2YU9H

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yu9H00
3PO2G 4DAYB 4A3FG 1YNXA 1VQBA 3NENA 4C3JH 4A3EH 1XPOA 4C3IH 2PI2A 2GVBA 4A3JG 2YU9H 1XNRQ 5LMUQ 2NVQH 4R4IA 2R7ZG 1UE1A 4X65Q 3CD6A 4KHZA 4R4OA 1EOVA 1PH8A 3GDEA 3PSIA 3KJOA 3ZJYC 4LFCQ 4GKJL 3U4ZA 5GAGC 1YI2A 1QUQA 4J15A 1E7ZA 4R4TA 4A4IA 4LF6Q 1P8LA 1IZ6A 4JI1Q 2UU9L 4GS3A 2CFMA 1BKBA 5IP7H 1HR0W 4GKKL 1I5FA 4JYAL 1KXLA 1SN8A 5ELOA 2R93H 2D62A 5JJIA 1D7QA 3RLNA 3BZKA 2Q2UA 3PIPA 1N9WA 4IPGA 2C35B 3RN2A 3HKZE 4OO1I 5M3FG 1IBKL 1ASZA 3S15H 4JV5L 4PMWA 1XMOL 4QGUA 4R4CA 2MNAA 4X62L 3B6YA 3BU2A 1QVFA 4IOCA 1XTDA 3HOVH 3KYHC 4GLXA 1VQFA 4DV0L 4OX9L 2GVAA 4LUOA 3IRBA 4BBRG 4YY3Q 4H02A 2KHJA 2ZTDA 2R7DA 1NJIC 3CXCA 4EQ5A 3GTKH 4HIDA 2L15A 4IOAA 5JJLA 2JA8H 3PO3H 1N34L 2JE6I 2UXCQ 1YHAA 2UXBQ 1JB7A 1HZ9A 4YCUA 2PMZE 1QUQB 5FLMG 3HOWH 2I5HA 1A63A 1MJEA 1Z47A 4L5RC 2VNUD 3ERSX 1KC8C 5IP7G 2QGQA 3PIOA 1EYGA 1IYJB 1N33Q 2F4VQ 1XMQQ 4DK6C 1E24A 3FHWA 3CCUA 3U4VA 1SFOH 3CC2A 3J81j 4KLKA 4DNIA 4JI6Q 2IY5B 3FKIG 3EN2A 4QQBX 1K8AC 4FDBA 4DV1Q 4QIWE 3CMEA 3FKIH 4JC0A 3CCEA 1IBKQ 4JBKA 4WJ4A 1OXXK 1SMXA 1O7IA 2JA5H 3PUYA 1JMCA 5K36G 2B63G 1VQEA 5BR8L 1XPUA 4KHPL 2V1CC 1XNQL 3K80C 3LGJA 3WWVA 4A3FH 1YBYA 2PQAA 2N8NA 4OONA 3RZOH 1TWCH 2WFWA 1PA6A 1XPRA 3S24A 4JOIA 3T1HQ 1N36L 4DR5L 3HKSA 4A3MH 3CQZH 1HNZQ 4K0KQ 1PVOA 1NMFA 2H5XA 3GD7A 4X66L 3E0EA 4DKAC 3I4NH 2EQSA 1PH4A 3M4OH 4DR4Q 4IJHA 4XIGS 2JEAI 2MO1A 1A62A 1SRUA 1IL2A 3S1NH 4B3RL 4JI6L 2IT1A 3STBD 1J5EQ 1C9OA 1L0WA 5E7NA 4P71A 4AYBG 1TWFH 2B3GA 2D0PA 2MQHA 1K8GA 5C0XG 4YCVA 2K75A 2YTVA 3NBHB 4NXNQ 1NMGA 5GROA 2UUBQ 4A93H 2Z6KA 3HKZG 3S17H 2NVXH 2E2JH 1VQLA 4BY7G 1OXVA 4DV6L 2AWOA 3KFUA 3HFZB 3JC66 1Q86C 2HHHL 1AE2A 1Q81C 1B8AA 3D31A 4DPGA 2NN6I 1EFWA 4A75A 1C7YA 2BH2A 1K73C 1BBUA 3I7FA 3H0GH 4DR4L 1P16A 1X54A 2IX0A 2I0QA 3D0FA 1N34Q 1VQ9A 1EQRA 2UXBL 1UE6A 4K0KL 4YWLA 1I94L 2OWOA 4P73A 4HJ9A 1K3RA 1A8VA 4A3KG 4A3GH 5DLQE 5ELNA 3J81c 4DV7Q 1G51A 2CKZB 3CCJA 1TXYA 2UUAL 5JJKA 4A3EG 1XMOQ 1B70B 2VL6A 1PH1A 2KHIA 4IFDI 2UUBL 2XTIA 1WYDA 4A3DG 2K52A 4B3MQ 5JEAG 2HIVA 1IBLL 3NELA 4A3IG 4A3CG 3I4MH 1EWIA 1XMQL 4DK3C 3I55A 4APVA 2UUCQ 5C0XI 4BY7H 4X6AH 3CPFA 1NBWA 5M3MH 1FJGQ 1BVSA 4DUZL 4LF4L 2JJQA 2KBNA 2OCEA 3ULPA 5M5WH 2ZM6L 1PH7A 2N3SA 4LWCA 3H15A 2UXDL 4POGA 3PV0A 3CCQA 1SLJA 4B3TQ 3M3YH 1VQDA 2NVYH 3F2BA 2RHSB 3BJUA 2I5LX 1CKNB 4MNOA 1UEBA 2K14A 2E2HH 2KCMA 4GOPB 4IFDG 1XNQQ 1GVPA 5JEAJ 1MJCA 4QJFA 1RL2A 3ULLA 4DR3Q 1V1QA 2LXKA 5C44G 4X65L 1KQSA 4UP7A 3I4NG 3AFPA 3I4MG 2OQ0A 1VQOA 1VQ8A 2AMCB 2Y0SG 2OQKA 4NXMQ 2ZTEA 3ICEA 4A3CH 4DV1L 4DUYQ 4JI0L 3HOZH 1L2FA 4UY8C 4A3DH 3F2DA 2A19A 3TQYA 1EIFA 1AE3A 2D0OA 1MIUA 4Y7NH 4BA1I 4LF9L 4GN3B 3RN5A 3EIVA 1YZ6A 4X64Q 3MXNB 1OXTA 1E22A 2K50A 1G291 4JCVE 5M5XH 1VQHA 2CCZA 3H3VI 1YITA 1N8RC 1K9MC 2CWAA 2QA4A 1X9NA 4LUVA 3S1RH 4YWMA 1VQJA 4IPHA 2E5LL 2ID0A 4JI3Q 3K7UC 4DUZQ 1Y1WG 4LF4Q 4JI7Q 3F1ZA 3DLLA 1X6OA 4P72A 1N32L 1FVIA 1IBLQ 1I6HH 4GLAC 4LF8Q 1HNWL 1VQPA 3PF4A 3T1YQ 4JI2Q 1C0AA 2R92G 1VQ6A 4LF5Q 4DR1L 2PQAB 1Y14B 5FJ8H 4Y52H 5LMUL 4A93G 4LF9Q 3JAMi 1XNRL 1AH9A 1GO3E 3PCOB 4L5SA 2F3IA 3CC7A 1Q46A 1G6PA 4AH6A 1X3FA 1I94Q 4LF8L 1HNWQ 3S16H 4YHHL 2AKWB 1OXUA 4OWXB 1TWHH 1QZGA 2K4KA 4AIMA 4HJAA 1YJ9A 1VQ7A 5HGQA 3J80i 4A3JH 4JI7L 1X65A 4KI0A 5H1SE 4HIKA 2Q2TA 3K0XA 2LSSA 3KF8B 4C3HH 3BZCA 3H3VH 5AJ3Q 4DV2Q 4GLVB 1YJNA 1VQKA 1KHIA 4A3MG 2HIXA 4JI3L 3RLFA 3ER0A 2ZTCA 3M7NA 2ZJQA 2AWNA 2IHFA 2E8GA 5IYDG 2VQEL 5C44H 2CQOA 2K5HA 4LF7Q 2QEXA 1L1OB 4ALPA 2VZAA 2EXDA 1X3EA 2WB1G 4PZ6A 1KRTA 1IBMQ 2MO0A 4JI0Q 1M1KC 4P74A 3I4OA 4YHHQ 4JG2A 1VQAA 1PH3A 4A3BH 1NE3A 4BA2I 2IX1A 3F2CA 1PYBA 3A5UA 1UE5A 4O0AA 4DR3L 3TEHB 1VQCA 5FJ8G 4GOPC 2RF4A 4JBWA 1X56A 1PV4A 3HOYG 3G4SA 3F8TA 5GAHC 1S3OA 1VQNA 3HOWG 3S1MH 2Q2HA 1FGUA 