRUA 4DR1Q 3PIPA 1AFPA 1RTOA 3G6JB 4BY1B 3K5NA 1X3QA 1HTLD 3HOXB 1EY9A 2UXBQ 1A63A 2IWHA 1X32A 5LMNW 4LWCA 2I5LX 3M85A 3P20A 1E0BA 1X3GA 2K5NA 1NJIC 1ENAA 4IFDG 1EQTA 2G9DA 1PV4A 1I6HB 1QUQA 4X66L 1XNRQ 1IW7D 3TP5A 1Q90A 5M5XB 3RZOH 3GP7A 2IY5B 3S2HB 5M3FB 1DD2A 3A55A 1NMFA 3EROA 1TWAB 5GAEC 3GTLB 1HQRD 4OHJA 5JJKA 1YHBA 3J81E 2IL8A 1BQQT 4Q0FA 3NTKA 4HN7A 2MO0A 4NW2A 1H9SB 5J1ZA 4A3IG 3KF8A 2R93B 2QKIC 2BDOA 2KJXA 4LMQD 1QVGA 3J7A5 2Q2TA 3TEHB 3BVGA 2HHHL 1T5XD 4B08A 1ENCA 3NPPA 2FINB 2XVSA 2O4XA 4A3MG 3AYHB 2KCNA 1G51A 1HNZL 4JPBW 5M3FH 1YNXA 1HFNA 3I4MB 1SE2A 2UUBQ 4DK1A 1VQ8A 1V8QA 4DNRB 1B4OA 2I46A 4FF2A 3QR8A 3I70A 1EQRA 4DAYA 5KNDA 2L11A 3J80L 1BBUA 1DOKA 4QF4A 3Q24A 4A3LH 2KUMA 1KXLA 1FNWA 5M3MH 4A3BG 3I4NG 3PF4A 1EOTA 3H15A 1VQ9A 2OTLA 2L9HA 1S4ZA 1PLFA 1WCMG 3GTKH 5CYUA 2EY2A 4APVA 4M1UB 1KDBA 1A62A 2ICEC 3CMEA 4DV7Q 2JA5B 1HTPA 4OXPA 5IP9H 5D14A 2FMCA 4EVOA 4K2LA 5C3EH 1TKWB 1VQDA 1HQMC 2EYOA 2SEBD 3KF8B 4DV2L 3J80c 2R3ZA 1TS2A 4DN4M 1YNJD 1N33Q 3UE1A 1BUVT 4DR7L 1O7YA 4FO2A 3S1QH 1LLRD 2AUKA 2EY5A 2PMZB 1J8IA 3DHQA 3ITPA 2FHTA 3X3MA 1N34Q 4LF7L 3CU7A 2B2TA 4CKBA 5IT9L 3K5OA 5CC4A 3NUCA 1WCMB 1JORA 4JI2Q 3G71A 1SMYD 4GOPB 1GUSA 1QZGA 3L9AX 2DUDA 1W2BA 4LFAL 4FXKC 1HNXL 1Z47A 3CD6A 2K1BA 3CAMA 5IGGA 1YNNC 3CCSA 4J6HA 2K14A 1B70B 4DPGA 1FR3A 1EYCA 4C3IG 2E74C 5EKLA 2R6GA 5LL6X 3VDYA 5CBEE 2ES2A 1VQIA 2F0DA 4IJLA 4UP7A 4LF9L 4RHSA 1JB3A 1G6PA 1EY7A 1NR2A 3CCRA 1CSPA 4JYAL 2CHBD 4A3FG 1CA6A 2UXDQ 3HOVG 4DR3L 1ZEQX 1LTTD 3CHBD 5C4JB 5FLXE 1MSGA 4UDUC 1FGUA 3MAQA 2ZJRA 3Q23A 5A35A 1QZHA 5J3BA 2O5IC 4DV4L 3IRBA 2HDLA 3K7AB 2F0LA 2Z8LA 2WFWA 1XMQQ 1MIUA 3S14B 4LW1A 3B6YA 2ATWA 3HOUG 2Z1CA 1TU2B 3L7ZC 5D3IB 3QOJA 5HGQA 3S2HH 1FNVA 2FMMA 1MJEA 5M3MG 2NUCA 3J81j 1RCVD 4DR6Q 5A2QE 1M4VA 4IFDI 4B3TL 1TWHB 1HNZQ 1STNA 4ZAIA 2L0CA 2EQSA 4K8IA 5LHY1 2YYZA 2XRQD 3DWPA 1QILA 4RG1A 2VB2X 1BCPB 1BO0A 1ZYRC 3ZYYX 1XPOA 2PQAA 3M3YB 5EPJA 1KAWA 5CR3A 4HMJA 4YY3Q 2VZAA 1I3QH 1KQSA 4KKTA 1A3TA 3CCLA 4O42A 3Q6SA 4PNYA 3S9WA 4DR4L 4DF7A 1HUNA 3U9OA 4AH6A 3KBXA 3FVQA 2VUMG 1VQGA 3NQIA 3EFXD 2MFIA 1CK1A 4OEMB 5D3DA 1JE5A 2ID0A 4X66Q 3ND9A 1XNRL 5EBCA 5C4XB 4RGOS 1STAA 1KLGD 4GLXA 4HJAA 1LM0A 3VR4A 2VL6A 5M9OA 3MVVA 2K01A 2GN5A 5M3MB 1F2MA 3HOUH 2N55A 5IYBH 3EQLC 1TT2A 4A3KB 2F3WA 3F8TA 4HIKA 2LFNA 3N52A 2RCFA 4P74A 4LF8Q 5C44H 1UEAB 5FLXL 1VMCA 1AN8A 4A3DG 1XTCD 2KA7A 3BDLA 1B9NA 1FJGQ 3SK4A 4F7XA 3X3NA 2GVBA 1XMOL 1EEFD 2F52A 4A3JH 4HJ7A 1F9PA 2IJ0A 3LWUA 3GD7A 3LX0A 4K0KL 1OXXK 2DGYA 5C4HA 4GNXC 5I2XA 3TREA 3T51B 1EZ6A 2MUYA 5ELOA 2YTYA 4UP9A 3J81c 1HCZA 3STBC 3S1MB 2SDFA 3EN2A 2DY7A 5FLMH 1ET9A 4CDDC 3F2CA 4N8FA 3PGZA 3HS0C 1WTWA 3H3VC 5TSSA 1S5DD 2K75A 3OW2A 1K3RA 2B2VA 4A3EG 1RJTA 4HMIA 1VQLA 2HCCA 5EGTA 1RKNA 2B63B 1Y1WH 1PFBA 1ENFA 4IZ8A 2FFKB 4FF3A 1K73C 5KYLA 2XSCA 1W6JA 1SFOB 2NZHA 3MA2B 1WOCA 3I3CA 4NPSA 5EKKA 4AQYQ 1HUMA 2BA0A 3D3RA 3S1MH 4OWXB 2UUAQ 2PI2E 3OMCA 3T13A 4JI3Q 3VYUA 4CJ2C 3HOYB 1KHIA 1YVCA 3NBHA 2MJ8A 3CMAA 2BH8A 2Z4IA 5C3EB 4G7ZC 1TWCH 4XQNA 3K80C 3PO2B 4B9XA 5FLMG 2E2HB 2M2LA 4KN4C 4R8NA 4F87A 1XMOQ 1SN8A 4A3KH 3HZXA 2DJFC 4F8MA 4FF4A 2D9UA 4X65Q 1JB7A 5E4WC 2QCPX 1WTRA 1Q7YC 1M90C 3KOJA 3A5ZB 3AU7A 2L1BA 4A3GG 4L63B 4FDBA 1WTQA 3CCQA 2OQ0A 3KLSX 5C44B 1CA5A 2QDBA 2NVYH 3MHBA 1SSOA 3S24A 1FGBD 2AHOB 2R7FA 3H0GG 4LJZC 2VQEL 1PMRA 5I6WA 5CV5A 4CHTB 2G9HD 2NYZD 4R1JA 2I0QA 3IAYA 4KTAA 1TWCB 2R7ZG 4ZK9B 1KDAA 4JI7Q 3KLSA 2CWAA 4MTNA 4BBRB 1K8AC 4KHZA 1IW7C 2LS01 1EYGA 4A76A 4P75A 2RHSB 1H9JA 4HJ8A 2JA5H 3KFUA 1SNOA 5I6YA 3VR6A 4QQBX 2JA8B 2YU9H 1I4PA 4JBMA 4DA2A 2EPBA 4KN7C 4LUVA 5CV8A 1JOKA 5JOBA 3HOYH 1NTGA 3C46A 1HZAA 1B3AA 1CSQA 5IP7H 1SJED 2CWPA 2XNAC 2A69C 1WTPA 2UXCL 5IODA 2CH4A 3LGJA 2F4VQ 3S1RB 1LT4D 2ZTCA 3KDFB 1YHQA 2PNHA 1SFOH 1OXSC 4DR2L 3HOZB 3T1YQ 2K28A 3WOEA 4IALA 1MI2A 2NTSA 1SYFA 5M5WB 3S15H 1XX8A 2K5QA 2F03A 1LV9A 3DEOA 1XTDA 4BY7B 3GO5A 1IKLA 1XNQL 2IPKD 4P2CB 2EYHA 4WFN3 5C6AA 1PRTF 4BXXG 2C9OA 3CCEA 3RZDH 1KDCA 1RHPA 1TVXA 5IGBA 2RKSA 3GTPH 2A5HA 3CQZH 2NB0A 3H0GH 2V1CC 4CDCC 4B3MQ 1NSNS 3VYRA 1Q82C 4N9PA 3CF5A 2WV6D 2EXZA 5E1FA 1L0YB 2F0TA 1ML0D 1MGSA 5BR8Q 3K0YA 2K50A 2F0EA 1LACA 4DV6Q 4RHRA 1AZQA 1PA6A 2JP1A 2XIWA 1HXYD 3NTHA 1XWEA 3U4ZA 2EJFC 1I50H 4X3SA 5IGFA 1YJ9A 3RZDB 2A8VA 2IHFA 2KQ3A 2F0JA 3M7NA 1TY2A 4RFBA 3SXHA 3ZJYC 3U4VA 3PIP3 5KNCA 3UDIA 2EIFA 3BZCA 3TDQA 4CDFC 1YHAA 1AW7A 2JA7G 3UDFA 1LT5D 3GTQH 2AMCB 3QWNA 4TQUS 3QO2A 3I56A 4XQJA 1EY4A 5JPNC 3J7YW 3BYTB 4OO1H 2EZVA 1X54A 1Z9FA 1GHJA 3OWEB 4LFCQ 1IBML 1T5EA 4K6LA 2D62A 4DR7Q 4DK3C 2QILA 4DFAA 1EYDA 1PFNA 4AIMA 2JA8H 4JV5L 4HJ5A 1E2VA 1V43A 1YBYA 3R2TA 2VXWA 4GN3B 5C4XH 1PTOH 3CCJA 5IGCA 1NBWA 2Q2IA 4IUTA 1TWFB 1KNAA 4DUYQ 2JA9A 5HGTA 1YJWA 3DM3A 2VQEQ 3HOVB 1CI3M 3I91A 4EGVA 1MJCA 1S3OA 3CC2A 1EFWA 3PUXA 3UDGA 3TRZA 2EDGA 1WTOA 3TMEA 4WRDA 3J80E 1LT6D 1LTID 2BE5D 3KDFA 2K5WA 4GLAC 2J0TD 2ALYB 3TZDA 3PMFA 5JVH3 3ONAB 1VQEA 4H7BA 1CKOA 4C2MH 3UDXA 3T1YL 4A3BH 4DV1Q 4IO9A 4V190 4H44C 5LL6S 4NXML 2RQXA 3NXWA 1VQNA 1E2WA 4JBKA 2CQOA 2QF7A 1N9WA 3KLRA 1SMXA 2NVTH 3TP7A 1STHA 2E2IH 4G4KA 3MXGA 1Q8KA 2F0FA 1LO5D 2X6LA 1O78A 1QNKA 1PRTD 1JJCB 2EJGC 5IWAQ 4L6TB 2XWJB 3S16B 5M5YB 3S17B 3ERSX 3NP8A 2QDLA 4GNXB 2HIVA 2ASBA 1HNWL 2B8GA 1PH5A 2WKDA 2EXDA 4OGQC 3GTLH 4A3JG 4J15A 4PMBA 1NY4A 3PO3H 2Y0SE 3VYTA 5ELNA 1EQVA 1Y1VH 2M9VA 3M4OH 3NTIA 3H3VI 1K9MC 2Z6BA 1XNQQ 3I2ZA 1UE1A 4UY8C 1K83H 3MC0B 3ICEA 2IW3A 1JICA 3E3XA 4V0BA 4OIJA 3A54A 3A8JE 1NNXA 1RL2A 1CTMA 4DR6L 3GTGH 2N88A 3J7AV 2K32A 2A19A 2RDGA 1GVPA 1IYUA 4LNQA 5IP7G 3A7AB 5GROA 2F0UA 4YWMA 5T1GA 5CMDA 4EQ5A 3R93A 5BN4A 1EZ8A 2EY6A 1OTCA 1YITA 2O5JC 3OSOA 2N3SA 5DEHA 4DXGA 2KECA 2R7ZH 3K81C 3MXNB 1RDPD 2JA7B 4LFAQ 1A2TA 4L5QA 1STEA 4JI5L 2PZTA 3W5OA 3FKIH 1W3SA 3HOWH 4R4QA 1B9MA 3H94A 1BCPD 2IHEA 1L0WA 4MTKA 4Y7NB 4PMCA 4IUVA 2VY3A 4UHVA 4C3IH 3WOFA 4BBSB 1JE4A 1AH9A 3VA5A 1CT1D 1MHWC 4OX9Q 1I5FA 1JQYD 4QCLA 3MZ5A 1PRTC 5FK9C 4XT1B 4P71A 3W3AA 2NZ1D 1L1OB 1Y8NB 1ASZA 1H95A 1RTNA 5D65A 4OL7A 4XXEA 2L12A 4X65L 4BBSH 2D0PA 3PO2G 1X3FA 3KJPA 2H5XA 3HOXG 2ENBA 2JA7H 1EIGA 2K04A 2F0QA 1C9OA 4S3SA 1SBBB 1F9QA 1IBLL 1PH9A 2F1MA 4L5SA 1Y1WB 5JJLA 2D5DA 2K03A 2K5DA 3Q0AA 3J7ZC 4DV2Q 1PRTB 2XTIA 3K59A 1STBA 5I9OA 3DWAA 3E5SA 1D6EC 4I7AA 3BVMA 3GTJB 3TSSA 2L4NA 1VQ5A 3BS1A 2B63H 4QUFA 1VQMA 4U68A 2ZJPA 1A0IA 1KD1C 3E0EA 2ZXPA 5ISRA 4R9WA 3LWEA 5EAYA 4ZKBB 2WP8J 3GTMB 1HRJA 3E9IA 4XDXA 3RMHA 4A3DH 5IWAL 5M5YH 2LXJA 4C1NK 3CCVA 4C1NI 2UXCQ 4QMGA 2NTTA 1AP0A 2F4VL 1I4QA 2WB1B 1RODA 1VDZA 1L0XB 5I4DA 5FJ8G 1N32L 2DNEA 4L8JA 4ODGA 1FJGL 2AUJD 1OXUA 2KCMA 2A6ED 2XRSD 3AFPA 3BDOA 2N78A 2C35B 3H0GB 4O0AA 4DKAC 5GQOA 2NWGA 4NP5A 4LF8L 1F9RA 1G2TA 5DNFA 2PW7A 2NVXB 1PYSB 3J7AF 2E2IB 1VF7A 4AYBB 5M3FG 3GTOB 2JN4A 3HFZB 1C8CA 4QL5A 3DLLA 4DAYB 3D4WA 4ZRZA 1WJJA 1PH7A 5C0XG 5CBAE 1EY8A 3HOZH 2MNAA 1N34L 2Q2HA 2RCNA 1AE3A 4JI0Q 4DGZA 1SE4A 1X9NA 2L55A 4B9WA 4LFBL 4Y52H 5HY6A 3PO3G 4GOPA 3FPUB 2YV5A 1Q12A 5ELCA 4RA8A 1KIXA 1K0RA 1IKMA 1QCBD 3N6RA 3I72A 4LF6Q 4UAIA 1LTBD 4M8AA 2OQKA 1HZ9A 2NVXH 1Z6HA 4A3GH 5FJ8H 1RD9D 1IYJB 1CKMA 5FLXc 1B50A 1I94L 2X69A 1YJNA 1X65A 3AEVA 2E5LQ 5JEAG 4A93B 1TY0A 1X3PA 4PZ6A 3K58A 1F9SA 2B2WC 3IFDA 4PZ8A 4ZQ3A 3ER0A 1BBWA 3HKSA 4XT3B 2Q8RE 1A3UA 1S5FD 3K5LA 1MBYA 2EJMA 1B3QA 2R7ZB 2JEAI 4PQXA 2O2LD 3SEBA 4WJ4A 1JC7A 1PFMA 4BA2I 1Y1VB 3NBHB 1QWYA 1K8OA 4KD3A 2OT2A 3JC66 1YEZA 4X64L 1PHJA 1DM0B 1FL0A 3L0OA 4OONA 3I8ZA 3P75A 1N36Q 2G5DA 1OXTA 4HTHA 3S14H 5BN3A 3Q22A 1GUOA 4H02A 3V96A 4BY1G 5IOCA 2B2WA 2PYKA 2C5CA 1Y69U 1Y14B 3PUYA 1LTSD 1O80A 4HEDA 1DCZA 2NVQH 4MIUA 2DJGC 5COYA 1STGA 4JK1C 4TRDA 4N8X1 1ICFB 3VA7A 4K5XA 4OX9L 2R93H 1UEBA 1EWHA 4K0KQ 3NWSA 4FP5D 3TS2A 3BDCA 1D5XC 1EU4A 2BOSA 3OIPA 2KCTA 1SR3A 2DY8A 4BY7H 1S5BD 1SNQA 4FNFA 1JJGA 2LMCB 1TWAH 3EVQA 3HKZE 2MQHA 4K8JA 2CKZB 3D4DA 4KD4A 4MHEA 4JCVE 4IPGA 3VR5A 2A69D 2A74C 4DUZQ 4HIDA 2ZJQA 4DV3Q 3RD4A 3T1HQ 1N32Q 1II3A 3PIOA 1IBKL 1QE6A 4IOCA 4A3GB 1E1OA 4HR7B 5KYIA 1HJPA 3I4MG 4YWLA 5DM73 3LNNA 1L1OC 4EQNA 2AQ2B 2F0WA 4KHVA 1P8LA 2QEJC 3D6CA 4ZUIA 4HCEA 4Q5VA 1WCMH 2D2CC 2WKCA 5IIFA 5H1SE 5JVG3 3FHWA 5IGDA 5K36H 3DUZA 3D0FA 2P5ZX 1PDQA 3NSWA 