2YU9H

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yu9H00
3SGIA 4LF8Q 1HR0L 4BY1G 3PF5A 2IHEA 2OTLA 1S72A 1VQAA 4YY3L 4DR5Q 4HIKA 4B3TQ 1QUQB 2AKWB 5K36G 2RHQB 4IJHA 4DPGA 1KAWA 4R4QA 1SN8A 4PG3A 2ALYB 5IP9G 3J81i 4A3IH 1HNZQ 4A3BH 3S1QH 4OO1I 1IXRA 2YYZA 2PNHA 4DV2L 1YITA 1YJWA 3HOWH 2QGQA 3CCLA 4A3GH 1GVPA 4JI3L 2N3SA 2E8GA 3G71A 2UXCQ 1JE5A 3A5ZB 3D0FA 4DV1Q 4IOAA 2UXBL 1OXSC 5LMNW 1X54A 1HZ9A 3RR5A 3CCRA 4GNXC 4KLKA 1KHIA 4Y7NH 4BY7G 2PQAB 5M3FG 3RN2A 4JV5Q 3DM3A 2ZJQA 4X66L 5C44G 3G6EA 1PV4A 3S1MH 1G6PA 2NN6G 4A3JH 3CXCA 4A3LG 4RMFA 4IO9A 1N36Q 2IHFA 3TQYA 1HZCA 4NXML 1XMQQ 1QZGA 4YY3Q 4DR5L 4TQUS 1YNXA 4ME3A 2JA6H 1VQ8A 4POFA 5FJ8G 1KIXA 4JI5Q 3TEHB 4AIMA 4BBRG 3CMEA 2UUBL 1EUJA 4IPGA 3GTMH 3HOXH 1IBKL 1Q46A 2OQKA 1HJPA 3L2PA 4A93H 3HOYH 2R93H 2B63H 4B3RQ 1NY4A 1Q8KA 2HHHQ 4C3JH 3KLWA 1SR3A 1JB7A 1VCIA 5JEAJ 3BJUA 1SLJA 3PIPA 3F2CA 1FJGL 2WAQE 4IFDG 1RL2A 2VW9A 3I4MG 1A8VA 4P72A 3PUVA 1L1OC 4C2MH 1BBUA 1S40A 1QUQA 3F1ZA 3NELA 4P74A 4QL5A 5M3MG 1PFSA 4DV5L 1TWHH 3E9IA 4JOIC 1A0IA 4B3SL 4A3CG 5C0XI 2VNUD 3KOJA 4YCUA 1Y1WG 3HKSA 2YU9H 2GVBA 4MTNA 1VS0A 1B8AA 1WCMH 5FLXc 4A93G 2ASBA 2NZOA 2RF4A 1X3GA 4H02A 3I56A 4GNXA 4A3DG 4XIGS 3GTJH 4C3HH 5C3EG 4A76A 4DV6L 1E24A 2CFMA 2EIFA 2HIVA 3PUWA 2YV5A 5M5YH 4YHHL 2UUAQ 2I0QA 1B7YB 1KL9A 1Q1BA 5IYCH 1MJEA 3PUZA 1PYSB 1FL0A 3W5OA 1E7ZA 2PI2A 4JI6L 1N34Q 1Q86C 1WJJA 3ER0A 5BR8Q 4IFDJ 4JI4L 3PIOA 4X62L 3PO3G 1J6QA 1QVCA 1VQIA 3HOVH 3I4NG 4KHPL 4NPSA 4X64L 2R6GA 4LFAQ 5IYDG 2VY3A 1TWAH 2Z6KA 1EIYB 4GLXA 5H1SE 5C0XG 3Q8DA 1N32Q 3H0GH 5GQOA 4JBJA 2KENA 5M3MH 5IE8A 1DGSA 2D0PA 1QZHA 4DV3L 1VQLA 2I5HA 2KCMA 1V9PA 4A3MH 3CCVA 1VQDA 1VQ4A 2E2HH 1KXLA 1GD7A 3PO2H 1VQFA 5GROA 1XNQL 1GKHA 4MNOA 4JBKA 4BXXH 4R4OA 4DNIA 5HGQA 4A3BG 1IBLL 1L2FA 1JJCB 5LMNL 1EFWA 3PO3H 3J7ZC 4DR7L 1VQGA 4IJLA 4GOPC 1SFOH 4A4IA 3H15A 2UXCL 3S15H 2VUMG 2VZAA 1KRTA 4JI8Q 4HJ7A 4NXNQ 1D8LA 1PH6A 3TREA 4IPCA 1L1OB 5FJ8H 1YJ9A 3CP0A 3STBC 3K8AA 2UXDQ 1I94Q 4A3KG 4DV0L 3FKIG 4JI6Q 3AEVA 1RIPA 2LSSA 3VDYA 3EN2A 2Q2UA 1HNXQ 4LF7Q 1Y1WH 1TWGH 3G4SA 1YHAA 3PV0A 2JQOA 1X6OA 2QA4A 4HJ5A 2WB1E 4DR6L 1JJ2A 1HH2P 1L1OA 1EWIA 1SROA 1U5KA 2F3IA 2XGTA 4JBMA 4LF8L 4BA2I 3EBEA 1C9OA 4O2DA 2BH8A 2MO1A 2R7ZG 1WI5A 1UWVA 1LTLA 2JJQA 4QGUA 1OXUA 4AH6A 2AHOB 3PGZA 1IZ6A 2R7FA 3S14H 5LMUQ 4DR1Q 3TRZA 2JA8H 2JA7G 1ASZA 3J81c 3HKZG 2NVYH 5AJ3Q 5BR8L 1TXYA 2N8NA 2CWAA 4X6AH 1Q82C 4POGA 4JI3Q 1K73C 3NBHB 4DV0Q 3CC7A 1AE2A 2E5LQ 5IYCG 2CCZA 4JYAQ 2LXKA 2ZTCA 3STBD 2XTIA 1UEBA 2RCNA 3H0GG 2GN5A 1YZ6A 1EOVA 5FLMH 1T9HA 4LWCA 3AQQA 4PZ6A 1SE8A 4LF5Q 4JV5L 2BH2A 4A3KH 4UP9A 1K9MC 4ALPA 2YTVA 4DV7L 4DR4Q 5FLMG 1U0LA 1VQNA 4GLVB 1TWFH 3MEFA 3CC4A 3CCMA 1XPRA 1PH4A 3S2HH 3M3YH 3M7NA 5C3EH 3OYYA 3S16H 2OCEA 1IBKQ 1I3QH 4R4CA 1VQBA 4GNXB 3K7AH 1IBML 4LFBQ 3ULPA 1BBWA 4JI1Q 2Z6KC 3T1YQ 5IYBH 1O7IA 1XNRL 3M9BA 2NZHA 1JMCA 4GKJQ 3A0JA 1Q1EA 4MZ9A 4PZ7A 2JA8G 3GDEA 2A8VA 4OWXB 3CQZH 3L0OA 2CWPA 2DUDA 5HY6A 1V1QA 3M4PA 4LFAL 1NBWA 5IYBG 4LUOA 3PO2G 4DUYQ 4IPDA 1K83H 3UE1A 1LM0A 4WJ4A 4R4IA 4UPAA 3PF4A 2IX1A 4HJ8A 2UU9Q 2UU9L 4R1JA 1HR0W 2NVQH 5C4XH 1J5EL 3LGJA 3L7ZC 4JI5L 4AQYQ 3HOWG 3RLFA 5IY0A 4X66Q 2D62A 1Z9FA 3E9HA 1XMOL 4QIWE 1I6HH 4UP7A 2AWNA 1N36L 4A3JG 2JEBI 5IWAQ 1HZBA 1C7YA 2UUCQ 4LF9L 3GTKH 1I50H 4GKKQ 2ID0A 3KF8B 1VQJA 3UDGA 1UE6A 1K3RA 3PCOB 4NB3A 4OXPA 2VS1A 4EQ5A 1X65A 4DV2Q 3CC2A 1Z47A 2ZTDA 1X3EA 3CF5A 2Q2TA 4LF6L 1CSPA 2A1AA 4AYBE 3JAMi 4DR3Q 2UXBQ 1W2BA 4A3LH 2LXJA 1XNRQ 1YHBA 4B3MQ 1WCMG 2PQAA 3OTOL 1NTGA 4LF7L 3U50C 2AMCB 4NXMQ 4UP8A 3TS2A 5C4XG 2PMZE 4DR2L 4GOPA 2F4VQ 1EQRA 2UXDL 1VQ6A 1OXTA 2VQFQ 4WJ3M 2WP8J 3M4QA 4BY1H 4IPHA 2ZJRA 2NN6I 3M85A 1HNXL 2KBNA 4Y52H 3BZCA 2ZM6L 1IYJB 3K7UC 3GTPH 1HNWQ 3I55A 4A3GG 4QJFA 4XTCS 2MNAA 2OWOA 1UE5A 4DUZQ 2K14A 3I4MH 4BXXG 2WB1G 3HOZH 4HIMA 1OXVA 1GM5A 4L5TA 4UY8C 2L15A 5C4JH 4LF4L 4HJAA 5LMNQ 2JEAI 1YHQA 2VL6A 4K0KQ 3ULJA 5IWAL 2MQHA 4A3MG 1NJIC 1Q12A 4JOIA 5J3BA 3HOYG 2R93G 2DGYA 1EQQA 2R92G 3RLOA 5JJKA 3ZJYC 4GN3B 3GTGH 3CW2C 2C35B 1N33L 3RN5A 1A62A 2GVAA 2VUMH 1CSQA 1M90C 4X65L 3JC66 4A75A 5GAGC 3J7A5 2K4KA 3KYHC 3FHWA 3FKIH 1UE1A 3KF6B 1WFQA 2A19A 3J80c 1VQPA 2N49A 5GAHC 3D31A 4A3EG 4HIOA 3FP9A 2YTYA 4BY7H 4L5RC 1PH3A 1XMOQ 2JA5G 4A3CH 1WOCA 1E3PA 1HZAA 2H5XA 4R4TA 1E1TA 3F8TA 3T1HQ 1NMFA 3GTLH 4FDBA 1PA6A 4JBWA 2WAQG 2Y0SE 2Q2HA 3BZKA 4BBSH 1IBLQ 1OXXK 1P16A 4GN5A 4A3EH 2HQLA 4LNQA 3J81j 2ZTEA 5LMUL 4DR1L 3U58A 4GN4B 1YI2A 1VQ5A 4JI0L 1KQSA 5ELOA 5M5XH 1P8LA 4DV1L 4L5QA 5C0XJ 4DV4Q 3RZDH 2B63G 4RG1A 4BBRH 1Y14B 3H3VH 4DV5Q 2HT1A 3HOXG 3ULLA 1PH9A 2KCTA 3TS0A 1VQ7A 2N78A 4LW1A 2BA0A 1G51A 2RHSB 4TVAB 4KI0A 3BU2A 4YWLA 1K8AC 2E2JH 4JI7L 4DR7Q 1HNWL 4LUZA 5M3FH 2IT1A 3PSIA 3HOZG 1V43A 3UDIA 4JI2L 3T1HL 1JJGA 1NE3A 4DKAC 2UUAL 2Q2IA 3K80C 1B70B 4IOCA 3AYHB 3GTOH 1Q81C 3HOUG 4A3DH 4APVA 5JEAG 3B6YA 1E22A 4K0KL 2K5VA 2IX0A 2JE6I 3CPWA 4LFCQ 4LFBL 1YBYA 2JA5H 4B3RL 5M5WH 4NXNL 4JI8L 4DAYB 4GOPB 5IP7G 4A3IG 2JA7H 1N32L 1FJGQ 1PVOA 1X9NA 5AJ3L 4O0AA 4JI0Q 1FGUA 3K81C 3CCEA 1AH9A 3CD6A 1VQOA 2R7ZH 1XJVA 3KDFA 3F2DA 1NMGA 1M1KC 1VQ9A 3S17H 1EYGA 4JC0A 4P71A 1HNZL 1VQHA 1CUKA 3RNUA 5IYDH 1LYLA 3I4OA 3G48A 1Y1VH 4JI2Q 4DV3Q 1YJNA 3S1RH 3KJPA 1K8GA 3I4NH 3AFPA 1I5FA 5GAEC 3HKZE 3HFZB 1Q7YC 2YTXA 5E7NA 3CCQA 3KJOA 1KD1C 1H95A 2D0OA 1PH1A 2ZM6Q 3NEMA 4YWMA 4A3FH 3CCSA 3CPFA 4LFCL 1CKNB 4X62Q 2B3GA 1L0WA 2JA6G 5IP7H 1N33Q 4J15A 2NVTH 5JJIA 1CKNA 3RZOH 4DUYL 5ELNA 2HIXA 2R7DA 4LUVA 1I94L 4GS3A 3W1GA 4X65Q 3RLNA 1XPUA 4OWTB 4HIDA 1PH8A 1SRUA 2VQEQ 4DV4L 2KHIA 4LF5L 4KHPQ 3CCUA 2K5NA 1YEZA 5IP9H 4DR3L 1XMQL 4YCVA 1N9WA 4AQYL 3GTQH 4P73A 1PH2A 4B3SQ 3GD7A 1MJCA 1FVIA 2AWOA 4C3IH 1SMXA 5DLQE 3MXNB 3KDFB 4JI7Q 1G291 2PI2E 1X56A 3E0EA 1KC8C 2VQFL 4YCWA 1VQMA 1HR0Q 1R9TH 2NVXH 1XPOA 1XNQQ 3H3VI 4DR4L 4L5SA 1PYBA 2UUBQ 1EIFA 1GO3E 4IFDI 4LF4Q 3I7FA 2B29A 2V1CC 1CKOA 3GO5A 3UE0A 5GADC 4YHHQ 2R92H 1PH7A 3HOVG 4P75A 2OTJA 1K0RA 4DUZL 2ZJPA 4LF6Q 3K0XA 4LF9Q 3S1NH 4GKKL 1IBMQ 1E1OA 1VQKA 2K50A 2MFIA 3NENA 3CAMA 4X64Q 3ICEA 2OQ0A 2E5LL 2HHHL 3OTOQ 1A63A 4GKJL 2CQOA 4EX5A 2I5MX 2K52A 3KF6A 3S24A 1OTCA 1LUZA 4JI4Q 1VQEA 4OX9L 1CKMA 1UE7A 1AE3A 4DK3C 3CMAA 3U4ZA 3S2DH 4DV7Q 4OWWB 1KRSA 3U4VA 3EIVA 2KHJA 3W1BA 1X3FA 3DLLA 2E2IH 4PMWA 1XTDA 2F52A 2WFWA 5C44H 4DV6Q 2FXQA 4YWKA 2UUCL 1J5EQ 2ATWA 3A5UA 2EQSA 4GLAC 2IY5B 4JCVE 2QEXA 4QY7A 1PHJA 1D7QA 4QQBX 4BA1I 4BBSG 3J80i 3A74A 4B3TL 3WWVA 2ES2A 4JI1L 3T1YL 2K75A 1N34L 1C0AA 2BA1A 4AYBG 5JJLA 1N8RC 1BKBA 3I2ZA 3HOUH 4DK6C 4OONA 4DAMA 3CCJA 2JK8A 1YVCA 3UDXA 1X55A 4JG2A 4HJ9A 3PUYA 1PH5A 4OO1G 3F2BA 1TWCH 3M4OH 3JAMc 1MKHA 5EAYA 2EXDA 1QVFA 2JA9A 3KFUA 2MO0A 2Y0SG 1WYDA 1BVSA 2VQEL 4PZ8A 4DR2Q 2F4VL 1JT8A 1YIJA 3AFQA 1ASYA 3ERSX 3UDFA 1Y1VG 2Z0SA 1IL2A 4JYAL 4B3ML 3OW2A 1VQCA 4DR6Q 2I5LX 1QVGA 4OX9Q 1W3SA 3IRBA 5IT9c 4KHZA 2K5HA 2CKZB 3PUXA 1S3OA 4A3FG 1MIUA
chains in the Genus database with same CATH superfamily
1SYBA 1HR0L 3PF5A 2OTLA 1BXTA 2A6HC 5I6YA 3IL8A 2LKVA 2MHVA 3NXWA 5IIFA 1D6EC 1WCMB 3K58A 4A3BH 2B2VC 4KY5A 1IXRA 1YITA 2QGQA 1EOTA 2UXCQ 3NHHA 3G71A 4DV1Q 1E2ZA 2F0JA 3CCRA 4GNXC 1KHIA 4Y7NH 1K3BC 2BDOA 2PQAB 4JV5Q 1ET9A 3DM3A 1M8AA 1Y8PB 1TWCB 5K36H 3CXCA 1PZJD 1TY2A 1BDOA 3IFDA 3HOYB 2R93B 3AU7A 4MTKA 1QZGA 1JWUD 4DR5L 3TEHB 3CMEA 4C1NK 1Q46A 1SYDA 2OQKA 3L2PA 3U9SA 1EIHA 2B2YC 1STEA 1SR3A 1JB7A 1VCIA 3BJUA 1SLJA 5A35A 5C5LA 3PUVA 3F1ZA 1Q3LA 5J1ZA 5M3MG 2FINB 1PFSA 2OF1A 2WAQB 4A3CG 2VNUD 3T16A 4YIJA 2ICIA 1F2YA 1BF4A 1VS0A 4FP5D 3GTLB 1PFNA 3I56A 1HA5A 4A3DG 2HDMA 4XIGS 3GTJH 1I4QA 4DV6L 1E24A 2CFMA 2EIFA 4YHHL 4DK0A 2A5HA 3IAYA 1Y1VB 1SMYD 2I0QA 5IOCA 1KL9A 5IYCH 1MJEA 3PUZA 4C3HG 4JI6L 4ME5A 1N34Q 1I4PA 2K5WA 3ER0A 1HTLD 3PIOA 1EY7A 3PO3G 3I4NG 1S5CD 1X3QA 5H1SE 1RTNA 3H0GH 3DWAA 5DNFA 5M3MH 3GTGB 2M00A 1DGSA 1QZHA 4NDXA 1EEID 1LTRD 1NNXA 5GROA 4JBKA 5D3IB 5HGQA 3OMGA 1IBLL 1BQQT 4RKLA 3J7ZC 3I70A 3SK5A 3TP7A 1VQGA 1SFOH 4Y7NB 4JI8Q 4NXNQ 2O5IC 1JQYD 1PH6A 3BG3A 3HG9A 4IPCA 4HMJA 1A2TA 1MD2D 3CP0A 5C5MA 2UXDQ 3ONAB 1V1PA 3A55A 3VDYA 1HXYD 3G4SA 5CBEE 1Y69U 2JQOA 4PMCA 4V190 4DR6L 1HHVA 4FYDA 2F0UA 2F3IA 2AUJD 4DFAA 4BA2I 1C9OA 2BH8A 2IPKD 1UWVA 1LTLA 2KOLA 4QGUA 4AH6A 2DJGC 4DR1Q 4QF4A 1ZXTA 5E3FA 4X6AH 4NW2A 1MBYA 4QUCA 4DV0Q 4JYAQ 1KNAA 4MHEA 5JVH3 4A3DB 1GUOA 5FLMH 1WTRA 1T9HA 3BVZA 4JV5L 2BH2A 3VR3A 3D6CA 5FO7B 1PFBA 2EYOA 4H44C 4RAUC 1KLUD 4M1UB 4OO1H 2L12A 3QO2A 2OCEA 1IBKQ 2PCFB 4C3JB 1PTOD 1DOMA 3ULPA 2J0TD 5A2QL 3SEBA 5ELBA 3H0GB 2NZHA 1DONA 3T53B 1PTOH 5HY6A 5IYBG 4FXDA 2B2UA 3KBGA 3UE1A 2F0FA 1U4PA 4R4IA 4QIWB 4WJ4A 2XRQD 1JICA 4OL7A 3TDQA 5ISRA 3Q22A 1I3QB 1I4RA 3LGJA 4Q0FA 4AQYQ 1Z9FA 1G91A 5C4XB 2PZTA 1N36L 3KF8A 5IWAQ 3OOCA 3GP7A 4PNYA 2ID0A 1EY4A 1VQJA 1UE6A 1K3RA 4NB3A 4CGYB 4EQ5A 4DV2Q 3KLSA 1G8ZD 4DNRB 4DXGA 3BVMA 3A8IE 4AYBE 4DR3Q 3NPPA 1W2BA 4F87A 2E75C 3HOWB 1WCMG 1H9SB 1NTGA 4A3MB 2AMCB 1BUVT 2A69C 3TS2A 1EQRA 2K6AA 3TZDA 2UXDL 2JA7B 2WP8J 3M4QA 5C6AA 2AQ3B 4IPHA 4KD3A 2DY7A 2ZJRA 1EZ6A 2F0KA 4Y52H 1IYJB 3GTPH 2ZXRA 4XTCS 5FO9B 2OWOA 2K14A 2WB1G 3HOZH 1C4QA 1XYIA 3ULJA 2DGYA 2LY7A 1EQQA 5JJKA 2F0SA 3GV6A 3ZJYC 3IFTA 1EWCA 3NWSA 1A62A 2N55A 3Q6SA 1KTKA 3E0JA 3JC66 5GAGC 3J7A5 4J6HA 4RA8A 4HTHA 3RZDB 5G3LF 3J80c 1VQPA 1A6XA 