2A1AA 3GO5A 4R1JA 1YJWA 3CMAA 5FLXc 2JA8G 4HJ7A 4KHPQ 1CKMA 3PO3G 2K5NA 1E1OA 2Q2IA 4OWTB 2YYZA 4UP8A 3J7ZC 4IPDA 1FJGL 4HJ8A 4DR2Q 3PUZA 2ZM6Q 1PH9A 4GOPA 3EBEA 2CWPA 4L5QA 1YIJA 4A3GG 1T9HA 4A3KH 2YTYA 2E5LQ 1J6QA 3U50C 1L1OA 2VY3A 3AEVA 1GD7A 3RLOA 3K8AA 3CAMA 1U0LA 2NN6G 4MZ9A 1NY4A 5IY0A 4BXXH 2FXQA 3UDIA 2R7FA 1VQGA 4EX5A 5EAYA 1X3GA 2F52A 4DUYL 1GKHA 1VS0A 1W3SA 1X55A 3OYYA 1QVGA 1J5EL 2ALYB 3HOUG 3CW2C 3UDXA 3HOYH 4DR7L 3PUVA 3G6EA 4JBJA 4DV5Q 4QL5A 4RMFA 3A5ZB 1K83H 1LTLA 5C3EH 3OTOL 3J80c 1JE5A 5IWAQ 2LXJA 3G71A 2HHHQ 5C4JH 1W2BA 2B29A 4DV6Q 1EUJA 3FP9A 4JI8L 2WAQG 4DV3Q 3JAMc 1IXRA 1FL0A 3TREA 5IT9c 5GADC 1B7YB 3PUXA 1UE7A 3CPWA 5LMNQ 5IYCH 4JI2L 5C4XG 4BBSH 1WCMH 1PYSB 2UXDQ 3PGZA 4IPCA 3HOUH 3PO2H 2K5VA 3GTLH 4RG1A 4JI5Q 3HOZG 1JJ2A 3E9IA 4DV4Q 5IP9H 4A3IH 4GN5A 5J3BA 1HR0L 4PG3A 3KOJA 4BXXG 3RR5A 4GNXB 4DAMA 3HOXG 1PH6A 2BA1A 2JK8A 1Z9FA 1VQIA 2B63H 2R6GA 2JA5G 4NXML 2UUAQ 4A3LH 2JA6G 1L1OC 2AHOB 1CSQA 1OXSC 3KF6A 3U58A 4DR5Q 4BBRH 3S2HH 5IWAL 4B3SL 3TS0A 1VCIA 3KLWA 4NB3A 4DV7L 1Q8KA 3OW2A 4OXPA 4DV5L 4JOIC 4HIMA 2JEBI 1LM0A 1OTCA 2Y0SE 3H0GG 5BR8Q 1PH5A 2WB1E 1WFQA 2ASBA 3Q8DA 1PFSA 1HZAA 3K7AH 3PF5A 4B3TL 1WOCA 1TWAH 1KAWA 5IYBG 2A8VA 1WJJA 2R92H 2Z0SA 1WI5A 4AQYQ 4OX9Q 3E9HA 2R93G 4GN4B 2NVTH 4NXNL 1VQ5A 5IYBH 2UUCL 2JQOA 2ZJPA 4LW1A 1BBWA 4LFBL 1CKNA 3CCMA 3S14H 3GTPH 4POFA 4HJ5A 1HR0Q 4DV4L 4DR6Q 2OTJA 4IJLA 1YEZA 4O2DA 2GN5A 2F4VL 2DUDA 1KL9A 3KDFB 1Q7YC 2JA6H 1TWGH 1JJCB 4X66Q 3M9BA 4DV3L 2ES2A 4A3LG 1H95A 4TQUS 3L2PA 2PNHA 1HNZL 3M85A 2WAQE 5IYDH 4IO9A 1Y1VH 2DGYA 2VUMG 4B3RQ 2UXCL 4DR2L 5LMNW 3NEMA 4IFDJ 4JI8Q 4LUZA 1Q12A 5GQOA 3ULJA 2MFIA 3RNUA 3K81C 4P75A 3KJPA 3T1HL 1VQMA 1N36Q 4B3SQ 4NPSA 5C4XH 4DR7Q 1CSPA 1V43A 1HJPA 4UP9A 2ZJRA 4BBSG 2VW9A 5IYCG 1E1TA 2VQFQ 3M4QA 2E2IH 1KRSA 4ME3A 2N78A 3UDGA 3G48A 4R4QA 2XGTA 1HZCA 1NTGA 1KD1C 2NZHA 4LNQA 1EIYB 1YHQA 1ASYA 4A3BG 4TVAB 3AFQA 4XTCS 1DGSA 2VQEQ 2VS1A 4PZ7A 3MEFA 4C2MH 4DR6L 2KENA 4AYBE 1QZHA 5C3EG 3CF5A 1S40A 2R7ZH 3GTQH 4LFBQ 4LFAQ 3RZDH 4YWKA 1HNXL 2UU9Q 3CP0A 1I3QH 3CCSA 4YCWA 5M3MG 3KDFA 3CCVA 3UE0A 3HOXH 4LF7L 4OWWB 2EIFA 1SR3A 3M4PA 4OO1G 1E3PA 4LF6L 3PUWA 1A0IA 1K0RA 5GAEC 5FLMH 1N33L 1VQ4A 2KCTA 3DM3A 1Y1VG 2RHQB 2VUMH 2HQLA 5HY6A 2ATWA 1HH2P 5M5YH 3J7A5 1HNXQ 4UPAA 4GNXC 4QY7A 2PI2E 5AJ3L 3CCRA 4DV2L 1SE8A 4MTNA 1YHBA 4DV0Q 1U5KA 3STBC 5C0XJ 2JA7G 1YVCA 3W1BA 2RCNA 3A0JA 3CC4A 4JBMA 1LUZA 4BY1H 1UWVA 3A74A 1HZBA 4WJ3M 4JI4L 3W1GA 1GM5A 2VQFL 5IE8A 1Q82C 4HIOA 1QVCA 4JI4Q 1V9PA 5M3FH 3S2DH 4JV5Q 1N32Q 1I50H 1CKOA 1MKHA 4GNXA 1PHJA 1IBML 4X62Q 4L5TA 1RIPA 3L7ZC 1D8LA 1KIXA 3GTOH 3AQQA 4JI5L 4DR1Q 2OTLA 1JJGA 3T1YL 1CUKA 4LFCL 1Q1EA 3KF6B 3L0OA 3GTMH 3AYHB 2BA0A 5LMNL 2N49A 4JI1L 3S1QH 1Y1WH 2NZOA 3TRZA 4GKKQ 2Z6KC 4JYAQ 3UE1A 3VDYA 4BY1G 2BH8A 1R9TH 1M90C 3W5OA 2I5MX 2HT1A 2JA7H 3SGIA 3TS2A 3OTOQ 3HOVG 3CCLA 4LFAL 2WP8J 4GKJQ 4B3ML 4YY3L 1PH2A 4X64L 3I56A 1LYLA 1Q1BA 3I2ZA 4PZ8A 2YV5A 5IP9G 4AQYL 3UDFA 1SROA 2YTXA 3J81i 3GTJH 1S72A 1EQQA 2JA9A 1JT8A 1WCMG 3GTGH 4A76A 2IHEA 4LF5L 1XJVA
chains in the Genus database with same CATH superfamily
1YNXA 1VQBA 2Z6BA 3NENA 1XPOA 4UAIA 2YU9H 2PI2A 5NUCA 4R4IA 4FVMA 3CQZB 2R7ZG 4X65Q 2EY6A 3GDEA 1A3TA 3PSIA 2K1BA 4GKJL 2EYFA 1E7ZA 4A4IA 1CQVA 4JI1Q 3SVMA 4H7BA 5IP7H 4JYAL 1KXLA 1CA6A 4JPBW 1RODA 1GUGA 3T4AC 1NCVA 2C35B 3J7AV 3J80E 4OO1I 3G6JB 5KYLA 5M3FG 3MFGA 4JV5L 1XMOL 3B6YA 4OGQC 4DV0L 1U4LA 1EOTA 4LUOA 3IRBA 3LWUA 4F7XA 4EQ5A 5JJLA 5FO8B 4YCUA 2PMZE 2NUCA 4IQZA 3HOWH 2I5HA 1A63A 3QOLA 4L5RC 1EYGA 1IYJB 1XMQQ 3GTMB 3FHWA 3A8IE 4DNIA 1SBBB 2IY5B 4QQBX 1QILA 5T1IA 4DV1Q 4QIWE 3FKIH 4JC0A 5DM63 1W6JA 4JBKA 5CV7A 4WJ4A 3PUYA 1DJRD 3U9OA 4K2LA 1XNQL 3K80C 2LS01 3WWVA 1YBYA 2B2TA 2N8NA 3D4DA 1TWCH 2RDFA 2WFWA 1TT2A 4HTHA 5EKLA 