2RDHA 4DK6C 2JK8A 2A6EC 2F3VA 1TS5A 3BZKA 1S72A 5J39A 4EQOA 1C7YA 1D7QA 1Q46A 1B44D 1J9OA 1V1PB 1VQFA 2CW0C 4QJFA 1TQOA 3PUZA 1QUQB 3BVZA 2Q2UA 4KKSA 4KV6A 2J7ZA 5DAUA 3M9BA 2ZXRA 5C0XH 4JI5Q 5C5LA 1PYWD 2JYOA 4LUZA 3DM1A 1I50B 1D5ZC 1UE6A 2E76C 3GV3A 3K0XA 2AWOA 3M4QA 1MSHA 1RF2D 2NVYB 4RKLA 3W1GA 3NK9A 1GUGA 1B53A 5JJIA 2NBFA 4AYBG 5I2YA 3QIAA 2ZTDA 4J8QA 3Q8DA 1GKHA 3F1ZA 1DONA 1SEBD 3F2UA 3TP6A 4CDEC 1GD7A 3HOYG 4JI1L 3SE0A 2TMPA 1V1QA 1DXMA 1A6XA 2D0OA 1H9KA 4ZUJA 1PZKD 2KEEA 2ICIA 3AFQA 3K7AH 3ULLA 1TWHH 3VR3A 3K8AA 4K2KA 1ESRA 3GTMH 4XIGS 2EYPA 2A6HC 4IPCA 4A3IH 2BH2A 3HOWB 3SK5A 1H9MA 4R4CA 2HHHQ 4ZCKA 1EUJA 3PSIA 2DN8A 1LT3D 2L15A 1KL9A 3OOCA 4X3UA 5KGUA 1EEID 1G291 5CGKA 5C4JH 2L5TA 5JPMC 3CQZB 3G7LA 4YCUA 5JJZA 5LMUQ 4NDXA 1EIFA 3NEMA 1BNZA 1I6VC 2H1EA 1GUNA 1VQHA 2NVTB 5KNBA 4BY7G 2OTJA 1CM9A 4ULLA 4RKBA 4A3FH 1IBMQ 3D31A 5CV7A 2TSSA 5A2QL 2CH4W 4DV5L 2M00A 4EX5A 4C3HH 3TN2A 1MKHA 2UUCL 4PMWA 1K8GA 3IL8A 1TR5A 2PCFB 2IX3A 3K57A 1QG7A 3K5MA 1U4LA 4CJ0B 1A15A 1O7ZA 4HIMA 1FNUA 2WAQB 2KHIA 1NCVA 4QUCA 1TS4A 3SDZA 4RGMA 2JA8G 1VQ7A 4CKCA 4GZYC 2OF1A 1SE8A 3CXCA 4OO1I 1F2ZA 3U58A 1PH6A 2B2YC 2KENA 1D1KA 4RCOA 3OIQA 1SXTA 1VQPA 2I5HA 3H09A 2KOLA 3C1EA 4UP8A 2E2JH 4OO1G 1FVIA 3GTKB 1UE5A 2ZTEA 1SNDA 4WORA 1SNCA 2HIXA 3OYYA 3NENA 1E3PA 2Z6KA 3C3LA 2CVRA 4HSVA 1PH8A 4C2MB 4DAVA 4LUOA 4LFCL 1OO9B 4NXNL 3PUVA 4AYBE 3VR2A 2JA6H 1BCPF 3RLOA 3G6EA 2PZUA 4LK1C 2E2HH 2F0KA 3PO2H 1I4RA 1VQ4A 4YY3L 1WVLA 1C48A 1PYBA 1ASYA 5IP9G 3W2DA 5DLQE 4A93G 3CC4A 1NUCA 1WD0A 1XJVA 2JEBI 4R4OA 4KY7A 5IYBG 3CC7A 2MGSA 1WI5A 5I9PA 3BZDB 3I4NH 1QNUA 4NMZA 1EU3A 4WJWA 2Z6KC 1PTOB 2PQEA 1QVFA 1TWGB 1HR0W 3CKIB 2VUMH 2Q8IB 1K8MA 1DZ1A 1VS0A 2WB1E 1KABA 1SNPA 1VCIA 2EE1A 2F0HA 4R4TA 3R8BA 3KLWA 5EPKA 3K7UC 1EQQA 4ABNA 2AQ1B 4LF4L 1JOQA 3I4OA 4A3DB 2MPMA 4LF6L 4ILWA 3U9SA 1X6OA 3E6ZX 4JI6Q 1I94Q 4OIKA 3TZUA 1HZCA 4BS9A 3GTGB 1BCPC 5ELBA 4ALPA 2F0PA 2K4KA 4HAEA 1TWGH 4GNXA 4XTCS 1KC8C 3A8IE 5C5MA 5LMNL 1Q1BA 2A68D 2DNCA 2EYJA 5HURA 1MD2D 1TXYA 1U4RA 3J80i 1HHVA 4A3JB 1C0AA 3PF5A 4X62Q 1SYEA 4QIWE 5IY0A 5BN5A 4RGTA 1VQOA 3QB3A 3C2PA 4JI6L 1JWUD 3RLNA 1YZ6A 1BF4A 5M5XH 3RZOB 2EYFA 5M5WH 1S5ED 4JC0A 3I4NB 4PV1C 1Z7TA 4A3BB 1R4QB 4LF4Q 1Q86C 1Y1VG 3EIVA 3A5UA 5FO7B 3C1FA 5EJWA 4TKOB 2LKVA 4LF5Q 2RA4A 4DV0Q 1F77A 1YNND 2R61A 2YTVA 4FYDA 1G2SA 4RWSC 3TP8A 2UUBL 2E75C 4IN3A 3CCUA 3ULPA 1KNEA 4GS3A 3G48A 4A93H 2CW0D 4C3JH 4B3SL 2K7VA 4POFA 4A3KG 2XWBB 3I7FA 3MTSA 2LXKA 3DWQA 2HCIA 1TWFH 3WWVA 3JAMi 1U4MA 4ZKCB 1DYQA 1PTOC 1UWVA 2LSSA 2XGTA 2Z9HA 4O2DA 4J1MA 1L1OA 3NBIA 1M1KC 4NXNQ 3HOVH 1I4HA 3L3OC 4FVMA 4KJNA 4WJ3M 1J6QA 3GQBA 3S1QB 4C56C 1HR0L 4BBRH 3IKJA 3FKIB 3OW7A 4JYAQ 2KCCA 2JJQA 5C4ZA 3QOLA 3BG3A 5DM63 4DXFA 1JT8A 5JEAJ 2Y0SB 4POGA 1H9RA 1CHQD 2BE5C 3PIO3 1WTXA 2LY7A 3K6OA 4A3EH 1S5CD 4C3IB 1QJOA 1JJ2A 1B1ZA 1LUZA 3M4OB 2SNSA 3TS0A 3KYHC 1LTGD 4BWGB 5C0XI 1Q81C 4BBSG 1ILPA 2HQLA 2RSNA 4A3MB 1GJXA 1SE3A 1EY5A 2N49A 2WIIB 1GUWA 2E2JB 2B2VC 5KEEA 2WB1G 1IHZA 3MEFA 4MZ9A 4ZYSA 2R92B 1G8ZD 4HCSA 2MO1A 3U50C 2PMZE 2NZOA 1B7YB 3T56B 4P73A 4DK0A 1M8AA 1SYBA 2ZM6L 2HUGA 2FJ2A 1STYA 3AMUA 2Z4HA 4GN5A 4DNTB 3S1NB 1X55A 4XQQA 2B39A 4A3FB 4B3SQ 4BXXH 4NB3A 3TQYA 4DUYL 5E4XA 1AEXA 3MXNA 3A56A 3I55A 1DOLA 4G57A 2V4DA 5ELDA 3HOZG 4CKEA 3I90A 4DV0L 4BA1I 4IJHA 3BYYB 2YTXA 4R4IA 4JOIC 3IFTA 4DR1L 2VS1A 4U673 1ZKOA 1U4PA 1E1TA 4NKLA 4JBWA 1AZPA 3TBIB 3O13A 4KK7A 3MWYW 3I4LA 2XN9C 4O1NA 1ILQA 4AQYL 3OHXC 2JA5G 2NN6I 5AJ3L 2VUMB 1ZYRD 1JMCA 1I4XA 2E2DC 4DAPA 3SVMA 1WFQA 4NXMQ 4DAMA 1GO3E 4XYOA 3NHHA 3FRPB 3RUZA 3KJOA 1E2ZA 4DV4Q 1FYCA 2K5HA 3T53B 5IYDG 3KF6B 2EOTA 4OELB 2WAQE 2RF4A 2IT1A 1SLJA 4YWKA 4IPDA 4DR4Q 3G4SA 2B2YA 1HZBA 3RN2A 4IOAA 4KJOA 2B63G 4JI7L 2F0NA 2F0IA 1EWIA 3PV0A 3SGIA 3D4RA 4TVAB 1IYVA 3E9HA 4ME5A 4YCWA 2JA6B 2HQEA 2VQFL 4IFDH 2KBNA 4C3JB 1PH1A 3MFGA 1O7LA 3BU2A 4LAAA 4Y7NH 3RNUA 4QY7A 2RHQB 3HOUB 2UXDL 1KAAA 1SDFA 4YIJA 5GADC 2KVMA 1WTHA 3I4MH 4KI0A 4RAUC 4X6AH 3E0JA 2AQ3B 4DR2Q 2FXQA 2Z0SA 3A8KE 2EVBA 1L2FA 1VQBA 1PH2A 1GXDC 3MXUA 2JE6I 4GKJL 3MEHA 2I5MX 3HP3A 3CPFA 3WDNA 2HT1A 4FXDA 4JBJA 1CUKA 1T9HA 3DMUA 2F0OA 1XXGA 3STBD 1LTAD 2OXPA 1HR0Q 3F2BA 4DUZL 4PZ7A 4C3HB 4I7ZC 1WYDA 4H0LC 1VQJA 4DV5Q 2K05A 4JI3L 2NN6G 2B2TC 1OXVA 2R93G 3FDTA 3GTJH 1BR9A 3NQTA 4IUQA 1HFGA 1IL2A 2UU9L 2JXMB 1N33L 1JWMD 3M7GA 1I6HH 3R3OA 4JI4L 1ET6A 5IGEA 3H3VH 1EY0A 4DNIA 1SRUA 2ZT9C 4DV6L 5LMUL 3SR1A 1S40A 4OWWB 2VNUD 4R8IA 2QW7A 3PO3B 3OWFA 1EIHA 2IX1A 3MXPA 1SAPA 2K33A 1D5MC 4BY1H 1X56A 1D8LA 2R7DA 5AFWA 1K3BC 3CW2C 3UE0A 5IT9E 4A3IB 4C3HG 3A7LA 2F0GA 4A3CH 4QGUA 1V1PA 1TIID 3PQIA 4CJ1B 3HOWG 4CGYB 5FO8B 5G3LF 3HEJA 1HNXQ 4B3TQ 4L5TA 5IT9c 1CQVA 3GV6A 1EIYB 4JI2L 2NVQB 3SHLA 2MP1A 5NUCA 3OTOQ 4RCNA 5FKAC 2CFMA 2KEDA 1G91A 2PZWA 1Q1EA 1F2LA 3EBEA 4TSSA 4JI1Q 1R9TH 2A6HD 3D8GA 3RLFA 2JSOA 5C44G 1E22A 2UUAL 1K28A 1U0LA 5T1IA 2GVAA 4C3JG 1A8VA 1XYIA 4GKKQ 4JVZA 1KLUD 2N8NA 1ICWA 2KHJA 1U9RA 2PQAB 3CP0A 2VQFQ 2RSOA 1QB5D 4MNOA 1UUPA 3NWTA 1JCKB 3KK7A 4B3ML 4G7OC 1SYGA 1QOHA 1VMPA 2F0MA 1ONLA 4X62L 4DV7L 2B29A 1O7IA 1YI2A 3NE5B 1C4QA 1DGSA 4EQPA 5FO9B 2RBMA 1Y8OB 1X3EA 4DR5L 1PTOF 4K14A 1CZWA 4ID6A 4IUUA 4DU9A 3T16A 2VW9A 3MFYA 4IURA 2UXBL 3T1HL 1I3QB 1U5KA 1W6KA 1KRTA 4K6DA 1TS3A 3QJYA 2WAQG 4CBVA 3RR5A 4FF1A 1CZGA 5KIXA 3S2DB 4Z9CB 1GOZA 4ME3A 5C3XA 1SYCA 5ELFA 4QIWB 5CV4A 1CKNA 1IBKQ 1K83B 2CQAA 1N8RC 4HIOA 2WINB 2A68C 5E7NA 2VB3X 1R9TB 3W1BA 2GA4B 2Y0SG 1EOVA 3KUPA 1VQ6A 2WACA 1BDOA 1EY6A 1UNSA 1PZID 3GDEA 3HKZB 1CHPD 4A3CG 3OMGA 2BA1A 4KHPQ 4DR5Q 1JOOA 4H13C 1VQAA 1Q8IA 4DR3Q 3I73A 3ULJA 2JA6G 1G6ZA 2IX0A 1WD1A 1SMYC 1WTVA 2QGQA 3HG9A 4YHHL 1PFSA 5LMNQ 5ELEA 4KLKA 4YCVA 2UU9Q 4KKUA 1Q3LA 4MN3A 5GAHC 5EKIA 1NR4A 1UAPA 2A73B 5GAGC 4RH6A 5J22A 3HRZC 3HKZG 3CRLC 4UPAA 2NN6H 1VQKA 2OCEA 2B2UA 1D1IA 3PCOB 2R92H 1CKNB 1ESFA 4K5WA 3HGBA 5JAVA 2E8GA 4GKJQ 4P72A 1IL8A 3SK8A 4LF9Q 3JAME 1GHKA 1JWSD 1XPUA 3DXJC 1BVSA 1DJRD 1E7ZA 2OEOA 4RGNA 5IYCG 3V2TA 3HOXH 3J81L 3FPPA 3OTOL 4JW0A 3EJIA 2HDMA 5BR8L 2H4OA 3AB9A 1RIPA 4KY6A 3S1RH 1PTOD 3ERQA 5G3LD 3D6WA 4JOIA 1KRSA 4HJ9A 4IUPA 1A3VA 4JI8Q 1BKBA 2F3IA 2B2UC 3SK6A
chains in the Genus database with same CATH topology
5M5WH 2XTIA 4JC0A 3PUWA 3NELA 4LF4Q 4A3DG 1Q86C 1Y1VG 3EIVA 1VQ5A 1FJGQ 3A5UA 4LF5Q 4GLVB 1N36L 2GVBA 1XMOL 2B63H 4JG2A 4DV0Q 1VQMA 2F52A 4X64Q 2ZJPA 1A0IA 4HJ7A 4A3JH 1YIJA 3E0EA 1KD1C 3GD7A 4GKKL 4K0KL 1OXXK 2YTVA 5EAYA 2DGYA 4GNXC 2WP8J 3RN5A 3E9IA 4YHHQ 4A3DH 2UUBL 3TREA 5IWAL 5M5YH 2LXJA 3CCUA 1GM5A 3ULPA 5ELOA 4LFBQ 3CCVA 5IYDH 4GS3A 3G48A 2OWOA 2YTYA 4C3JH 4A93H 2UXCQ 4B3SL 2B3GA 4POFA 5C0XJ 4UP9A 3J81c 4A3KG 5AJ3Q 3STBC 4JI0L 2F4VL 3I7FA 2LXKA 3J81i 3EN2A 5FJ8G 1HH2P 5FLMH 1N32L 4RMFA 1FJGL 1TWFH 3F2CA 1OXUA 2KCMA 3WWVA 2AKWB 2AWNA 3JAMi 3AFPA 1VQCA 3PGZA 4A3LG 2N78A 1UWVA 2LSSA 2XGTA 2C35B 2K75A 4O0AA 4JI8Q 4O2DA 5GQOA 4DKAC 1K3RA 3OW2A 4LF8L 4A3EG 2K5VA 5C3EG 2E5LL 3S1NH 4B3RQ 1L1OA 1M1KC 1VQLA 4NXNQ 3HOVH 1PYSB 3GTOH 1V9PA 1B8AA 1Y1WH 4WJ3M 1J6QA 5M3FG 3HFZB 4QL5A 1K73C 3DLLA 4BBRH 3CCMA 1XPRA 1HR0L 3S16H 4DAYB 4JYAQ 1WJJA 2JJQA 1PH7A 2NZHA 5C0XG 2QA4A 1JT8A 5JEAJ 4POGA 3HOZH 1WOCA 2MNAA 1AE2A 4NPSA 1N34L 2Q2HA 4AQYQ 2RCNA 1AE3A 2BA0A 3S1MH 4A3EH 4JI0Q 4OWXB 2UUAQ 1LYLA 2PI2E 4JI3Q 1X9NA 3M4PA 4A75A 1XMQL 4LFBL 1KHIA 1JJ2A 2ZM6Q 1YVCA 1UE7A 4Y52H 5HY6A 3PO3G 4GOPA 1LUZA 2BH8A 3CMAA 2YV5A 1Q12A 1TWCH 3TS0A 1KIXA 1K0RA 1SROA 3K80C 3KYHC 4JV5Q 4IFDJ 5FLMG 1PH3A 5C0XI 1Q81C 4LF6Q 4BBSG 5K36G 2OQKA 2HQLA 1HZ9A 2NVXH 1XMOQ 1SN8A 2N49A 4A3KH 3BJUA 3JAMc 1P16A 4A3MH 4A3GH 5FJ8H 1IYJB 1CKMA 5FLXc 4X65Q 1I94L 1JB7A 2WB1G 3KF6A 1X65A 2JQOA 3MEFA 4GN4B 4MZ9A 1YJNA 2E5LQ 5JEAG 3AEVA 4PZ6A 1Q7YC 2MO1A 1J5EQ 1M90C 1IBLQ 3KOJA 3A5ZB 3U50C 4A3GG 4FDBA 2PMZE 3CCQA 2OQ0A 4IPHA 1IZ6A 4PZ8A 2NVYH 2NZOA 3S24A 3ER0A 1B7YB 1BBWA 3HKSA 2R7FA 2AHOB 3H0GG 4P73A 2ZM6L 2VQEL 4GN5A 1X55A 3S2DH 2JEAI 4R1JA 2I0QA 2CCZA 4B3SQ 4BXXH 4WJ4A 4NB3A 3TQYA 4DUYL 4BA2I 4A4IA 2R7ZG 4DV1L 3A0JA 1J5EL 1PH4A 5IE8A 3AQQA 3NBHB 3I55A 4DV3L 2PI2A 4JI7Q 4GOPC 3HOZG 4OWTB 3S17H 2CWAA 3JC66 1YEZA 4PG3A 4MTNA 3CPWA 1IXRA 1K8AC 1QVCA 4KHZA 4X64L 1PHJA 4DV0L 1FL0A 3L0OA 1NE3A 1EYGA 