1B2TA 2V4DA 4BY7H 1SXTA 1WOCA 1E3PA 1HZAA 4KY7A 1NMFA 1S5ED 3GTLH 5JOBA 4JBWA 2EYLA 3BZKA 4LJZC 3J81j 3C46A 4DR1L 1YI2A 5KGUA 4DV1L 4L5QA 5M5YB 4KY6A 2JXMB 3ZYYX 4WRDA 2HQEA 1JWMD 3HOXG 4XQJA 3ULLA 3CRKC 2JA5B 2SNSA 2N78A 2BA0A 2RQXA 5IGGA 1CM9A 4N8FA 3A7LA 3HOZG 2NTSA 4HMIA 1XTCD 2Q2IA 3K80C 2A68C 2JP1A 4IOCA 1NCVA 1R9TB 1Q81C 2F3WA 3HOUG 1WVLA 5JEAG 3EFXD 4CJ1B 1BNZA 2JA7H 1FJGQ 4LAAA 1AH9A 3CD6A 2G9DA 4TSSA 3KDFA 3F2DA 1NR2A 1EYGA 1W6KA 4OIJA 3GTKB 1RKNA 2VB2X 1HNZL 1PLFA 3HOUB 1YJNA 4DV3Q 2ICEC 3S1RH 1GUSA 1JE4A 1ESFA 2OEOA 2R3ZA 5EKLA 4HSPA 3HKZE 3HFZB 4A3FH 3CCSA 3CPFA 4HAEA 3DEPA 1L0WA 3BZDB 4J15A 3SDZA 1I94L 4CDCC 1AN8A 2R7DA 1IW7C 3W1GA 3RLNA 4OWTB 1SE3A 2VQEQ 2QILA 3QR8A 2JSOA 2KHIA 4LF5L 1GHKA 3M7GA 3CCUA 2F0DA 1R4PB 1YEZA 1ZKOA 2QCPX 4DR3L 1XMQL 1FNUA 1MJCA 3H09A 2BCOA 4C3IH 1LABA 4FNFA 3KDFB 5FLXE 4JI7Q 1KC8C 5IGFA 4R8IA 3H94A 4DAPA 2K01A 4LF4Q 3I7FA 2B29A 2V1CC 1CKOA 3VR6A 3UE0A 5GADC 4YHHQ 1K8MA 3HOVG 4P75A 3D8GA 1K0RA 2OTJA 2ZJPA 4LF9Q 4GKKL 3WOEA 2K50A 3CAMA 3SR1A 2HHHL 1F9SA 2EPBA 3MA2B 3HGBA 4DK3C 3BYYB 1PTOF 2L11A 1WTXA 4ZUIA 3EIVA 4ZKCB 5I4DA 1X3FA 3DLLA 4QMGA 2FXQA 3J80E 2UUCL 1J5EQ 2ATWA 3N52A 5IT9E 2BE5D 1PHJA 3EROA 3QOJA 3R8BA 3A74A 1QNKA 4N9TA 3I4NB 3K5MA 4KD4A 4K5WA 4DK6C 3FVQA 1YNJD 3PUYA 3M4OH 3EVQA 2EXDA 1XXGA 2MO0A 2Y0SG 3K0YA 2VQEL 2F4VL 4PZ8A 1MSGA 1BCPD 1CFMA 4JVZA 1ASYA 4LMQD 4JYAL 2FMMA 3HEJA 2I46A 4B3ML 1VQCA 1WTVA 4C3HB 1QVGA 1CI3M 1SNQA 3D4RA 4BY1G 4ODGA 1ML0D 2K5DA 4YY3L 4HIKA 4B3TQ 3NBIA 4IJHA 2L5TA 5IP9G 2ALYB 1HNZQ 4OO1I 4RGMA 3S1QH 1X3PA 1LTBD 3HOWH 3E3XA 2PNHA 4DV2L 1YJWA 5JVG3 3CCLA 2MP1A 1GVPA 2IJ0A 1TQOA 1I50B 1A3VA 4IOAA 5E4WC 1HUMA 1TWAB 5CV7A 5LMNW 1X54A 3RR5A 4UAIA 4KKSA 5M3FG 1DXMA 2FFKB 2ZJQA 3OWEB 3J7YW 1PV4A 1EY6A 2NN6G 4QCLA 1PTOB 4A3LG 3MHBA 5A2QE 3TQYA 2EJMA 3BVGA 1XMQQ 2X6GA 4TQUS 4POFA 5FJ8G 4C1NI 2VB3X 2RDHA 5IGDA 3FPPA 4OELB 1IBKL 1CQFA 2EY1A 4B3RQ 4I7ZC 1NY4A 3KLWA 1AEXA 3PIPA 3F2CA 1VF5C 2KVMA 2VW9A 1CTMA 4P72A 1QUQA 4G7HC 4P74A 4J8QA 1CT1D 3PIO3 3E9IA 4JOIC 4KTAA 5C0XI 4ZAIA 3I90A 3HKSA 5EJWA 2YU9H 2GVBA 4MTNA 5FLXc 2ASBA 4GNXA 4NKLA 4Z9CB 1F77A 3OIPA 3PUWA 2YV5A 1S4ZA 1B7YB 2XWBB 1FL0A 3W5OA 1Q86C 5BR8Q 4JI4L 1O78A 4X62L 1RODA 2VY3A 1TWAH 4ZCKA 4GLXA 1DD2A 3C1EA 3LWEA 5GQOA 2BE5C 2KENA 5IE8A 4N8X1 4OHJA 5BN5A 2KCMA 1KXLA 1VQ4A 3MXNA 2ENBA 3AMUA 1I4HA 3TBIB 4DNIA 1L2FA 2EZVA 4ZRZA 1JJCB 5LMNL 3PO3H 1QJOA 4OIKA 4DR7L 4GOPC 2K5QA 3A7AB 4A4IA 3S15H 1KRTA 3T51B 3O13A 3H6MA 2ZXOA 1L0YB 2HDLA 2A74C 3TREA 1L1OB 1FGBD 5JPMC 5I2XA 1JB3A 3MFYA 5NUCA 3Q0AA 4K6DA 4B08A 3AEVA 1E2WA 1RIPA 2HUGA 3EN2A 2PW5A 2HCIA 3IKJA 4LF7Q 2BOSA 2WB1E 4O1NA 1HH2P 2XRSD 1EWIA 1II3A 4LF8L 2XGTA 4CJ0B 4O2DA 1D5MC 2MO1A 2R7ZG 1U4LA 2F0PA 2JJQA 3G7LA 5EQ0A 4CDFC 5J39A 3PGZA 3T4AC 5JPNC 2F0IA 3HKZG 2NZ1D 3MXUA 1TXYA 1PMRA 4RHSA 1Q82C 1J9OA 4XT1B 1K73C 3NBHB 1AE2A 2E5LQ 2GN5A 3H0GG 1EOVA 2B2TC 4LWCA 3AQQA 4UP9A 4ALPA 4DV7L 2PZWA 1B9NA 5FLMG 4GLVB 1TWFH 3MEFA 4BS9A 5L37A 3CCMA 2N88A 1PH4A 4IURA 4DAVA 4MIUA 3RD4A 2NVYB 1K28A 3M7NA 3OYYA 3S16H 5CV6A 1I3QH 1LT5D 3FDTA 3QJYA 4GNXB 4TRDA 4LFBQ 2DJFC 2EYMA 1BBWA 3G6JB 1WTWA 1O7IA 2Z8LA 5FLXL 2QEJC 5CV5A 1Y8OB 1JMCA 1Q1EA 4MZ9A 4PZ7A 5J22A 2DNCA 3GDEA 4OWXB 1EFID 3L0OA 2CWPA 1KNEA 4XQNA 4LFAL 1V1QA 3I4LA 3M4PA 3PO2G 4LUOA 1QCBD 4IPDA 4DUYQ 3QB3A 5EBDA 1LM0A 3R2TA 4ZQ3A 1H9JA 3OMCA 1PRTC 1ET6A 3L3OC 2IL8A 5C4XH 1J5EL 1F2MA 3HOWG 2AUKA 2B63B 1I6HH 4QIWE 4UP7A 2AWNA 5CBAE 1C7YA 3GTKH 1I50H 3T13A 1J8IA 4OXPA 2VS1A 1X65A 1YNND 3S2DB 1PYWD 1TS3A 3CF5A 2UXBQ 4B3MQ 4LF7L 2PQAA 3OTOL 4DXFA 4UP8A 2D2CC 1OXTA 5ELDA 4ZK9B 1SYFA 1M4VA 1PRTF 1V1OA 2L4NA 3BZCA 2ZM6L 3VYSA 3FMCA 1UE5A 5C44B 1CK1A 4UY8C 4LF4L 5LMNQ 1YHQA 4K0KQ 2MQHA 1DCZA 1SBBB 1Q12A 4JOIA 5J3BA 1WD0A 1DOLA 2R92G 2EYHA 2QF7A 3MFGA 1KDCA 1YNNC 2VUMH 1M90C 1WTOA 2CHBD 2K4KA 3HKZB 3LWUA 1UE1A 2PYKA 1D5XC 3FEWX 3KF6B 1KDBA 1K8OA 2A19A 1SYEA 1ZEQX 1YNJC 2EY6A 2ZT9C 2YTYA 1CHPD 3I91A 4L5RC 2JA8B 5KNBA 2WINB 2Q8TA 3PO2B 1GUNA 3F8TA 3T1HQ 3I8ZA 2WAQG 2Q2HA 4BBSH 1IBLQ 1SSOA 2QW7A 1SDFA 2ZTEA 4IQZA 4GN4B 1VQ5A 4B9XA 1HFNA 1Y1WB 1KQSA 4B9WA 4G7ZC 2AQ2B 4DV4Q 1SJED 5C4ZA 1PDQA 4PV1C 4RG1A 1NAPA 1HRJA 3TN2A 3C2PA 1STYA 2HT1A 2K7VA 1PH9A 4LW1A 2SOBA 2CQAA 2NUCA 2Q8RE 1U4RA 3GTJB 1FYCA 1TWHB 2NWGA 1K8AC 2E2JH 1HNWL 1AP0A 2IT1A 3PSIA 1JJGA 1V1PB 4DKAC 4K2LA 1H9MA 4X3TA 3HRZC 1UAPA 1EYCA 4A3DH 4APVA 4K0KL 3B6YA 3CPWA 4LFBL 2JA5H 4B3RL 2ZXPA 4NXNL 4JI8L 4A3IG 4GOPB 2EJGC 1SJHD 1AW7A 2EYPA 3MXGA 2JA6B 2Z1CA 3CRLC 5D3DA 4RGOS 1XJVA 2K1BA 1M1KC 3S17H 4J1MA 4JC0A 4P71A 5C0XH 5IYDH 3VYRA 1LYLA 3G48A 1ONLA 1BCPB 3KJPA 3FKIB 5GAEC 4F88A 1Q7YC 5E7NA 3KJOA 3S1RB 2ZM6Q 3NEMA 4YWMA 3I73A 1SNMA 4CHTB 2JA6G 3KK7A 1N33Q 4XYQA 3QIAA 2HIXA 4LUVA 5EPLA 4F8MA 1EU3A 4K2KA 1XPUA 1PTOC 1PH8A 1SRUA 1T5EA 4DV4L 1HTPA 3DM1A 2F1MA 3MAQA 1XWEA 3S1NB 1SEBD 5IP9H 4AQYL 1ESRA 4BBRB 1STNA 3NQTA 2D9UA 4FO2A 5CGKA 2FMCA 5DLQE 3MXNB 3NP8A 2K32A 5KNCA 2PI2E 3E0EA 5JAVA 2X6LA 1HR0Q 1PYBA 4G57A 4RKBA 1EIFA 1GO3E 4I7AA 4F7XA 4IFDI 1V8QA 2R92H 1PH7A 2P5ZX 3K0XA 2E5LL 2CQOA 2I5MX 2K52A 3KF6A 3S24A 4JI4Q 1B44D 1AE3A 3EQLC 3J80L 3JAME 3S2DH 2KHJA 3W1BA 1VMPA 4C2MB 2IX3A 3MTSA 1O7YA 1O80A 1T5XD 2QKIC 1JWSD 1GUWA 4BBSG 3MZ5A 1H9RA 3WWVA 1BO0A 3URYA 3JAML 5JJLA 4K14A 1BKBA 3I2ZA 3HOUH 3GTMB 4CBVA 1YVCA 1F9PA 1X55A 4JG2A 1CA6A 4A93B 1TWCH 5T1GA 3JAMc 5HGTA 1MKHA 1QVFA 1BVSA 1TWGB 3AFQA 1IL2A 1Y1VG 5C4HA 5TSSA 3ITPA 1MI2A 1JOQA 3BDOA 4OX9Q 1W3SA 3IRBA 5IT9c 2K5HA 1TS5A 4KHVA 4A3FG 4ZKBB 1EY5A 4LF8Q 1TKWB 5JJZA 1VQAA 4QUFA 3K57A 1QUQB 2AKWB 5EPKA 3W2DA 5K36G 1EYDA 2RHQB 4DPGA 4A3IH 4WJ3M 1SN8A 1EY0A 2B2WC 3W3AA 2B2TA 3A56A 4JI3L 4O42A 1JE5A 2UXBL 3J7AF 4HCSA 1OXSC 4CJ2C 5M9OA 4OGQC 3MC0B 4BY7G 3X3MA 4FF4A 4X66L 5C44G 3G6EA 2RKSA 4XDXA 2A73B 3KUPA 4RMFA 5ELFA 3KBXA 4IO9A 4NXML 1TR5A 2PQEA 5ELCA 2R92B 4YY3Q 4ME3A 3OHXC 4CDDC 2JA6H 1KIXA 4JI5Q 2UUBL 4AIMA 4BBRG 1SFOB 4IPGA 3GTMH 1B9MA 5DM73 1A2UA 4A93H 2A6EC 3HOYH 3M3YB 2R93H 2B63H 4BY7B 1C8CA 1GJXA 5JEAJ 1FJGL 2EYFA 3S1MB 1RL2A 3I4MG 3C3LA 4IALA 1L1OC 4C2MH 1BBUA 5LL6X 1S40A 2EXZA 4HSVA 5FKAC 3NELA 4QL5A 1VMCA 2K04A 4C3IG 1TWHH 4B3SL 2EDGA 1Y8NB 4DF7A 3KOJA 2SNMA 5CR3A 1WCMH 2JN4A 2NZOA 4H02A 1LTTD 1X3GA 1IYUA 4C3HH 5C3EG 2Z9HA 2EYJA 2UUAQ 1ZYRD 4KK7A 3N6RA 1Z6HA 3OW7A 1PYSB 1E7ZA 5M3MB 4IFDJ 1EWHA 1J6QA 1VQIA 4HCEA 5C4JB 4NPSA 1EIYB 3D3RA 1N32Q 4KKUA 2OXPA 3GQBA 2XNAC 4JPBW 4JBJA 4X3KA 2XN9C 4K5XA 1IW7D 3SK4A 2AQ1B 4DV3L 1VQLA 2I5HA 3NTIA 3CCVA 4QB4A 3K6OA 1VQFA 1GHJA 1XNQL 2NTTA 3DXJC 4BXXH 4ZYSA 4EQPA 2RSNA 5M3FB 3TMEA 4IJLA 3H15A 5KIXA 2UXCL 3NTKA 1Q90A 4DK1A 3ND9A 1D8LA 1KLGD 4WFN3 1YJ9A 1NUCA 4G4KA 4IUTA 3AB9A 3K8AA 2E76C 1I94Q 1JCKB 3M4OB 2LSSA 2PNRC 2Q2UA 1Y1WH 2PO4A 1UNSA 2OT2A 1VDZA 1X6OA 2WB1B 4HJ5A 1JJ2A 1L1OA 1U5KA 3S15B 1SNPA 1GUTA 4K8JA 2AHOB 1IZ6A 2R7FA 2CVRA 2JA8H 2WV6D 4DA2A 1GXDC 1RTOA 2XVSA 2LS01 1KABA 3J81c 1TVXA 2NVYH 4RGTA 5AJ3Q 1EL0A 3GTQB 2N8NA 2CWAA 4A3GB 4JI3Q 3E6ZX 5IYCG 3H3VC 4RCOA 1R4QB 2ZTCA 1UEBA 3SXHA 4ZLTF 3M4YA 3QG1A 4PZ6A 5IODA 1SE8A 1S5FD 1IHZA 1K9MC 4DR4Q 3VYUA 1U0LA 4RWSC 1VQNA 4IUUA 4RGNA 1SMYC 5IGEA 1XPRA 5EKIA 2LMCB 4R4CA 2NVQB 3J81E 2G5DA 3K7AH 1IBML 5IYBH 1IKLA 3H91A 3M9BA 1A3TA 3CQZH 1A15A 1TY0A 1NBWA 1PRTB 1ILQA 1K83H 3MVVA 4IUVA 1TWFB 3MXPA 5CV8A 3PF4A 1CZGA 1FD7D 2RSOA 4HJ8A 4UHVA 2UU9L 4R1JA 4C3JG 4DNTB 3RLFA 1NR4A 5IY0A 3E9HA 2Q8IB 2Z6BA 3NSWA 2JEBI 2RBMA 2KECA 5C3WA 3UDGA 2L0CA 1PFMA 3R3OA 4A3BB 2X69A 2F0GA 1STHA 1QNUA 2ZTDA 4LF6L 1CSPA 1B50A 5E1FA 4A3LH 5FK9C 2LXJA 1XNRQ 3RUZA 3U50C 2KA7A 5C3XA 3RMHA 2PMZE 3CQZB 4DR2L 1G6ZA 2B2WA 3FPUB 5LL6S 1F2LA 3M85A 4R8NA 2KBNA 4OEMB 1ENAA 4G7OC 4MN3A 3K7UC 3E5SA 4A3GG 2MNAA 3I4MH 4BXXG 4DUZQ 3VA5A 2EY2A 3WDNA 4HIMA 1OXVA 4K6LA 4L5TA 2SEBD 1S5DD 2JEAI 2A6ED 2M9VA 3HOYG 2R93G 3P75A 3RLOA 3A8KE 3R93A 3CW2C 2C35B 1C48A 3RN5A 2GVAA 2DNEA 1CSQA 1HQMC 5DM63 2QDLA 4L8JA 3FKIH 2J7ZA 3ND8A 4GZYC 2WKCA 2N49A 2WKDA 3D31A 5GAHC 4A3EG 4HIOA 3FP9A 1PZKD 1KAAA 1RF2D 4LK1C 1PH3A 3TZUA 2JA5G 5KEEA 2H5XA 4R4TA 2HCCA 1LACA 5ELEA 4C3IB 4FVMA 4FDBA 1PA6A 2Y0SE 1ILPA 1ZYRC 4GN5A 4A3EH 2NVXB 3U58A 1D2BA 5K5PA 5M5XH 2EVBA 1D5ZC 4FF1A 1LTID 2F4IA 1Y14B 1CA5A 2F0VA 2KCTA 3TS0A 5D65A 2KEDA 2HD3A 2MGSA 2M2LA 4CDEC 2RHSB 4TVAB 5CC4A 1ENFA 4JI7L 2MJ8A 4DR7Q 5M3FH 5EGTA 1B4OA 4JI2L 3T1HL 2RDFA 1NE3A 2K28A 2UUAL 5AFWA 1B70B 3AYHB 1LTAD 1RDPD 5G3LD 4NMZA 1I4GA 3NK9A 4FXKC 1Z7TA 2IX0A 2JE6I 3A54A 4RH6A 4LFCQ 2F0WA 2K03A 5M5WH 1DYQA 2L9HA 4RFBA 2A69D 4DAYB 5IP7G 1QB5D 1N32L 1PVOA 1X9NA 5KRUA 3OWFA 4JI0Q 1FGUA 2KJXA 4XYOA 2CW0D 3CCEA 3A8JE 1VQOA 2R7ZH 1FR3A 1BCPC 5CYUA 2O2LD 1HFGA 1VQHA 1CUKA 3Q23A 3S17B 3HZXA 3I4NH 3AFPA 3J7AV 1KD1C 2YTXA 1H95A 4H13C 2D0OA 1PH1A 4IUPA 2B3GA 1S5BD 5JJIA 2VXWA 1CKNA 4DUYL 5ELNA 4GS3A 2PZUA 3S1QB 4HIDA 1SYCA 4KJNA 4PQXA 2K5NA 4YCVA 1PH2A 4KMUC 4B3SQ 1FVIA 3WOFA 3CKIB 1G291 1X56A 1VQMA 4YCWA 2NVXH 3S14B 1R9TH 1XPOA 3SK8A 1XNQQ 3OIQA 2B2YA 1WTPA 4X3UA 3SE0A 5I9OA 4DAYA 1EQVA 2F0OA 1JORA 4DUZL 3S1NH 3K7AB 1E1OA 3NENA 4X64Q 3OTOQ 4GKJL 1U9RA 2KCNA 2NBFA 4R9WA 1VQEA 4DN4M 1CKMA 4OX9L 1UE7A 4IUQA 1GUGA 1I6VC 3CMAA 1HA6A 1KRSA 3U4VA 2E2IH 1JOKA 1XTDA 4DU9A 5C44H 1HUNA 4YWKA 1X32A 2A68D 5CV9A 3HOXB 3A5UA 2EQSA 4GLAC 4QY7A 1D7QA 