3S24A 1L0XB 4DR5L 4K0KQ 1S5ED 1PVOA 2K33A 4X66L 1LT4D 4DKAC 1G6ZA 1PH4A 4C3IB 1TQOA 4IJHA 2PCFB 2IT1A 4X3TA 4P71A 1TWFH 2B2UC 1B1ZA 2EJMA 3I90A 5EPKA 1K8GA 5KNDA 3R2TA 3MXUA 4A93H 5KNBA 1G2SA 4K2KA 2G9DA 4Z9CB 4IUUA 4DV6L 1Q86C 1I4PA 1IW7D 1AE2A 2EXZA 5D65A 1Q81C 1B8AA 1EFWA 2NN6I 4A75A 1KNEA 1K73C 3D4WA 3H0GH 2IX0A 2I0QA 2KHSA 1N34Q 1VQ9A 3V2TA 4K0KL 1KLUD 3SE0A 4ODGA 4HJ9A 5EQ0A 1K3RA 4K5WA 3VR4A 4QB4A 1G51A 4KJNA 3T56B 1A3UA 3CCJA 1X32A 4A3EG 1PH1A 2YU9B 4IFDI 2KHIA 2WKCA 2EY5A 1OO9B 1TWHB 3VA5A 5I2YA 2HIVA 4A3KB 3IFDA 3NELA 4RKLA 4A3CG 1K0SA 3I55A 4APVA 5C0XI 3CPFA 1BVSA 4LF4L 2JJQA 1F2YA 2AQ2B 1PH7A 2UXDL 1EWCA 1SLJA 4HR7B 3M3YH 1JORA 1MBYA 1D1KA 2RHSB 3MTSA 4MNOA 1UEBA 2E2HH 4IFDG 1D1IA 4QJFA 1QNKA 1RL2A 2LXKA 3I4MG 2OQ0A 4ID6A 4ULLA 2AMCB 2Y0SG 3ICEA 4DV1L 3KBGA 5EJWA 4JI0L 2EE1A 3F2DA 1AE3A 4Y7NH 1MIUA 4BA1I 3RN5A 4G4KA 1YZ6A 3AU7A 2NN6H 2F0UA 4X64Q 3MXNB 1PTOF 2F0OA 3H3VI 4NKLA 1HFGA 1U4PA 4OL7A 1BXTA 2E5LL 3K7UC 3IAYA 1ESRA 4IN3A 1ENCA 1B3AA 2J0TD 5DM73 4P72A 4MIUA 3HOXB 1C0AA 2R92G 1VQ6A 3FVQA 3J7AF 2PQAB 3A56A 3JAMi 1AH9A 1IKMA 3PCOB 1HFNA 2A69D 5C0XH 1DOKA 4NW2A 1V1PB 1X3FA 1I94Q 2AKWB 2L55A 1CFMA 2LMCB 4OWXB 3AMUA 1VQ7A 1ZEQX 3G7LA 2F1MA 4FNFA 2RSNA 1S5FD 5JVG3 5AJ3Q 1BR9A 1YNND 2HIXA 1PRTB 2XVSA 5EKKA 5CC4A 3K7AB 4JI3L 3A8KE 3OWEB 4ZUJA 3V05A 5C3XA 3M7NA 2CQAA 2SOBA 1YNJD 2K5HA 1H9SA 4LF7Q 2QEXA 1L1OB 4L63B 5DAUA 2VZAA 2EXDA 1X3EA 2WB1G 1KRTA 2AQ3B 2EJGC 4L6TB 4A3DB 4JI0Q 1M1KC 3I4OA 4YHHQ 3GTJB 3OHXC 1GOZA 1WTPA 1PH3A 3S14B 1UE5A 2HCIA 3HOYG 2F0FA 4IZ8A 5GAHC 1VQNA 2PZUA 4H13C 2RBMA 1FGUA 2A1AA 3HRZC 1YJWA 3CMAA 5FLXc 4CDEC 4OWTB 1XWEA 3S1RB 4HJ8A 4DR2Q 1XYIA 2EVBA 3EBEA 3NBIA 2F0GA 1J6QA 1I4HA 3AEVA 3RLOA 1TS5A 3V96A 2NN6G 4BXXH 3K58A 1X3GA 2DY8A 2P5ZX 3HOUG 1HXYD 1SYBA 4RMFA 1SXTA 2Q8IB 3IKJA 3A7AB 2HHHQ 3G71A 4DV6Q 4JI8L 4X3KA 4C3HB 1SNDA 3CRLC 3TREA 5IT9c 1UE7A 5C3EB 1EFID 3BVGA 5C4XG 1WCMH 4I65A 5FKAC 4C2MB 4X3SA 2K5VA 2JSOA 1BCPC 5ISRA 4XYOA 1LT5D 1PRTC 2L0CA 1VF5C 5EBDA 1LTAD 4KKSA 2R6GA 2JA5G 3QJYA 1U9RA 4A3LH 2JA6G 5D3IB 5I2XA 2MP1A 2AHOB 4DAVA 4DR5Q 3M3YB 4DU9A 3KLWA 4DV5L 1LM0A 5D3DA 3NQIA 5BR8Q 1KABA 1TWAH 1KAWA 4O1NA 1X3PA 4Y7NB 2EYMA 4BWGB 1KLGD 4AQYQ 3VYRA 1VDZA 3FDTA 3DUZA 2NVTH 4RWSC 3OMGA 1SYCA 2M00A 1F9QA 4LW1A 1CKNA 3CCMA 1G8ZD 4HJ5A 2NBFA 4DV4L 4IJLA 1YEZA 2DNEA 5LHY1 3X3NA 2F4VL 2JA6H 2ICEC 3HS0C 4A3LG 4KKTA 3L2PA 2Z1CA 5IYDH 3HP3A 1B3QA 4GZYC 2UXCL 5CYUA 5LMNW 1PZJD 3NEMA 4JI8Q 2IL8A 1GUNA 1FR3A 4P75A 3T1HL 1N36Q 4B3SQ 1AZQA 1SEBD 5KRUA 5C4XH 5JPNC 1CSPA 1LV9A 1HJPA 1LTRD 1PFMA 2VQFQ 3M4QA 2E2IH 3UDGA 1QCBD 4ABNA 1KD1C 2NZHA 1EIYB 1YHQA 1RJTA 1TWFB 1E2WA 2VS1A 4PZ7A 1ZKOA 4JVZA 2NZ1D 1S40A 3GTQH 4LFBQ 1PZID 4N8FA 4C3JG 1I3QH 4YCWA 3CCVA 1EZ8A 2KVMA 1D5MC 2NVYB 3M4PA 3OPOA 5IT9L 3ND8A 5CV9A 3BVZA 1Y1VG 2RHQB 1HTLD 2B63B 2PI2E 1SE8A 1U5KA 2JA7G 1YVCA 2RCNA 3A0JA 4ME5A 4JBMA 1UWVA 1HZBA 5IGBA 4WJ3M 3W1GA 1ONLA 3VYTA 4O42A 4HIOA 4RGTA 4JI4Q 1N32Q 1CKOA 5IGCA 4GNXA 3I4NB 4KY5A 3I91A 2A6HD 3AQQA 4RHSA 4JI5L 1Q90A 1ET9A 2J4XA 3DM1A 2NWGA 1ET6A 1LT6D 2EYJA 2N49A 5FO7B 4CDFC 1I6VC 3HOYB 3UE1A 1NSNS 3SK8A 1EU4A 2B8FA 2HT1A 3OTOQ 2NB0A 2WP8J 4FF4A 4HMIA 4B3ML 1LYLA 4F8MA 3TSSA 1KTKA 2YV5A 5IP9G 1CTMA 3UDFA 4AQYL 4A3IB 4A3GB 5JEAH 1IW7C 1BDOA 3GTGH 3I73A 2IHEA 1XJVA 3NQTA 1IBKQ 4A3FG 4JI2L 4C3JH 1F2LA 4J6HA 2NVQH 2GVBA 1EY6A 1UE1A 4ZKCB 2KEDA 1MHWC 1PH8A 3FEWX 5LL6S 3ZJYC 5CBEE 1YI2A 1HUNA 3K5MA 2KEEA 4GKKL 3BYYB 5AFWA 2F0WA 4BY7B 3PIPA 1N9WA 3L3OC 3HKZE 4FO2A 1IBKL 1ASZA 1LTGD 4MHEA 4PMWA 2PMZB 2A73B 4R4CA 4OHJA 4GLXA 1KDAA 2KHJA 1NJIC 3SK4A 1NUCA 5FO9B 2JA8H 4CDCC 1PTOB 3P1HA 4KY6A 1JB7A 2XWBB 1HPCA 4QUCA 5D14A 5CGKA 1MJEA 1TS3A 2VNUD 3ERSX 3PIOA 2L12A 4DK6C 2MJ8A 3CCUA 3CC2A 1CHPD 1I3QB 3J81j 2XWJB 4JI6Q 2WACA 3EN2A 