4OONA 4P75A 4A76A 2A1AA 4BA1I 1N36Q 4IJHA 1OXTA 2RHSB 4BBRG 3S14H 2YTXA 4HJ8A 4R4IA 4H02A 4L5RC 2JA5H 4BY1G 3KFUA 4JOIC 4DR1L 2VS1A 2UUCQ 1Y14B 4QQBX 3FP9A 1E1TA 3PUYA 4JBWA 2YU9H 4JBMA 4LF7Q 3HOYH 3PF4A 4LUVA 4JI8L 2NVQH 1NTGA 5IYCH 1HZAA 5C4XG 1CSQA 4AQYL 5IP7H 2UXCL 2CWPA 2JA5G 2NN6I 3LGJA 5AJ3L 2F4VQ 2ZTCA 4OX9L 1LTLA 2R93H 1UEBA 3KDFB 1YHQA 1JMCA 4JI4Q 3F2DA 2PNHA 4NXMQ 1WFQA 1OXSC 1SFOH 1PVOA 4DAMA 4DR2L 2R92G 1GO3E 3T1YQ 4K0KQ 3KJOA 3TS2A 3M3YH 3S15H 4DV4Q 2KCTA 1NMGA 2K5HA 5IYDG 3L2PA 1SR3A 2K52A 4BY7H 3A74A 3KF6B 4KHPL 1E24A 2WAQE 2RF4A 1TWAH 1XTDA 3FKIG 2MQHA 3GO5A 3HKZE 2IT1A 1SLJA 1Y1WG 2QEXA 4LF5L 1XNQL 4YWKA 4IPDA 4DR4Q 4BXXG 3CCEA 3G4SA 3RZDH 2CKZB 1HZBA 3RN2A 4JCVE 3GTPH 4IOAA 4IPGA 3PIPA 4DR1Q 2B63G 3CQZH 3H0GH 2V1CC 4DUZQ 4HIDA 2ZJQA 4DV3Q 4JI7L 4B3MQ 1Q82C 3CF5A 3T1HQ 1N32Q 1EWIA 3PIOA 1IBKL 3PV0A 3SGIA 4TVAB 2UXBQ 3E9HA 1A63A 4YCWA 4IOCA 1E1OA 4LWCA 2VQFL 5LMNW 2KBNA 2I5LX 5BR8Q 1HJPA 3M85A 4YWLA 3I4MG 1PH1A 2K50A 1L1OC 4Y7NH 3BU2A 4DV6Q 3RNUA 4QY7A 1X3GA 2RHQB 2K5NA 1NJIC 2UXDL 5GADC 4IFDG 1PA6A 1PV4A 3I4MH 1QUQA 1P8LA 4KI0A 1WCMH 4X66L 5H1SE 4DR2Q 1XNRQ 2FXQA 4X6AH 2Z0SA 3FHWA 3U4ZA 1I50H 1YJ9A 2A8VA 2IHFA 1L2FA 1VQBA 3D0FA 1PH2A 3RZOH 2IY5B 3M7NA 2JE6I 4GKJL 4DK6C 1NMFA 2JK8A 5GAEC 2I5MX 3CPFA 3ZJYC 3U4VA 2HT1A 3BZKA 1S72A 4JBJA 5JJKA 1YHBA 1CUKA 3UDIA 3BZCA 1T9HA 2EIFA 1YHAA 1C7YA 1D7QA 2JA7G 1Q46A 3STBD 3UDFA 3GTQH 2MO0A 1VQFA 1HR0Q 2AMCB 3F2BA 4DUZL 4QJFA 4TQUS 4PZ7A 3PUZA 1QUQB 3I56A 2Q2UA 1WYDA 4A3IG 1QVGA 4LF8Q 3J7A5 2Q2TA 3M9BA 1VQJA 3TEHB 4JI5Q 4DV5Q 2HHHL 4LUZA 2NN6G 4JI3L 1X54A 1Z9FA 1OXVA 2R93G 4A3MG 4LFCQ 1UE6A 3AYHB 3K0XA 2AWOA 1G51A 3M4QA 3GTJH 1HNZL 1IBML 1IL2A 2D62A 5M3FH 2UU9L 3W1GA 4DR7Q 1YNXA 4DK3C 1N33L 5JJIA 1I6HH 4AIMA 4JV5L 4AYBG 2JA8H 4JI4L 1JJGA 4HJ5A 1V43A 1YBYA 2ZTDA 2UUBQ 4GN3B 3H3VH 5C4XH 3Q8DA 3CCJA 1GKHA 3F1ZA 4DNIA 1NBWA 2Q2IA 1VQ8A 1SRUA 4DV6L 5LMUL 1EQRA 1S40A 4OWWB 4DUYQ 1GD7A 3HOYG 2VNUD 2JA9A 4JI1L 1YJWA 1BBUA 1V1QA 2IX1A 4A3LH 3DM3A 2D0OA 1KXLA 5M3MH 2VQEQ 4A3BG 4BY1H 1X56A 3AFQA 1D8LA 3K7AH 3ULLA 3I4NG 2R7DA 1MJCA 1TWHH 1S3OA 3CW2C 3H15A 1EFWA 3PUXA 3UE0A 3UDGA 3CC2A 3K8AA 1VQ9A 3TRZA 2OTLA 3GTMH 4XIGS 4IPCA 2BH2A 4A3IH 1WCMG 3GTKH 4APVA 4A3CH 4QGUA 4R4CA 1HNWQ 1A62A 3CMEA 2HHHQ 4DV7Q 1EUJA 3PSIA 3KDFA 4OXPA 4GLAC 2L15A 5IP9H 3HOWG 1KL9A 1HNXQ 4B3TQ 1G291 2ALYB 5C4JH 4L5TA 1VQEA 1CKOA 5IT9c 4C2MH 1EIYB 5C3EH 4YCUA 3UDXA 3T1YL 4JI2L 5LMUQ 4DV1Q 4IO9A 3OTOQ 4A3BH 1EIFA 4NXML 1VQDA 3NEMA 3KF8B 1VQNA 4DV2L 3J80c 4JBKA 2CFMA 2CQOA 1N9WA 1N33Q 1VQHA 3UE1A 4DR7L 1Q1EA 4BY7G 2OTJA 3S1QH 1SMXA 4A3FH 1IBMQ 3D31A 2NVTH 3EBEA 1R9TH 4JI1Q 3RLFA 2UUAL 2E2IH 5C44G 1E22A 4DV5L 1Q8KA 4LF7L 1N34Q 4EX5A 1U0LA 4C3HH 1JJCB 5IWAQ 2GVAA 1MKHA 2UUCL 1A8VA 3ERSX 4PMWA 4GNXB 2HIVA 1K8GA 2ASBA 4GKKQ 1HNWL 1PH5A 4JI2Q 2N8NA 3G71A 4GOPB 2EXDA 2KHJA 2PQAB 3CP0A 2VQFQ 1QZGA 3GTLH 2DUDA 1W2BA 4LFAL 4MNOA 4A3JG 4J15A 4HIMA 1HNXL 2KHIA 1Z47A 3CD6A 1NY4A 3PO3H 2Y0SE 4B3ML 3CAMA 4DV7L 5ELNA 4X62L 3CCSA 2JA8G 2K14A 1VQ7A 1Y1VH 2B29A 1B70B 4DPGA 3M4OH 1O7IA 3H3VI 1YI2A 1K9MC 1SE8A 3CXCA 4OO1I 4B3RL 3U58A 1PH6A 1XNQQ 3I2ZA 1UE1A 2KENA 4UY8C 1K83H 1DGSA 2R6GA 3VDYA 3ICEA 1VQPA 2ES2A 1VQIA 2I5HA 4IJLA 1X3EA 4DR5L 4UP7A 4UP8A 2E2JH 4OO1G 1FVIA 4LF9L 1RL2A 4DR6L 1UE5A 3GTGH 2ZTEA 2VW9A 1G6PA 2A19A 1GVPA 2UXBL 4LNQA 3CCRA 5IP7G 3T1HL 1CSPA 5GROA 4JYAL 1U5KA 1KRTA 4YWMA 4EQ5A 4A3FG 2HIXA 3OYYA 3HOVG 3NENA 4DR3L 2UXDQ 1E3PA 1OTCA 1YITA 2WAQG 2Z6KA 3RR5A 2N3SA 1PH8A 2R7ZH 1FGUA 3K81C 3MXNB 4ME3A 4LUOA 4LFCL 4LFAQ 4NXNL 2ZJRA 1CKNA 4L5QA 3PUVA 4AYBE 1IBKQ 4JI5L 2JA6H 3RLOA 3G6EA 1N8RC 4HIOA 5E7NA 5J3BA 1QZHA 3W1BA 2E2HH 3PO2H 2Y0SG 1VQ4A 1EOVA 3W5OA 4YY3L 4DV4L 1VQ6A 3FKIH 1W3SA 3IRBA 1PYBA 1ASYA 5IP9G 4R4QA 3HOWH 5DLQE 3GDEA 4A93G 2WFWA 1XMQQ 3CC4A 1MIUA 4A3CG 2IHEA 1L0WA 1XJVA 2BA1A 2JEBI 4R4OA 5IYBG 4KHPQ 4LW1A 3B6YA 2ATWA 3HOUG 3L7ZC 3CC7A 4DR5Q 2VY3A 4C3IH 1WI5A 5HGQA 1VQAA 4DR3Q 3S2HH 3ULJA 3I4NH 1MJEA 2JA6G 1AH9A 5M3MG 2IX0A 2Z6KC 3J81j 4OX9Q 2QGQA 4YHHL 1QVFA 1HR0W 4DR6Q 1PFSA 5LMNQ 1I5FA 2VUMH 4KLKA 4YCVA 2UU9Q 4B3TL 4IFDI 1HNZQ 1VS0A 5GAHC 2EQSA 2WB1E 1VCIA 4R4TA 2YYZA 3KLWA 3K7UC 4RG1A 1EQQA 4LF4L 4P71A 5GAGC 3I4OA 1XPOA 2PQAA 1L1OB 3HKZG 4UPAA 1KAWA 4LF6L 1ASZA 4YY3Q 1VQKA 2VZAA 2OCEA 1X6OA 1H95A 1I3QH 1KQSA 4JI6Q 4X65L 3PCOB 1I94Q 2R92H 1HZCA 1CKNB 4BBSH 3CCLA 2D0PA 4ALPA 4DR4L 4GKJQ 2E8GA 3PO2G 4P72A 1X3FA 2K4KA 4AH6A 3KJPA 2H5XA 3HOXG 4LF9Q 1VQGA 2VUMG 2MFIA 1TWGH 4GNXA 2JA7H 4XTCS 1JE5A 1KC8C 1XPUA 2ID0A 4X66Q 1XNRL 1BVSA 1E7ZA 5IYCG 5LMNL 1Q1BA 1C9OA 3HOXH 4GLXA 4HJAA 1LM0A 2VL6A 1TXYA 3J80i 3OTOL 1IBLL 2GN5A 1PH9A 1C0AA 3PF5A 5BR8L 4L5SA 4X62Q 1RIPA 3HOUH 3S1RH 5JJLA 5IYBH 4QIWE 5IY0A 4JOIA 1VQOA 1KRSA 3F8TA 4HIKA 4HJ9A 3J7ZC 4DV2Q 4JI6L 3RLNA 4P74A 1BKBA 2F3IA 1YZ6A 5C44H 5M5XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5W H;  2XTI A;  4JC0 A;  3PUW A;  3NEL A;  4LF4 Q;  4A3D G;  1Q86 C;  1Y1V G;  3EIV A;  1VQ5 A;  1FJG Q;  3A5U A;  4LF5 Q;  4GLV B;  1N36 L;  2GVB A;  1XMO L;  2B63 H;  4JG2 A;  4DV0 Q;  1VQM A;  2F52 A;  4X64 Q;  2ZJP A;  1A0I A;  4HJ7 A;  4A3J H;  1YIJ A;  3E0E A;  1KD1 C;  3GD7 A;  4GKK L;  4K0K L;  1OXX K;  2YTV A;  5EAY A;  2DGY A;  4GNX C;  2WP8 J;  3RN5 A;  3E9I A;  4YHH Q;  4A3D H;  2UUB L;  3TRE A;  5IWA L;  5M5Y H;  2LXJ A;  3CCU A;  1GM5 A;  3ULP A;  5ELO A;  4LFB Q;  3CCV A;  5IYD H;  4GS3 A;  3G48 A;  2OWO A;  2YTY A;  4C3J H;  4A93 H;  2UXC Q;  4B3S L;  2B3G A;  4POF A;  5C0X J;  4UP9 A;  3J81 c;  4A3K G;  5AJ3 Q;  3STB C;  4JI0 L;  2F4V L;  3I7F A;  2LXK A;  3J81 i;  3EN2 A;  5FJ8 G;  1HH2 P;  5FLM H;  1N32 L;  4RMF A;  1FJG L;  1TWF H;  3F2C A;  1OXU A;  2KCM A;  3WWV A;  2AKW B;  2AWN A;  3JAM i;  3AFP A;  1VQC A;  3PGZ A;  4A3L G;  2N78 A;  1UWV A;  2LSS A;  2XGT A;  2C35 B;  2K75 A;  4O0A A;  4JI8 Q;  4O2D A;  5GQO A;  4DKA C;  1K3R A;  3OW2 A;  4LF8 L;  4A3E G;  2K5V A;  5C3E G;  2E5L L;  3S1N H;  4B3R Q;  1L1O A;  1M1K C;  1VQL A;  4NXN Q;  3HOV H;  1PYS B;  3GTO H;  1V9P A;  1B8A A;  1Y1W H;  4WJ3 M;  1J6Q A;  5M3F G;  3HFZ B;  4QL5 A;  1K73 C;  3DLL A;  4BBR H;  3CCM A;  1XPR A;  1HR0 L;  3S16 H;  4DAY B;  4JYA Q;  1WJJ A;  2JJQ A;  1PH7 A;  2NZH A;  5C0X G;  2QA4 A;  1JT8 A;  5JEA J;  4POG A;  3HOZ H;  1WOC A;  2MNA A;  1AE2 A;  4NPS A;  1N34 L;  2Q2H A;  4AQY Q;  2RCN A;  1AE3 A;  2BA0 A;  3S1M H;  4A3E H;  4JI0 Q;  4OWX B;  2UUA Q;  1LYL A;  2PI2 E;  4JI3 Q;  1X9N A;  3M4P A;  4A75 A;  1XMQ L;  4LFB L;  1KHI A;  1JJ2 A;  2ZM6 Q;  1YVC A;  1UE7 A;  4Y52 H;  5HY6 A;  3PO3 G;  4GOP A;  1LUZ A;  2BH8 A;  3CMA A;  2YV5 A;  1Q12 A;  1TWC H;  3TS0 A;  1KIX A;  1K0R A;  1SRO A;  3K80 C;  3KYH C;  4JV5 Q;  4IFD J;  5FLM G;  1PH3 A;  5C0X I;  1Q81 C;  4LF6 Q;  4BBS G;  5K36 G;  2OQK A;  2HQL A;  1HZ9 A;  2NVX H;  1XMO Q;  1SN8 A;  2N49 A;  4A3K H;  3BJU A;  3JAM c;  1P16 A;  4A3M H;  4A3G H;  5FJ8 H;  1IYJ B;  1CKM A;  5FLX c;  4X65 Q;  1I94 L;  1JB7 A;  2WB1 G;  3KF6 A;  1X65 A;  2JQO A;  3MEF A;  4GN4 B;  4MZ9 A;  1YJN A;  2E5L Q;  5JEA G;  3AEV A;  4PZ6 A;  1Q7Y C;  2MO1 A;  1J5E Q;  1M90 C;  1IBL Q;  3KOJ A;  3A5Z B;  3U50 C;  4A3G G;  4FDB A;  2PMZ E;  3CCQ A;  2OQ0 A;  4IPH A;  1IZ6 A;  4PZ8 A;  2NVY H;  2NZO A;  3S24 A;  3ER0 A;  1B7Y B;  1BBW A;  3HKS A;  2R7F A;  2AHO B;  3H0G G;  4P73 A;  2ZM6 L;  2VQE L;  4GN5 A;  1X55 A;  3S2D H;  2JEA I;  4R1J A;  2I0Q A;  2CCZ A;  4B3S Q;  4BXX H;  4WJ4 A;  4NB3 A;  3TQY A;  4DUY L;  4BA2 I;  4A4I A;  2R7Z G;  4DV1 L;  3A0J A;  1J5E L;  1PH4 A;  5IE8 A;  3AQQ A;  3NBH B;  3I55 A;  4DV3 L;  2PI2 A;  4JI7 Q;  4GOP C;  3HOZ G;  4OWT B;  3S17 H;  2CWA A;  3JC6 6;  1YEZ A;  4PG3 A;  4MTN A;  3CPW A;  1IXR A;  1K8A C;  1QVC A;  4KHZ A;  4X64 L;  1PHJ A;  4DV0 L;  1FL0 A;  3L0O A;  1NE3 A;  1EYG A;  4OON A;  4P75 A;  4A76 A;  2A1A A;  4BA1 I;  1N36 Q;  4IJH A;  1OXT A;  2RHS B;  4BBR G;  3S14 H;  2YTX A;  4HJ8 A;  4R4I A;  4H02 A;  4L5R C;  2JA5 H;  4BY1 G;  3KFU A;  4JOI C;  4DR1 L;  2VS1 A;  2UUC Q;  1Y14 B;  4QQB X;  3FP9 A;  1E1T A;  3PUY A;  4JBW A;  2YU9 H;  4JBM A;  4LF7 Q;  3HOY H;  3PF4 A;  4LUV A;  4JI8 L;  2NVQ H;  