1F9QA 4BA1I 3J80i 2BA1A 4AYBG 2EOTA 3X3NA 3R2IA 2F03A 3UDXA 4HJ9A 3I3CA 2F0NA 5EAYA 3KFUA 2JA9A 2NYZD 1JT8A 4DGZA 1YIJA 3ERSX 1MHWC 3UDFA 2E2DC 5KYLA 5I9PA 3OW2A 2KHSA 3I72A 1STGA 4HR7B 1EY8A 1MIUA 3K59A 3SGIA 4WJWA 3Q24A 1A3UA 2IHEA 1S72A 4DR5Q 1WTHA 2Z4IA 1H9KA 1KAWA 4R4QA 4PG3A 3J81i 2YYZA 4M8AA 4A3GH 1OO9B 2GA4B 2N3SA 2E8GA 3A5ZB 3D0FA 5DEHA 1D1KA 2F0TA 1HZ9A 1HPCA 4H0LC 4KLKA 2XIWA 4IN3A 1WTQA 1H9SA 3RN2A 3TP5A 2KQ3A 1CHQD 4FF2A 3S1MH 1D1IA 3K5LA 2XSCA 1G6PA 1PZID 4A3JH 1JR0D 1N36Q 2IHFA 1HZCA 2D5DA 1EU4A 1YNXA 2PPBC 1VQ8A 2EE1A 1EUJA 4XXEA 1VF7A 3HOXH 5T1IA 1HCZA 2IWHA 2F0LA 2L1BA 1HJPA 2KUMA 1TT2A 4H7BA 1Q8KA 1I4XA 1SAPA 2WIIB 4U68A 4C3JH 1FNWA 2HHHQ 4IFDG 2FJ2A 1B3AA 2WAQE 4BWGB 4A3EB 4RHRA 2QDBA 1A8VA 4EQOA 2JYOA 2WACA 1B53A 3K5OA 1B1ZA 4I65A 5D14A 3CU7A 4DV5L 1A0IA 4KN4C 4YCUA 1DJRD 5FO8B 1Y1WG 4KV6A 4ULLA 3OPOA 1B8AA 4A93G 1F9RA 2RF4A 2R61A 4A76A 2B8GA 2HIVA 5M5YH 1SE2A 1EYAA 4HN7A 1Q1BA 1QE6A 1Q8IA 1STAA 2MPMA 2PI2A 3T56B 4L6TB 1WJJA 2CH4A 2MUYA 1RHPA 4A3FB 3C1FA 5I2YA 2KEEA 1QVCA 3HOVH 3VYTA 2PMZB 2EY5A 4KHPL 4X64L 2R6GA 4LFAQ 5IYDG 2Z6KA 4CKCA 5C0XG 3Q8DA 5LHY1 2D0PA 1QWYA 1SYGA 4A3MH 1V9PA 1VQDA 2E2HH 1GD7A 3PO2H 1O7LA 1EZ8A 3BDCA 3S16B 1GKHA 4MNOA 1PRTD 1TS2A 4R4OA 4S3SA 4A3BG 2IW3A 1EFWA 1DOKA 3S9WA 3BS1A 3NUCA 1B3QA 2VZAA 4HJ7A 2VUMG 4FXGC 3DWPA 1EIGA 3FRPB 5FJ8H 3STBC 2F0MA 4A3JB 5I6WA 1ICFB 1U4MA 4A3KG 4DV0L 3FKIG 4JI6Q 3CHBD 4CKEA 1HNXQ 1TWGH 1YHAA 3PV0A 2QA4A 1K0SA 1LLRD 1SROA 4JBMA 2BDNA 3EBEA 3LX0A 2K33A 3UI2A 1WI5A 1UUPA 1OXUA 4WORA 3TRZA 3S14H 5LMUQ 1I6HB 2JA7G 1ASZA 5KNDA 2L55A 4UDUC 3EJIA 5BR8L 3QOLA 4POGA 1FNVA 3CC7A 2CCZA 3K5NA 2LXKA 5IGBA 1O7ZA 3STBD 2E2JB 1F2ZA 2XTIA 2RCNA 1YZ6A 3HOVB 5CMDA 4K5VA 1JOOA 3I4MB 4LF5Q 3TP6A 4A3KH 3VA7A 2YTVA 1K83B 2SDFA 3DUZA 5HURA 3CC4A 3S2HH 3M3YH 3OSOA 4XQQA 5C3EH 1CZWA 1VQBA 3VR4A 4ABNA 1LO5D 2G9HD 3VR5A 4JI1Q 2Z6KC 3T1YQ 1AFPA 4CKBA 1KDAA 1XNRL 4GKJQ 2NN6H 4JK1C 3A0JA 2JA8G 1STBA 2A8VA 2E2IB 2DUDA 3HS0C 3D6WA 3DHQA 4UPAA 2IX1A 2F0EA 2C5CA 2UU9Q 1PXUA 1TIID 3TSSA 1HR0W 3PO3B 2NVQH 4JI5L 3L7ZC 4KN7C 5IGCA 4X66Q 2D62A 1XMOL 3BDLA 4A3JG 3P20A 5CV4A 2E74C 1HZBA 4LF9L 2UUCQ 4GKKQ 3KF8B 3PQIA 2NB0A 3PCOB 2H1EA 3BYTB 1BR9A 3TP8A 4Q5VA 3CC2A 3KLRA 1Z47A 3HOZB 1X3EA 2Q2TA 2A1AA 3JAMi 4BY1B 1DM0B 1YHBA 5EKKA 1QILA 4NXMQ 5IT9L 5C4XG 2F4VQ 4GOPA 4ILWA 1VQ6A 2VQFQ 3S2HB 4BY1H 3LNNA 2NN6I 2H4OA 1HNXL 1HNWQ 4RCNA 4IFDH 2C9OA 1SNOA 3I55A 1MSHA 1TS4A 4QJFA 5M5WB 1W6JA 2K05A 1GM5A 4L63B 1CQVA 2L15A 5C4JH 3NBHA 4HJAA 1SE4A 2VL6A 4KKTA 5IWAL 4A3MG 1NJIC 4ID6A 5EBCA 4GN3B 3GTGH 1N33L 4K8IA 1BCPF 1MGSA 4X65L 4A75A 1NSNS 3KYHC 3FHWA 3PIP3 1WFQA 2B2UC 1XMOQ 4A3CH 5JEAH 1AZPA 1E1TA 2J4XA 2O5JC 3J81L 1ENCA 4N9PA 3NWTA 1OXXK 1P16A 2EJFC 3V2TA 2HQLA 4LNQA 5LMUL 3SK6A 4JI0L 1DZ1A 3ERQA 5ELOA 1P8LA 1RCVD 3DMUA 1QG7A 5C0XJ 3V96A 3RZDH 2B63G 4BBRH 2RDGA 3RZOB 3H3VH 4DV5Q 1TU2B 1WD1A 1VQ7A 4P2CB 5BN3A 1XX8A 3VR2A 4A3IB 4X3SA 1G51A 1E2VA 5E4XA 3GTOB 1G2TA 4KI0A 4AYBB 3BU2A 4YWLA 2KCCA 4LUZA 2E2HB 1V43A 3UDIA 3NE5B 1GOZA 3P1HA 3GTOH 1BOSA 3V05A 4E6IA 1E22A 2K5VA 3GTPB 1YBYA 3MWYW 5FOBB 4IZ8A 1LTSD 3F2UA 4BBSB 4EGVA 1E0BA 4O0AA 3NTHA 5AJ3L 4EQNA 3K81C 4V0BA 2B2VA 2VUMB 3P7JA 2TMPA 5EPJA 2FHTA 1NMGA 1VQ9A 1LV9A 1G2SA 5F2DA 5CORA 1IL8A 3RNUA 4HEDA 2Y0SB 1SNDA 3I4OA 4JI2Q 1Y1VH 3SHLA 4A3KB 1K8GA 1I5FA 1RJTA 2F0HA 2CW0C 3KLSX 3CCQA 2RVLA 3D4DA 2XWJB 1EQTA 2DY8A 3DWQA 3MEHA 2YU9B 3L9AX 4KJOA 5COYA 4LFCL 1CKNB 4X62Q 3NQIA 2NVTH 5IP7H 3RZOH 4X65Q 2R7ZB 1QOHA 3EA6A 4C56C 4KHPQ 1HQRD 4U673 2NVTB 2CH4W 1N9WA 3GTQH 4P73A 1AZQA 1IKMA 1IYVA 3GD7A 5BN4A 2AWOA 4EVOA 1L0XB 1SMXA 5DAUA 3PMFA 2VQFL 1BBXC 3H3VI 4DR4L 4L5SA 5KYIA 1RD9D 1EEFD 4JW0A 1LT6D 4XT3B 2UUBQ 3D4WA 3HP3A 3GO5A 4NP5A 1ICWA 3U9OA 3SVMA 4LF6Q 2DN8A 1IBMQ 1VQKA 3ICEA 2MFIA 2O4XA 2OQ0A 1LT3D 1A63A 2F3VA 4EX5A 1OTCA 4FF3A 4ZUJA 1LUZA 2PW7A 3U4ZA 4DV7Q 4OWWB 3GV3A 4PMBA 5C3EB 4PMWA 2A6HD 2F52A 2WFWA 4DV6Q 2B8FA 2I07B 2IY5B 4JCVE 2QEXA 4QQBX 4B3TL 4TKOB 2ES2A 4JI1L 3T1YL 2K75A 1N34L 1C0AA 2B39A 1N8RC 5M5XB 2TSSA 4OONA 4DAMA 3CCJA 2JK8A 4IUNA 1PH5A 4OO1G 3F2BA 3QWNA 2RA4A 3DEOA 1JC7A 1SNCA 4DR2Q 1LTGD 1WYDA 2Z4HA 1LT4D 1UEAB 2F0QA 2Z0SA 2RCFA 1EY9A 4DR6Q 2I5LX 4KHZA 2CKZB 3PUXA 1S3OA 2LFNA
chains in the Genus database with same CATH topology
3SGIA 4LF8Q 1HR0L 4BY1G 3PF5A 2IHEA 2OTLA 1S72A 1VQAA 4YY3L 4DR5Q 4HIKA 4B3TQ 1QUQB 2AKWB 5K36G 2RHQB 4IJHA 4DPGA 1KAWA 4R4QA 1SN8A 4PG3A 2ALYB 5IP9G 3J81i 4A3IH 1HNZQ 4A3BH 3S1QH 4OO1I 1IXRA 2YYZA 2PNHA 4DV2L 1YITA 1YJWA 3HOWH 2QGQA 3CCLA 4A3GH 1GVPA 4JI3L 2N3SA 2E8GA 3G71A 2UXCQ 1JE5A 3A5ZB 3D0FA 4DV1Q 4IOAA 2UXBL 1OXSC 5LMNW 1X54A 1HZ9A 3RR5A 3CCRA 4GNXC 4KLKA 1KHIA 4Y7NH 4BY7G 2PQAB 5M3FG 3RN2A 4JV5Q 3DM3A 2ZJQA 4X66L 5C44G 3G6EA 1PV4A 3S1MH 1G6PA 2NN6G 4A3JH 3CXCA 4A3LG 4RMFA 4IO9A 1N36Q 2IHFA 3TQYA 1HZCA 4NXML 1XMQQ 1QZGA 4YY3Q 4DR5L 4TQUS 1YNXA 4ME3A 2JA6H 1VQ8A 4POFA 5FJ8G 1KIXA 4JI5Q 3TEHB 4AIMA 4BBRG 3CMEA 2UUBL 1EUJA 4IPGA 3GTMH 3HOXH 1IBKL 1Q46A 2OQKA 1HJPA 3L2PA 4A93H 3HOYH 2R93H 2B63H 4B3RQ 1NY4A 1Q8KA 2HHHQ 4C3JH 3KLWA 1SR3A 1JB7A 1VCIA 5JEAJ 3BJUA 1SLJA 3PIPA 3F2CA 1FJGL 2WAQE 4IFDG 1RL2A 2VW9A 3I4MG 1A8VA 4P72A 3PUVA 1L1OC 4C2MH 1BBUA 1S40A 1QUQA 3F1ZA 3NELA 4P74A 4QL5A 5M3MG 1PFSA 4DV5L 1TWHH 3E9IA 4JOIC 1A0IA 4B3SL 4A3CG 5C0XI 2VNUD 3KOJA 4YCUA 1Y1WG 3HKSA 2YU9H 2GVBA 4MTNA 1VS0A 1B8AA 1WCMH 5FLXc 4A93G 2ASBA 2NZOA 2RF4A 1X3GA 4H02A 3I56A 4GNXA 4A3DG 4XIGS 3GTJH 4C3HH 5C3EG 4A76A 4DV6L 1E24A 2CFMA 2EIFA 2HIVA 3PUWA 2YV5A 5M5YH 4YHHL 2UUAQ 2I0QA 1B7YB 1KL9A 1Q1BA 5IYCH 1MJEA 3PUZA 1PYSB 1FL0A 3W5OA 1E7ZA 2PI2A 4JI6L 1N34Q 1Q86C 1WJJA 3ER0A 5BR8Q 4IFDJ 4JI4L 3PIOA 4X62L 3PO3G 1J6QA 1QVCA 1VQIA 3HOVH 3I4NG 4KHPL 4NPSA 4X64L 2R6GA 4LFAQ 5IYDG 2VY3A 1TWAH 2Z6KA 1EIYB 4GLXA 5H1SE 5C0XG 3Q8DA 1N32Q 3H0GH 5GQOA 4JBJA 2KENA 5M3MH 5IE8A 1DGSA 2D0PA 1QZHA 4DV3L 1VQLA 2I5HA 2KCMA 1V9PA 4A3MH 3CCVA 1VQDA 1VQ4A 2E2HH 1KXLA 1GD7A 3PO2H 1VQFA 5GROA 1XNQL 1GKHA 4MNOA 4JBKA 4BXXH 4R4OA 4DNIA 5HGQA 4A3BG 1IBLL 1L2FA 1JJCB 5LMNL 1EFWA 3PO3H 3J7ZC 4DR7L 1VQGA 4IJLA 4GOPC 1SFOH 4A4IA 3H15A 2UXCL 3S15H 2VUMG 2VZAA 1KRTA 4JI8Q 4HJ7A 4NXNQ 1D8LA 1PH6A 3TREA 4IPCA 1L1OB 5FJ8H 1YJ9A 3CP0A 3STBC 3K8AA 2UXDQ 1I94Q 4A3KG 4DV0L 3FKIG 4JI6Q 3AEVA 1RIPA 2LSSA 3VDYA 3EN2A 2Q2UA 1HNXQ 4LF7Q 1Y1WH 1TWGH 3G4SA 1YHAA 3PV0A 2JQOA 1X6OA 2QA4A 4HJ5A 2WB1E 4DR6L 1JJ2A 1HH2P 1L1OA 1EWIA 1SROA 1U5KA 2F3IA 2XGTA 4JBMA 4LF8L 4BA2I 3EBEA 1C9OA 4O2DA 2BH8A 2MO1A 2R7ZG 1WI5A 1UWVA 1LTLA 2JJQA 4QGUA 1OXUA 4AH6A 2AHOB 3PGZA 1IZ6A 2R7FA 3S14H 5LMUQ 4DR1Q 3TRZA 2JA8H 2JA7G 1ASZA 3J81c 3HKZG 2NVYH 5AJ3Q 5BR8L 1TXYA 2N8NA 2CWAA 4X6AH 1Q82C 4POGA 4JI3Q 1K73C 3NBHB 4DV0Q 3CC7A 1AE2A 2E5LQ 5IYCG 2CCZA 4JYAQ 2LXKA 2ZTCA 3STBD 2XTIA 1UEBA 2RCNA 3H0GG 2GN5A 1YZ6A 1EOVA 5FLMH 1T9HA 4LWCA 3AQQA 4PZ6A 1SE8A 4LF5Q 4JV5L 2BH2A 4A3KH 4UP9A 1K9MC 4ALPA 2YTVA 4DV7L 4DR4Q 5FLMG 1U0LA 1VQNA 4GLVB 1TWFH 3MEFA 3CC4A 3CCMA 1XPRA 1PH4A 3S2HH 3M3YH 3M7NA 5C3EH 3OYYA 3S16H 2OCEA 1IBKQ 1I3QH 4R4CA 1VQBA 4GNXB 3K7AH 1IBML 4LFBQ 3ULPA 1BBWA 4JI1Q 2Z6KC 3T1YQ 5IYBH 1O7IA 1XNRL 3M9BA 2NZHA 1JMCA 4GKJQ 3A0JA 1Q1EA 4MZ9A 4PZ7A 2JA8G 3GDEA 2A8VA 4OWXB 3CQZH 3L0OA 2CWPA 2DUDA 5HY6A 1V1QA 3M4PA 4LFAL 1NBWA 5IYBG 4LUOA 3PO2G 4DUYQ 4IPDA 1K83H 3UE1A 1LM0A 4WJ4A 4R4IA 4UPAA 3PF4A 2IX1A 4HJ8A 2UU9Q 2UU9L 4R1JA 1HR0W 2NVQH 5C4XH 1J5EL 3LGJA 3L7ZC 4JI5L 4AQYQ 3HOWG 3RLFA 5IY0A 4X66Q 2D62A 1Z9FA 3E9HA 1XMOL 4QIWE 1I6HH 4UP7A 2AWNA 1N36L 4A3JG 2JEBI 5IWAQ 1HZBA 1C7YA 2UUCQ 4LF9L 3GTKH 1I50H 4GKKQ 2ID0A 3KF8B 1VQJA 3UDGA 1UE6A 1K3RA 3PCOB 4NB3A 4OXPA 2VS1A 4EQ5A 1X65A 4DV2Q 3CC2A 1Z47A 2ZTDA 1X3EA 3CF5A 2Q2TA 4LF6L 1CSPA 2A1AA 4AYBE 3JAMi 4DR3Q 2UXBQ 1W2BA 4A3LH 2LXJA 1XNRQ 1YHBA 4B3MQ 1WCMG 2PQAA 3OTOL 1NTGA 4LF7L 3U50C 2AMCB 4NXMQ 4UP8A 3TS2A 5C4XG 2PMZE 4DR2L 4GOPA 2F4VQ 1EQRA 2UXDL 1VQ6A 1OXTA 2VQFQ 4WJ3M 2WP8J 3M4QA 4BY1H 4IPHA 2ZJRA 2NN6I 3M85A 1HNXL 2KBNA 4Y52H 3BZCA 2ZM6L 1IYJB 3K7UC 3GTPH 1HNWQ 3I55A 4A3GG 4QJFA 4XTCS 2MNAA 2OWOA 1UE5A 4DUZQ 2K14A 3I4MH 4BXXG 2WB1G 3HOZH 4HIMA 1OXVA 1GM5A 4L5TA 4UY8C 2L15A 5C4JH 4LF4L 4HJAA 5LMNQ 2JEAI 1YHQA 2VL6A 4K0KQ 3ULJA 5IWAL 2MQHA 4A3MG 1NJIC 1Q12A 4JOIA 5J3BA 3HOYG 2R93G 2DGYA 1EQQA 2R92G 3RLOA 5JJKA 3ZJYC 4GN3B 3GTGH 3CW2C 2C35B 1N33L 3RN5A 1A62A 2GVAA 2VUMH 1CSQA 1M90C 4X65L 3JC66 4A75A 5GAGC 3J7A5 2K4KA 3KYHC 3FHWA 3FKIH 1UE1A 3KF6B 1WFQA 2A19A 3J80c 1VQPA 2N49A 5GAHC 3D31A 4A3EG 4HIOA 3FP9A 2YTYA 4BY7H 4L5RC 1PH3A 1XMOQ 2JA5G 4A3CH 1WOCA 1E3PA 1HZAA 2H5XA 4R4TA 1E1TA 3F8TA 3T1HQ 1NMFA 3GTLH 4FDBA 1PA6A 4JBWA 2WAQG 2Y0SE 2Q2HA 3BZKA 4BBSH 1IBLQ 1OXXK 1P16A 4GN5A 4A3EH 2HQLA 4LNQA 3J81j 2ZTEA 5LMUL 4DR1L 3U58A 4GN4B 1YI2A 1VQ5A 4JI0L 1KQSA 5ELOA 5M5XH 1P8LA 4DV1L 4L5QA 5C0XJ 4DV4Q 3RZDH 2B63G 4RG1A 4BBRH 1Y14B 3H3VH 4DV5Q 2HT1A 3HOXG 3ULLA 1PH9A 2KCTA 3TS0A 1VQ7A 2N78A 4LW1A 2BA0A 1G51A 2RHSB 4TVAB 4KI0A 3BU2A 4YWLA 1K8AC 2E2JH 4JI7L 4DR7Q 1HNWL 4LUZA 5M3FH 2IT1A 3PSIA 3HOZG 1V43A 3UDIA 4JI2L 3T1HL 1JJGA 1NE3A 4DKAC 2UUAL 2Q2IA 3K80C 1B70B 4IOCA 3AYHB 3GTOH 1Q81C 3HOUG 4A3DH 4APVA 5JEAG 3B6YA 1E22A 4K0KL 2K5VA 2IX0A 2JE6I 3CPWA 4LFCQ 4LFBL 1YBYA 2JA5H 4B3RL 5M5WH 4NXNL 4JI8L 4DAYB 4GOPB 5IP7G 4A3IG 2JA7H 1N32L 1FJGQ 1PVOA 