2A68D 4FDBA 5I9OA 3KLSA 3CCEA 5M3FB 3S2DB 4WRDA 3BS1A 1OXXK 4XYQA 2JA5H 1O7IA 4EQNA 1XPUA 3E3XA 5J39A 4OONA 3RZOH 1BOSA 1ESFA 2PYKA 1PA6A 1XPRA 2OXPA 4JOIA 1NR4A 1V1OA 1HNZQ 2K28A 3E0EA 1B53A 4B08A 4DR4Q 3MA2B 1SRUA 1BF4A 4JI6L 1J5EQ 1SJHD 2CW0C 1TKWB 4AYBG 3GTOB 2D0PA 1O7YA 4DNTB 2L5TA 3HOVB 5IGDA 4A3EB 1NMGA 1STYA 2K7VA 1SSOA 5C4ZA 4IALA 3JC66 2EYLA 4K5XA 2BH2A 1C7YA 2EPBA 1HRJA 1BBUA 1II3A 3I7FA 3KBXA 1EU3A 3NUCA 4CJ0B 1UE6A 1I94L 4P73A 1L0YB 1A8VA 3VR5A 4A3GH 4N8X1 5ELNA 1K28A 2BOSA 2CKZB 1RD9D 1TXYA 2UUAL 2VL6A 1T5XD 2LFNA 2UUBL 1WYDA 5J1ZA 1PTOC 5EPLA 1M8AA 2GA4B 1EIGA 4A3IG 1EWIA 4DN4M 5JOBA 1XMQL 2UUCQ 3NWSA 4BY7H 4X6AH 1SNMA 5M3MH 1FJGQ 2OCEA 4DK1A 2ZM6L 2N3SA 4POGA 1RKNA 1ICWA 2F0PA 1XXGA 4N9TA 5G3LF 3HOWB 2I5LX 2K14A 2KCMA 1SYGA 4GOPB 5JEAJ 4DXGA 1GUWA 4DR3Q 3W3AA 3OWFA 5IGEA 2VB2X 1Q8IA 1KQSA 2RVLA 3I4NG 3NPPA 1VQ8A 3BVMA 3GV3A 4A3CH 1TY0A 3P7JA 3H3VC 3VYSA 1STGA 4DUYQ 1A3VA 1L2FA 4RCOA 4ZLTF 1B9MA 3KUPA 4GN3B 4LF9L 4NDXA 3A54A 4LJZC 5C4XB 1SDFA 2PW5A 5I9PA 4TRDA 1UAPA 3EQLC 1N8RC 2R93B 3A55A 2ID0A 3SXHA 4LF4Q 2RQXA 3E0JA 3K5LA 2FINB 4DGZA 3DLLA 1X6OA 1DOLA 4OO1H 1N32L 2KOLA 2ZXRA 1I6HH 2G5DA 4GLAC 4LF8Q 5BN3A 3T1YQ 1SJED 2PZTA 4JI2Q 1GHKA 4XXEA 3LNNA 2JA5B 1ZXTA 4ZYSA 1RTOA 2NVXB 1GO3E 2JA6B 1BUVT 2A5HA 1IHZA 1G6PA 4AH6A 3S16H 1OXUA 4AIMA 5JVH3 5HGQA 4KI0A 5CMDA 3KF8B 1I4QA 2LSSA 4FXGC 1UUPA 3BZDB 3FPUB 3H3VH 3C1FA 5KGUA 3QOJA 2G9HD 2CVRA 3RLFA 2ZTCA 2IHFA 2VQEL 5C44H 2CQOA 2K04A 4C1NK 4EQPA 1SNOA 3SR1A 4PZ6A 2IPKD 3EA6A 4KN7C 1G2TA 3R93A 1VQAA 4A3BH 4BA2I 3HOUB 2IX1A 5FK9C 3A5UA 2EYOA 5FJ8G 4GOPC 4EVOA 1SAPA 4JBWA 4AYBB 5A2QE 2Q2HA 2NTSA 1FNUA 4CKCA 1BBXC 4PQXA 2Q2IA 2YYZA 2PW7A 2CWPA 1T9HA 4A3KH 1DM0B 3K57A 2E5LQ 2VY3A 3VR3A 2JN4A 1YNJC 3K8AA 1WD0A 1TS2A 3CAMA 4A3JB 3UI2A 5IY0A 1WTRA 2R7FA 3ITPA 5EAYA 4PNYA 2F52A 2F0TA 3NSWA 1GKHA 4KHVA 4DUYL 1W3SA 2A6HC 2ALYB 3UDXA 4ILWA 3HOYH 4V0BA 3PUVA 5EPJA 3J80L 4DV5Q 1FYCA 3FMCA 5C3EH 1PTOH 2X69A 1KDBA 1SNCA 3TZDA 2VB3X 4DA2A 3PUXA 3CPWA 2B2VA 4CJ1B 2K5WA 1PYSB 1WTHA 4WJWA 4JI5Q 1K3BC 3I72A 1ILPA 3F2UA 4HCEA 5J3BA 3CHBD 5CV6A 3RR5A 2D5DA 4GNXB 4DAMA 1DZ1A 4RH6A 1Z9FA 1EY5A 2WV6D 5ELDA 5C4HA 2UUAQ 4NXML 3KLSX 4HAEA 5K36H 1CSQA 1A2UA 3S2HH 1I6HB 1J8IA 3OW2A 3R8BA 2Y0SE 4CKBA 1DYQA 1PH5A 2WB1E 2OT2A 3K7AH 1EY9A 3DMUA 3Q8DA 3PF5A 5IYBG 2A8VA 3RD4A 2B2WA 1VMCA 4GN4B 4RGOS 1UEAB 1VQ5A 5IYBH 3R3OA 1FNVA 4U673 1SFOB 1LABA 1SE4A 3BDOA 4KY7A 3S14H 3GTPH 4POFA 1HR0Q 4DAYA 2WB1B 4TKOB 1RF2D 1R9TB 3TZUA 1TWGH 4X66Q 1H95A 2DNCA 3T16A 1HNZL 3EJIA 4IO9A 2DGYA 2VUMG 2AQ1B 3QG1A 3NHHA 2X6LA 2R3ZA 1Q12A 5GQOA 1VQMA 4QF4A 2O2LD 3MXGA 1B4OA 4XT1B 4UP9A 2N78A 4RA8A 1QB5D 3G48A 4LNQA 1B44D 4TVAB 3AFQA 2VQEQ 3PO2B 1QZHA 4XQQA 4YWKA 2UU9Q 1V8QA 3CP0A 2RDGA 4J8QA 3CCSA 5M3MG 3KDFA 3UE0A 2K32A 3NTIA 4LF7L 5IGGA 4OWWB 2A6EC 3DWAA 4OO1G 2Z4IA 5FLMH 2KECA 2NTTA 2VUMH 5M5YH 3J7A5 2JXMB 1EY4A 1S5DD 4UPAA 5BN5A 5AJ3L 5IIFA 2A69C 4EGVA 1NR2A 4MN3A 2C5CA 4IURA 5I6YA 3AB9A 1GM5A 2VQFL 3K59A 5IE8A 1Q82C 3D3RA 1QVCA 1V9PA 3S1NB 3CU7A 2ENBA 1PHJA 1IBML 1KIXA 3L7ZC 1D8LA 4YIJA 5E1FA 3CRKC 3T1YL 3WOFA 1DD2A 3AYHB 5M5WB 5F2DA 1Y1WH 4GKKQ 5KIXA 4KKUA 1A6XA 1PRTD 2BH8A 1BCPD 2I5MX 3SGIA 4S3SA 2K03A 4X64L 2O5JC 4PZ8A 5EGTA 3S16B 1SROA 3HOZB 1JT8A 3K6OA 4A76A 3PO2G 4KTAA 4C3IH 4A3JG 1XNRQ 2XRSD 5LMUQ 1RHPA 4FF1A 1RTNA 3CD6A 2F0EA 4KHZA 1EOVA 3C3LA 1MD2D 5GAGC 2SDFA 5L37A 1P8LA 3SHLA 1D6EC 4GS3A 2CFMA 4OEMB 5ELOA 2K01A 2R93H 4LK1C 2ZT9C 3RLNA 3BZKA 2F3VA 2Q2UA 1JWUD 3EVQA 4IPGA 3RZDB 4QGUA 1STBA 4X62L 1QVFA 1HA5A 1PDQA 1XTDA 2F0IA 3FKIB 4YY3Q 4H02A 3WDNA 4Q0FA 5J22A 3CXCA 3QB3A 2LY7A 2L15A 1GJXA 4CBVA 5JPMC 3ONAB 1N34L 2UXCQ 1YHAA 1JB3A 3E5SA 1HZ9A 1QUQB 1H9MA 5IP7G 2F4VQ 3GTQB 1E24A 2EY1A 1SFOH 1Y69U 3I4MB 2B2UA 3GTGB 1G91A 1KAAA 2F0QA 