1NTG A;  5IYC H;  1HZA A;  5C4X G;  1CSQ A;  4AQY L;  5IP7 H;  2UXC L;  2CWP A;  2JA5 G;  2NN6 I;  3LGJ A;  5AJ3 L;  2F4V Q;  2ZTC A;  4OX9 L;  1LTL A;  2R93 H;  1UEB A;  3KDF B;  1YHQ A;  1JMC A;  4JI4 Q;  3F2D A;  2PNH A;  4NXM Q;  1WFQ A;  1OXS C;  1SFO H;  1PVO A;  4DAM A;  4DR2 L;  2R92 G;  1GO3 E;  3T1Y Q;  4K0K Q;  3KJO A;  3TS2 A;  3M3Y H;  3S15 H;  4DV4 Q;  2KCT A;  1NMG A;  2K5H A;  5IYD G;  3L2P A;  1SR3 A;  2K52 A;  4BY7 H;  3A74 A;  3KF6 B;  4KHP L;  1E24 A;  2WAQ E;  2RF4 A;  1TWA H;  1XTD A;  3FKI G;  2MQH A;  3GO5 A;  3HKZ E;  2IT1 A;  1SLJ A;  1Y1W G;  2QEX A;  4LF5 L;  1XNQ L;  4YWK A;  4IPD A;  4DR4 Q;  4BXX G;  3CCE A;  3G4S A;  3RZD H;  2CKZ B;  1HZB A;  3RN2 A;  4JCV E;  3GTP H;  4IOA A;  4IPG A;  3PIP A;  4DR1 Q;  2B63 G;  3CQZ H;  3H0G H;  2V1C C;  4DUZ Q;  4HID A;  2ZJQ A;  4DV3 Q;  4JI7 L;  4B3M Q;  1Q82 C;  3CF5 A;  3T1H Q;  1N32 Q;  1EWI A;  3PIO A;  1IBK L;  3PV0 A;  3SGI A;  4TVA B;  2UXB Q;  3E9H A;  1A63 A;  4YCW A;  4IOC A;  1E1O A;  4LWC A;  2VQF L;  5LMN W;  2KBN A;  2I5L X;  5BR8 Q;  1HJP A;  3M85 A;  4YWL A;  3I4M G;  1PH1 A;  2K50 A;  1L1O C;  4Y7N H;  3BU2 A;  4DV6 Q;  3RNU A;  4QY7 A;  1X3G A;  2RHQ B;  2K5N A;  1NJI C;  2UXD L;  5GAD C;  4IFD G;  1PA6 A;  1PV4 A;  3I4M H;  1QUQ A;  1P8L A;  4KI0 A;  1WCM H;  4X66 L;  5H1S E;  4DR2 Q;  1XNR Q;  2FXQ A;  4X6A H;  2Z0S A;  3FHW A;  3U4Z A;  1I50 H;  1YJ9 A;  2A8V A;  2IHF A;  1L2F A;  1VQB A;  3D0F A;  1PH2 A;  3RZO H;  2IY5 B;  3M7N A;  2JE6 I;  4GKJ L;  4DK6 C;  1NMF A;  2JK8 A;  5GAE C;  2I5M X;  3CPF A;  3ZJY C;  3U4V A;  2HT1 A;  3BZK A;  1S72 A;  4JBJ A;  5JJK A;  1YHB A;  1CUK A;  3UDI A;  3BZC A;  1T9H A;  2EIF A;  1YHA A;  1C7Y A;  1D7Q A;  2JA7 G;  1Q46 A;  3STB D;  3UDF A;  3GTQ H;  2MO0 A;  1VQF A;  1HR0 Q;  2AMC B;  3F2B A;  4DUZ L;  4QJF A;  4TQU S;  4PZ7 A;  3PUZ A;  1QUQ B;  3I56 A;  2Q2U A;  1WYD A;  4A3I G;  1QVG A;  4LF8 Q;  3J7A 5;  2Q2T A;  3M9B A;  1VQJ A;  3TEH B;  4JI5 Q;  4DV5 Q;  2HHH L;  4LUZ A;  2NN6 G;  4JI3 L;  1X54 A;  1Z9F A;  1OXV A;  2R93 G;  4A3M G;  4LFC Q;  1UE6 A;  3AYH B;  3K0X A;  2AWO A;  1G51 A;  3M4Q A;  3GTJ H;  1HNZ L;  1IBM L;  1IL2 A;  2D62 A;  5M3F H;  2UU9 L;  3W1G A;  4DR7 Q;  1YNX A;  4DK3 C;  1N33 L;  5JJI A;  1I6H H;  4AIM A;  4JV5 L;  4AYB G;  2JA8 H;  4JI4 L;  1JJG A;  4HJ5 A;  1V43 A;  1YBY A;  2ZTD A;  2UUB Q;  4GN3 B;  3H3V H;  5C4X H;  3Q8D A;  3CCJ A;  1GKH A;  3F1Z A;  4DNI A;  1NBW A;  2Q2I A;  1VQ8 A;  1SRU A;  4DV6 L;  5LMU L;  1EQR A;  1S40 A;  4OWW B;  4DUY Q;  1GD7 A;  3HOY G;  2VNU D;  2JA9 A;  4JI1 L;  1YJW A;  1BBU A;  1V1Q A;  2IX1 A;  4A3L H;  3DM3 A;  2D0O A;  1KXL A;  5M3M H;  2VQE Q;  4A3B G;  4BY1 H;  1X56 A;  3AFQ A;  1D8L A;  3K7A H;  3ULL A;  3I4N G;  2R7D A;  1MJC A;  1TWH H;  1S3O A;  3CW2 C;  3H15 A;  1EFW A;  3PUX A;  3UE0 A;  3UDG A;  3CC2 A;  3K8A A;  1VQ9 A;  3TRZ A;  2OTL A;  3GTM H;  4XIG S;  4IPC A;  2BH2 A;  4A3I H;  1WCM G;  3GTK H;  4APV A;  4A3C H;  4QGU A;  4R4C A;  1HNW Q;  1A62 A;  3CME A;  2HHH Q;  4DV7 Q;  1EUJ A;  3PSI A;  3KDF A;  4OXP A;  4GLA C;  2L15 A;  5IP9 H;  3HOW G;  1KL9 A;  1HNX Q;  4B3T Q;  1G29 1;  2ALY B;  5C4J H;  4L5T A;  1VQE A;  1CKO A;  5IT9 c;  4C2M H;  1EIY B;  5C3E H;  4YCU A;  3UDX A;  3T1Y L;  4JI2 L;  5LMU Q;  4DV1 Q;  4IO9 A;  3OTO Q;  4A3B H;  1EIF A;  4NXM L;  1VQD A;  3NEM A;  3KF8 B;  1VQN A;  4DV2 L;  3J80 c;  4JBK A;  2CFM A;  2CQO A;  1N9W A;  1N33 Q;  1VQH A;  3UE1 A;  4DR7 L;  1Q1E A;  4BY7 G;  2OTJ A;  3S1Q H;  1SMX A;  4A3F H;  1IBM Q;  3D31 A;  2NVT H;  3EBE A;  1R9T H;  4JI1 Q;  3RLF A;  2UUA L;  2E2I H;  5C44 G;  1E22 A;  4DV5 L;  1Q8K A;  4LF7 L;  1N34 Q;  4EX5 A;  1U0L A;  4C3H H;  1JJC B;  5IWA Q;  2GVA A;  1MKH A;  2UUC L;  1A8V A;  3ERS X;  4PMW A;  4GNX B;  2HIV A;  1K8G A;  2ASB A;  4GKK Q;  1HNW L;  1PH5 A;  4JI2 Q;  2N8N A;  3G71 A;  4GOP B;  2EXD A;  2KHJ A;  2PQA B;  3CP0 A;  2VQF Q;  1QZG A;  3GTL H;  2DUD A;  1W2B A;  4LFA L;  4MNO A;  4A3J G;  4J15 A;  4HIM A;  1HNX L;  2KHI A;  1Z47 A;  3CD6 A;  1NY4 A;  3PO3 H;  2Y0S E;  4B3M L;  3CAM A;  4DV7 L;  5ELN A;  4X62 L;  3CCS A;  2JA8 G;  2K14 A;  1VQ7 A;  1Y1V H;  2B29 A;  1B70 B;  4DPG A;  3M4O H;  1O7I A;  3H3V I;  1YI2 A;  1K9M C;  1SE8 A;  3CXC A;  4OO1 I;  4B3R L;  3U58 A;  1PH6 A;  1XNQ Q;  3I2Z A;  1UE1 A;  2KEN A;  4UY8 C;  1K83 H;  1DGS A;  2R6G A;  3VDY A;  3ICE A;  1VQP A;  2ES2 A;  1VQI A;  2I5H A;  4IJL A;  1X3E A;  4DR5 L;  4UP7 A;  4UP8 A;  2E2J H;  4OO1 G;  1FVI A;  4LF9 L;  1RL2 A;  4DR6 L;  1UE5 A;  3GTG H;  2ZTE A;  2VW9 A;  1G6P A;  2A19 A;  1GVP A;  2UXB L;  4LNQ A;  3CCR A;  5IP7 G;  3T1H L;  1CSP A;  5GRO A;  4JYA L;  1U5K A;  1KRT A;  4YWM A;  4EQ5 A;  4A3F G;  2HIX A;  3OYY A;  3HOV G;  3NEN A;  4DR3 L;  2UXD Q;  1E3P A;  1OTC A;  1YIT A;  2WAQ G;  2Z6K A;  3RR5 A;  2N3S A;  1PH8 A;  2R7Z H;  1FGU A;  3K81 C;  3MXN B;  4ME3 A;  4LUO A;  4LFC L;  4LFA Q;  4NXN L;  2ZJR A;  1CKN A;  4L5Q A;  3PUV A;  4AYB E;  1IBK Q;  4JI5 L;  2JA6 H;  3RLO A;  3G6E A;  1N8R C;  4HIO A;  5E7N A;  5J3B A;  1QZH A;  3W1B A;  2E2H H;  3PO2 H;  2Y0S G;  1VQ4 A;  1EOV A;  3W5O A;  4YY3 L;  4DV4 L;  1VQ6 A;  3FKI H;  1W3S A;  3IRB A;  1PYB A;  1ASY A;  5IP9 G;  4R4Q A;  3HOW H;  5DLQ E;  3GDE A;  4A93 G;  2WFW A;  1XMQ Q;  3CC4 A;  1MIU A;  4A3C G;  2IHE A;  1L0W A;  1XJV A;  2BA1 A;  2JEB I;  4R4O A;  5IYB G;  4KHP Q;  4LW1 A;  3B6Y A;  2ATW A;  3HOU G;  3L7Z C;  3CC7 A;  4DR5 Q;  2VY3 A;  4C3I H;  1WI5 A;  5HGQ A;  1VQA A;  4DR3 Q;  3S2H H;  3ULJ A;  3I4N H;  1MJE A;  2JA6 G;  1AH9 A;  5M3M G;  2IX0 A;  2Z6K C;  3J81 j;  4OX9 Q;  2QGQ A;  4YHH L;  1QVF A;  1HR0 W;  4DR6 Q;  1PFS A;  5LMN Q;  1I5F A;  2VUM H;  4KLK A;  4YCV A;  2UU9 Q;  4B3T L;  4IFD I;  1HNZ Q;  1VS0 A;  5GAH C;  2EQS A;  2WB1 E;  1VCI A;  4R4T A;  2YYZ A;  3KLW A;  3K7U C;  4RG1 A;  1EQQ A;  4LF4 L;  4P71 A;  5GAG C;  3I4O A;  1XPO A;  2PQA A;  1L1O B;  3HKZ G;  4UPA A;  1KAW A;  4LF6 L;  1ASZ A;  4YY3 Q;  1VQK A;  2VZA A;  2OCE A;  1X6O A;  1H95 A;  1I3Q H;  1KQS A;  4JI6 Q;  4X65 L;  3PCO B;  1I94 Q;  2R92 H;  1HZC A;  1CKN B;  4BBS H;  3CCL A;  2D0P A;  4ALP A;  4DR4 L;  4GKJ Q;  2E8G A;  3PO2 G;  4P72 A;  1X3F A;  2K4K A;  4AH6 A;  3KJP A;  2H5X A;  3HOX G;  4LF9 Q;  1VQG A;  2VUM G;  2MFI A;  1TWG H;  4GNX A;  2JA7 H;  4XTC S;  1JE5 A;  1KC8 C;  1XPU A;  2ID0 A;  4X66 Q;  1XNR L;  1BVS A;  1E7Z A;  5IYC G;  5LMN L;  1Q1B A;  1C9O A;  3HOX H;  4GLX A;  4HJA A;  1LM0 A;  2VL6 A;  1TXY A;  3J80 i;  3OTO L;  1IBL L;  2GN5 A;  1PH9 A;  1C0A A;  3PF5 A;  5BR8 L;  4L5S A;  4X62 Q;  1RIP A;  3HOU H;  3S1R H;  5JJL A;  5IYB H;  4QIW E;  5IY0 A;  4JOI A;  1VQO A;  1KRS A;  3F8T A;  4HIK A;  4HJ9 A;  3J7Z C;  4DV2 Q;  4JI6 L;  3RLN A;  4P74 A;  1BKB A;  2F3I A;  1YZ6 A;  5C44 H;  5M5X H; 
#chains in the Genus database with same CATH topology
 2HD3 A;  3KBG A;  1EL0 A;  3PUW A;  3NEL A;  1F2Y A;  4F88 A;  1EWC A;  1B2T A;  4K5V A;  1EYA A;  3FMC A;  4GLV B;  2PO4 A;  2BCO A;  1N36 L;  4I65 A;  4JG2 A;  4X64 Q;  1YIJ A;  5EPL A;  4GKK L;  3QG1 A;  1Y8P B;  3P7J A;  4KMU C;  3RN5 A;  2KHS A;  5JEA H;  4YHH Q;  2MHV A;  1GM5 A;  4LFB Q;  5IYD H;  3UI2 A;  2OWO A;  1K0S A;  1PXU A;  2B3G A;  4JI0 L;  5C0X J;  5AJ3 Q;  3H6M A;  3J81 i;  1HH2 P;  4XYQ A;  4RMF A;  2AKW B;  2AWN A;  1VQC A;  2EY1 A;  4A3L G;  1BBX C;  3JAM L;  5E3F A;  3ND8 A;  3URY A;  2K5V A;  5C3E G;  2E5L L;  3S1N H;  4B3R Q;  1YNJ C;  3GTO H;  1V9P A;  1H9S A;  5F2D A;  1B8A A;  4ZLT F;  3OPO A;  1CQF A;  3CCM A;  3DEP A;  1XPR A;  3S16 H;  2F0S A;  1LAB A;  2B8F A;  2QA4 A;  1V1O A;  5CV9 A;  2EYM A;  1AE2 A;  2F4I A;  1LYL A;  1SJH D;  3M4P A;  4A75 A;  1XMQ L;  2BDN A;  1BOS A;  2ZM6 Q;  1UE7 A;  1GUT A;  3VYS A;  4JV5 Q;  3V05 A;  1SRO A;  4HSP A;  4FXG C;  4IFD J;  1PH3 A;  5K36 G;  1ZXT A;  2Q8T A;  2I07 B;  1PZJ D;  3BJU A;  5CV6 A;  3JAM c;  1P16 A;  4A3M H;  2K6A A;  3P1H A;  4KY5 A;  2RDF A;  3S15 B;  3KF6 A;  4GN4 B;  2JQO A;  1HNW Q;  5EQ0 A;  1J5E Q;  1IBL Q;  2PW5 A;  1SYD A;  5L37 A;  4IPH A;  1IZ6 A;  5COR A;  