1X9NA 5AJ3L 4O0AA 4JI0Q 1FGUA 3K81C 3CCEA 1AH9A 3CD6A 1VQOA 2R7ZH 1XJVA 3KDFA 3F2DA 1NMGA 1M1KC 1VQ9A 3S17H 1EYGA 4JC0A 4P71A 1HNZL 1VQHA 1CUKA 3RNUA 5IYDH 1LYLA 3I4OA 3G48A 1Y1VH 4JI2Q 4DV3Q 1YJNA 3S1RH 3KJPA 1K8GA 3I4NH 3AFPA 1I5FA 5GAEC 3HKZE 3HFZB 1Q7YC 2YTXA 5E7NA 3CCQA 3KJOA 1KD1C 1H95A 2D0OA 1PH1A 2ZM6Q 3NEMA 4YWMA 4A3FH 3CCSA 3CPFA 4LFCL 1CKNB 4X62Q 2B3GA 1L0WA 2JA6G 5IP7H 1N33Q 4J15A 2NVTH 5JJIA 1CKNA 3RZOH 4DUYL 5ELNA 2HIXA 2R7DA 4LUVA 1I94L 4GS3A 3W1GA 4X65Q 3RLNA 1XPUA 4OWTB 4HIDA 1PH8A 1SRUA 2VQEQ 4DV4L 2KHIA 4LF5L 4KHPQ 3CCUA 2K5NA 1YEZA 5IP9H 4DR3L 1XMQL 4YCVA 1N9WA 4AQYL 3GTQH 4P73A 1PH2A 4B3SQ 3GD7A 1MJCA 1FVIA 2AWOA 4C3IH 1SMXA 5DLQE 3MXNB 3KDFB 4JI7Q 1G291 2PI2E 1X56A 3E0EA 1KC8C 2VQFL 4YCWA 1VQMA 1HR0Q 1R9TH 2NVXH 1XPOA 1XNQQ 3H3VI 4DR4L 4L5SA 1PYBA 2UUBQ 1EIFA 1GO3E 4IFDI 4LF4Q 3I7FA 2B29A 2V1CC 1CKOA 3GO5A 3UE0A 5GADC 4YHHQ 2R92H 1PH7A 3HOVG 4P75A 2OTJA 1K0RA 4DUZL 2ZJPA 4LF6Q 3K0XA 4LF9Q 3S1NH 4GKKL 1IBMQ 1E1OA 1VQKA 2K50A 2MFIA 3NENA 3CAMA 4X64Q 3ICEA 2OQ0A 2E5LL 2HHHL 3OTOQ 1A63A 4GKJL 2CQOA 4EX5A 2I5MX 2K52A 3KF6A 3S24A 1OTCA 1LUZA 4JI4Q 1VQEA 4OX9L 1CKMA 1UE7A 1AE3A 4DK3C 3CMAA 3U4ZA 3S2DH 4DV7Q 4OWWB 1KRSA 3U4VA 3EIVA 2KHJA 3W1BA 1X3FA 3DLLA 2E2IH 4PMWA 1XTDA 2F52A 2WFWA 5C44H 4DV6Q 2FXQA 4YWKA 2UUCL 1J5EQ 2ATWA 3A5UA 2EQSA 4GLAC 2IY5B 4JCVE 2QEXA 4QY7A 1PHJA 1D7QA 4QQBX 4BA1I 4BBSG 3J80i 3A74A 4B3TL 3WWVA 2ES2A 4JI1L 3T1YL 2K75A 1N34L 1C0AA 2BA1A 4AYBG 5JJLA 1N8RC 1BKBA 3I2ZA 3HOUH 4DK6C 4OONA 4DAMA 3CCJA 2JK8A 1YVCA 3UDXA 1X55A 4JG2A 4HJ9A 3PUYA 1PH5A 4OO1G 3F2BA 1TWCH 3M4OH 3JAMc 1MKHA 5EAYA 2EXDA 1QVFA 2JA9A 3KFUA 2MO0A 2Y0SG 1WYDA 1BVSA 2VQEL 4PZ8A 4DR2Q 2F4VL 1JT8A 1YIJA 3AFQA 1ASYA 3ERSX 3UDFA 1Y1VG 2Z0SA 1IL2A 4JYAL 4B3ML 3OW2A 1VQCA 4DR6Q 2I5LX 1QVGA 4OX9Q 1W3SA 3IRBA 5IT9c 4KHZA 2K5HA 2CKZB 3PUXA 1S3OA 4A3FG 1MIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  4LF8 Q;  1HR0 L;  4BY1 G;  3PF5 A;  2IHE A;  2OTL A;  1S72 A;  1VQA A;  4YY3 L;  4DR5 Q;  4HIK A;  4B3T Q;  1QUQ B;  2AKW B;  5K36 G;  2RHQ B;  4IJH A;  4DPG A;  1KAW A;  4R4Q A;  1SN8 A;  4PG3 A;  2ALY B;  5IP9 G;  3J81 i;  4A3I H;  1HNZ Q;  4A3B H;  3S1Q H;  4OO1 I;  1IXR A;  2YYZ A;  2PNH A;  4DV2 L;  1YIT A;  1YJW A;  3HOW H;  2QGQ A;  3CCL A;  4A3G H;  1GVP A;  4JI3 L;  2N3S A;  2E8G A;  3G71 A;  2UXC Q;  1JE5 A;  3A5Z B;  3D0F A;  4DV1 Q;  4IOA A;  2UXB L;  1OXS C;  5LMN W;  1X54 A;  1HZ9 A;  3RR5 A;  3CCR A;  4GNX C;  4KLK A;  1KHI A;  4Y7N H;  4BY7 G;  2PQA B;  5M3F G;  3RN2 A;  4JV5 Q;  3DM3 A;  2ZJQ A;  4X66 L;  5C44 G;  3G6E A;  1PV4 A;  3S1M H;  1G6P A;  2NN6 G;  4A3J H;  3CXC A;  4A3L G;  4RMF A;  4IO9 A;  1N36 Q;  2IHF A;  3TQY A;  1HZC A;  4NXM L;  1XMQ Q;  1QZG A;  4YY3 Q;  4DR5 L;  4TQU S;  1YNX A;  4ME3 A;  2JA6 H;  1VQ8 A;  4POF A;  5FJ8 G;  1KIX A;  4JI5 Q;  3TEH B;  4AIM A;  4BBR G;  3CME A;  2UUB L;  1EUJ A;  4IPG A;  3GTM H;  3HOX H;  1IBK L;  1Q46 A;  2OQK A;  1HJP A;  3L2P A;  4A93 H;  3HOY H;  2R93 H;  2B63 H;  4B3R Q;  1NY4 A;  1Q8K A;  2HHH Q;  4C3J H;  3KLW A;  1SR3 A;  1JB7 A;  1VCI A;  5JEA J;  3BJU A;  1SLJ A;  3PIP A;  3F2C A;  1FJG L;  2WAQ E;  4IFD G;  1RL2 A;  2VW9 A;  3I4M G;  1A8V A;  4P72 A;  3PUV A;  1L1O C;  4C2M H;  1BBU A;  1S40 A;  1QUQ A;  3F1Z A;  3NEL A;  4P74 A;  4QL5 A;  5M3M G;  1PFS A;  4DV5 L;  1TWH H;  3E9I A;  4JOI C;  1A0I A;  4B3S L;  4A3C G;  5C0X I;  2VNU D;  3KOJ A;  4YCU A;  1Y1W G;  3HKS A;  2YU9 H;  2GVB A;  4MTN A;  1VS0 A;  1B8A A;  1WCM H;  5FLX c;  4A93 G;  2ASB A;  2NZO A;  2RF4 A;  1X3G A;  4H02 A;  3I56 A;  4GNX A;  4A3D G;  4XIG S;  3GTJ H;  4C3H H;  5C3E G;  4A76 A;  4DV6 L;  1E24 A;  2CFM A;  2EIF A;  2HIV A;  3PUW A;  2YV5 A;  5M5Y H;  4YHH L;  2UUA Q;  2I0Q A;  1B7Y B;  1KL9 A;  1Q1B A;  5IYC H;  1MJE A;  3PUZ A;  1PYS B;  1FL0 A;  3W5O A;  1E7Z A;  2PI2 A;  4JI6 L;  1N34 Q;  1Q86 C;  1WJJ A;  3ER0 A;  5BR8 Q;  4IFD J;  4JI4 L;  3PIO A;  4X62 L;  3PO3 G;  1J6Q A;  1QVC A;  1VQI A;  3HOV H;  3I4N G;  4KHP L;  4NPS A;  4X64 L;  2R6G A;  4LFA Q;  5IYD G;  2VY3 A;  1TWA H;  2Z6K A;  1EIY B;  4GLX A;  5H1S E;  5C0X G;  3Q8D A;  1N32 Q;  3H0G H;  5GQO A;  4JBJ A;  2KEN A;  5M3M H;  5IE8 A;  1DGS A;  2D0P A;  1QZH A;  4DV3 L;  1VQL A;  2I5H A;  2KCM A;  1V9P A;  4A3M H;  3CCV A;  1VQD A;  1VQ4 A;  2E2H H;  1KXL A;  1GD7 A;  3PO2 H;  1VQF A;  5GRO A;  1XNQ L;  1GKH A;  4MNO A;  4JBK A;  4BXX H;  4R4O A;  4DNI A;  5HGQ A;  4A3B G;  1IBL L;  1L2F A;  1JJC B;  5LMN L;  1EFW A;  3PO3 H;  3J7Z C;  4DR7 L;  1VQG A;  4IJL A;  4GOP C;  1SFO H;  4A4I A;  3H15 A;  2UXC L;  3S15 H;  2VUM G;  2VZA A;  1KRT A;  4JI8 Q;  4HJ7 A;  4NXN Q;  1D8L A;  1PH6 A;  3TRE A;  4IPC A;  1L1O B;  5FJ8 H;  1YJ9 A;  3CP0 A;  3STB C;  3K8A A;  2UXD Q;  1I94 Q;  4A3K G;  4DV0 L;  3FKI G;  4JI6 Q;  3AEV A;  1RIP A;  2LSS A;  3VDY A;  3EN2 A;  2Q2U A;  1HNX Q;  4LF7 Q;  1Y1W H;  1TWG H;  3G4S A;  1YHA A;  3PV0 A;  2JQO A;  1X6O A;  2QA4 A;  4HJ5 A;  2WB1 E;  4DR6 L;  1JJ2 A;  1HH2 P;  1L1O A;  1EWI A;  1SRO A;  1U5K A;  2F3I A;  2XGT A;  4JBM A;  4LF8 L;  4BA2 I;  3EBE A;  1C9O A;  4O2D A;  2BH8 A;  2MO1 A;  2R7Z G;  1WI5 A;  1UWV A;  1LTL A;  2JJQ A;  4QGU A;  1OXU A;  4AH6 A;  2AHO B;  3PGZ A;  1IZ6 A;  2R7F A;  3S14 H;  5LMU Q;  4DR1 Q;  3TRZ A;  2JA8 H;  2JA7 G;  1ASZ A;  3J81 c;  3HKZ G;  2NVY H;  5AJ3 Q;  5BR8 L;  1TXY A;  2N8N A;  2CWA A;  4X6A H;  1Q82 C;  4POG A;  4JI3 Q;  1K73 C;  3NBH B;  4DV0 Q;  3CC7 A;  1AE2 A;  2E5L Q;  5IYC G;  2CCZ A;  4JYA Q;  2LXK A;  2ZTC A;  3STB D;  2XTI A;  1UEB A;  2RCN A;  3H0G G;  2GN5 A;  1YZ6 A;  1EOV A;  5FLM H;  1T9H A;  4LWC A;  3AQQ A;  4PZ6 A;  1SE8 A;  4LF5 Q;  4JV5 L;  2BH2 A;  4A3K H;  4UP9 A;  1K9M C;  4ALP A;  2YTV A;  4DV7 L;  4DR4 Q;  5FLM G;  1U0L A;  1VQN A;  4GLV B;  1TWF H;  3MEF A;  3CC4 A;  3CCM A;  1XPR A;  1PH4 A;  3S2H H;  3M3Y H;  3M7N A;  5C3E H;  3OYY A;  3S16 H;  2OCE A;  1IBK Q;  1I3Q H;  4R4C A;  1VQB A;  4GNX B;  3K7A H;  1IBM L;  4LFB Q;  3ULP A;  1BBW A;  4JI1 Q;  2Z6K C;  3T1Y Q;  5IYB H;  1O7I A;  1XNR L;  3M9B A;  2NZH A;  1JMC A;  4GKJ Q;  3A0J A;  1Q1E A;  4MZ9 A;  4PZ7 A;  2JA8 G;  3GDE A;  2A8V A;  4OWX B;  3CQZ H;  3L0O A;  2CWP A;  2DUD A;  5HY6 A;  1V1Q A;  3M4P A;  4LFA L;  1NBW A;  5IYB G;  4LUO A;  3PO2 G;  4DUY Q;  4IPD A;  1K83 H;  3UE1 A;  1LM0 A;  4WJ4 A;  4R4I A;  4UPA A;  3PF4 A;  2IX1 A;  4HJ8 A;  2UU9 Q;  2UU9 L;  4R1J A;  1HR0 W;  2NVQ H;  5C4X H;  1J5E L;  3LGJ A;  3L7Z C;  4JI5 L;  4AQY Q;  3HOW G;  3RLF A;  5IY0 A;  4X66 Q;  2D62 A;  1Z9F A;  3E9H A;  1XMO L;  4QIW E;  1I6H H;  4UP7 A;  2AWN A;  1N36 L;  4A3J G;  2JEB I;  5IWA Q;  1HZB A;  1C7Y A;  2UUC Q;  4LF9 L;  3GTK H;  1I50 H;  4GKK Q;  2ID0 A;  3KF8 B;  1VQJ A;  3UDG A;  1UE6 A;  1K3R A;  3PCO B;  4NB3 A;  4OXP A;  2VS1 A;  4EQ5 A;  1X65 A;  4DV2 Q;  3CC2 A;  1Z47 A;  2ZTD A;  1X3E A;  3CF5 A;  2Q2T A;  4LF6 L;  1CSP A;  2A1A A;  4AYB E;  3JAM i;  4DR3 Q;  2UXB Q;  1W2B A;  4A3L H;  2LXJ A;  1XNR Q;  1YHB A;  4B3M Q;  1WCM G;  2PQA A;  3OTO L;  1NTG A;  4LF7 L;  3U50 C;  2AMC B;  4NXM Q;  4UP8 A;  3TS2 A;  5C4X G;  2PMZ E;  4DR2 L;  4GOP A;  2F4V Q;  1EQR A;  2UXD L;  1VQ6 A;  1OXT A;  2VQF Q;  4WJ3 M;  2WP8 J;  3M4Q A;  4BY1 H;  4IPH A;  2ZJR A;  2NN6 I;  3M85 A;  1HNX L;  2KBN A;  4Y52 H;  3BZC A;  2ZM6 L;  1IYJ B;  3K7U C;  3GTP H;  1HNW Q;  3I55 A;  4A3G G;  4QJF A;  4XTC S;  2MNA A;  2OWO A;  1UE5 A;  4DUZ Q;  2K14 A;  3I4M H;  4BXX G;  2WB1 G;  3HOZ H;  4HIM A;  1OXV A;  1GM5 A;  4L5T A;  4UY8 C;  2L15 A;  5C4J H;  4LF4 L;  4HJA A;  5LMN Q;  2JEA I;  1YHQ A;  2VL6 A;  4K0K Q;  3ULJ A;  5IWA L;  2MQH A;  4A3M G;  1NJI C;  1Q12 A;  4JOI A;  5J3B A;  3HOY G;  2R93 G;  2DGY A;  1EQQ A;  2R92 G;  3RLO A;  5JJK A;  3ZJY C;  4GN3 B;  3GTG H;  3CW2 C;  2C35 B;  1N33 L;  3RN5 A;  1A62 A;  2GVA A;  2VUM H;  1CSQ A;  1M90 C;  4X65 L;  3JC6 6;  4A75 A;  5GAG C;  3J7A 5;  2K4K A;  3KYH C;  3FHW A;  3FKI H;  1UE1 A;  3KF6 B;  1WFQ A;  2A19 A;  3J80 c;  1VQP A;  2N49 A;  5GAH C;  3D31 A;  4A3E G;  4HIO A;  3FP9 A;  2YTY A;  4BY7 H;  4L5R C;  1PH3 A;  1XMO Q;  2JA5 G;  4A3C H;  1WOC A;  1E3P A;  1HZA A;  2H5X A;  4R4T A;  1E1T A;  3F8T A;  3T1H Q;  1NMF A;  3GTL H;  4FDB A;  1PA6 A;  4JBW A;  2WAQ G;  2Y0S E;  2Q2H A;  3BZK A;  4BBS H;  1IBL Q;  1OXX K;  1P16 A;  4GN5 A;  4A3E H;  2HQL A;  4LNQ A;  3J81 j;  2ZTE A;  5LMU L;  4DR1 L;  3U58 A;  4GN4 B;  1YI2 A;  1VQ5 A;  4JI0 L;  1KQS A;  5ELO A;  5M5X H;  1P8L A;  4DV1 L;  4L5Q A;  5C0X J;  4DV4 Q;  3RZD H;  2B63 G;  4RG1 A;  4BBR H;  1Y14 B;  3H3V H;  4DV5 Q;  2HT1 A;  3HOX G;  3ULL A;  1PH9 A;  2KCT A;  3TS0 A;  1VQ7 A;  2N78 A;  4LW1 A;  2BA0 A;  1G51 A;  2RHS B;  4TVA B;  4KI0 A;  3BU2 A;  4YWL A;  1K8A C;  2E2J H;  4JI7 L;  4DR7 Q;  1HNW L;  4LUZ A;  5M3F H;  2IT1 A;  3PSI A;  3HOZ G;  1V43 A;  3UDI A;  4JI2 L;  3T1H L;  1JJG A;  1NE3 A;  4DKA C;  2UUA L;  2Q2I A;  3K80 C;  1B70 B;  4IOC A;  3AYH B;  3GTO H;  1Q81 C;  3HOU G;  4A3D H;  4APV A;  5JEA G;  3B6Y A;  1E22 A;  4K0K L;  2K5V A;  2IX0 A;  2JE6 I;  3CPW A;  4LFC Q;  4LFB L;  1YBY A;  2JA5 H;  4B3R L;  5M5W H;  4NXN L;  4JI8 L;  