4FP5D 3CMEA 3Q23A 2F0JA 1SMXA 3NK9A 2B63G 5K36G 4XQJA 2J7ZA 2D9UA 1VF7A 4A3FH 2PQAA 1GHJA 5KEEA 3N6RA 3T1HQ 1N36L 3HKSA 4A3MH 1DOMA 3CQZH 4H0LC 5M9OA 2H5XA 3GD7A 3VYUA 3I4NH 2F0VA 2IWHA 2EQSA 3OOCA 4XIGS 3LWEA 3QR8A 3HZXA 2R61A 3STBD 4LMQD 1C9OA 1H9JA 5E7NA 3FPPA 2B3GA 2MQHA 3RUZA 4ZUIA 2K75A 2YTVA 3NBHB 2UUBQ 4R8IA 3HKZG 1TVXA 3S17H 3BG3A 1VQLA 4BY7G 1OXVA 3JAME 1CZGA 1I4RA 4MTKA 2AWOA 1AFPA 2B2TC 4DPGA 2L9HA 1LT3D 3MC0B 1P16A 1TS4A 4I7ZC 3D6WA 1EQRA 2QDBA 4A3KG 3ND9A 5ELFA 1SYFA 1XMOQ 1B70B 1SYEA 3P20A 4A3DG 5JEAG 1YNNC 1F9RA 1IBLL 2MGSA 4DK3C 2F0KA 3MXNA 3TP7A 4V190 3GQBA 4XDXA 1NBWA 1J9OA 4DUZL 2JA8B 2KBNA 5M5WH 2NVTB 3H15A 3TBIB 3CCQA 1QJOA 3NTHA 1HUMA 1NNXA 4B3TQ 1VQDA 3F2BA 3BJUA 1CI3M 1CKNB 4KK7A 1GVPA 2B2YA 2ZXOA 4L8JA 1Y8NB 3ULLA 3A8JE 5C44G 2RA4A 4X65L 3AFPA 2E74C 2OQKA 1LTTD 3K5OA 4R8NA 3HOZH 2FHTA 2OEOA 2PZWA 4DK0A 2A19A 3TQYA 5C44B 3EIVA 4IUVA 1AP0A 1JWMD 2B2VC 1R4PB 1E22A 2K50A 2O5IC 1VQHA 1YITA 4F88A 1K9MC 3NP8A 1X9NA 4LUVA 2JP1A 3S1RH 1JWSD 1GUTA 4IPHA 2R92B 3IL8A 4JI3Q 2LKVA 4JI7Q 3F1ZA 1GUOA 2F0MA 1TWGB 1FVIA 3H09A 1HNWL 3PF4A 3GTPB 5FJ8H 4Y52H 5LMUL 2PQEA 3H91A 4B9WA 1XNRL 2FMCA 2F4IA 2XNAC 1Q3LA 1SMYD 1HHVA 4G7OC 1HNWQ 4YHHL 1TWHH 1ENFA 1QZGA 2K4KA 1YJ9A 4JI7L 1WTQA 1X65A 5H1SE 2HQEA 2Q2TA 5C5LA 1SYDA 4C3HH 3NBHA 4DV2Q 1YJNA 2QCPX 2H4OA 2WAQB 4DNRB 1CA5A 1WD1A 4PMBA 1I4XA 2ZJQA 5EBCA 1QNUA 2E8GA 5IYDG 1EZ6A 2EZVA 4KJOA 2HDLA 1Z7TA 3TP5A 2MO0A 1O80A 1M4VA 4P74A 2E2DC 5T1GA 3F2CA 1PYWD 4XQNA 4C1NI 4NP5A 3M4YA 1CHQD 4DR3L 3TEHB 1VQCA 4RAUC 1X56A 3F8TA 1QWYA 3S1MH 1Y1VB 4OELB 1XTCD 1STHA 4R1JA 5I4DA 1TR5A 3URYA 4HJ7A 2JA8G 4KHPQ 4M8AA 3PO3G 4H44C 1E1OA 4UP8A 4IPDA 1FJGL 1D2BA 2ZM6Q 4GOPA 5I6WA 4L5QA 1YIJA 4A3GG 3S1MB 1CZWA 3S2HB 3C46A 3NWTA 3CKIB 3J7YW 5M3MB 2EY2A 2E2IB 2XIWA 3PIP3 2FXQA 2TMPA 3MAQA 4EX5A 1VQGA 3J81E 1DONA 1VS0A 1QVGA 1TU2B 1LTSD 4I7AA 4UDUC 1JCKB 3CW2C 4DR7L 3G6EA 1IL8A 4JBJA 1GUSA 4QL5A 3MZ5A 1JOKA 3A5ZB 1LTLA 2XN9C 4M1UB 3OTOL 3A7LA 3J80c 2F0DA 5IWAQ 2LXJA 5C4JH 2B29A 3DXJC 3K5NA 3TP8A 1EY0A 2WAQG 1I50B 4UHVA 4DV3Q 1IXRA 3HKZB 5GADC 1B50A 1K83B 2QDLA 3I8ZA 2UXDQ 3PGZA 4IPCA 3HOUH 3HEJA 4PMCA 1WTVA 3E9IA 1JJ2A 5IP9H 2Y0SB 4GN5A 3KOJA 4BXXG 5CR3A 2M2LA 2BA1A 2JK8A 1VQIA 1WTWA 4LAAA 1F77A 4P2CB 1OXSC 3N52A 4BBRH 1RCVD 2K5QA 4DAPA 3KF8A 1Q8KA 1CM9A 2BE5C 4HIMA 2JEBI 2F0HA 1W6KA 1PFSA 1HZAA 1BO0A 1WOCA 1LO5D 4N9PA 2R92H 1H9SB 1WI5A 4A3BB 4OX9Q 3E9HA 2JQOA 1HCZA 2ZXPA 1BBWA 4LFBL 2HD3A 4DR6Q 2KCCA 4K8JA 2OTJA 4O2DA 2DUDA 1KL9A 3KDFB 4ZQ3A 3VR6A 2ES2A 4K6LA 3NE5B 4TQUS 2PNHA 3M85A 2WAQE 5C5MA 4TSSA 4ZK9B 1Y1VH 4B3RQ 4DR2L 2VUMB 4LUZA 2EOTA 3K81C 4KN4C 3KJPA 1LTBD 2BCOA 3LX0A 4KMUC 1V43A 1EYDA 2VW9A 3ZYYX 1K8MA 4ME3A 1F9PA 4OIJA 2XGTA 1HZCA 1ASYA 4IUNA 5LL6X 1Y8OB 3MEFA 2AUJD 4C2MH 2KENA 4AYBE 4K6DA 4LFAQ 1HNXL 2RCFA 1SE2A 5JJZA 2PPBC 3J81L 5DEHA 4CHTB 1O78A 1SR3A 1K0RA 3D8GA 2RKSA 3T13A 1MSGA 5GAEC 1VQ4A 3DM3A 2L1BA 1HH2P 2IX3A 4Q5VA 1HNXQ 1O7ZA 1AW7A 2I07B 4MTNA 3T53B 5C6AA 4DV0Q 4KD4A 3STBC 3MEHA 3W1BA 3SK5A 3CC4A 5E4XA 4FXDA 1STEA 4CJ2C 2F0LA 1MKHA 1D5ZC 3QIAA 3MWYW 4L5TA 1RIPA 2KCNA 4BS9A 5KYIA 2NYZD 4DR1Q 2OTLA 1F2MA 3M7GA 1Q1EA 3KF6B 3GTMH 2A74C 5LMNL 4JI1L 3S1QH 2QEJC 2NZOA 4JYAQ 4RCNA 3VDYA 3I70A 5FLXL 1R9TH 2H1EA 3W5OA 1ILQA 1M90C 2JA7H 2E2JB 5FOBB 3HOVG 3CCLA 1ICFB 4LFAL 2AUKA 1PH2A 3I56A 4K5VA 3I2ZA 5EKIA 1I4GA 1R4QB 2YTXA 3GTJH 1EQQA 2JA9A 1WCMG 4BBSB 4LF5L 1NAPA 4DAYB 4QIWB 4A3EH 5G3LD 1EEID 2CH4W 4R4OA 2CH4A 3KJOA 4LFCQ 3U4ZA 1QUQA 2C9OA 4J15A 4R4TA 2QW7A 4R9WA 1PXUA 2QF7A 1IZ6A 1BCPF 1PTOD 1AZPA 2UU9L 2Q8TA 3JAML 1BKBA 1HR0W 1CQFA 1I5FA 4ZCKA 1SN8A 2D62A 1DXMA 2VXWA 3H6MA 3MFYA 1XX8A 3RZOB 5JJIA 1D7QA 3WOEA 1UNSA 1EY8A 3DWQA 3RN2A 4FYDA 1H9KA 3S15H 1ENAA 2MNAA 4HSVA 3BU2A 1LTID 3IFTA 4IOCA 1WTXA 3HOVH 