2ZXO A;  1NAP A;  1A2U A;  2RVL A;  3S2D H;  2CCZ A;  2YU9 B;  4X3K A;  1I4G A;  5FOB B;  1KTK A;  2J4X A;  3T4A C;  4E6I A;  1D2B A;  1FD7 D;  3FEW X;  3M4Y A;  4IQZ A;  4A4I A;  3A0J A;  4DV1 L;  1J5E L;  3EA6 A;  5IE8 A;  3AQQ A;  4DV3 L;  1PH4 A;  2PI2 A;  4IUN A;  4QB4 A;  4GOP C;  1SNM A;  3R2I A;  4OWT B;  4N9T A;  3S17 H;  4PG3 A;  3CPW A;  1IXR A;  1QVC A;  1VF5 C;  3CRK C;  1NE3 A;  2A1A A;  2PNR C;  4BBR G;  4A3E B;  4L5R C;  2X6G A;  1JR0 D;  2UUC Q;  1BXT A;  3FP9 A;  2F0V A;  4LF7 Q;  1HA6 A;  4JI8 L;  5IYC H;  5C4X G;  1EFI D;  1LTR D;  1LTL A;  3GTQ B;  5K5P A;  5C3W A;  4JI4 Q;  1HPC A;  1HA5 A;  5EBD A;  3F2D A;  1PVO A;  2R92 G;  1CFM A;  3M3Y H;  1R4P B;  1NMG A;  2EYL A;  3L2P A;  2K52 A;  2SNM A;  3A74 A;  4KHP L;  2SOB A;  1E24 A;  4B3R L;  1Y1W G;  1DOM A;  3FKI G;  4G7H C;  2PPB C;  2QEX A;  4LF5 L;  3H91 A;  3GTP B;  4X3T A;  5KRU A;  4DR1 Q;  3PIP A;  1AFP A;  1RTO A;  3G6J B;  4BY1 B;  3K5N A;  1X3Q A;  1HTL D;  3HOX B;  1EY9 A;  2UXB Q;  1A63 A;  2IWH A;  1X32 A;  5LMN W;  4LWC A;  2I5L X;  3M85 A;  3P20 A;  1E0B A;  1X3G A;  2K5N A;  1NJI C;  1ENA A;  4IFD G;  1EQT A;  2G9D A;  1PV4 A;  1I6H B;  1QUQ A;  4X66 L;  1XNR Q;  1IW7 D;  3TP5 A;  1Q90 A;  5M5X B;  3RZO H;  3GP7 A;  2IY5 B;  3S2H B;  5M3F B;  1DD2 A;  3A55 A;  1NMF A;  3ERO A;  1TWA B;  5GAE C;  3GTL B;  1HQR D;  4OHJ A;  5JJK A;  1YHB A;  3J81 E;  2IL8 A;  1BQQ T;  4Q0F A;  3NTK A;  4HN7 A;  2MO0 A;  4NW2 A;  1H9S B;  5J1Z A;  4A3I G;  3KF8 A;  2R93 B;  2QKI C;  2BDO A;  2KJX A;  4LMQ D;  1QVG A;  3J7A 5;  2Q2T A;  3TEH B;  3BVG A;  2HHH L;  1T5X D;  4B08 A;  1ENC A;  3NPP A;  2FIN B;  2XVS A;  2O4X A;  4A3M G;  3AYH B;  2KCN A;  1G51 A;  1HNZ L;  4JPB W;  5M3F H;  1YNX A;  1HFN A;  3I4M B;  1SE2 A;  2UUB Q;  4DK1 A;  1VQ8 A;  1V8Q A;  4DNR B;  1B4O A;  2I46 A;  4FF2 A;  3QR8 A;  3I70 A;  1EQR A;  4DAY A;  5KND A;  2L11 A;  3J80 L;  1BBU A;  1DOK A;  4QF4 A;  3Q24 A;  4A3L H;  2KUM A;  1KXL A;  1FNW A;  5M3M H;  4A3B G;  3I4N G;  3PF4 A;  1EOT A;  3H15 A;  1VQ9 A;  2OTL A;  2L9H A;  1S4Z A;  1PLF A;  1WCM G;  3GTK H;  5CYU A;  2EY2 A;  4APV A;  4M1U B;  1KDB A;  1A62 A;  2ICE C;  3CME A;  4DV7 Q;  2JA5 B;  1HTP A;  4OXP A;  5IP9 H;  5D14 A;  2FMC A;  4EVO A;  4K2L A;  5C3E H;  1TKW B;  1VQD A;  1HQM C;  2EYO A;  2SEB D;  3KF8 B;  4DV2 L;  3J80 c;  2R3Z A;  1TS2 A;  4DN4 M;  1YNJ D;  1N33 Q;  3UE1 A;  1BUV T;  4DR7 L;  1O7Y A;  4FO2 A;  3S1Q H;  1LLR D;  2AUK A;  2EY5 A;  2PMZ B;  1J8I A;  3DHQ A;  3ITP A;  2FHT A;  3X3M A;  1N34 Q;  4LF7 L;  3CU7 A;  2B2T A;  4CKB A;  5IT9 L;  3K5O A;  5CC4 A;  3NUC A;  1WCM B;  1JOR A;  4JI2 Q;  3G71 A;  1SMY D;  4GOP B;  1GUS A;  1QZG A;  3L9A X;  2DUD A;  1W2B A;  4LFA L;  4FXK C;  1HNX L;  1Z47 A;  3CD6 A;  2K1B A;  3CAM A;  5IGG A;  1YNN C;  3CCS A;  4J6H A;  2K14 A;  1B70 B;  4DPG A;  1FR3 A;  1EYC A;  4C3I G;  2E74 C;  5EKL A;  2R6G A;  5LL6 X;  3VDY A;  5CBE E;  2ES2 A;  1VQI A;  2F0D A;  4IJL A;  4UP7 A;  4LF9 L;  4RHS A;  1JB3 A;  1G6P A;  1EY7 A;  1NR2 A;  3CCR A;  1CSP A;  4JYA L;  2CHB D;  4A3F G;  1CA6 A;  2UXD Q;  3HOV G;  4DR3 L;  1ZEQ X;  1LTT D;  3CHB D;  5C4J B;  5FLX E;  1MSG A;  4UDU C;  1FGU A;  3MAQ A;  2ZJR A;  3Q23 A;  5A35 A;  1QZH A;  5J3B A;  2O5I C;  4DV4 L;  3IRB A;  2HDL A;  3K7A B;  2F0L A;  2Z8L A;  2WFW A;  1XMQ Q;  1MIU A;  3S14 B;  4LW1 A;  3B6Y A;  2ATW A;  3HOU G;  2Z1C A;  1TU2 B;  3L7Z C;  5D3I B;  3QOJ A;  5HGQ A;  3S2H H;  1FNV A;  2FMM A;  1MJE A;  5M3M G;  2NUC A;  3J81 j;  1RCV D;  4DR6 Q;  5A2Q E;  1M4V A;  4IFD I;  4B3T L;  1TWH B;  1HNZ Q;  1STN A;  4ZAI A;  2L0C A;  2EQS A;  4K8I A;  5LHY 1;  2YYZ A;  2XRQ D;  3DWP A;  1QIL A;  4RG1 A;  2VB2 X;  1BCP B;  1BO0 A;  1ZYR C;  3ZYY X;  1XPO A;  2PQA A;  3M3Y B;  5EPJ A;  1KAW A;  5CR3 A;  4HMJ A;  4YY3 Q;  2VZA A;  1I3Q H;  1KQS A;  4KKT A;  1A3T A;  3CCL A;  4O42 A;  3Q6S A;  4PNY A;  3S9W A;  4DR4 L;  4DF7 A;  1HUN A;  3U9O A;  4AH6 A;  3KBX A;  3FVQ A;  2VUM G;  1VQG A;  3NQI A;  3EFX D;  2MFI A;  1CK1 A;  4OEM B;  5D3D A;  1JE5 A;  2ID0 A;  4X66 Q;  3ND9 A;  1XNR L;  5EBC A;  5C4X B;  4RGO S;  1STA A;  1KLG D;  4GLX A;  4HJA A;  1LM0 A;  3VR4 A;  2VL6 A;  5M9O A;  3MVV A;  2K01 A;  2GN5 A;  5M3M B;  1F2M A;  3HOU H;  2N55 A;  5IYB H;  3EQL C;  1TT2 A;  4A3K B;  2F3W A;  3F8T A;  4HIK A;  2LFN A;  3N52 A;  2RCF A;  4P74 A;  4LF8 Q;  5C44 H;  1UEA B;  5FLX L;  1VMC A;  1AN8 A;  4A3D G;  1XTC D;  2KA7 A;  3BDL A;  1B9N A;  1FJG Q;  3SK4 A;  4F7X A;  3X3N A;  2GVB A;  1XMO L;  1EEF D;  2F52 A;  4A3J H;  4HJ7 A;  1F9P A;  2IJ0 A;  3LWU A;  3GD7 A;  3LX0 A;  4K0K L;  1OXX K;  2DGY A;  5C4H A;  4GNX C;  5I2X A;  3TRE A;  3T51 B;  1EZ6 A;  2MUY A;  5ELO A;  2YTY A;  4UP9 A;  3J81 c;  1HCZ A;  3STB C;  3S1M B;  2SDF A;  3EN2 A;  2DY7 A;  5FLM H;  1ET9 A;  4CDD C;  3F2C A;  4N8F A;  3PGZ A;  3HS0 C;  1WTW A;  3H3V C;  5TSS A;  1S5D D;  2K75 A;  3OW2 A;  1K3R A;  2B2V A;  4A3E G;  1RJT A;  4HMI A;  1VQL A;  2HCC A;  5EGT A;  1RKN A;  2B63 B;  1Y1W H;  1PFB A;  1ENF A;  4IZ8 A;  2FFK B;  4FF3 A;  1K73 C;  5KYL A;  2XSC A;  1W6J A;  1SFO B;  2NZH A;  3MA2 B;  1WOC A;  3I3C A;  4NPS A;  5EKK A;  4AQY Q;  1HUM A;  2BA0 A;  3D3R A;  3S1M H;  4OWX B;  2UUA Q;  2PI2 E;  3OMC A;  3T13 A;  4JI3 Q;  3VYU A;  4CJ2 C;  3HOY B;  1KHI A;  1YVC A;  3NBH A;  2MJ8 A;  3CMA A;  2BH8 A;  2Z4I A;  5C3E B;  4G7Z C;  1TWC H;  4XQN A;  3K80 C;  3PO2 B;  4B9X A;  5FLM G;  2E2H B;  2M2L A;  4KN4 C;  4R8N A;  4F87 A;  1XMO Q;  1SN8 A;  4A3K H;  3HZX A;  2DJF C;  4F8M A;  4FF4 A;  2D9U A;  4X65 Q;  1JB7 A;  5E4W C;  2QCP X;  1WTR A;  1Q7Y C;  1M90 C;  3KOJ A;  3A5Z B;  3AU7 A;  2L1B A;  4A3G G;  4L63 B;  4FDB A;  1WTQ A;  3CCQ A;  2OQ0 A;  3KLS X;  5C44 B;  1CA5 A;  2QDB A;  2NVY H;  3MHB A;  1SSO A;  3S24 A;  1FGB D;  2AHO B;  2R7F A;  3H0G G;  4LJZ C;  2VQE L;  1PMR A;  5I6W A;  5CV5 A;  4CHT B;  2G9H D;  2NYZ D;  4R1J A;  2I0Q A;  3IAY A;  4KTA A;  1TWC B;  2R7Z G;  4ZK9 B;  1KDA A;  4JI7 Q;  3KLS A;  2CWA A;  4MTN A;  4BBR B;  1K8A C;  4KHZ A;  1IW7 C;  2LS0 1;  1EYG A;  4A76 A;  4P75 A;  2RHS B;  1H9J A;  4HJ8 A;  2JA5 H;  3KFU A;  1SNO A;  5I6Y A;  3VR6 A;  4QQB X;  2JA8 B;  2YU9 H;  1I4P A;  4JBM A;  4DA2 A;  2EPB A;  4KN7 C;  4LUV A;  5CV8 A;  1JOK A;  5JOB A;  3HOY H;  1NTG A;  3C46 A;  1HZA A;  1B3A A;  1CSQ A;  5IP7 H;  1SJE D;  2CWP A;  2XNA C;  2A69 C;  1WTP A;  2UXC L;  5IOD A;  2CH4 A;  3LGJ A;  2F4V Q;  3S1R B;  1LT4 D;  2ZTC A;  3KDF B;  1YHQ A;  2PNH A;  1SFO H;  1OXS C;  4DR2 L;  3HOZ B;  3T1Y Q;  2K28 A;  3WOE A;  4IAL A;  1MI2 A;  2NTS A;  1SYF A;  5M5W B;  3S15 H;  1XX8 A;  2K5Q A;  2F03 A;  1LV9 A;  3DEO A;  1XTD A;  4BY7 B;  3GO5 A;  1IKL A;  1XNQ L;  2IPK D;  4P2C B;  2EYH A;  4WFN 3;  5C6A A;  1PRT F;  4BXX G;  2C9O A;  3CCE A;  3RZD H;  1KDC A;  1RHP A;  1TVX A;  5IGB A;  2RKS A;  3GTP H;  2A5H A;  3CQZ H;  2NB0 A;  3H0G H;  2V1C C;  4CDC C;  4B3M Q;  1NSN S;  3VYR A;  1Q82 C;  4N9P A;  3CF5 A;  2WV6 D;  2EXZ A;  5E1F A;  1L0Y B;  2F0T A;  1ML0 D;  1MGS A;  5BR8 Q;  3K0Y A;  2K50 A;  2F0E A;  1LAC A;  4DV6 Q;  4RHR A;  1AZQ A;  1PA6 A;  2JP1 A;  2XIW A;  1HXY D;  3NTH A;  1XWE A;  3U4Z A;  2EJF C;  1I50 H;  4X3S A;  5IGF A;  1YJ9 A;  3RZD B;  2A8V A;  2IHF A;  2KQ3 A;  2F0J A;  3M7N A;  1TY2 A;  4RFB A;  3SXH A;  3ZJY C;  3U4V A;  3PIP 3;  5KNC A;  3UDI A;  2EIF A;  3BZC A;  3TDQ A;  4CDF C;  1YHA A;  1AW7 A;  2JA7 G;  3UDF A;  1LT5 D;  3GTQ H;  2AMC B;  3QWN A;  4TQU S;  3QO2 A;  3I56 A;  4XQJ A;  1EY4 A;  5JPN C;  3J7Y W;  3BYT B;  4OO1 H;  2EZV A;  1X54 A;  1Z9F A;  1GHJ A;  3OWE B;  4LFC Q;  1IBM L;  1T5E A;  4K6L A;  2D62 A;  4DR7 Q;  4DK3 C;  2QIL A;  4DFA A;  1EYD A;  1PFN A;  4AIM A;  2JA8 H;  4JV5 L;  4HJ5 A;  1E2V A;  1V43 A;  1YBY A;  3R2T A;  2VXW A;  4GN3 B;  5C4X H;  1PTO H;  3CCJ A;  5IGC A;  1NBW A;  2Q2I A;  4IUT A;  1TWF B;  1KNA A;  4DUY Q;  2JA9 A;  5HGT A;  1YJW A;  3DM3 A;  2VQE Q;  3HOV B;  1CI3 M;  3I91 A;  4EGV A;  1MJC A;  1S3O A;  3CC2 A;  1EFW A;  3PUX A;  3UDG A;  3TRZ A;  2EDG A;  1WTO A;  3TME A;  