4DAY B;  4GOP B;  5IP7 G;  4A3I G;  2JA7 H;  1N32 L;  1FJG Q;  1PVO A;  1X9N A;  5AJ3 L;  4O0A A;  4JI0 Q;  1FGU A;  3K81 C;  3CCE A;  1AH9 A;  3CD6 A;  1VQO A;  2R7Z H;  1XJV A;  3KDF A;  3F2D A;  1NMG A;  1M1K C;  1VQ9 A;  3S17 H;  1EYG A;  4JC0 A;  4P71 A;  1HNZ L;  1VQH A;  1CUK A;  3RNU A;  5IYD H;  1LYL A;  3I4O A;  3G48 A;  1Y1V H;  4JI2 Q;  4DV3 Q;  1YJN A;  3S1R H;  3KJP A;  1K8G A;  3I4N H;  3AFP A;  1I5F A;  5GAE C;  3HKZ E;  3HFZ B;  1Q7Y C;  2YTX A;  5E7N A;  3CCQ A;  3KJO A;  1KD1 C;  1H95 A;  2D0O A;  1PH1 A;  2ZM6 Q;  3NEM A;  4YWM A;  4A3F H;  3CCS A;  3CPF A;  4LFC L;  1CKN B;  4X62 Q;  2B3G A;  1L0W A;  2JA6 G;  5IP7 H;  1N33 Q;  4J15 A;  2NVT H;  5JJI A;  1CKN A;  3RZO H;  4DUY L;  5ELN A;  2HIX A;  2R7D A;  4LUV A;  1I94 L;  4GS3 A;  3W1G A;  4X65 Q;  3RLN A;  1XPU A;  4OWT B;  4HID A;  1PH8 A;  1SRU A;  2VQE Q;  4DV4 L;  2KHI A;  4LF5 L;  4KHP Q;  3CCU A;  2K5N A;  1YEZ A;  5IP9 H;  4DR3 L;  1XMQ L;  4YCV A;  1N9W A;  4AQY L;  3GTQ H;  4P73 A;  1PH2 A;  4B3S Q;  3GD7 A;  1MJC A;  1FVI A;  2AWO A;  4C3I H;  1SMX A;  5DLQ E;  3MXN B;  3KDF B;  4JI7 Q;  1G29 1;  2PI2 E;  1X56 A;  3E0E A;  1KC8 C;  2VQF L;  4YCW A;  1VQM A;  1HR0 Q;  1R9T H;  2NVX H;  1XPO A;  1XNQ Q;  3H3V I;  4DR4 L;  4L5S A;  1PYB A;  2UUB Q;  1EIF A;  1GO3 E;  4IFD I;  4LF4 Q;  3I7F A;  2B29 A;  2V1C C;  1CKO A;  3GO5 A;  3UE0 A;  5GAD C;  4YHH Q;  2R92 H;  1PH7 A;  3HOV G;  4P75 A;  2OTJ A;  1K0R A;  4DUZ L;  2ZJP A;  4LF6 Q;  3K0X A;  4LF9 Q;  3S1N H;  4GKK L;  1IBM Q;  1E1O A;  1VQK A;  2K50 A;  2MFI A;  3NEN A;  3CAM A;  4X64 Q;  3ICE A;  2OQ0 A;  2E5L L;  2HHH L;  3OTO Q;  1A63 A;  4GKJ L;  2CQO A;  4EX5 A;  2I5M X;  2K52 A;  3KF6 A;  3S24 A;  1OTC A;  1LUZ A;  4JI4 Q;  1VQE A;  4OX9 L;  1CKM A;  1UE7 A;  1AE3 A;  4DK3 C;  3CMA A;  3U4Z A;  3S2D H;  4DV7 Q;  4OWW B;  1KRS A;  3U4V A;  3EIV A;  2KHJ A;  3W1B A;  1X3F A;  3DLL A;  2E2I H;  4PMW A;  1XTD A;  2F52 A;  2WFW A;  5C44 H;  4DV6 Q;  2FXQ A;  4YWK A;  2UUC L;  1J5E Q;  2ATW A;  3A5U A;  2EQS A;  4GLA C;  2IY5 B;  4JCV E;  2QEX A;  4QY7 A;  1PHJ A;  1D7Q A;  4QQB X;  4BA1 I;  4BBS G;  3J80 i;  3A74 A;  4B3T L;  3WWV A;  2ES2 A;  4JI1 L;  3T1Y L;  2K75 A;  1N34 L;  1C0A A;  2BA1 A;  4AYB G;  5JJL A;  1N8R C;  1BKB A;  3I2Z A;  3HOU H;  4DK6 C;  4OON A;  4DAM A;  3CCJ A;  2JK8 A;  1YVC A;  3UDX A;  1X55 A;  4JG2 A;  4HJ9 A;  3PUY A;  1PH5 A;  4OO1 G;  3F2B A;  1TWC H;  3M4O H;  3JAM c;  1MKH A;  5EAY A;  2EXD A;  1QVF A;  2JA9 A;  3KFU A;  2MO0 A;  2Y0S G;  1WYD A;  1BVS A;  2VQE L;  4PZ8 A;  4DR2 Q;  2F4V L;  1JT8 A;  1YIJ A;  3AFQ A;  1ASY A;  3ERS X;  3UDF A;  1Y1V G;  2Z0S A;  1IL2 A;  4JYA L;  4B3M L;  3OW2 A;  1VQC A;  4DR6 Q;  2I5L X;  1QVG A;  4OX9 Q;  1W3S A;  3IRB A;  5IT9 c;  4KHZ A;  2K5H A;  2CKZ B;  3PUX A;  1S3O A;  4A3F G;  1MIU A; 
#chains in the Genus database with same CATH topology
 1SYB A;  1HR0 L;  3PF5 A;  2OTL A;  1BXT A;  2A6H C;  5I6Y A;  3IL8 A;  2LKV A;  2MHV A;  3NXW A;  5IIF A;  1D6E C;  1WCM B;  3K58 A;  4A3B H;  2B2V C;  4KY5 A;  1IXR A;  1YIT A;  2QGQ A;  1EOT A;  2UXC Q;  3NHH A;  3G71 A;  4DV1 Q;  1E2Z A;  2F0J A;  3CCR A;  4GNX C;  1KHI A;  4Y7N H;  1K3B C;  2BDO A;  2PQA B;  4JV5 Q;  1ET9 A;  3DM3 A;  1M8A A;  1Y8P B;  1TWC B;  5K36 H;  3CXC A;  1PZJ D;  1TY2 A;  1BDO A;  3IFD A;  3HOY B;  2R93 B;  3AU7 A;  4MTK A;  1QZG A;  1JWU D;  4DR5 L;  3TEH B;  3CME A;  4C1N K;  1Q46 A;  1SYD A;  2OQK A;  3L2P A;  3U9S A;  1EIH A;  2B2Y C;  1STE A;  1SR3 A;  1JB7 A;  1VCI A;  3BJU A;  1SLJ A;  5A35 A;  5C5L A;  3PUV A;  3F1Z A;  1Q3L A;  5J1Z A;  5M3M G;  2FIN B;  1PFS A;  2OF1 A;  2WAQ B;  4A3C G;  2VNU D;  3T16 A;  4YIJ A;  2ICI A;  1F2Y A;  1BF4 A;  1VS0 A;  4FP5 D;  3GTL B;  1PFN A;  3I56 A;  1HA5 A;  4A3D G;  2HDM A;  4XIG S;  3GTJ H;  1I4Q A;  4DV6 L;  1E24 A;  2CFM A;  2EIF A;  4YHH L;  4DK0 A;  2A5H A;  3IAY A;  1Y1V B;  1SMY D;  2I0Q A;  5IOC A;  1KL9 A;  5IYC H;  1MJE A;  3PUZ A;  4C3H G;  4JI6 L;  4ME5 A;  1N34 Q;  1I4P A;  2K5W A;  3ER0 A;  1HTL D;  3PIO A;  1EY7 A;  3PO3 G;  3I4N G;  1S5C D;  1X3Q A;  5H1S E;  1RTN A;  3H0G H;  3DWA A;  5DNF A;  5M3M H;  3GTG B;  2M00 A;  1DGS A;  1QZH A;  4NDX A;  1EEI D;  1LTR D;  1NNX A;  5GRO A;  4JBK A;  5D3I B;  5HGQ A;  3OMG A;  1IBL L;  1BQQ T;  4RKL A;  3J7Z C;  3I70 A;  3SK5 A;  3TP7 A;  1VQG A;  1SFO H;  4Y7N B;  4JI8 Q;  4NXN Q;  2O5I C;  1JQY D;  1PH6 A;  3BG3 A;  3HG9 A;  4IPC A;  4HMJ A;  1A2T A;  1MD2 D;  3CP0 A;  5C5M A;  2UXD Q;  3ONA B;  1V1P A;  3A55 A;  3VDY A;  1HXY D;  3G4S A;  5CBE E;  1Y69 U;  2JQO A;  4PMC A;  4V19 0;  4DR6 L;  1HHV A;  4FYD A;  2F0U A;  2F3I A;  2AUJ D;  4DFA A;  4BA2 I;  1C9O A;  2BH8 A;  2IPK D;  1UWV A;  1LTL A;  2KOL A;  4QGU A;  4AH6 A;  2DJG C;  4DR1 Q;  4QF4 A;  1ZXT A;  5E3F A;  4X6A H;  4NW2 A;  1MBY A;  4QUC A;  4DV0 Q;  4JYA Q;  1KNA A;  4MHE A;  5JVH 3;  4A3D B;  1GUO A;  5FLM H;  1WTR A;  1T9H A;  3BVZ A;  4JV5 L;  2BH2 A;  3VR3 A;  3D6C A;  5FO7 B;  1PFB A;  2EYO A;  4H44 C;  4RAU C;  1KLU D;  4M1U B;  4OO1 H;  2L12 A;  3QO2 A;  2OCE A;  1IBK Q;  2PCF B;  4C3J B;  1PTO D;  1DOM A;  3ULP A;  2J0T D;  5A2Q L;  3SEB A;  5ELB A;  3H0G B;  2NZH A;  1DON A;  3T53 B;  1PTO H;  5HY6 A;  5IYB G;  4FXD A;  2B2U A;  3KBG A;  3UE1 A;  2F0F A;  1U4P A;  4R4I A;  4QIW B;  4WJ4 A;  2XRQ D;  1JIC A;  4OL7 A;  3TDQ A;  5ISR A;  3Q22 A;  1I3Q B;  1I4R A;  3LGJ A;  4Q0F A;  4AQY Q;  1Z9F A;  1G91 A;  5C4X B;  2PZT A;  1N36 L;  3KF8 A;  5IWA Q;  3OOC A;  3GP7 A;  4PNY A;  2ID0 A;  1EY4 A;  1VQJ A;  1UE6 A;  1K3R A;  4NB3 A;  4CGY B;  4EQ5 A;  4DV2 Q;  3KLS A;  1G8Z D;  4DNR B;  4DXG A;  3BVM A;  3A8I E;  4AYB E;  4DR3 Q;  3NPP A;  1W2B A;  4F87 A;  2E75 C;  3HOW B;  1WCM G;  1H9S B;  1NTG A;  4A3M B;  2AMC B;  1BUV T;  2A69 C;  3TS2 A;  1EQR A;  2K6A A;  3TZD A;  2UXD L;  2JA7 B;  2WP8 J;  3M4Q A;  5C6A A;  2AQ3 B;  4IPH A;  4KD3 A;  2DY7 A;  2ZJR A;  1EZ6 A;  2F0K A;  4Y52 H;  1IYJ B;  3GTP H;  2ZXR A;  4XTC S;  5FO9 B;  2OWO A;  2K14 A;  2WB1 G;  3HOZ H;  1C4Q A;  1XYI A;  3ULJ A;  2DGY A;  2LY7 A;  1EQQ A;  5JJK A;  2F0S A;  3GV6 A;  3ZJY C;  3IFT A;  1EWC A;  3NWS A;  1A62 A;  2N55 A;  3Q6S A;  1KTK A;  3E0J A;  3JC6 6;  5GAG C;  3J7A 5;  4J6H A;  4RA8 A;  4HTH A;  3RZD B;  5G3L F;  3J80 c;  1VQP A;  1A6X A;  1B2T A;  2V4D A;  4BY7 H;  1SXT A;  1WOC A;  1E3P A;  1HZA A;  4KY7 A;  1NMF A;  1S5E D;  3GTL H;  5JOB A;  4JBW A;  2EYL A;  3BZK A;  4LJZ C;  3J81 j;  3C46 A;  4DR1 L;  1YI2 A;  5KGU A;  4DV1 L;  4L5Q A;  5M5Y B;  4KY6 A;  2JXM B;  3ZYY X;  4WRD A;  2HQE A;  1JWM D;  3HOX G;  4XQJ A;  3ULL A;  3CRK C;  2JA5 B;  2SNS A;  2N78 A;  2BA0 A;  2RQX A;  5IGG A;  1CM9 A;  4N8F A;  3A7L A;  3HOZ G;  2NTS A;  4HMI A;  1XTC D;  2Q2I A;  3K80 C;  2A68 C;  2JP1 A;  4IOC A;  1NCV A;  1R9T B;  1Q81 C;  2F3W A;  3HOU G;  1WVL A;  5JEA G;  3EFX D;  4CJ1 B;  1BNZ A;  2JA7 H;  1FJG Q;  4LAA A;  1AH9 A;  3CD6 A;  2G9D A;  4TSS A;  3KDF A;  3F2D A;  1NR2 A;  1EYG A;  1W6K A;  4OIJ A;  3GTK B;  1RKN A;  2VB2 X;  1HNZ L;  1PLF A;  3HOU B;  1YJN A;  4DV3 Q;  2ICE C;  3S1R H;  1GUS A;  1JE4 A;  1ESF A;  2OEO A;  2R3Z A;  5EKL A;  4HSP A;  3HKZ E;  3HFZ B;  4A3F H;  3CCS A;  3CPF A;  4HAE A;  3DEP A;  1L0W A;  3BZD B;  4J15 A;  3SDZ A;  1I94 L;  4CDC C;  1AN8 A;  2R7D A;  1IW7 C;  3W1G A;  3RLN A;  4OWT B;  1SE3 A;  2VQE Q;  2QIL A;  3QR8 A;  2JSO A;  2KHI A;  4LF5 L;  1GHK A;  3M7G A;  3CCU A;  2F0D A;  1R4P B;  1YEZ A;  1ZKO A;  2QCP X;  4DR3 L;  1XMQ L;  1FNU A;  1MJC A;  3H09 A;  2BCO A;  4C3I H;  1LAB A;  4FNF A;  3KDF B;  5FLX E;  4JI7 Q;  1KC8 C;  5IGF A;  4R8I A;  3H94 A;  4DAP A;  2K01 A;  4LF4 Q;  3I7F A;  2B29 A;  2V1C C;  1CKO A;  3VR6 A;  3UE0 A;  5GAD C;  4YHH Q;  1K8M A;  3HOV G;  4P75 A;  3D8G A;  1K0R A;  2OTJ A;  2ZJP A;  4LF9 Q;  4GKK L;  3WOE A;  2K50 A;  3CAM A;  3SR1 A;  2HHH L;  1F9S A;  2EPB A;  3MA2 B;  3HGB A;  4DK3 C;  3BYY B;  1PTO F;  2L11 A;  1WTX A;  4ZUI A;  3EIV A;  4ZKC B;  5I4D A;  1X3F A;  3DLL A;  4QMG A;  2FXQ A;  3J80 E;  2UUC L;  1J5E Q;  2ATW A;  3N52 A;  5IT9 E;  2BE5 D;  1PHJ A;  3ERO A;  3QOJ A;  3R8B A;  3A74 A;  1QNK A;  4N9T A;  3I4N B;  3K5M A;  4KD4 A;  4K5W A;  4DK6 C;  3FVQ A;  1YNJ D;  3PUY A;  3M4O H;  3EVQ A;  2EXD A;  1XXG A;  2MO0 A;  2Y0S G;  3K0Y A;  2VQE L;  2F4V L;  4PZ8 A;  1MSG A;  1BCP D;  1CFM A;  4JVZ A;  1ASY A;  4LMQ D;  4JYA L;  2FMM A;  3HEJ A;  2I46 A;  4B3M L;  1VQC A;  1WTV A;  4C3H B;  1QVG A;  1CI3 M;  1SNQ A;  3D4R A;  4BY1 G;  4ODG A;  1ML0 D;  2K5D A;  4YY3 L;  4HIK A;  4B3T Q;  3NBI A;  4IJH A;  2L5T A;  5IP9 G;  2ALY B;  1HNZ Q;  4OO1 I;  4RGM A;  3S1Q H;  1X3P A;  1LTB D;  3HOW H;  3E3X A;  2PNH A;  4DV2 L;  1YJW A;  5JVG 3;  3CCL A;  2MP1 A;  1GVP A;  2IJ0 A;  1TQO A;  1I50 B;  1A3V A;  4IOA A;  5E4W C;  1HUM A;  1TWA B;  5CV7 A;  5LMN W;  1X54 A;  3RR5 A;  4UAI A;  4KKS A;  5M3F G;  1DXM A;  2FFK B;  2ZJQ A;  3OWE B;  3J7Y W;  1PV4 A;  1EY6 A;  2NN6 G;  4QCL A;  1PTO B;  4A3L G;  3MHB A;  5A2Q E;  3TQY A;  2EJM A;  3BVG A;  1XMQ Q;  2X6G A;  4TQU S;  4POF A;  5FJ8 G;  4C1N I;  2VB3 X;  