3KYHC 1VQFA 2B2YC 2FMMA 3T51B 3EROA 4OX9L 2GVAA 4BBRG 1JC7A 5TSSA 2ZTDA 2R7DA 5M5YB 2A68C 3GTKH 1E2ZA 4HIDA 4IOAA 3L9AX 4HEDA 3PO3H 2UXBQ 2JE6I 2E2HB 5FLMG 4IUTA 1Z47A 3PIO3 1KC8C 1PLFA 2HDMA 2QGQA 1N33Q 5ELBA 2B2WC 4X3UA 5CBAE 1EYAA 3U4VA 4KLKA 3FKIG 3Q6SA 2SNMA 1K8AC 2KQ3A 2SEBD 2WKDA 1JMCA 2F0SA 1VQEA 5BR8L 1Y1WB 2V1CC 4KHPL 3LGJA 3OMCA 2MHVA 4C56C 1ZYRD 4FF2A 5C4JB 1S5BD 3RMHA 5C3WA 1F2ZA 1NMFA 4C3JB 3M4OH 3I3CA 2NVQB 1U4RA 3S17B 2JEAI 2MO1A 1A62A 3OSOA 1IL2A 3S1NH 4IFDH 4B3RL 3DHQA 1VMPA 3NTKA 2EYPA 2MPMA 3P75A 1L0WA 1EL0A 1S5CD 4ZAIA 5C0XG 4YCVA 1EWHA 4KV6A 4NXNQ 2KJXA 1EY7A 2N55A 5GROA 4B9XA 2Z6KA 2NVXH 2RDHA 3R2IA 2E2JH 3O13A 1KDCA 3KFUA 3HFZB 2D2CC 2HHHL 1SNPA 3D31A 4IUQA 2TSSA 5COYA 3I4LA 1WTOA 3QWNA 5KNCA 4DR4L 3KLRA 1X54A 2EDGA 3D0FA 2UXBL 1D5XC 2R7ZB 4YWLA 2OWOA 2ICIA 5DLQE 3S1QB 4U68A 3J81c 4DV7Q 2PNRC 5JJKA 4G7HC 5DNFA 2KA7A 2XTIA 2K52A 4B3MQ 3GTLB 3S15B 4RHRA 3DEPA 3I4MH 1MGSA 3FRPB 2I46A 3ULPA 2JA7B 4LWCA 3PV0A 2NVYH 4JW0A 5ELCA 1XNQQ 1MJCA 5IGFA 1V1QA 4HCSA 4UP7A 4WFN3 1VQOA 3BDLA 3U9SA 3VA7A 4NXMQ 2ZTEA 3OIQA 2F0NA 2SNSA 2FJ2A 4UY8C 4A3DH 1EIFA 1QE6A 2D0OA 2BE5D 3SEBA 3EFXD 2IJ0A 1OXTA 5M5XH 1G291 4JCVE 2CCZA 2E75C 1C8CA 2CWAA 2QA4A 3BYTB 5CV5A 4YWMA 1VQJA 4DUZQ 1Y1WG 1T5EA 1MI2A 1F9SA 4G7ZC 1IBLQ 3SK6A 1VQPA 1HQRD 4LF5Q 4DR1L 2IW3A 1Y14B 3TN2A 3DWPA 4A93G 4LF9Q 3H94A 4IUPA 4L5SA 2F3IA 3TP6A 3CC7A 1Q46A 1LACA 2JYOA 4LF8L 1X3QA 1O7LA 2E76C 2A6ED 4HJAA 4RKBA 3J80i 4C3IG 3Q24A 4A3JH 4HIKA 2B8GA 3K0XA 1B9NA 2Q8RE 3D6CA 3BZCA 1HTPA 1VQKA 4GLVB 1E2VA 1KHIA 4A3MG 2WIIB 3ER0A 1PZKD 2AWNA 3SDZA 4KD3A 4ALPA 1KNAA 4PV1C 2EYHA 1IBMQ 3X3MA 1GXDC 1Z6HA 5E3FA 2RSOA 1EQVA 4JG2A 1NE3A 1WCMB 1PYBA 1EEFD 4O0AA 1E0BA 5IT9E 2RF4A 4ZKBB 1PV4A 3G4SA 1SMYC 2PO4A 1JQYD 5HGTA 1S3OA 3HOWG 5CV8A 1WVLA 1PFNA 2K6AA 3GO5A 3KK7A 4C3HG 1TWAB 1CKMA 4G57A 2K5NA 3J7ZC 3M4OB 2BDOA 2FFKB 3PUZA 1PH9A 3C1EA 1FD7D 3K0YA 4RGMA 5E4WC 4CKEA 4DFAA 4BBRB 2YTYA 3U50C 1L1OA 2B39A 3Q22A 1GD7A 4K14A 4CDDC 1S4ZA 1U0LA 4MZ9A 1NY4A 4A93B 2WINB 2XRQD 1LLRD 1Y8PB 3UDIA 5IODA 5JAVA 3OIPA 2F3WA 1X55A 4RGNA 3OYYA 2M9VA 1J5EL 4BY1B 5CV4A 2HCCA 1JOOA 3NXWA 4J1MA 2KUMA 5CORA 1CT1D 1K83H 5FLXE 1QG7A 3PO3B 4RFBA 3TDQA 2MUYA 1JE5A 3BDCA 1JR0D 2CHBD 1TWCB 1W2BA 5A35A 4QUFA 2F03A 1EUJA 3FP9A 4OIKA 1K8OA 3JAMc 1FL0A 1PRTF 4QMGA 1B7YB 4FXKC 5K5PA 5LMNQ 5IYCH 4BBSH 1SNQA 3PO2H 3GTLH 2BDNA 4RG1A 3HOZG 4A3IH 4DV4Q 1TY2A 1HR0L 1A15A 4PG3A 2QKIC 5IOCA 3ERQA 2L11A 3HOXG 1PH6A 3HG9A 2L4NA 2B63H 2DJGC 1MSHA 1HA6A 1L1OC 3KF6A 4EQOA 3U58A 5IWAL 4A3MB 4B3SL 3TS0A 1VCIA 4NB3A 4DV7L 3C2PA 4QCLA 4OXPA 4JOIC 4JK1C 1OTCA 5M5XB 1FGBD 3H0GG 1SE3A 1WFQA 2N88A 2OF1A 2X6GA 4B3TL 1STAA 2ASBA 1JICA 3E6ZX 1WJJA 2Z0SA 3VR2A 2R93G 4A3FB 4HN7A 4NXNL 2UUCL 2ZJPA 2Z4HA 3PQIA 1QOHA 4LF6Q 1JOQA 1ML0D 1STNA 1H9RA 2GN5A 1Q7YC 1JJCB 3M9BA 1PFBA 4DV3L 3S9WA 5HURA 1AN8A 2CW0D 4IFDJ 2DN8A 3RNUA 3MVVA 3ULJA 2MFIA 1BNZA 5ELEA 2K5DA 4NPSA 4DR7Q 2DJFC 1BQQT 2ZJRA 4BBSG 2Z9HA 1C48A 1E1TA 5IYCG 1KRSA 3HGBA 4R4QA 1HQMC 1NTGA 4XT3B 4A3BG 3DEOA 4XTCS 1DGSA 4DR6L 2HUGA 1CK1A 5C3EG 3CF5A 2R7ZH 1DCZA 1JE4A 2EJFC 3RZDH 4HMJA 1A2TA 1U4MA 1IYVA 3HOXH 1AEXA 1B2TA 4NMZA 4DF7A 2EIFA 2V4DA 1E3PA 4LF6L 3PUWA 2DY7A 1A0IA 1BCPB 1N33L 4GKJQ 2KCTA 1V1PA 2HQLA 4WORA 5HY6A 2ATWA 1EYCA 2XSCA 4FF3A 1C4QA 4GNXC 4QY7A 3CCRA 4DV2L 3MXPA 1YHBA 5C0XJ 4DXFA 2O4XA 1PMRA 1LUZA 4BY1H 3QO2A 4E6IA 1EQTA 3A74A 4JI4L 3PMFA 4HSPA 5A2QL 5M3FH 3S2DH 4JV5Q 1I50H 1ZYRC 4X62Q 3Q0AA 3GTOH 3D4RA 1JJGA 1CUKA 4LFCL 3L0OA 3GV6A 2BA0A 2QILA 3H0GB 3MHBA 4F87A 1IYUA 3TRZA 2Z6KC 2Z8LA 4BY1G 4CGYB 3TS2A 3W2DA 1TIID 4K8IA 2K05A 3GTKB 3OW7A 4YY3L 1IKLA 5BN4A 1Q1BA 1EIHA 1RDPD 3GP7A 1FNWA 3J81i 1S72A 4ZRZA 3TMEA
chains in the Genus database with same CATH topology