4WRD A;  3J80 E;  1LT6 D;  1LTI D;  2BE5 D;  3KDF A;  2K5W A;  4GLA C;  2J0T D;  2ALY B;  3TZD A;  3PMF A;  5JVH 3;  3ONA B;  1VQE A;  4H7B A;  1CKO A;  4C2M H;  3UDX A;  3T1Y L;  4A3B H;  4DV1 Q;  4IO9 A;  4V19 0;  4H44 C;  5LL6 S;  4NXM L;  2RQX A;  3NXW A;  1VQN A;  1E2W A;  4JBK A;  2CQO A;  2QF7 A;  1N9W A;  3KLR A;  1SMX A;  2NVT H;  3TP7 A;  1STH A;  2E2I H;  4G4K A;  3MXG A;  1Q8K A;  2F0F A;  1LO5 D;  2X6L A;  1O78 A;  1QNK A;  1PRT D;  1JJC B;  2EJG C;  5IWA Q;  4L6T B;  2XWJ B;  3S16 B;  5M5Y B;  3S17 B;  3ERS X;  3NP8 A;  2QDL A;  4GNX B;  2HIV A;  2ASB A;  1HNW L;  2B8G A;  1PH5 A;  2WKD A;  2EXD A;  4OGQ C;  3GTL H;  4A3J G;  4J15 A;  4PMB A;  1NY4 A;  3PO3 H;  2Y0S E;  3VYT A;  5ELN A;  1EQV A;  1Y1V H;  2M9V A;  3M4O H;  3NTI A;  3H3V I;  1K9M C;  2Z6B A;  1XNQ Q;  3I2Z A;  1UE1 A;  4UY8 C;  1K83 H;  3MC0 B;  3ICE A;  2IW3 A;  1JIC A;  3E3X A;  4V0B A;  4OIJ A;  3A54 A;  3A8J E;  1NNX A;  1RL2 A;  1CTM A;  4DR6 L;  3GTG H;  2N88 A;  3J7A V;  2K32 A;  2A19 A;  2RDG A;  1GVP A;  1IYU A;  4LNQ A;  5IP7 G;  3A7A B;  5GRO A;  2F0U A;  4YWM A;  5T1G A;  5CMD A;  4EQ5 A;  3R93 A;  5BN4 A;  1EZ8 A;  2EY6 A;  1OTC A;  1YIT A;  2O5J C;  3OSO A;  2N3S A;  5DEH A;  4DXG A;  2KEC A;  2R7Z H;  3K81 C;  3MXN B;  1RDP D;  2JA7 B;  4LFA Q;  1A2T A;  4L5Q A;  1STE A;  4JI5 L;  2PZT A;  3W5O A;  3FKI H;  1W3S A;  3HOW H;  4R4Q A;  1B9M A;  3H94 A;  1BCP D;  2IHE A;  1L0W A;  4MTK A;  4Y7N B;  4PMC A;  4IUV A;  2VY3 A;  4UHV A;  4C3I H;  3WOF A;  4BBS B;  1JE4 A;  1AH9 A;  3VA5 A;  1CT1 D;  1MHW C;  4OX9 Q;  1I5F A;  1JQY D;  4QCL A;  3MZ5 A;  1PRT C;  5FK9 C;  4XT1 B;  4P71 A;  3W3A A;  2NZ1 D;  1L1O B;  1Y8N B;  1ASZ A;  1H95 A;  1RTN A;  5D65 A;  4OL7 A;  4XXE A;  2L12 A;  4X65 L;  4BBS H;  2D0P A;  3PO2 G;  1X3F A;  3KJP A;  2H5X A;  3HOX G;  2ENB A;  2JA7 H;  1EIG A;  2K04 A;  2F0Q A;  1C9O A;  4S3S A;  1SBB B;  1F9Q A;  1IBL L;  1PH9 A;  2F1M A;  4L5S A;  1Y1W B;  5JJL A;  2D5D A;  2K03 A;  2K5D A;  3Q0A A;  3J7Z C;  4DV2 Q;  1PRT B;  2XTI A;  3K59 A;  1STB A;  5I9O A;  3DWA A;  3E5S A;  1D6E C;  4I7A A;  3BVM A;  3GTJ B;  3TSS A;  2L4N A;  1VQ5 A;  3BS1 A;  2B63 H;  4QUF A;  1VQM A;  4U68 A;  2ZJP A;  1A0I A;  1KD1 C;  3E0E A;  2ZXP A;  5ISR A;  4R9W A;  3LWE A;  5EAY A;  4ZKB B;  2WP8 J;  3GTM B;  1HRJ A;  3E9I A;  4XDX A;  3RMH A;  4A3D H;  5IWA L;  5M5Y H;  2LXJ A;  4C1N K;  3CCV A;  4C1N I;  2UXC Q;  4QMG A;  2NTT A;  1AP0 A;  2F4V L;  1I4Q A;  2WB1 B;  1ROD A;  1VDZ A;  1L0X B;  5I4D A;  5FJ8 G;  1N32 L;  2DNE A;  4L8J A;  4ODG A;  1FJG L;  2AUJ D;  1OXU A;  2KCM A;  2A6E D;  2XRS D;  3AFP A;  3BDO A;  2N78 A;  2C35 B;  3H0G B;  4O0A A;  4DKA C;  5GQO A;  2NWG A;  4NP5 A;  4LF8 L;  1F9R A;  1G2T A;  5DNF A;  2PW7 A;  2NVX B;  1PYS B;  3J7A F;  2E2I B;  1VF7 A;  4AYB B;  5M3F G;  3GTO B;  2JN4 A;  3HFZ B;  1C8C A;  4QL5 A;  3DLL A;  4DAY B;  3D4W A;  4ZRZ A;  1WJJ A;  1PH7 A;  5C0X G;  5CBA E;  1EY8 A;  3HOZ H;  2MNA A;  1N34 L;  2Q2H A;  2RCN A;  1AE3 A;  4JI0 Q;  4DGZ A;  1SE4 A;  1X9N A;  2L55 A;  4B9W A;  4LFB L;  4Y52 H;  5HY6 A;  3PO3 G;  4GOP A;  3FPU B;  2YV5 A;  1Q12 A;  5ELC A;  4RA8 A;  1KIX A;  1K0R A;  1IKM A;  1QCB D;  3N6R A;  3I72 A;  4LF6 Q;  4UAI A;  1LTB D;  4M8A A;  2OQK A;  1HZ9 A;  2NVX H;  1Z6H A;  4A3G H;  5FJ8 H;  1RD9 D;  1IYJ B;  1CKM A;  5FLX c;  1B50 A;  1I94 L;  2X69 A;  1YJN A;  1X65 A;  3AEV A;  2E5L Q;  5JEA G;  4A93 B;  1TY0 A;  1X3P A;  4PZ6 A;  3K58 A;  1F9S A;  2B2W C;  3IFD A;  4PZ8 A;  4ZQ3 A;  3ER0 A;  1BBW A;  3HKS A;  4XT3 B;  2Q8R E;  1A3U A;  1S5F D;  3K5L A;  1MBY A;  2EJM A;  1B3Q A;  2R7Z B;  2JEA I;  4PQX A;  2O2L D;  3SEB A;  4WJ4 A;  1JC7 A;  1PFM A;  4BA2 I;  1Y1V B;  3NBH B;  1QWY A;  1K8O A;  4KD3 A;  2OT2 A;  3JC6 6;  1YEZ A;  4X64 L;  1PHJ A;  1DM0 B;  1FL0 A;  3L0O A;  4OON A;  3I8Z A;  3P75 A;  1N36 Q;  2G5D A;  1OXT A;  4HTH A;  3S14 H;  5BN3 A;  3Q22 A;  1GUO A;  4H02 A;  3V96 A;  4BY1 G;  5IOC A;  2B2W A;  2PYK A;  2C5C A;  1Y69 U;  1Y14 B;  3PUY A;  1LTS D;  1O80 A;  4HED A;  1DCZ A;  2NVQ H;  4MIU A;  2DJG C;  5COY A;  1STG A;  4JK1 C;  4TRD A;  4N8X 1;  1ICF B;  3VA7 A;  4K5X A;  4OX9 L;  2R93 H;  1UEB A;  1EWH A;  4K0K Q;  3NWS A;  4FP5 D;  3TS2 A;  3BDC A;  1D5X C;  1EU4 A;  2BOS A;  3OIP A;  2KCT A;  1SR3 A;  2DY8 A;  4BY7 H;  1S5B D;  1SNQ A;  4FNF A;  1JJG A;  2LMC B;  1TWA H;  3EVQ A;  3HKZ E;  2MQH A;  4K8J A;  2CKZ B;  3D4D A;  4KD4 A;  4MHE A;  4JCV E;  4IPG A;  3VR5 A;  2A69 D;  2A74 C;  4DUZ Q;  4HID A;  2ZJQ A;  4DV3 Q;  3RD4 A;  3T1H Q;  1N32 Q;  1II3 A;  3PIO A;  1IBK L;  1QE6 A;  4IOC A;  4A3G B;  1E1O A;  4HR7 B;  5KYI A;  1HJP A;  3I4M G;  4YWL A;  5DM7 3;  3LNN A;  1L1O C;  4EQN A;  2AQ2 B;  2F0W A;  4KHV A;  1P8L A;  2QEJ C;  3D6C A;  4ZUI A;  4HCE A;  4Q5V A;  1WCM H;  2D2C C;  2WKC A;  5IIF A;  5H1S E;  5JVG 3;  3FHW A;  5IGD A;  5K36 H;  3DUZ A;  3D0F A;  2P5Z X;  1PDQ A;  3NSW A;  2RDH A;  4DK6 C;  2JK8 A;  2A6E C;  2F3V A;  1TS5 A;  3BZK A;  1S72 A;  5J39 A;  4EQO A;  1C7Y A;  1D7Q A;  1Q46 A;  1B44 D;  1J9O A;  1V1P B;  1VQF A;  2CW0 C;  4QJF A;  1TQO A;  3PUZ A;  1QUQ B;  3BVZ A;  2Q2U A;  4KKS A;  4KV6 A;  2J7Z A;  5DAU A;  3M9B A;  2ZXR A;  5C0X H;  4JI5 Q;  5C5L A;  1PYW D;  2JYO A;  4LUZ A;  3DM1 A;  1I50 B;  1D5Z C;  1UE6 A;  2E76 C;  3GV3 A;  3K0X A;  2AWO A;  3M4Q A;  1MSH A;  1RF2 D;  2NVY B;  4RKL A;  3W1G A;  3NK9 A;  1GUG A;  1B53 A;  5JJI A;  2NBF A;  4AYB G;  5I2Y A;  3QIA A;  2ZTD A;  4J8Q A;  3Q8D A;  1GKH A;  3F1Z A;  1DON A;  1SEB D;  3F2U A;  3TP6 A;  4CDE C;  1GD7 A;  3HOY G;  4JI1 L;  3SE0 A;  2TMP A;  1V1Q A;  1DXM A;  1A6X A;  2D0O A;  1H9K A;  4ZUJ A;  1PZK D;  2KEE A;  2ICI A;  3AFQ A;  3K7A H;  3ULL A;  1TWH H;  3VR3 A;  3K8A A;  4K2K A;  1ESR A;  3GTM H;  4XIG S;  2EYP A;  2A6H C;  4IPC A;  4A3I H;  2BH2 A;  3HOW B;  3SK5 A;  1H9M A;  4R4C A;  2HHH Q;  4ZCK A;  1EUJ A;  3PSI A;  2DN8 A;  1LT3 D;  2L15 A;  1KL9 A;  3OOC A;  4X3U A;  5KGU A;  1EEI D;  1G29 1;  5CGK A;  5C4J H;  2L5T A;  5JPM C;  3CQZ B;  3G7L A;  4YCU A;  5JJZ A;  5LMU Q;  4NDX A;  1EIF A;  3NEM A;  1BNZ A;  1I6V C;  2H1E A;  1GUN A;  1VQH A;  2NVT B;  5KNB A;  4BY7 G;  2OTJ A;  1CM9 A;  4ULL A;  4RKB A;  4A3F H;  1IBM Q;  3D31 A;  5CV7 A;  2TSS A;  5A2Q L;  2CH4 W;  4DV5 L;  2M00 A;  4EX5 A;  4C3H H;  3TN2 A;  1MKH A;  2UUC L;  4PMW A;  1K8G A;  3IL8 A;  1TR5 A;  2PCF B;  2IX3 A;  3K57 A;  1QG7 A;  3K5M A;  1U4L A;  4CJ0 B;  1A15 A;  1O7Z A;  4HIM A;  1FNU A;  2WAQ B;  2KHI A;  1NCV A;  4QUC A;  1TS4 A;  3SDZ A;  4RGM A;  2JA8 G;  1VQ7 A;  4CKC A;  4GZY C;  2OF1 A;  1SE8 A;  3CXC A;  4OO1 I;  1F2Z A;  3U58 A;  1PH6 A;  2B2Y C;  2KEN A;  1D1K A;  4RCO A;  3OIQ A;  1SXT A;  1VQP A;  2I5H A;  3H09 A;  2KOL A;  3C1E A;  4UP8 A;  2E2J H;  4OO1 G;  1FVI A;  3GTK B;  1UE5 A;  2ZTE A;  1SND A;  4WOR A;  1SNC A;  2HIX A;  3OYY A;  3NEN A;  1E3P A;  2Z6K A;  3C3L A;  2CVR A;  4HSV A;  1PH8 A;  4C2M B;  4DAV A;  4LUO A;  4LFC L;  1OO9 B;  4NXN L;  3PUV A;  4AYB E;  3VR2 A;  2JA6 H;  1BCP F;  3RLO A;  3G6E A;  2PZU A;  4LK1 C;  2E2H H;  2F0K A;  3PO2 H;  1I4R A;  1VQ4 A;  4YY3 L;  1WVL A;  1C48 A;  1PYB A;  1ASY A;  5IP9 G;  3W2D A;  5DLQ E;  4A93 G;  3CC4 A;  1NUC A;  1WD0 A;  1XJV A;  2JEB I;  4R4O A;  4KY7 A;  5IYB G;  3CC7 A;  2MGS A;  1WI5 A;  5I9P A;  3BZD B;  3I4N H;  1QNU A;  4NMZ A;  1EU3 A;  4WJW A;  2Z6K C;  1PTO B;  2PQE A;  1QVF A;  1TWG B;  1HR0 W;  3CKI B;  2VUM H;  2Q8I B;  1K8M A;  1DZ1 A;  1VS0 A;  2WB1 E;  1KAB A;  1SNP A;  1VCI A;  2EE1 A;  2F0H A;  4R4T A;  3R8B A;  3KLW A;  5EPK A;  3K7U C;  1EQQ A;  4ABN A;  2AQ1 B;  4LF4 L;  1JOQ A;  3I4O A;  4A3D B;  2MPM A;  4LF6 L;  4ILW A;  3U9S A;  1X6O A;  3E6Z X;  4JI6 Q;  1I94 Q;  4OIK A;  3TZU A;  1HZC A;  4BS9 A;  3GTG B;  1BCP C;  5ELB A;  4ALP A;  2F0P A;  2K4K A;  4HAE A;  1TWG H;  4GNX A;  4XTC S;  1KC8 C;  3A8I E;  5C5M A;  5LMN L;  1Q1B A;  2A68 D;  2DNC A;  2EYJ A;  5HUR A;  1MD2 D;  1TXY A;  1U4R A;  3J80 i;  1HHV A;  4A3J B;  1C0A A;  3PF5 A;  4X62 Q;  1SYE A;  4QIW E;  5IY0 A;  5BN5 A;  4RGT