2RDH A;  5IGD A;  3FPP A;  4OEL B;  1IBK L;  1CQF A;  2EY1 A;  4B3R Q;  4I7Z C;  1NY4 A;  3KLW A;  1AEX A;  3PIP A;  3F2C A;  1VF5 C;  2KVM A;  2VW9 A;  1CTM A;  4P72 A;  1QUQ A;  4G7H C;  4P74 A;  4J8Q A;  1CT1 D;  3PIO 3;  3E9I A;  4JOI C;  4KTA A;  5C0X I;  4ZAI A;  3I90 A;  3HKS A;  5EJW A;  2YU9 H;  2GVB A;  4MTN A;  5FLX c;  2ASB A;  4GNX A;  4NKL A;  4Z9C B;  1F77 A;  3OIP A;  3PUW A;  2YV5 A;  1S4Z A;  1B7Y B;  2XWB B;  1FL0 A;  3W5O A;  1Q86 C;  5BR8 Q;  4JI4 L;  1O78 A;  4X62 L;  1ROD A;  2VY3 A;  1TWA H;  4ZCK A;  4GLX A;  1DD2 A;  3C1E A;  3LWE A;  5GQO A;  2BE5 C;  2KEN A;  5IE8 A;  4N8X 1;  4OHJ A;  5BN5 A;  2KCM A;  1KXL A;  1VQ4 A;  3MXN A;  2ENB A;  3AMU A;  1I4H A;  3TBI B;  4DNI A;  1L2F A;  2EZV A;  4ZRZ A;  1JJC B;  5LMN L;  3PO3 H;  1QJO A;  4OIK A;  4DR7 L;  4GOP C;  2K5Q A;  3A7A B;  4A4I A;  3S15 H;  1KRT A;  3T51 B;  3O13 A;  3H6M A;  2ZXO A;  1L0Y B;  2HDL A;  2A74 C;  3TRE A;  1L1O B;  1FGB D;  5JPM C;  5I2X A;  1JB3 A;  3MFY A;  5NUC A;  3Q0A A;  4K6D A;  4B08 A;  3AEV A;  1E2W A;  1RIP A;  2HUG A;  3EN2 A;  2PW5 A;  2HCI A;  3IKJ A;  4LF7 Q;  2BOS A;  2WB1 E;  4O1N A;  1HH2 P;  2XRS D;  1EWI A;  1II3 A;  4LF8 L;  2XGT A;  4CJ0 B;  4O2D A;  1D5M C;  2MO1 A;  2R7Z G;  1U4L A;  2F0P A;  2JJQ A;  3G7L A;  5EQ0 A;  4CDF C;  5J39 A;  3PGZ A;  3T4A C;  5JPN C;  2F0I A;  3HKZ G;  2NZ1 D;  3MXU A;  1TXY A;  1PMR A;  4RHS A;  1Q82 C;  1J9O A;  4XT1 B;  1K73 C;  3NBH B;  1AE2 A;  2E5L Q;  2GN5 A;  3H0G G;  1EOV A;  2B2T C;  4LWC A;  3AQQ A;  4UP9 A;  4ALP A;  4DV7 L;  2PZW A;  1B9N A;  5FLM G;  4GLV B;  1TWF H;  3MEF A;  4BS9 A;  5L37 A;  3CCM A;  2N88 A;  1PH4 A;  4IUR A;  4DAV A;  4MIU A;  3RD4 A;  2NVY B;  1K28 A;  3M7N A;  3OYY A;  3S16 H;  5CV6 A;  1I3Q H;  1LT5 D;  3FDT A;  3QJY A;  4GNX B;  4TRD A;  4LFB Q;  2DJF C;  2EYM A;  1BBW A;  3G6J B;  1WTW A;  1O7I A;  2Z8L A;  5FLX L;  2QEJ C;  5CV5 A;  1Y8O B;  1JMC A;  1Q1E A;  4MZ9 A;  4PZ7 A;  5J22 A;  2DNC A;  3GDE A;  4OWX B;  1EFI D;  3L0O A;  2CWP A;  1KNE A;  4XQN A;  4LFA L;  1V1Q A;  3I4L A;  3M4P A;  3PO2 G;  4LUO A;  1QCB D;  4IPD A;  4DUY Q;  3QB3 A;  5EBD A;  1LM0 A;  3R2T A;  4ZQ3 A;  1H9J A;  3OMC A;  1PRT C;  1ET6 A;  3L3O C;  2IL8 A;  5C4X H;  1J5E L;  1F2M A;  3HOW G;  2AUK A;  2B63 B;  1I6H H;  4QIW E;  4UP7 A;  2AWN A;  5CBA E;  1C7Y A;  3GTK H;  1I50 H;  3T13 A;  1J8I A;  4OXP A;  2VS1 A;  1X65 A;  1YNN D;  3S2D B;  1PYW D;  1TS3 A;  3CF5 A;  2UXB Q;  4B3M Q;  4LF7 L;  2PQA A;  3OTO L;  4DXF A;  4UP8 A;  2D2C C;  1OXT A;  5ELD A;  4ZK9 B;  1SYF A;  1M4V A;  1PRT F;  1V1O A;  2L4N A;  3BZC A;  2ZM6 L;  3VYS A;  3FMC A;  1UE5 A;  5C44 B;  1CK1 A;  4UY8 C;  4LF4 L;  5LMN Q;  1YHQ A;  4K0K Q;  2MQH A;  1DCZ A;  1SBB B;  1Q12 A;  4JOI A;  5J3B A;  1WD0 A;  1DOL A;  2R92 G;  2EYH A;  2QF7 A;  3MFG A;  1KDC A;  1YNN C;  2VUM H;  1M90 C;  1WTO A;  2CHB D;  2K4K A;  3HKZ B;  3LWU A;  1UE1 A;  2PYK A;  1D5X C;  3FEW X;  3KF6 B;  1KDB A;  1K8O A;  2A19 A;  1SYE A;  1ZEQ X;  1YNJ C;  2EY6 A;  2ZT9 C;  2YTY A;  1CHP D;  3I91 A;  4L5R C;  2JA8 B;  5KNB A;  2WIN B;  2Q8T A;  3PO2 B;  1GUN A;  3F8T A;  3T1H Q;  3I8Z A;  2WAQ G;  2Q2H A;  4BBS H;  1IBL Q;  1SSO A;  2QW7 A;  1SDF A;  2ZTE A;  4IQZ A;  4GN4 B;  1VQ5 A;  4B9X A;  1HFN A;  1Y1W B;  1KQS A;  4B9W A;  4G7Z C;  2AQ2 B;  4DV4 Q;  1SJE D;  5C4Z A;  1PDQ A;  4PV1 C;  4RG1 A;  1NAP A;  1HRJ A;  3TN2 A;  3C2P A;  1STY A;  2HT1 A;  2K7V A;  1PH9 A;  4LW1 A;  2SOB A;  2CQA A;  2NUC A;  2Q8R E;  1U4R A;  3GTJ B;  1FYC A;  1TWH B;  2NWG A;  1K8A C;  2E2J H;  1HNW L;  1AP0 A;  2IT1 A;  3PSI A;  1JJG A;  1V1P B;  4DKA C;  4K2L A;  1H9M A;  4X3T A;  3HRZ C;  1UAP A;  1EYC A;  4A3D H;  4APV A;  4K0K L;  3B6Y A;  3CPW A;  4LFB L;  2JA5 H;  4B3R L;  2ZXP A;  4NXN L;  4JI8 L;  4A3I G;  4GOP B;  2EJG C;  1SJH D;  1AW7 A;  2EYP A;  3MXG A;  2JA6 B;  2Z1C A;  3CRL C;  5D3D A;  4RGO S;  1XJV A;  2K1B A;  1M1K C;  3S17 H;  4J1M A;  4JC0 A;  4P71 A;  5C0X H;  5IYD H;  3VYR A;  1LYL A;  3G48 A;  1ONL A;  1BCP B;  3KJP A;  3FKI B;  5GAE C;  4F88 A;  1Q7Y C;  5E7N A;  3KJO A;  3S1R B;  2ZM6 Q;  3NEM A;  4YWM A;  3I73 A;  1SNM A;  4CHT B;  2JA6 G;  3KK7 A;  1N33 Q;  4XYQ A;  3QIA A;  2HIX A;  4LUV A;  5EPL A;  4F8M A;  1EU3 A;  4K2K A;  1XPU A;  1PTO C;  1PH8 A;  1SRU A;  1T5E A;  4DV4 L;  1HTP A;  3DM1 A;  2F1M A;  3MAQ A;  1XWE A;  3S1N B;  1SEB D;  5IP9 H;  4AQY L;  1ESR A;  4BBR B;  1STN A;  3NQT A;  2D9U A;  4FO2 A;  5CGK A;  2FMC A;  5DLQ E;  3MXN B;  3NP8 A;  2K32 A;  5KNC A;  2PI2 E;  3E0E A;  5JAV A;  2X6L A;  1HR0 Q;  1PYB A;  4G57 A;  4RKB A;  1EIF A;  1GO3 E;  4I7A A;  4F7X A;  4IFD I;  1V8Q A;  2R92 H;  1PH7 A;  2P5Z X;  3K0X A;  2E5L L;  2CQO A;  2I5M X;  2K52 A;  3KF6 A;  3S24 A;  4JI4 Q;  1B44 D;  1AE3 A;  3EQL C;  3J80 L;  3JAM E;  3S2D H;  2KHJ A;  3W1B A;  1VMP A;  4C2M B;  2IX3 A;  3MTS A;  1O7Y A;  1O80 A;  1T5X D;  2QKI C;  1JWS D;  1GUW A;  4BBS G;  3MZ5 A;  1H9R A;  3WWV A;  1BO0 A;  3URY A;  3JAM L;  5JJL A;  4K14 A;  1BKB A;  3I2Z A;  3HOU H;  3GTM B;  4CBV A;  1YVC A;  1F9P A;  1X55 A;  4JG2 A;  1CA6 A;  4A93 B;  1TWC H;  5T1G A;  3JAM c;  5HGT A;  1MKH A;  1QVF A;  1BVS A;  1TWG B;  3AFQ A;  1IL2 A;  1Y1V G;  5C4H A;  5TSS A;  3ITP A;  1MI2 A;  1JOQ A;  3BDO A;  4OX9 Q;  1W3S A;  3IRB A;  5IT9 c;  2K5H A;  1TS5 A;  4KHV A;  4A3F G;  4ZKB B;  1EY5 A;  4LF8 Q;  1TKW B;  5JJZ A;  1VQA A;  4QUF A;  3K57 A;  1QUQ B;  2AKW B;  5EPK A;  3W2D A;  5K36 G;  1EYD A;  2RHQ B;  4DPG A;  4A3I H;  4WJ3 M;  1SN8 A;  1EY0 A;  2B2W C;  3W3A A;  2B2T A;  3A56 A;  4JI3 L;  4O42 A;  1JE5 A;  2UXB L;  3J7A F;  4HCS A;  1OXS C;  4CJ2 C;  5M9O A;  4OGQ C;  3MC0 B;  4BY7 G;  3X3M A;  4FF4 A;  4X66 L;  5C44 G;  3G6E A;  2RKS A;  4XDX A;  2A73 B;  3KUP A;  4RMF A;  5ELF A;  3KBX A;  4IO9 A;  4NXM L;  1TR5 A;  2PQE A;  5ELC A;  2R92 B;  4YY3 Q;  4ME3 A;  3OHX C;  4CDD C;  2JA6 H;  1KIX A;  4JI5 Q;  2UUB L;  4AIM A;  4BBR G;  1SFO B;  4IPG A;  3GTM H;  1B9M A;  5DM7 3;  1A2U A;  4A93 H;  2A6E C;  3HOY H;  3M3Y B;  2R93 H;  2B63 H;  4BY7 B;  1C8C A;  1GJX A;  5JEA J;  1FJG L;  2EYF A;  3S1M B;  1RL2 A;  3I4M G;  3C3L A;  4IAL A;  1L1O C;  4C2M H;  1BBU A;  5LL6 X;  1S40 A;  2EXZ A;  4HSV A;  5FKA C;  3NEL A;  4QL5 A;  1VMC A;  2K04 A;  4C3I G;  1TWH H;  4B3S L;  2EDG A;  1Y8N B;  4DF7 A;  3KOJ A;  2SNM A;  5CR3 A;  1WCM H;  2JN4 A;  2NZO A;  4H02 A;  1LTT D;  1X3G A;  1IYU A;  4C3H H;  5C3E G;  2Z9H A;  2EYJ A;  2UUA Q;  1ZYR D;  4KK7 A;  3N6R A;  1Z6H A;  3OW7 A;  1PYS B;  1E7Z A;  5M3M B;  4IFD J;  1EWH A;  1J6Q A;  1VQI A;  4HCE A;  5C4J B;  4NPS A;  1EIY B;  3D3R A;  1N32 Q;  4KKU A;  2OXP A;  3GQB A;  2XNA C;  4JPB W;  4JBJ A;  4X3K A;  2XN9 C;  4K5X A;  1IW7 D;  3SK4 A;  2AQ1 B;  4DV3 L;  1VQL A;  2I5H A;  3NTI A;  3CCV A;  4QB4 A;  3K6O A;  1VQF A;  1GHJ A;  1XNQ L;  2NTT A;  3DXJ C;  4BXX H;  4ZYS A;  4EQP A;  2RSN A;  5M3F B;  3TME A;  4IJL A;  3H15 A;  5KIX A;  2UXC L;  3NTK A;  1Q90 A;  4DK1 A;  3ND9 A;  1D8L A;  1KLG D;  4WFN 3;  1YJ9 A;  1NUC A;  4G4K A;  4IUT A;  3AB9 A;  3K8A A;  2E76 C;  1I94 Q;  1JCK B;  3M4O B;  2LSS A;  2PNR C;  2Q2U A;  1Y1W H;  2PO4 A;  1UNS A;  2OT2 A;  1VDZ A;  1X6O A;  2WB1 B;  4HJ5 A;  1JJ2 A;  1L1O A;  1U5K A;  3S15 B;  1SNP A;  1GUT A;  4K8J A;  2AHO B;  1IZ6 A;  2R7F A;  2CVR A;  2JA8 H;  2WV6 D;  4DA2 A;  1GXD C;  1RTO A;  2XVS A;  2LS0 1;  1KAB A;  3J81 c;  1TVX A;  2NVY H;  4RGT A;  5AJ3 Q;  1EL0 A;  3GTQ B;  2N8N A;  2CWA A;  4A3G B;  4JI3 Q;  3E6Z X;  5IYC G;  3H3V C;  4RCO A;  1R4Q B;  2ZTC A;  1UEB A;  3SXH A;  4ZLT F;  3M4Y A;  3QG1 A;  4PZ6 A;  5IOD A;  1SE8 A;  1S5F D;  1IHZ A;  1K9M C;  4DR4 Q;  3VYU A;  1U0L A;  4RWS C;  1VQN A;  4IUU A;  4RGN A;  1SMY C;  5IGE A;  1XPR A;  5EKI A;  2LMC B;  4R4C A;  2NVQ B;  3J81 E;  2G5D A;  3K7A H;  1IBM L;  5IYB H;  1IKL A;  3H91 A;  3M9B A;  1A3T A;  3CQZ H;  1A15 A;  1TY0 A;  1NBW A;  1PRT B;  1ILQ A;  1K83 H;  3MVV A;  4IUV A;  1TWF B;  3MXP A;  5CV8 A;  3PF4 A;  1CZG A;  1FD7 D;  2RSO A;  4HJ8 A;  4UHV A;  2UU9 L;  4R1J A;  4C3J G;  4DNT B;  3RLF A;  1NR4 A;  5IY0 A;  3E9H A;  2Q8I B;  2Z6B A;  3NSW A;  2JEB I;  2RBM A;  2KEC A;  5C3W A;  3UDG A;  2L0C A;  1PFM A;  3R3O A;  4A3B B;  2X69 A;  2F0G A;  1STH A;  1QNU A;  2ZTD A;  4LF6 L;  1CSP A;  1B50 A;  5E1F A;  4A3L H;  5FK9 C;  2LXJ A;  1XNR Q;  3RUZ A;  3U50 C;  2KA7 A;  5C3X A;  3RMH A;  2PMZ E;  3CQZ B;  4DR2 L;  1G6Z A;  2B2W A;  3FPU B;  5LL6 S;  1F2L A;  3M85 A;  4R8N A;  2KBN A;  4OEM B;  1ENA A;  4G7O C;  4MN3 A;  3K7U C;  3E5S A;  4A3G G;  2MNA A;  3I4M H;  4BXX G;  4DUZ Q;  3VA5 A;  2EY2 A;  3WDN A;  4HIM A;  1OXV A;  4K6L A;  4L5T A;  2SEB D;  1S5D D;  2JEA I;  2A6E D;  2M9V A;  3HOY G;  2R93 G;  3P75 A;  3RLO A;  3A8K E;  3R93 A;  3CW2 C;  2C35 B;  1C48 A;  3RN5 A;  2GVA A;  2DNE A;  1CSQ A;  1HQM C;  5DM6 3;  2QDL A;  4L8J A;  3FKI H;  2J7Z A;  3ND8 A;  4GZY C;  2WKC A;  2N49 A;  2WKD A;  3D31 A;  5GAH C;  4A3E G;  4HIO A;  3FP9 A;  1PZK D;  1KAA A;  1RF2 D;  4LK1 C;  1PH3 A;  3TZU A;  2JA5 G;  5KEE A;  2H5X A;  4R4T A;  2HCC A;  1LAC A;  5ELE