3PO2G 4DAYB 4A3FG 1YNXA 1VQBA 3NENA 4C3JH 4A3EH 1XPOA 4C3IH 2PI2A 2GVBA 4A3JG 2YU9H 1XNRQ 5LMUQ 2NVQH 4R4IA 2R7ZG 1UE1A 4X65Q 3CD6A 4KHZA 4R4OA 1EOVA 1PH8A 3GDEA 3PSIA 3KJOA 3ZJYC 4LFCQ 4GKJL 3U4ZA 5GAGC 1YI2A 1QUQA 4J15A 1E7ZA 4R4TA 4A4IA 4LF6Q 1P8LA 1IZ6A 4JI1Q 2UU9L 4GS3A 2CFMA 1BKBA 5IP7H 1HR0W 4GKKL 1I5FA 4JYAL 1KXLA 1SN8A 5ELOA 2R93H 2D62A 5JJIA 1D7QA 3RLNA 3BZKA 2Q2UA 3PIPA 1N9WA 4IPGA 2C35B 3RN2A 3HKZE 4OO1I 5M3FG 1IBKL 1ASZA 3S15H 4JV5L 4PMWA 1XMOL 4QGUA 4R4CA 2MNAA 4X62L 3B6YA 3BU2A 1QVFA 4IOCA 1XTDA 3HOVH 3KYHC 4GLXA 1VQFA 4DV0L 4OX9L 2GVAA 4LUOA 3IRBA 4BBRG 4YY3Q 4H02A 2KHJA 2ZTDA 2R7DA 1NJIC 3CXCA 4EQ5A 3GTKH 4HIDA 2L15A 4IOAA 5JJLA 2JA8H 3PO3H 1N34L 2JE6I 2UXCQ 1YHAA 2UXBQ 1JB7A 1HZ9A 4YCUA 2PMZE 1QUQB 5FLMG 3HOWH 2I5HA 1A63A 1MJEA 1Z47A 4L5RC 2VNUD 3ERSX 1KC8C 5IP7G 2QGQA 3PIOA 1EYGA 1IYJB 1N33Q 2F4VQ 1XMQQ 4DK6C 1E24A 3FHWA 3CCUA 3U4VA 1SFOH 3CC2A 3J81j 4KLKA 4DNIA 4JI6Q 2IY5B 3FKIG 3EN2A 4QQBX 1K8AC 4FDBA 4DV1Q 4QIWE 3CMEA 3FKIH 4JC0A 3CCEA 1IBKQ 4JBKA 4WJ4A 1OXXK 1SMXA 1O7IA 2JA5H 3PUYA 1JMCA 5K36G 2B63G 1VQEA 5BR8L 1XPUA 4KHPL 2V1CC 1XNQL 3K80C 3LGJA 3WWVA 4A3FH 1YBYA 2PQAA 2N8NA 4OONA 3RZOH 1TWCH 2WFWA 1PA6A 1XPRA 3S24A 4JOIA 3T1HQ 1N36L 4DR5L 3HKSA 4A3MH 3CQZH 1HNZQ 4K0KQ 1PVOA 1NMFA 2H5XA 3GD7A 4X66L 3E0EA 4DKAC 3I4NH 2EQSA 1PH4A 3M4OH 4DR4Q 4IJHA 4XIGS 2JEAI 2MO1A 1A62A 1SRUA 1IL2A 3S1NH 4B3RL 4JI6L 2IT1A 3STBD 1J5EQ 1C9OA 1L0WA 5E7NA 4P71A 4AYBG 1TWFH 2B3GA 2D0PA 2MQHA 1K8GA 5C0XG 4YCVA 2K75A 2YTVA 3NBHB 4NXNQ 1NMGA 5GROA 2UUBQ 4A93H 2Z6KA 3HKZG 3S17H 2NVXH 2E2JH 1VQLA 4BY7G 1OXVA 4DV6L 2AWOA 3KFUA 3HFZB 3JC66 1Q86C 2HHHL 1AE2A 1Q81C 1B8AA 3D31A 4DPGA 2NN6I 1EFWA 4A75A 1C7YA 2BH2A 1K73C 1BBUA 3I7FA 3H0GH 4DR4L 1P16A 1X54A 2IX0A 2I0QA 3D0FA 1N34Q 1VQ9A 1EQRA 2UXBL 1UE6A 4K0KL 4YWLA 1I94L 2OWOA 4P73A 4HJ9A 1K3RA 1A8VA 4A3KG 4A3GH 5DLQE 5ELNA 3J81c 4DV7Q 1G51A 2CKZB 3CCJA 1TXYA 2UUAL 5JJKA 4A3EG 1XMOQ 1B70B 2VL6A 1PH1A 2KHIA 4IFDI 2UUBL 2XTIA 1WYDA 4A3DG 2K52A 4B3MQ 5JEAG 2HIVA 1IBLL 3NELA 4A3IG 4A3CG 3I4MH 1EWIA 1XMQL 4DK3C 3I55A 4APVA 2UUCQ 5C0XI 4BY7H 4X6AH 3CPFA 1NBWA 5M3MH 1FJGQ 1BVSA 4DUZL 4LF4L 2JJQA 2KBNA 2OCEA 3ULPA 5M5WH 2ZM6L 1PH7A 2N3SA 4LWCA 3H15A 2UXDL 4POGA 3PV0A 3CCQA 1SLJA 4B3TQ 3M3YH 1VQDA 2NVYH 3F2BA 2RHSB 3BJUA 2I5LX 1CKNB 4MNOA 1UEBA 2K14A 2E2HH 2KCMA 4GOPB 4IFDG 1XNQQ 1GVPA 5JEAJ 1MJCA 4QJFA 1RL2A 3ULLA 4DR3Q 1V1QA 2LXKA 5C44G 4X65L 1KQSA 4UP7A 3I4NG 3AFPA 3I4MG 2OQ0A 1VQOA 1VQ8A 2AMCB 2Y0SG 2OQKA 4NXMQ 2ZTEA 3ICEA 4A3CH 4DV1L 4DUYQ 4JI0L 3HOZH 1L2FA 4UY8C 4A3DH 3F2DA 2A19A 3TQYA 1EIFA 1AE3A 2D0OA 1MIUA 4Y7NH 4BA1I 4LF9L 4GN3B 3RN5A 3EIVA 1YZ6A 4X64Q 3MXNB 1OXTA 1E22A 2K50A 1G291 4JCVE 5M5XH 1VQHA 2CCZA 3H3VI 1YITA 1N8RC 1K9MC 2CWAA 2QA4A 1X9NA 4LUVA 3S1RH 4YWMA 1VQJA 4IPHA 2E5LL 2ID0A 4JI3Q 3K7UC 4DUZQ 1Y1WG 4LF4Q 4JI7Q 3F1ZA 3DLLA 1X6OA 4P72A 1N32L 1FVIA 1IBLQ 1I6HH 4GLAC 4LF8Q 1HNWL 1VQPA 3PF4A 3T1YQ 4JI2Q 1C0AA 2R92G 1VQ6A 4LF5Q 4DR1L 2PQAB 1Y14B 5FJ8H 4Y52H 5LMUL 4A93G 4LF9Q 3JAMi 1XNRL 1AH9A 1GO3E 3PCOB 4L5SA 2F3IA 3CC7A 1Q46A 1G6PA 4AH6A 1X3FA 1I94Q 4LF8L 1HNWQ 3S16H 4YHHL 2AKWB 1OXUA 4OWXB 1TWHH 1QZGA 2K4KA 4AIMA 4HJAA 1YJ9A 1VQ7A 5HGQA 3J80i 4A3JH 4JI7L 1X65A 4KI0A 5H1SE 4HIKA 2Q2TA 3K0XA 2LSSA 3KF8B 4C3HH 3BZCA 3H3VH 5AJ3Q 4DV2Q 4GLVB 1YJNA 1VQKA 1KHIA 4A3MG 2HIXA 4JI3L 3RLFA 3ER0A 2ZTCA 3M7NA 2ZJQA 2AWNA 2IHFA 2E8GA 5IYDG 2VQEL 5C44H 2CQOA 2K5HA 4LF7Q 2QEXA 1L1OB 4ALPA 2VZAA 2EXDA 1X3EA 2WB1G 4PZ6A 1KRTA 1IBMQ 2MO0A 4JI0Q 1M1KC 4P74A 3I4OA 4YHHQ 4JG2A 1VQAA 1PH3A 4A3BH 1NE3A 4BA2I 2IX1A 3F2CA 1PYBA 3A5UA 1UE5A 4O0AA 4DR3L 3TEHB 1VQCA 5FJ8G 4GOPC 2RF4A 4JBWA 1X56A 1PV4A 3HOYG 3G4SA 3F8TA 5GAHC 1S3OA 1VQNA 3HOWG 3S1MH 2Q2HA 1FGUA 2A1AA 3GO5A 4R1JA 1YJWA 3CMAA 5FLXc 2JA8G 4HJ7A 4KHPQ 1CKMA 3PO3G 2K5NA 1E1OA 2Q2IA 4OWTB 2YYZA 