A;  1VQO A;  3QB3 A;  3C2P A;  4JI6 L;  1JWU D;  3RLN A;  1YZ6 A;  1BF4 A;  5M5X H;  3RZO B;  2EYF A;  5M5W H;  1S5E D;  4JC0 A;  3I4N B;  4PV1 C;  1Z7T A;  4A3B B;  1R4Q B;  4LF4 Q;  1Q86 C;  1Y1V G;  3EIV A;  3A5U A;  5FO7 B;  3C1F A;  5EJW A;  4TKO B;  2LKV A;  4LF5 Q;  2RA4 A;  4DV0 Q;  1F77 A;  1YNN D;  2R61 A;  2YTV A;  4FYD A;  1G2S A;  4RWS C;  3TP8 A;  2UUB L;  2E75 C;  4IN3 A;  3CCU A;  3ULP A;  1KNE A;  4GS3 A;  3G48 A;  4A93 H;  2CW0 D;  4C3J H;  4B3S L;  2K7V A;  4POF A;  4A3K G;  2XWB B;  3I7F A;  3MTS A;  2LXK A;  3DWQ A;  2HCI A;  1TWF H;  3WWV A;  3JAM i;  1U4M A;  4ZKC B;  1DYQ A;  1PTO C;  1UWV A;  2LSS A;  2XGT A;  2Z9H A;  4O2D A;  4J1M A;  1L1O A;  3NBI A;  1M1K C;  4NXN Q;  3HOV H;  1I4H A;  3L3O C;  4FVM A;  4KJN A;  4WJ3 M;  1J6Q A;  3GQB A;  3S1Q B;  4C56 C;  1HR0 L;  4BBR H;  3IKJ A;  3FKI B;  3OW7 A;  4JYA Q;  2KCC A;  2JJQ A;  5C4Z A;  3QOL A;  3BG3 A;  5DM6 3;  4DXF A;  1JT8 A;  5JEA J;  2Y0S B;  4POG A;  1H9R A;  1CHQ D;  2BE5 C;  3PIO 3;  1WTX A;  2LY7 A;  3K6O A;  4A3E H;  1S5C D;  4C3I B;  1QJO A;  1JJ2 A;  1B1Z A;  1LUZ A;  3M4O B;  2SNS A;  3TS0 A;  3KYH C;  1LTG D;  4BWG B;  5C0X I;  1Q81 C;  4BBS G;  1ILP A;  2HQL A;  2RSN A;  4A3M B;  1GJX A;  1SE3 A;  1EY5 A;  2N49 A;  2WII B;  1GUW A;  2E2J B;  2B2V C;  5KEE A;  2WB1 G;  1IHZ A;  3MEF A;  4MZ9 A;  4ZYS A;  2R92 B;  1G8Z D;  4HCS A;  2MO1 A;  3U50 C;  2PMZ E;  2NZO A;  1B7Y B;  3T56 B;  4P73 A;  4DK0 A;  1M8A A;  1SYB A;  2ZM6 L;  2HUG A;  2FJ2 A;  1STY A;  3AMU A;  2Z4H A;  4GN5 A;  4DNT B;  3S1N B;  1X55 A;  4XQQ A;  2B39 A;  4A3F B;  4B3S Q;  4BXX H;  4NB3 A;  3TQY A;  4DUY L;  5E4X A;  1AEX A;  3MXN A;  3A56 A;  3I55 A;  1DOL A;  4G57 A;  2V4D A;  5ELD A;  3HOZ G;  4CKE A;  3I90 A;  4DV0 L;  4BA1 I;  4IJH A;  3BYY B;  2YTX A;  4R4I A;  4JOI C;  3IFT A;  4DR1 L;  2VS1 A;  4U67 3;  1ZKO A;  1U4P A;  1E1T A;  4NKL A;  4JBW A;  1AZP A;  3TBI B;  3O13 A;  4KK7 A;  3MWY W;  3I4L A;  2XN9 C;  4O1N A;  1ILQ A;  4AQY L;  3OHX C;  2JA5 G;  2NN6 I;  5AJ3 L;  2VUM B;  1ZYR D;  1JMC A;  1I4X A;  2E2D C;  4DAP A;  3SVM A;  1WFQ A;  4NXM Q;  4DAM A;  1GO3 E;  4XYO A;  3NHH A;  3FRP B;  3RUZ A;  3KJO A;  1E2Z A;  4DV4 Q;  1FYC A;  2K5H A;  3T53 B;  5IYD G;  3KF6 B;  2EOT A;  4OEL B;  2WAQ E;  2RF4 A;  2IT1 A;  1SLJ A;  4YWK A;  4IPD A;  4DR4 Q;  3G4S A;  2B2Y A;  1HZB A;  3RN2 A;  4IOA A;  4KJO A;  2B63 G;  4JI7 L;  2F0N A;  2F0I A;  1EWI A;  3PV0 A;  3SGI A;  3D4R A;  4TVA B;  1IYV A;  3E9H A;  4ME5 A;  4YCW A;  2JA6 B;  2HQE A;  2VQF L;  4IFD H;  2KBN A;  4C3J B;  1PH1 A;  3MFG A;  1O7L A;  3BU2 A;  4LAA A;  4Y7N H;  3RNU A;  4QY7 A;  2RHQ B;  3HOU B;  2UXD L;  1KAA A;  1SDF A;  4YIJ A;  5GAD C;  2KVM A;  1WTH A;  3I4M H;  4KI0 A;  4RAU C;  4X6A H;  3E0J A;  2AQ3 B;  4DR2 Q;  2FXQ A;  2Z0S A;  3A8K E;  2EVB A;  1L2F A;  1VQB A;  1PH2 A;  1GXD C;  3MXU A;  2JE6 I;  4GKJ L;  3MEH A;  2I5M X;  3HP3 A;  3CPF A;  3WDN A;  2HT1 A;  4FXD A;  4JBJ A;  1CUK A;  1T9H A;  3DMU A;  2F0O A;  1XXG A;  3STB D;  1LTA D;  2OXP A;  1HR0 Q;  3F2B A;  4DUZ L;  4PZ7 A;  4C3H B;  4I7Z C;  1WYD A;  4H0L C;  1VQJ A;  4DV5 Q;  2K05 A;  4JI3 L;  2NN6 G;  2B2T C;  1OXV A;  2R93 G;  3FDT A;  3GTJ H;  1BR9 A;  3NQT A;  4IUQ A;  1HFG A;  1IL2 A;  2UU9 L;  2JXM B;  1N33 L;  1JWM D;  3M7G A;  1I6H H;  3R3O A;  4JI4 L;  1ET6 A;  5IGE A;  3H3V H;  1EY0 A;  4DNI A;  1SRU A;  2ZT9 C;  4DV6 L;  5LMU L;  3SR1 A;  1S40 A;  4OWW B;  2VNU D;  4R8I A;  2QW7 A;  3PO3 B;  3OWF A;  1EIH A;  2IX1 A;  3MXP A;  1SAP A;  2K33 A;  1D5M C;  4BY1 H;  1X56 A;  1D8L A;  2R7D A;  5AFW A;  1K3B C;  3CW2 C;  3UE0 A;  5IT9 E;  4A3I B;  4C3H G;  3A7L A;  2F0G A;  4A3C H;  4QGU A;  1V1P A;  1TII D;  3PQI A;  4CJ1 B;  3HOW G;  4CGY B;  5FO8 B;  5G3L F;  3HEJ A;  1HNX Q;  4B3T Q;  4L5T A;  5IT9 c;  1CQV A;  3GV6 A;  1EIY B;  4JI2 L;  2NVQ B;  3SHL A;  2MP1 A;  5NUC A;  3OTO Q;  4RCN A;  5FKA C;  2CFM A;  2KED A;  1G91 A;  2PZW A;  1Q1E A;  1F2L A;  3EBE A;  4TSS A;  4JI1 Q;  1R9T H;  2A6H D;  3D8G A;  3RLF A;  2JSO A;  5C44 G;  1E22 A;  2UUA L;  1K28 A;  1U0L A;  5T1I A;  2GVA A;  4C3J G;  1A8V A;  1XYI A;  4GKK Q;  4JVZ A;  1KLU D;  2N8N A;  1ICW A;  2KHJ A;  1U9R A;  2PQA B;  3CP0 A;  2VQF Q;  2RSO A;  1QB5 D;  4MNO A;  1UUP A;  3NWT A;  1JCK B;  3KK7 A;  4B3M L;  4G7O C;  1SYG A;  1QOH A;  1VMP A;  2F0M A;  1ONL A;  4X62 L;  4DV7 L;  2B29 A;  1O7I A;  1YI2 A;  3NE5 B;  1C4Q A;  1DGS A;  4EQP A;  5FO9 B;  2RBM A;  1Y8O B;  1X3E A;  4DR5 L;  1PTO F;  4K14 A;  1CZW A;  4ID6 A;  4IUU A;  4DU9 A;  3T16 A;  2VW9 A;  3MFY A;  4IUR A;  2UXB L;  3T1H L;  1I3Q B;  1U5K A;  1W6K A;  1KRT A;  4K6D A;  1TS3 A;  3QJY A;  2WAQ G;  4CBV A;  3RR5 A;  4FF1 A;  1CZG A;  5KIX A;  3S2D B;  4Z9C B;  1GOZ A;  4ME3 A;  5C3X A;  1SYC A;  5ELF A;  4QIW B;  5CV4 A;  1CKN A;  1IBK Q;  1K83 B;  2CQA A;  1N8R C;  4HIO A;  2WIN B;  2A68 C;  5E7N A;  2VB3 X;  1R9T B;  3W1B A;  2GA4 B;  2Y0S G;  1EOV A;  3KUP A;  1VQ6 A;  2WAC A;  1BDO A;  1EY6 A;  1UNS A;  1PZI D;  3GDE A;  3HKZ B;  1CHP D;  4A3C G;  3OMG A;  2BA1 A;  4KHP Q;  4DR5 Q;  1JOO A;  4H13 C;  1VQA A;  1Q8I A;  4DR3 Q;  3I73 A;  3ULJ A;  2JA6 G;  1G6Z A;  2IX0 A;  1WD1 A;  1SMY C;  1WTV A;  2QGQ A;  3HG9 A;  4YHH L;  1PFS A;  5LMN Q;  5ELE A;  4KLK A;  4YCV A;  2UU9 Q;  4KKU A;  1Q3L A;  4MN3 A;  5GAH C;  5EKI A;  1NR4 A;  1UAP A;  2A73 B;  5GAG C;  4RH6 A;  5J22 A;  3HRZ C;  3HKZ G;  3CRL C;  4UPA A;  2NN6 H;  1VQK A;  2OCE A;  2B2U A;  1D1I A;  3PCO B;  2R92 H;  1CKN B;  1ESF A;  4K5W A;  3HGB A;  5JAV A;  2E8G A;  4GKJ Q;  4P72 A;  1IL8 A;  3SK8 A;  4LF9 Q;  3JAM E;  1GHK A;  1JWS D;  1XPU A;  3DXJ C;  1BVS A;  1DJR D;  1E7Z A;  2OEO A;  4RGN A;  5IYC G;  3V2T A;  3HOX H;  3J81 L;  3FPP A;  3OTO L;  4JW0 A;  3EJI A;  2HDM A;  5BR8 L;  2H4O A;  3AB9 A;  1RIP A;  4KY6 A;  3S1R H;  1PTO D;  3ERQ A;  5G3L D;  3D6W A;  4JOI A;  1KRS A;  4HJ9 A;  4IUP A;  1A3V A;  4JI8 Q;  1BKB A;  2F3I A;  2B2U C;  3SK6 A; 
#chains in the Genus database with same CATH homology
 5M5W H;  2XTI A;  4JC0 A;  3PUW A;  3NEL A;  4LF4 Q;  4A3D G;  1Q86 C;  1Y1V G;  3EIV A;  1VQ5 A;  1FJG Q;  3A5U A;  4LF5 Q;  4GLV B;  1N36 L;  2GVB A;  1XMO L;  2B63 H;  4JG2 A;  4DV0 Q;  1VQM A;  2F52 A;  4X64 Q;  2ZJP A;  1A0I A;  4HJ7 A;  4A3J H;  1YIJ A;  3E0E A;  1KD1 C;  3GD7 A;  4GKK L;  4K0K L;  1OXX K;  2YTV A;  5EAY A;  2DGY A;  4GNX C;  2WP8 J;  3RN5 A;  3E9I A;  4YHH Q;  4A3D H;  2UUB L;  3TRE A;  5IWA L;  5M5Y H;  2LXJ A;  3CCU A;  1GM5 A;  3ULP A;  5ELO A;  4LFB Q;  3CCV A;  5IYD H;  4GS3 A;  3G48 A;  2OWO A;  2YTY A;  4C3J H;  4A93 H;  2UXC Q;  4B3S L;  2B3G A;  4POF A;  5C0X J;  4UP9 A;  3J81 c;  4A3K G;  5AJ3 Q;  3STB C;  4JI0 L;  2F4V L;  3I7F A;  2LXK A;  3J81 i;  3EN2 A;  5FJ8 G;  1HH2 P;  5FLM H;  1N32 L;  4RMF A;  1FJG L;  1TWF H;  3F2C A;  1OXU A;  2KCM A;  3WWV A;  2AKW B;  2AWN A;  3JAM i;  3AFP A;  1VQC A;  3PGZ A;  4A3L G;  2N78 A;  1UWV A;  2LSS A;  2XGT A;  2C35 B;  2K75 A;  4O0A A;  4JI8 Q;  4O2D A;  5GQO A;  4DKA C;  1K3R A;  3OW2 A;  4LF8 L;  4A3E G;  2K5V A;  5C3E G;  2E5L L;  3S1N H;  4B3R Q;  1L1O A;  1M1K C;  1VQL A;  4NXN Q;  3HOV H;  1PYS B;  3GTO H;  1V9P A;  1B8A A;  1Y1W H;  4WJ3 M;  1J6Q A;  5M3F G;  3HFZ B;  4QL5 A;  1K73 C;  3DLL A;  4BBR H;  3CCM A;  1XPR A;  1HR0 L;  3S16 H;  4DAY B;  4JYA Q;  1WJJ A;  2JJQ A;  1PH7 A;  2NZH A;  5C0X G;  2QA4 A;  1JT8 A;  5JEA J;  4POG A;  3HOZ H;  1WOC A;  2MNA A;  1AE2 A;  4NPS A;  1N34 L;  2Q2H A;  4AQY Q;  2RCN A;  1AE3 A;  2BA0 A;  3S1M H;  4A3E H;  4JI0 Q;  4OWX B;  2UUA Q;  1LYL A;  2PI2 E;  4JI3 Q;  1X9N A;  3M4P A;  4A75 A;  1XMQ L;  4LFB L;  1KHI A;  1JJ2 A;  2ZM6 Q;  1YVC A;  1UE7 A;  4Y52 H;  5HY6 A;  3PO3 G;  4GOP A;  1LUZ A;  2BH8 A;  3CMA A;  2YV5 A;  1Q12 A;  1TWC H;  3TS0 A;  1KIX A;  1K0R A;  1SRO A;  3K80 C;  3KYH C;  4JV5 Q;  4IFD J;  5FLM G;  1PH3 A;  5C0X I;  1Q81 C;  4LF6 Q;  4BBS G;  5K36 G;  2OQK A;  2HQL A;  1HZ9 A;  2NVX H;  1XMO Q;  1SN8 A;  2N49 A;  4A3K H;  3BJU A;  3JAM c;  1P16 A;  4A3M H;  4A3G H;  5FJ8 H;  1IYJ B;  1CKM