A;  4C3I B;  4FVM A;  4FDB A;  1PA6 A;  2Y0S E;  1ILP A;  1ZYR C;  4GN5 A;  4A3E H;  2NVX B;  3U58 A;  1D2B A;  5K5P A;  5M5X H;  2EVB A;  1D5Z C;  4FF1 A;  1LTI D;  2F4I A;  1Y14 B;  1CA5 A;  2F0V A;  2KCT A;  3TS0 A;  5D65 A;  2KED A;  2HD3 A;  2MGS A;  2M2L A;  4CDE C;  2RHS B;  4TVA B;  5CC4 A;  1ENF A;  4JI7 L;  2MJ8 A;  4DR7 Q;  5M3F H;  5EGT A;  1B4O A;  4JI2 L;  3T1H L;  2RDF A;  1NE3 A;  2K28 A;  2UUA L;  5AFW A;  1B70 B;  3AYH B;  1LTA D;  1RDP D;  5G3L D;  4NMZ A;  1I4G A;  3NK9 A;  4FXK C;  1Z7T A;  2IX0 A;  2JE6 I;  3A54 A;  4RH6 A;  4LFC Q;  2F0W A;  2K03 A;  5M5W H;  1DYQ A;  2L9H A;  4RFB A;  2A69 D;  4DAY B;  5IP7 G;  1QB5 D;  1N32 L;  1PVO A;  1X9N A;  5KRU A;  3OWF A;  4JI0 Q;  1FGU A;  2KJX A;  4XYO A;  2CW0 D;  3CCE A;  3A8J E;  1VQO A;  2R7Z H;  1FR3 A;  1BCP C;  5CYU A;  2O2L D;  1HFG A;  1VQH A;  1CUK A;  3Q23 A;  3S17 B;  3HZX A;  3I4N H;  3AFP A;  3J7A V;  1KD1 C;  2YTX A;  1H95 A;  4H13 C;  2D0O A;  1PH1 A;  4IUP A;  2B3G A;  1S5B D;  5JJI A;  2VXW A;  1CKN A;  4DUY L;  5ELN A;  4GS3 A;  2PZU A;  3S1Q B;  4HID A;  1SYC A;  4KJN A;  4PQX A;  2K5N A;  4YCV A;  1PH2 A;  4KMU C;  4B3S Q;  1FVI A;  3WOF A;  3CKI B;  1G29 1;  1X56 A;  1VQM A;  4YCW A;  2NVX H;  3S14 B;  1R9T H;  1XPO A;  3SK8 A;  1XNQ Q;  3OIQ A;  2B2Y A;  1WTP A;  4X3U A;  3SE0 A;  5I9O A;  4DAY A;  1EQV A;  2F0O A;  1JOR A;  4DUZ L;  3S1N H;  3K7A B;  1E1O A;  3NEN A;  4X64 Q;  3OTO Q;  4GKJ L;  1U9R A;  2KCN A;  2NBF A;  4R9W A;  1VQE A;  4DN4 M;  1CKM A;  4OX9 L;  1UE7 A;  4IUQ A;  1GUG A;  1I6V C;  3CMA A;  1HA6 A;  1KRS A;  3U4V A;  2E2I H;  1JOK A;  1XTD A;  4DU9 A;  5C44 H;  1HUN A;  4YWK A;  1X32 A;  2A68 D;  5CV9 A;  3HOX B;  3A5U A;  2EQS A;  4GLA C;  4QY7 A;  1D7Q A;  1F9Q A;  4BA1 I;  3J80 i;  2BA1 A;  4AYB G;  2EOT A;  3X3N A;  3R2I A;  2F03 A;  3UDX A;  4HJ9 A;  3I3C A;  2F0N A;  5EAY A;  3KFU A;  2JA9 A;  2NYZ D;  1JT8 A;  4DGZ A;  1YIJ A;  3ERS X;  1MHW C;  3UDF A;  2E2D C;  5KYL A;  5I9P A;  3OW2 A;  2KHS A;  3I72 A;  1STG A;  4HR7 B;  1EY8 A;  1MIU A;  3K59 A;  3SGI A;  4WJW A;  3Q24 A;  1A3U A;  2IHE A;  1S72 A;  4DR5 Q;  1WTH A;  2Z4I A;  1H9K A;  1KAW A;  4R4Q A;  4PG3 A;  3J81 i;  2YYZ A;  4M8A A;  4A3G H;  1OO9 B;  2GA4 B;  2N3S A;  2E8G A;  3A5Z B;  3D0F A;  5DEH A;  1D1K A;  2F0T A;  1HZ9 A;  1HPC A;  4H0L C;  4KLK A;  2XIW A;  4IN3 A;  1WTQ A;  1H9S A;  3RN2 A;  3TP5 A;  2KQ3 A;  1CHQ D;  4FF2 A;  3S1M H;  1D1I A;  3K5L A;  2XSC A;  1G6P A;  1PZI D;  4A3J H;  1JR0 D;  1N36 Q;  2IHF A;  1HZC A;  2D5D A;  1EU4 A;  1YNX A;  2PPB C;  1VQ8 A;  2EE1 A;  1EUJ A;  4XXE A;  1VF7 A;  3HOX H;  5T1I A;  1HCZ A;  2IWH A;  2F0L A;  2L1B A;  1HJP A;  2KUM A;  1TT2 A;  4H7B A;  1Q8K A;  1I4X A;  1SAP A;  2WII B;  4U68 A;  4C3J H;  1FNW A;  2HHH Q;  4IFD G;  2FJ2 A;  1B3A A;  2WAQ E;  4BWG B;  4A3E B;  4RHR A;  2QDB A;  1A8V A;  4EQO A;  2JYO A;  2WAC A;  1B53 A;  3K5O A;  1B1Z A;  4I65 A;  5D14 A;  3CU7 A;  4DV5 L;  1A0I A;  4KN4 C;  4YCU A;  1DJR D;  5FO8 B;  1Y1W G;  4KV6 A;  4ULL A;  3OPO A;  1B8A A;  4A93 G;  1F9R A;  2RF4 A;  2R61 A;  4A76 A;  2B8G A;  2HIV A;  5M5Y H;  1SE2 A;  1EYA A;  4HN7 A;  1Q1B A;  1QE6 A;  1Q8I A;  1STA A;  2MPM A;  2PI2 A;  3T56 B;  4L6T B;  1WJJ A;  2CH4 A;  2MUY A;  1RHP A;  4A3F B;  3C1F A;  5I2Y A;  2KEE A;  1QVC A;  3HOV H;  3VYT A;  2PMZ B;  2EY5 A;  4KHP L;  4X64 L;  2R6G A;  4LFA Q;  5IYD G;  2Z6K A;  4CKC A;  5C0X G;  3Q8D A;  5LHY 1;  2D0P A;  1QWY A;  1SYG A;  4A3M H;  1V9P A;  1VQD A;  2E2H H;  1GD7 A;  3PO2 H;  1O7L A;  1EZ8 A;  3BDC A;  3S16 B;  1GKH A;  4MNO A;  1PRT D;  1TS2 A;  4R4O A;  4S3S A;  4A3B G;  2IW3 A;  1EFW A;  1DOK A;  3S9W A;  3BS1 A;  3NUC A;  1B3Q A;  2VZA A;  4HJ7 A;  2VUM G;  4FXG C;  3DWP A;  1EIG A;  3FRP B;  5FJ8 H;  3STB C;  2F0M A;  4A3J B;  5I6W A;  1ICF B;  1U4M A;  4A3K G;  4DV0 L;  3FKI G;  4JI6 Q;  3CHB D;  4CKE A;  1HNX Q;  1TWG H;  1YHA A;  3PV0 A;  2QA4 A;  1K0S A;  1LLR D;  1SRO A;  4JBM A;  2BDN A;  3EBE A;  3LX0 A;  2K33 A;  3UI2 A;  1WI5 A;  1UUP A;  1OXU A;  4WOR A;  3TRZ A;  3S14 H;  5LMU Q;  1I6H B;  2JA7 G;  1ASZ A;  5KND A;  2L55 A;  4UDU C;  3EJI A;  5BR8 L;  3QOL A;  4POG A;  1FNV A;  3CC7 A;  2CCZ A;  3K5N A;  2LXK A;  5IGB A;  1O7Z A;  3STB D;  2E2J B;  1F2Z A;  2XTI A;  2RCN A;  1YZ6 A;  3HOV B;  5CMD A;  4K5V A;  1JOO A;  3I4M B;  4LF5 Q;  3TP6 A;  4A3K H;  3VA7 A;  2YTV A;  1K83 B;  2SDF A;  3DUZ A;  5HUR A;  3CC4 A;  3S2H H;  3M3Y H;  3OSO A;  4XQQ A;  5C3E H;  1CZW A;  1VQB A;  3VR4 A;  4ABN A;  1LO5 D;  2G9H D;  3VR5 A;  4JI1 Q;  2Z6K C;  3T1Y Q;  1AFP A;  4CKB A;  1KDA A;  1XNR L;  4GKJ Q;  2NN6 H;  4JK1 C;  3A0J A;  2JA8 G;  1STB A;  2A8V A;  2E2I B;  2DUD A;  3HS0 C;  3D6W A;  3DHQ A;  4UPA A;  2IX1 A;  2F0E A;  2C5C A;  2UU9 Q;  1PXU A;  1TII D;  3TSS A;  1HR0 W;  3PO3 B;  2NVQ H;  4JI5 L;  3L7Z C;  4KN7 C;  5IGC A;  4X66 Q;  2D62 A;  1XMO L;  3BDL A;  4A3J G;  3P20 A;  5CV4 A;  2E74 C;  1HZB A;  4LF9 L;  2UUC Q;  4GKK Q;  3KF8 B;  3PQI A;  2NB0 A;  3PCO B;  2H1E A;  3BYT B;  1BR9 A;  3TP8 A;  4Q5V A;  3CC2 A;  3KLR A;  1Z47 A;  3HOZ B;  1X3E A;  2Q2T A;  2A1A A;  3JAM i;  4BY1 B;  1DM0 B;  1YHB A;  5EKK A;  1QIL A;  4NXM Q;  5IT9 L;  5C4X G;  2F4V Q;  4GOP A;  4ILW A;  1VQ6 A;  2VQF Q;  3S2H B;  4BY1 H;  3LNN A;  2NN6 I;  2H4O A;  1HNX L;  1HNW Q;  4RCN A;  4IFD H;  2C9O A;  1SNO A;  3I55 A;  1MSH A;  1TS4 A;  4QJF A;  5M5W B;  1W6J A;  2K05 A;  1GM5 A;  4L63 B;  1CQV A;  2L15 A;  5C4J H;  3NBH A;  4HJA A;  1SE4 A;  2VL6 A;  4KKT A;  5IWA L;  4A3M G;  1NJI C;  4ID6 A;  5EBC A;  4GN3 B;  3GTG H;  1N33 L;  4K8I A;  1BCP F;  1MGS A;  4X65 L;  4A75 A;  1NSN S;  3KYH C;  3FHW A;  3PIP 3;  1WFQ A;  2B2U C;  1XMO Q;  4A3C H;  5JEA H;  1AZP A;  1E1T A;  2J4X A;  2O5J C;  3J81 L;  1ENC A;  4N9P A;  3NWT A;  1OXX K;  1P16 A;  2EJF C;  3V2T A;  2HQL A;  4LNQ A;  5LMU L;  3SK6 A;  4JI0 L;  1DZ1 A;  3ERQ A;  5ELO A;  1P8L A;  1RCV D;  3DMU A;  1QG7 A;  5C0X J;  3V96 A;  3RZD H;  2B63 G;  4BBR H;  2RDG A;  3RZO B;  3H3V H;  4DV5 Q;  1TU2 B;  1WD1 A;  1VQ7 A;  4P2C B;  5BN3 A;  1XX8 A;  3VR2 A;  4A3I B;  4X3S A;  1G51 A;  1E2V A;  5E4X A;  3GTO B;  1G2T A;  4KI0 A;  4AYB B;  3BU2 A;  4YWL A;  2KCC A;  4LUZ A;  2E2H B;  1V43 A;  3UDI A;  3NE5 B;  1GOZ A;  3P1H A;  3GTO H;  1BOS A;  3V05 A;  4E6I A;  1E22 A;  2K5V A;  3GTP B;  1YBY A;  3MWY W;  5FOB B;  4IZ8 A;  1LTS D;  3F2U A;  4BBS B;  4EGV A;  1E0B A;  4O0A A;  3NTH A;  5AJ3 L;  4EQN A;  3K81 C;  4V0B A;  2B2V A;  2VUM B;  3P7J A;  2TMP A;  5EPJ A;  2FHT A;  1NMG A;  1VQ9 A;  1LV9 A;  1G2S A;  5F2D A;  5COR A;  1IL8 A;  3RNU A;  4HED A;  2Y0S B;  1SND A;  3I4O A;  4JI2 Q;  1Y1V H;  3SHL A;  4A3K B;  1K8G A;  1I5F A;  1RJT A;  2F0H A;  2CW0 C;  3KLS X;  3CCQ A;  2RVL A;  3D4D A;  2XWJ B;  1EQT A;  2DY8 A;  3DWQ A;  3MEH A;  2YU9 B;  3L9A X;  4KJO A;  5COY A;  4LFC L;  1CKN B;  4X62 Q;  3NQI A;  2NVT H;  5IP7 H;  3RZO H;  4X65 Q;  2R7Z B;  1QOH A;  3EA6 A;  4C56 C;  4KHP Q;  1HQR D;  4U67 3;  2NVT B;  2CH4 W;  1N9W A;  3GTQ H;  4P73 A;  1AZQ A;  1IKM A;  1IYV A;  3GD7 A;  5BN4 A;  2AWO A;  4EVO A;  1L0X B;  1SMX A;  5DAU A;  3PMF A;  2VQF L;  1BBX C;  3H3V I;  4DR4 L;  4L5S A;  5KYI A;  1RD9 D;  1EEF D;  4JW0 A;  1LT6 D;  4XT3 B;  2UUB Q;  3D4W A;  3HP3 A;  3GO5 A;  4NP5 A;  1ICW A;  3U9O A;  3SVM A;  4LF6 Q;  2DN8 A;  1IBM Q;  1VQK A;  3ICE A;  2MFI A;  2O4X A;  2OQ0 A;  1LT3 D;  1A63 A;  2F3V A;  4EX5 A;  1OTC A;  4FF3 A;  4ZUJ A;  1LUZ A;  2PW7 A;  3U4Z A;  4DV7 Q;  4OWW B;  3GV3 A;  4PMB A;  5C3E B;  4PMW A;  2A6H D;  2F52 A;  2WFW A;  4DV6 Q;  2B8F A;  2I07 B;  2IY5 B;  4JCV E;  2QEX A;  4QQB X;  4B3T L;  4TKO B;  2ES2 A;  4JI1 L;  3T1Y L;  2K75 A;  1N34 L;  1C0A A;  2B39 A;  1N8R C;  5M5X B;  2TSS A;  4OON A;  4DAM A;  3CCJ A;  2JK8 A;  4IUN A;  1PH5 A;  4OO1 G;  3F2B A;  3QWN A;  2RA4 A;  3DEO A;  1JC7 A;  1SNC A;  4DR2 Q;  1LTG D;  1WYD A;  2Z4H A;  1LT4 D;  1UEA B;  2F0Q A;  2Z0S A;  2RCF A;  1EY9 A;  4DR6 Q;  2I5L X;  4KHZ A;  2CKZ B;  3PUX A;  1S3O A;  2LFN A; 
#chains in the Genus database with same CATH homology
 3SGI A;  4LF8 Q;  1HR0 L;  4BY1 G;  3PF5 A;  2IHE A;  2OTL A;  1S72 A;  1VQA A;  4YY3 L;  4DR5 Q;  4HIK A;  4B3T Q;  1QUQ B;  2AKW B;  5K36 G;  2RHQ B;  4IJH A;  4DPG A;  1KAW A;  4R4Q A;  1SN8 A;  4PG3 A;  2ALY B;  5IP9 G;  3J81 i;  4A3I H;  1HNZ Q;  4A3B H;  3S1Q H;  4OO1 I;  1IXR A;  2YYZ A;  2PNH A;  4DV2 L;  1YIT A;  1YJW A;  3HOW H;  2QGQ A;  3CCL A;  4A3G H;  1GVP A;  4JI3 L;  2N3S A;  2E8G A;  3G71 A;  2UXC Q;  1JE5 A;  3A5Z B;  3D0F A;  4DV1 Q;  4IOA A;  2UXB L;  1OXS C;  5LMN W;  1X54 A;  1HZ9 A;  3RR5 A;  3CCR A;  4GNX C;  4KLK A;  1KHI A;  4Y7N H;  4BY7 G;  2PQA B;  5M3F G;  3RN2 A;  4JV5 Q;  3DM3 A;  2ZJQ A;  4X66 L;  5C44 G;  3G6E A;  1PV4 A;  3S1M H;  1G6P A;  2NN6 G;  4A3J H;  3CXC A;  4A3L G;  4RMF A;  4IO9 A;  1N36 Q;  2IHF A;  3TQY A;  1HZC A;  4NXM L;  1XMQ Q;  1QZG A;  4YY3 Q;  4DR5 L;  4TQU S;  1YNX A;  4ME3 A;  2JA6 H;  1VQ8 A;  4POF A;  5FJ8 G;  1KIX A;  4JI5 Q;  3TEH B;  4AIM A;  4BBR G;  3CME A;  2UUB L;  1EUJ A;  4IPG A;  3GTM H;  3HOX H;  1IBK L;  1Q46 A;  2OQK A;  1HJP A;  3L2P A;  4A93 H;  3HOY H;  2R93 H;  2B63 H;  4B3R Q;  1NY4 A;  1Q8K A;  2HHH Q;  4C3J H;  3KLW A;  1SR3 A;  1JB7 A;  1VCI A;  5JEA J;  3BJU A;  1SLJ A;  3PIP A;  3F2C A;  1FJG L;  2WAQ E;  4IFD G;  1RL2 A;  2VW9 A;  3I4M G;  1A8V A;  4P72 A;  3PUV A;  1L1O C;  4C2M H;  1BBU A;  1S40 A;  1QUQ A;  3F1Z A;  3NEL A;  4P74 A;  4QL5 A;  5M3M G;  1PFS A;  4DV5 L;  1TWH H;  3E9I A;  4JOI C;  1A0I A;  4B3S L;  4A3C G;  5C0X I;  2VNU D;  3KOJ A;  4YCU A;  1Y1W G;  3HKS A;  2YU9 H;  2GVB A;  4MTN A;  1VS0 A;  1B8A A;  1WCM H;  5FLX c;  4A93 G;  2ASB A;  2NZO A;  2RF4 A;  1X3G A;  4H02 A;  3I56 A;  4GNX A;  4A3D G;  4XIG S;  3GTJ H;  4C3H H;  5C3E G;  4A76 A;  4DV6 L;  1E24 A;  2CFM A;  2EIF A;  2HIV A;  3PUW A;  2YV5 A;  5M5Y H;  4YHH L;  2UUA Q;  2I0Q A;  1B7Y B;  1KL9 A;  1Q1B A;  5IYC H;  1MJE A;  3PUZ A;  1PYS B;  1FL0 A;  3W5O A;  1E7Z A;  2PI2 A;  4JI6 L;  1N34 Q;  1Q86 C;  1WJJ A;  3ER0 A;  5BR8 Q;  4IFD J;  4JI4 L;  3PIO A;  4X62 L;  3PO3 G;  1J6Q A;  1QVC A;  1VQI A;  3HOV H;  3I4N G;  4KHP L;  4NPS A;  4X64 L;  2R6G A;  4LFA Q;  5IYD G;  2VY3 A;  1TWA H;  2Z6K A;  1EIY B;  4GLX A;  5H1S E;  5C0X G;  3Q8D A;  1N32 Q;  3H0G H;  5GQO A;  4JBJ A;  2KEN A;  5M3M H;  5IE8 A;  1DGS A;  2D0P A;  1QZH A;  4DV3 L;  1VQL A;  2I5H A;  2KCM A;  1V9P A;  4A3M H;  3CCV A;  1VQD A;  1VQ4 A;  2E2H H;  1KXL A;  1GD7 A;  3PO2 H;  1VQF A;  5GRO A;  1XNQ L;  1GKH A;  4MNO A;  4JBK A;  4BXX H;  4R4O A;  4DNI A;  5HGQ A;  4A3B G;  1IBL L;  1L2F A;  1JJC B;  5LMN L;  1EFW A;  3PO3 H;  3J7Z C;  4DR7 L;  1VQG A;  4IJL A;  4GOP C;  1SFO H;  4A4I A;  3H15 A;  2UXC L;  3S15 H;  2VUM G;  2VZA A;  1KRT A;  4JI8 Q;  4HJ7 A;  4NXN Q;  1D8L A;  1PH6 A;  3TRE A;  4IPC A;  1L1O B;  5FJ8 H;  1YJ9 A;  3CP0 A;  3STB C;  3K8A A;  2UXD Q;  1I94 Q;  4A3K G;  4DV0 L;  3FKI G;  4JI6 Q;  3AEV A;  1RIP A;  2LSS A;  3VDY A;  3EN2 A;  2Q2U A;  1HNX Q;  4LF7 Q;  1Y1W H;  1TWG H;  3G4S A;  1YHA A;  3PV0 A;  2JQO A;  1X6O A;  2QA4 A;  4HJ5 A;  2WB1 E;  4DR6 L;  1JJ2 A;  1HH2 P;  1L1O A;  1EWI A;  1SRO A;  1U5K A;  2F3I A;  2XGT A;  4JBM A;  4LF8 L;  4BA2 I;  3EBE A;  1C9O A;  4O2D A;  2BH8 A;  2MO1 A;  2R7Z G;  1WI5 A;  1UWV A;  1LTL A;  2JJQ A;  4QGU A;  1OXU A;  4AH6 A;  2AHO B;  3PGZ A;  1IZ6 A;  2R7F A;  3S14 H;  5LMU Q;  4DR1 Q;  3TRZ A;  2JA8 H;  2JA7 G;  1ASZ A;  3J81 c;  3HKZ G;  2NVY H;  5AJ3 Q;  5BR8 L;  1TXY A;  2N8N A;  2CWA A;  4X6A H;  1Q82 C;  4POG A;  4JI3 Q;  1K73 C;  3NBH B;  4DV0 Q;  3CC7 A;  1AE2 A;  2E5L Q;  5IYC G;  2CCZ A;  4JYA Q;  2LXK A;  2ZTC A;  3STB D;  2XTI A;  1UEB A;  2RCN A;  3H0G G;  2GN5 A;  1YZ6 A;  1EOV A;  5FLM H;  1T9H A;  4LWC A;  3AQQ A;  4PZ6 A;  1SE8 A;  4LF5 Q;  4JV5 L;  2BH2 A;  4A3K H;  4UP9 A;  1K9M C;  4ALP A;  2YTV A;  4DV7 L;  4DR4 Q;  5FLM G;  1U0L A;  1VQN A;  4GLV B;  1TWF H;  3MEF A;  3CC4 A;  3CCM A;  1XPR A;  1PH4 A;  3S2H H;  3M3Y H;  3M7N A;  5C3E H;  3OYY A;  3S16 H;  2OCE A;  1IBK Q;  1I3Q H;  4R4C A;  1VQB A;  4GNX B;  3K7A H;  1IBM L;  4LFB Q;  3ULP A;  1BBW A;  4JI1 Q;  2Z6K C;  3T1Y Q;  5IYB H;  1O7I A;  1XNR L;  3M9B A;  2NZH A;  1JMC A;  4GKJ Q;  3A0J A;  1Q1E A;  4MZ9 A;  4PZ7 A;  2JA8 G;  3GDE A;  2A8V A;  4OWX B;  3CQZ H;  3L0O A;  2CWP A;  2DUD A;  5HY6 A;  1V1Q A;  3M4P A;  4LFA L;  1NBW A;  5IYB G;  4LUO A;  3PO2 G;  4DUY Q;  4IPD A;  1K83 H;  3UE1 A;  1LM0 A;  4WJ4 A;  4R4I A;  4UPA A;  3PF4 A;  2IX1 A;  4HJ8 A;  2UU9 Q;  2UU9 L;  4R1J A;  1HR0 W;  2NVQ H;  5C4X H;  1J5E L;  3LGJ A;  3L7Z C;  4JI5 L;  4AQY Q;  3HOW G;  3RLF A;  5IY0 A;  4X66 Q;  2D62 A;  1Z9F A;  3E9H A;  1XMO L;  4QIW E;  1I6H H;  4UP7 A;  2AWN A;  1N36 L;  4A3J G;  2JEB I;  5IWA Q;  1HZB A;  1C7Y A;  2UUC Q;  4LF9 L;  3GTK H;  1I50 H;  4GKK Q;  2ID0 A;  3KF8 B;  1VQJ A;  3UDG A;  1UE6 A;  1K3R A;  3PCO B;  4NB3 A;  4OXP A;  2VS1 A;  4EQ5 A;  1X65 A;  4DV2 Q;  3CC2 A;  1Z47 A;  2ZTD A;  1X3E A;  3CF5 A;  2Q2T A;  4LF6 L;  1CSP A;  2A1A A;  4AYB E;  3JAM i;  4DR3 Q;  2UXB Q;  1W2B A;  4A3L H;  2LXJ A;  1XNR Q;  1YHB A;  4B3M Q;  1WCM G;  2PQA A;  3OTO L;  1NTG A;  4LF7 L;  3U50 C;  2AMC B;  4NXM Q;  4UP8 A;  3TS2 A;  5C4X G;  2PMZ E;  4DR2 L;  4GOP A;  2F4V Q;  1EQR A;  2UXD L;  1VQ6 A;  1OXT A;  2VQF Q;  4WJ3 M;  2WP8 J;  3M4Q A;  4BY1 H;  4IPH A;  2ZJR A;  2NN6 I;  3M85 A;  1HNX L;  2KBN A;  4Y52 H;  3BZC A;  2ZM6 L;  1IYJ B;  3K7U C;  3GTP H;  1HNW Q;  3I55 A;  4A3G G;  4QJF A;  4XTC S;  2MNA A;  2OWO A;  1UE5 A;  4DUZ Q;  2K14 A;  3I4M H;  4BXX G;  2WB1 G;  3HOZ H;  4HIM A;  1OXV A;  1GM5 A;  4L5T A;  4UY8 C;  2L15 A;  5C4J H;  4LF4 L;  4HJA A;  5LMN Q;  2JEA I;  1YHQ A;  2VL6 A;  4K0K Q;  3ULJ A;  5IWA L;  2MQH A;  4A3M G;  1NJI C;  1Q12 A;  4JOI A;  5J3B A;  3HOY G;  2R93 G;  2DGY A;  1EQQ A;  2R92 G;  3RLO A;  5JJK A;  3ZJY C;  4GN3 B;  3GTG H;  3CW2 C;  2C35 B;  1N33 L;  3RN5 A;  1A62 A;  2GVA A;  2VUM H;  1CSQ A;  1M90 C;  4X65 L;  3JC6 6;  4A75 A;  5GAG C;  3J7A 5;  2K4K A;  3KYH C;  3FHW A;  3FKI H;  1UE1 A;  3KF6 B;  1WFQ A;  2A19 A;  3J80 c;  1VQP A;  2N49 A;  5GAH C;  3D31 A;  4A3E G;  4HIO A;  3FP9 A;  2YTY A;  4BY7 H;  4L5R C;  1PH3 A;  1XMO Q;  2JA5 G;  4A3C H;  1WOC A;  1E3P A;  1HZA A;  2H5X A;  4R4T A;  1E1T A;  3F8T A;  3T1H Q;  1NMF A;  3GTL H;  4FDB A;  1PA6 A;  4JBW A;  2WAQ G;  2Y0S E;  2Q2H A;  3BZK A;  4BBS H;  1IBL Q;  1OXX K;  1P16 A;  4GN5 A;  4A3E H;  2HQL A;  4LNQ A;  3J81 j;  2ZTE A;  5LMU L;  4DR1 L;  3U58 A;  4GN4 B;  1YI2 A;  1VQ5 A;  4JI0 L;  1KQS A;  5ELO A;  5M5X H;  1P8L A;  4DV1 L;  4L5Q A;  5C0X J;  4DV4 Q;  3RZD H;  2B63 G;  4RG1 A;  4BBR H;  1Y14 B;  3H3V H;  4DV5 Q;  2HT1 A;  3HOX G;  3ULL A;  1PH9 A;  2KCT A;  3TS0 A;  1VQ7 A;  2N78 A;  4LW1 A;  2BA0 A;  1G51 A;  2RHS B;  4TVA B;  4KI0 A;  3BU2 A;  4YWL A;  1K8A C;  2E2J H;  4JI7 L;  4DR7 Q;  1HNW L;  4LUZ A;  5M3F H;  2IT1 A;  3PSI A;  3HOZ G;  1V43 A;  3UDI A;  4JI2 L;  3T1H L;  1JJG A;  1NE3 A;  4DKA C;  2UUA L;  2Q2I A;  3K80 C;  1B70 B;  4IOC A;  3AYH B;  3GTO H;  1Q81 C;  3HOU G;  4A3D H;  4APV A;  5JEA G;  3B6Y A;  1E22 A;  4K0K L;  2K5V A;  2IX0 A;  2JE6 I;  3CPW A;  4LFC Q;  4LFB L;  1YBY A;  2JA5 H;  4B3R L;  5M5W H;  4NXN L;  4JI8 L;  4DAY B;  4GOP B;  5IP7 G;  4A3I G;  2JA7 H;  1N32 L;  1FJG Q;  1PVO A;  1X9N A;  5AJ3 L;  4O0A A;  4JI0 Q;  1FGU A;  3K81 C;  3CCE A;  1AH9 A;  3CD6 A;  1VQO A;  2R7Z H;  1XJV A;  3KDF A;  3F2D A;  1NMG A;  1M1K C;  1VQ9 A;  3S17 H;  1EYG A;  4JC0 A;  4P71 A;  1HNZ L;  1VQH A;  1CUK A;  3RNU A;  5IYD H;  1LYL A;  3I4O A;  3G48 A;  1Y1V H;  4JI2 Q;  4DV3 Q;  1YJN A;  3S1R H;  3KJP A;  1K8G A;  3I4N H;  3AFP A;  1I5F A;  5GAE C;  3HKZ E;  3HFZ B;  1Q7Y C;  2YTX A;  5E7N A;  3CCQ A;  3KJO A;  1KD1 C;  1H95 A;  2D0O A;  1PH1 A;  2ZM6 Q;  3NEM A;  4YWM A;  4A3F H;  3CCS A;  3CPF A;  4LFC L;  1CKN B;  4X62 Q;  2B3G A;  1L0W A;  2JA6 G;  5IP7 H;  1N33 Q;  4J15 A;  2NVT H;  5JJI A;  1CKN A;  3RZO H;  4DUY L;  5ELN A;  2HIX A;  2R7D A;  4LUV A;  1I94 L;  4GS3 A;  3W1G A;  4X65 Q;  3RLN A;  1XPU A;  4OWT B;  4HID A;  1PH8 A;  1SRU A;  2VQE Q;  4DV4 L;  2KHI A;  4LF5 L;  4KHP Q;  3CCU A;  2K5N A;  1YEZ A;  5IP9 H;  4DR3 L;  1XMQ L;  4YCV A;  1N9W A;  4AQY L;  3GTQ H;  4P73 A;  1PH2 A;  4B3S Q;  3GD7 A;  1MJC A;  1FVI A;  2AWO A;  4C3I H;  1SMX A;  5DLQ E;  3MXN B;  3KDF B;  4JI7 Q;  1G29 1;  2PI2 E;  1X56 A;  3E0E A;  1KC8 C;  2VQF L;  4YCW A;  1VQM A;  1HR0 Q;  1R9T H;  2NVX H;  1XPO A;  1XNQ Q;  3H3V I;  4DR4 L;  4L5S A;  1PYB A;  2UUB Q;  1EIF A;  1GO3 E;  4IFD I;  4LF4 Q;  3I7F A;  2B29 A;  2V1C C;  1CKO A;  3GO5 A;  3UE0 A;  5GAD C;  4YHH Q;  2R92 H;  1PH7 A;  3HOV G;  4P75 A;  2OTJ A;  1K0R A;  4DUZ L;  2ZJP A;  4LF6 Q;  3K0X A;  4LF9 Q;  3S1N H;  4GKK L;  1IBM Q;  1E1O A;  1VQK A;  2K50 A;  2MFI A;  3NEN A;  3CAM A;  4X64 Q;  3ICE A;  2OQ0 A;  2E5L L;  2HHH L;  3OTO Q;  1A63 A;  4GKJ L;  2CQO A;  4EX5 A;  2I5M X;  2K52 A;  3KF6 A;  3S24 A;  1OTC A;  1LUZ A;  4JI4 Q;  1VQE A;  4OX9 L;  1CKM A;  1UE7 A;  1AE3 A;  4DK3 C;  3CMA A;  3U4Z A;  3S2D H;  4DV7 Q;  4OWW B;  1KRS A;  3U4V A;  3EIV A;  2KHJ A;  3W1B A;  1X3F A;  3DLL A;  2E2I H;  4PMW A;  1XTD A;  2F52 A;  2WFW A;  5C44 H;  4DV6 Q;  2FXQ A;  4YWK A;  2UUC L;  1J5E Q;  2ATW A;  3A5U A;  2EQS A;  4GLA C;  2IY5 B;  4JCV E;  2QEX A;  4QY7 A;  1PHJ A;  1D7Q A;  4QQB X;  4BA1 I;  4BBS G;  3J80 i;  3A74 A;  4B3T L;  3WWV A;  2ES2 A;  4JI1 L;  3T1Y L;  2K75 A;  1N34 L;  1C0A A;  2BA1 A;  4AYB G;  5JJL A;  1N8R C;  1BKB A;  3I2Z A;  3HOU H;  4DK6 C;  4OON A;  4DAM A;  3CCJ A;  2JK8 A;  1YVC A;  3UDX A;  1X55 A;  4JG2 A;  4HJ9 A;  3PUY A;  1PH5 A;  4OO1 G;  3F2B A;  1TWC H;  3M4O H;  3JAM c;  1MKH A;  5EAY A;  2EXD A;  1QVF A;  2JA9 A;  3KFU A;  2MO0 A;  2Y0S G;  1WYD A;  1BVS A;  2VQE L;  4PZ8 A;  4DR2 Q;  2F4V L;  1JT8 A;  1YIJ A;  3AFQ A;  1ASY A;  3ERS X;  3UDF A;  1Y1V G;  2Z0S A;  1IL2 A;  4JYA L;  4B3M L;  3OW2 A;  1VQC A;  4DR6 Q;  2I5L X;  1QVG A;  4OX9 Q;  1W3S A;  3IRB A;  5IT9 c;  4KHZ A;  2K5H A;  2CKZ B;  3PUX A;  1S3O A;  4A3F G;  1MIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...