A;  5FLX c;  4X65 Q;  1I94 L;  1JB7 A;  2WB1 G;  3KF6 A;  1X65 A;  2JQO A;  3MEF A;  4GN4 B;  4MZ9 A;  1YJN A;  2E5L Q;  5JEA G;  3AEV A;  4PZ6 A;  1Q7Y C;  2MO1 A;  1J5E Q;  1M90 C;  1IBL Q;  3KOJ A;  3A5Z B;  3U50 C;  4A3G G;  4FDB A;  2PMZ E;  3CCQ A;  2OQ0 A;  4IPH A;  1IZ6 A;  4PZ8 A;  2NVY H;  2NZO A;  3S24 A;  3ER0 A;  1B7Y B;  1BBW A;  3HKS A;  2R7F A;  2AHO B;  3H0G G;  4P73 A;  2ZM6 L;  2VQE L;  4GN5 A;  1X55 A;  3S2D H;  2JEA I;  4R1J A;  2I0Q A;  2CCZ A;  4B3S Q;  4BXX H;  4WJ4 A;  4NB3 A;  3TQY A;  4DUY L;  4BA2 I;  4A4I A;  2R7Z G;  4DV1 L;  3A0J A;  1J5E L;  1PH4 A;  5IE8 A;  3AQQ A;  3NBH B;  3I55 A;  4DV3 L;  2PI2 A;  4JI7 Q;  4GOP C;  3HOZ G;  4OWT B;  3S17 H;  2CWA A;  3JC6 6;  1YEZ A;  4PG3 A;  4MTN A;  3CPW A;  1IXR A;  1K8A C;  1QVC A;  4KHZ A;  4X64 L;  1PHJ A;  4DV0 L;  1FL0 A;  3L0O A;  1NE3 A;  1EYG A;  4OON A;  4P75 A;  4A76 A;  2A1A A;  4BA1 I;  1N36 Q;  4IJH A;  1OXT A;  2RHS B;  4BBR G;  3S14 H;  2YTX A;  4HJ8 A;  4R4I A;  4H02 A;  4L5R C;  2JA5 H;  4BY1 G;  3KFU A;  4JOI C;  4DR1 L;  2VS1 A;  2UUC Q;  1Y14 B;  4QQB X;  3FP9 A;  1E1T A;  3PUY A;  4JBW A;  2YU9 H;  4JBM A;  4LF7 Q;  3HOY H;  3PF4 A;  4LUV A;  4JI8 L;  2NVQ H;  1NTG A;  5IYC H;  1HZA A;  5C4X G;  1CSQ A;  4AQY L;  5IP7 H;  2UXC L;  2CWP A;  2JA5 G;  2NN6 I;  3LGJ A;  5AJ3 L;  2F4V Q;  2ZTC A;  4OX9 L;  1LTL A;  2R93 H;  1UEB A;  3KDF B;  1YHQ A;  1JMC A;  4JI4 Q;  3F2D A;  2PNH A;  4NXM Q;  1WFQ A;  1OXS C;  1SFO H;  1PVO A;  4DAM A;  4DR2 L;  2R92 G;  1GO3 E;  3T1Y Q;  4K0K Q;  3KJO A;  3TS2 A;  3M3Y H;  3S15 H;  4DV4 Q;  2KCT A;  1NMG A;  2K5H A;  5IYD G;  3L2P A;  1SR3 A;  2K52 A;  4BY7 H;  3A74 A;  3KF6 B;  4KHP L;  1E24 A;  2WAQ E;  2RF4 A;  1TWA H;  1XTD A;  3FKI G;  2MQH A;  3GO5 A;  3HKZ E;  2IT1 A;  1SLJ A;  1Y1W G;  2QEX A;  4LF5 L;  1XNQ L;  4YWK A;  4IPD A;  4DR4 Q;  4BXX G;  3CCE A;  3G4S A;  3RZD H;  2CKZ B;  1HZB A;  3RN2 A;  4JCV E;  3GTP H;  4IOA A;  4IPG A;  3PIP A;  4DR1 Q;  2B63 G;  3CQZ H;  3H0G H;  2V1C C;  4DUZ Q;  4HID A;  2ZJQ A;  4DV3 Q;  4JI7 L;  4B3M Q;  1Q82 C;  3CF5 A;  3T1H Q;  1N32 Q;  1EWI A;  3PIO A;  1IBK L;  3PV0 A;  3SGI A;  4TVA B;  2UXB Q;  3E9H A;  1A63 A;  4YCW A;  4IOC A;  1E1O A;  4LWC A;  2VQF L;  5LMN W;  2KBN A;  2I5L X;  5BR8 Q;  1HJP A;  3M85 A;  4YWL A;  3I4M G;  1PH1 A;  2K50 A;  1L1O C;  4Y7N H;  3BU2 A;  4DV6 Q;  3RNU A;  4QY7 A;  1X3G A;  2RHQ B;  2K5N A;  1NJI C;  2UXD L;  5GAD C;  4IFD G;  1PA6 A;  1PV4 A;  3I4M H;  1QUQ A;  1P8L A;  4KI0 A;  1WCM H;  4X66 L;  5H1S E;  4DR2 Q;  1XNR Q;  2FXQ A;  4X6A H;  2Z0S A;  3FHW A;  3U4Z A;  1I50 H;  1YJ9 A;  2A8V A;  2IHF A;  1L2F A;  1VQB A;  3D0F A;  1PH2 A;  3RZO H;  2IY5 B;  3M7N A;  2JE6 I;  4GKJ L;  4DK6 C;  1NMF A;  2JK8 A;  5GAE C;  2I5M X;  3CPF A;  3ZJY C;  3U4V A;  2HT1 A;  3BZK A;  1S72 A;  4JBJ A;  5JJK A;  1YHB A;  1CUK A;  3UDI A;  3BZC A;  1T9H A;  2EIF A;  1YHA A;  1C7Y A;  1D7Q A;  2JA7 G;  1Q46 A;  3STB D;  3UDF A;  3GTQ H;  2MO0 A;  1VQF A;  1HR0 Q;  2AMC B;  3F2B A;  4DUZ L;  4QJF A;  4TQU S;  4PZ7 A;  3PUZ A;  1QUQ B;  3I56 A;  2Q2U A;  1WYD A;  4A3I G;  1QVG A;  4LF8 Q;  3J7A 5;  2Q2T A;  3M9B A;  1VQJ A;  3TEH B;  4JI5 Q;  4DV5 Q;  2HHH L;  4LUZ A;  2NN6 G;  4JI3 L;  1X54 A;  1Z9F A;  1OXV A;  2R93 G;  4A3M G;  4LFC Q;  1UE6 A;  3AYH B;  3K0X A;  2AWO A;  1G51 A;  3M4Q A;  3GTJ H;  1HNZ L;  1IBM L;  1IL2 A;  2D62 A;  5M3F H;  2UU9 L;  3W1G A;  4DR7 Q;  1YNX A;  4DK3 C;  1N33 L;  5JJI A;  1I6H H;  4AIM A;  4JV5 L;  4AYB G;  2JA8 H;  4JI4 L;  1JJG A;  4HJ5 A;  1V43 A;  1YBY A;  2ZTD A;  2UUB Q;  4GN3 B;  3H3V H;  5C4X H;  3Q8D A;  3CCJ A;  1GKH A;  3F1Z A;  4DNI A;  1NBW A;  2Q2I A;  1VQ8 A;  1SRU A;  4DV6 L;  5LMU L;  1EQR A;  1S40 A;  4OWW B;  4DUY Q;  1GD7 A;  3HOY G;  2VNU D;  2JA9 A;  4JI1 L;  1YJW A;  1BBU A;  1V1Q A;  2IX1 A;  4A3L H;  3DM3 A;  2D0O A;  1KXL A;  5M3M H;  2VQE Q;  4A3B G;  4BY1 H;  1X56 A;  3AFQ A;  1D8L A;  3K7A H;  3ULL A;  3I4N G;  2R7D A;  1MJC A;  1TWH H;  1S3O A;  3CW2 C;  3H15 A;  1EFW A;  3PUX A;  3UE0 A;  3UDG A;  3CC2 A;  3K8A A;  1VQ9 A;  3TRZ A;  2OTL A;  3GTM H;  4XIG S;  4IPC A;  2BH2 A;  4A3I H;  1WCM G;  3GTK H;  4APV A;  4A3C H;  4QGU A;  4R4C A;  1HNW Q;  1A62 A;  3CME A;  2HHH Q;  4DV7 Q;  1EUJ A;  3PSI A;  3KDF A;  4OXP A;  4GLA C;  2L15 A;  5IP9 H;  3HOW G;  1KL9 A;  1HNX Q;  4B3T Q;  1G29 1;  2ALY B;  5C4J H;  4L5T A;  1VQE A;  1CKO A;  5IT9 c;  4C2M H;  1EIY B;  5C3E H;  4YCU A;  3UDX A;  3T1Y L;  4JI2 L;  5LMU Q;  4DV1 Q;  4IO9 A;  3OTO Q;  4A3B H;  1EIF A;  4NXM L;  1VQD A;  3NEM A;  3KF8 B;  1VQN A;  4DV2 L;  3J80 c;  4JBK A;  2CFM A;  2CQO A;  1N9W A;  1N33 Q;  1VQH A;  3UE1 A;  4DR7 L;  1Q1E A;  4BY7 G;  2OTJ A;  3S1Q H;  1SMX A;  4A3F H;  1IBM Q;  3D31 A;  2NVT H;  3EBE A;  1R9T H;  4JI1 Q;  3RLF A;  2UUA L;  2E2I H;  5C44 G;  1E22 A;  4DV5 L;  1Q8K A;  4LF7 L;  1N34 Q;  4EX5 A;  1U0L A;  4C3H H;  1JJC B;  5IWA Q;  2GVA A;  1MKH A;  2UUC L;  1A8V A;  3ERS X;  4PMW A;  4GNX B;  2HIV A;  1K8G A;  2ASB A;  4GKK Q;  1HNW L;  1PH5 A;  4JI2 Q;  2N8N A;  3G71 A;  4GOP B;  2EXD A;  2KHJ A;  2PQA B;  3CP0 A;  2VQF Q;  1QZG A;  3GTL H;  2DUD A;  1W2B A;  4LFA L;  4MNO A;  4A3J G;  4J15 A;  4HIM A;  1HNX L;  2KHI A;  1Z47 A;  3CD6 A;  1NY4 A;  3PO3 H;  2Y0S E;  4B3M L;  3CAM A;  4DV7 L;  5ELN A;  4X62 L;  3CCS A;  2JA8 G;  2K14 A;  1VQ7 A;  1Y1V H;  2B29 A;  1B70 B;  4DPG A;  3M4O H;  1O7I A;  3H3V I;  1YI2 A;  1K9M C;  1SE8 A;  3CXC A;  4OO1 I;  4B3R L;  3U58 A;  1PH6 A;  1XNQ Q;  3I2Z A;  1UE1 A;  2KEN A;  4UY8 C;  1K83 H;  1DGS A;  2R6G A;  3VDY A;  3ICE A;  1VQP A;  2ES2 A;  1VQI A;  2I5H A;  4IJL A;  1X3E A;  4DR5 L;  4UP7 A;  4UP8 A;  2E2J H;  4OO1 G;  1FVI A;  4LF9 L;  1RL2 A;  4DR6 L;  1UE5 A;  3GTG H;  2ZTE A;  2VW9 A;  1G6P A;  2A19 A;  1GVP A;  2UXB L;  4LNQ A;  3CCR A;  5IP7 G;  3T1H L;  1CSP A;  5GRO A;  4JYA L;  1U5K A;  1KRT A;  4YWM A;  4EQ5 A;  4A3F G;  2HIX A;  3OYY A;  3HOV G;  3NEN A;  4DR3 L;  2UXD Q;  1E3P A;  1OTC A;  1YIT A;  2WAQ G;  2Z6K A;  3RR5 A;  2N3S A;  1PH8 A;  2R7Z H;  1FGU A;  3K81 C;  3MXN B;  4ME3 A;  4LUO A;  4LFC L;  4LFA Q;  4NXN L;  2ZJR A;  1CKN A;  4L5Q A;  3PUV A;  4AYB E;  1IBK Q;  4JI5 L;  2JA6 H;  3RLO A;  3G6E A;  1N8R C;  4HIO A;  5E7N A;  5J3B A;  1QZH A;  3W1B A;  2E2H H;  3PO2 H;  2Y0S G;  1VQ4 A;  1EOV A;  3W5O A;  4YY3 L;  4DV4 L;  1VQ6 A;  3FKI H;  1W3S A;  3IRB A;  1PYB A;  1ASY A;  5IP9 G;  4R4Q A;  3HOW H;  5DLQ E;  3GDE A;  4A93 G;  2WFW A;  1XMQ Q;  3CC4 A;  1MIU A;  4A3C G;  2IHE A;  1L0W A;  1XJV A;  2BA1 A;  2JEB I;  4R4O A;  5IYB G;  4KHP Q;  4LW1 A;  3B6Y A;  2ATW A;  3HOU G;  3L7Z C;  3CC7 A;  4DR5 Q;  2VY3 A;  4C3I H;  1WI5 A;  5HGQ A;  1VQA A;  4DR3 Q;  3S2H H;  3ULJ A;  3I4N H;  1MJE A;  2JA6 G;  1AH9 A;  5M3M G;  2IX0 A;  2Z6K C;  3J81 j;  4OX9 Q;  2QGQ A;  4YHH L;  1QVF A;  1HR0 W;  4DR6 Q;  1PFS A;  5LMN Q;  1I5F A;  2VUM H;  4KLK A;  4YCV A;  2UU9 Q;  4B3T L;  4IFD I;  1HNZ Q;  1VS0 A;  5GAH C;  2EQS A;  2WB1 E;  1VCI A;  4R4T A;  2YYZ A;  3KLW A;  3K7U C;  4RG1 A;  1EQQ A;  4LF4 L;  4P71 A;  5GAG C;  3I4O A;  1XPO A;  2PQA A;  1L1O B;  3HKZ G;  4UPA A;  1KAW A;  4LF6 L;  1ASZ A;  4YY3 Q;  1VQK A;  2VZA A;  2OCE A;  1X6O A;  1H95 A;  1I3Q H;  1KQS A;  4JI6 Q;  4X65 L;  3PCO B;  1I94 Q;  2R92 H;  1HZC A;  1CKN B;  4BBS H;  3CCL A;  2D0P A;  4ALP A;  4DR4 L;  4GKJ Q;  2E8G A;  3PO2 G;  4P72 A;  1X3F A;  2K4K A;  4AH6 A;  3KJP A;  2H5X A;  3HOX G;  4LF9 Q;  1VQG A;  2VUM G;  2MFI A;  1TWG H;  4GNX A;  2JA7 H;  4XTC S;  1JE5 A;  1KC8 C;  1XPU A;  2ID0 A;  4X66 Q;  1XNR L;  1BVS A;  1E7Z A;  5IYC G;  5LMN L;  1Q1B A;  1C9O A;  3HOX H;  4GLX A;  4HJA A;  1LM0 A;  2VL6 A;  1TXY A;  3J80 i;  3OTO L;  1IBL L;  2GN5 A;  1PH9 A;  1C0A A;  3PF5 A;  5BR8 L;  4L5S A;  4X62 Q;  1RIP A;  3HOU H;  3S1R H;  5JJL A;  5IYB H;  4QIW E;  5IY0 A;  4JOI A;  1VQO A;  1KRS A;  3F8T A;  4HIK A;  4HJ9 A;  3J7Z C;  4DV2 Q;  4JI6 L;  3RLN A;  4P74 A;  1BKB A;  2F3I A;  1YZ6 A;  5C44 H;  5M5X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...