4UP8A 3J7ZC 4IPDA 1FJGL 4HJ8A 4DR2Q 3PUZA 2ZM6Q 1PH9A 4GOPA 3EBEA 2CWPA 4L5QA 1YIJA 4A3GG 1T9HA 4A3KH 2YTYA 2E5LQ 1J6QA 3U50C 1L1OA 2VY3A 3AEVA 1GD7A 3RLOA 3K8AA 3CAMA 1U0LA 2NN6G 4MZ9A 1NY4A 5IY0A 4BXXH 2FXQA 3UDIA 2R7FA 1VQGA 4EX5A 5EAYA 1X3GA 2F52A 4DUYL 1GKHA 1VS0A 1W3SA 1X55A 3OYYA 1QVGA 1J5EL 2ALYB 3HOUG 3CW2C 3UDXA 3HOYH 4DR7L 3PUVA 3G6EA 4JBJA 4DV5Q 4QL5A 4RMFA 3A5ZB 1K83H 1LTLA 5C3EH 3OTOL 3J80c 1JE5A 5IWAQ 2LXJA 3G71A 2HHHQ 5C4JH 1W2BA 2B29A 4DV6Q 1EUJA 3FP9A 4JI8L 2WAQG 4DV3Q 3JAMc 1IXRA 1FL0A 3TREA 5IT9c 5GADC 1B7YB 3PUXA 1UE7A 3CPWA 5LMNQ 5IYCH 4JI2L 5C4XG 4BBSH 1WCMH 1PYSB 2UXDQ 3PGZA 4IPCA 3HOUH 3PO2H 2K5VA 3GTLH 4RG1A 4JI5Q 3HOZG 1JJ2A 3E9IA 4DV4Q 5IP9H 4A3IH 4GN5A 5J3BA 1HR0L 4PG3A 3KOJA 4BXXG 3RR5A 4GNXB 4DAMA 3HOXG 1PH6A 2BA1A 2JK8A 1Z9FA 1VQIA 2B63H 2R6GA 2JA5G 4NXML 2UUAQ 4A3LH 2JA6G 1L1OC 2AHOB 1CSQA 1OXSC 3KF6A 3U58A 4DR5Q 4BBRH 3S2HH 5IWAL 4B3SL 3TS0A 1VCIA 3KLWA 4NB3A 4DV7L 1Q8KA 3OW2A 4OXPA 4DV5L 4JOIC 4HIMA 2JEBI 1LM0A 1OTCA 2Y0SE 3H0GG 5BR8Q 1PH5A 2WB1E 1WFQA 2ASBA 3Q8DA 1PFSA 1HZAA 3K7AH 3PF5A 4B3TL 1WOCA 1TWAH 1KAWA 5IYBG 2A8VA 1WJJA 2R92H 2Z0SA 1WI5A 4AQYQ 4OX9Q 3E9HA 2R93G 4GN4B 2NVTH 4NXNL 1VQ5A 5IYBH 2UUCL 2JQOA 2ZJPA 4LW1A 1BBWA 4LFBL 1CKNA 3CCMA 3S14H 3GTPH 4POFA 4HJ5A 1HR0Q 4DV4L 4DR6Q 2OTJA 4IJLA 1YEZA 4O2DA 2GN5A 2F4VL 2DUDA 1KL9A 3KDFB 1Q7YC 2JA6H 1TWGH 1JJCB 4X66Q 3M9BA 4DV3L 2ES2A 4A3LG 1H95A 4TQUS 3L2PA 2PNHA 1HNZL 3M85A 2WAQE 5IYDH 4IO9A 1Y1VH 2DGYA 2VUMG 4B3RQ 2UXCL 4DR2L 5LMNW 3NEMA 4IFDJ 4JI8Q 4LUZA 1Q12A 5GQOA 3ULJA 2MFIA 3RNUA 3K81C 4P75A 3KJPA 3T1HL 1VQMA 1N36Q 4B3SQ 4NPSA 5C4XH 4DR7Q 1CSPA 1V43A 1HJPA 4UP9A 2ZJRA 4BBSG 2VW9A 5IYCG 1E1TA 2VQFQ 3M4QA 2E2IH 1KRSA 4ME3A 2N78A 3UDGA 3G48A 4R4QA 2XGTA 1HZCA 1NTGA 1KD1C 2NZHA 4LNQA 1EIYB 1YHQA 1ASYA 4A3BG 4TVAB 3AFQA 4XTCS 1DGSA 2VQEQ 2VS1A 4PZ7A 3MEFA 4C2MH 4DR6L 2KENA 4AYBE 1QZHA 5C3EG 3CF5A 1S40A 2R7ZH 3GTQH 4LFBQ 4LFAQ 3RZDH 4YWKA 1HNXL 2UU9Q 3CP0A 1I3QH 3CCSA 4YCWA 5M3MG 3KDFA 3CCVA 3UE0A 3HOXH 4LF7L 4OWWB 2EIFA 1SR3A 3M4PA 4OO1G 1E3PA 4LF6L 3PUWA 1A0IA 1K0RA 5GAEC 5FLMH 1N33L 1VQ4A 2KCTA 3DM3A 1Y1VG 2RHQB 2VUMH 2HQLA 5HY6A 2ATWA 1HH2P 5M5YH 3J7A5 1HNXQ 4UPAA 4GNXC 4QY7A 2PI2E 5AJ3L 3CCRA 4DV2L 1SE8A 4MTNA 1YHBA 4DV0Q 1U5KA 3STBC 5C0XJ 2JA7G 1YVCA 3W1BA 2RCNA 3A0JA 3CC4A 4JBMA 1LUZA 4BY1H 1UWVA 3A74A 1HZBA 4WJ3M 4JI4L 3W1GA 1GM5A 2VQFL 5IE8A 1Q82C 4HIOA 1QVCA 4JI4Q 1V9PA 5M3FH 3S2DH 4JV5Q 1N32Q 1I50H 1CKOA 1MKHA 4GNXA 1PHJA 1IBML 4X62Q 4L5TA 1RIPA 3L7ZC 1D8LA 1KIXA 3GTOH 3AQQA 4JI5L 4DR1Q 2OTLA 1JJGA 3T1YL 1CUKA 4LFCL 1Q1EA 3KF6B 3L0OA 3GTMH 3AYHB 2BA0A 5LMNL 2N49A 4JI1L 3S1QH 1Y1WH 2NZOA 3TRZA 4GKKQ 2Z6KC 4JYAQ 3UE1A 3VDYA 4BY1G 2BH8A 1R9TH 1M90C 3W5OA 2I5MX 2HT1A 2JA7H 3SGIA 3TS2A 3OTOQ 3HOVG 3CCLA 4LFAL 2WP8J 4GKJQ 4B3ML 4YY3L 1PH2A 4X64L 3I56A 1LYLA 1Q1BA 3I2ZA 4PZ8A 2YV5A 5IP9G 4AQYL 3UDFA 1SROA 2YTXA 3J81i 3GTJH 1S72A 1EQQA 2JA9A 1JT8A 1WCMG 3GTGH 4A76A 2IHEA 4LF5L 1XJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 G;  4DAY B;  4A3F G;  1YNX A;  1VQB A;  3NEN A;  4C3J H;  4A3E H;  1XPO A;  4C3I H;  2PI2 A;  2GVB A;  4A3J G;  2YU9 H;  1XNR Q;  5LMU Q;  2NVQ H;  4R4I A;  2R7Z G;  1UE1 A;  4X65 Q;  3CD6 A;  4KHZ A;  4R4O A;  1EOV A;  1PH8 A;  3GDE A;  3PSI A;  3KJO A;  3ZJY C;  4LFC Q;  4GKJ L;  3U4Z A;  5GAG C;  1YI2 A;  1QUQ A;  4J15 A;  1E7Z A;  4R4T A;  4A4I A;  4LF6 Q;  1P8L A;  1IZ6 A;  4JI1 Q;  2UU9 L;  4GS3 A;  2CFM A;  1BKB A;  5IP7 H;  1HR0 W;  4GKK L;  1I5F A;  4JYA L;  1KXL A;  1SN8 A;  5ELO A;  2R93 H;  2D62 A;  5JJI A;  1D7Q A;  3RLN A;  3BZK A;  2Q2U A;  3PIP A;  1N9W A;  4IPG A;  2C35 B;  3RN2 A;  3HKZ E;  4OO1 I;  5M3F G;  1IBK L;  1ASZ A;  3S15 H;  4JV5 L;  4PMW A;  1XMO L;  4QGU A;  4R4C A;  2MNA A;  4X62 L;  3B6Y A;  3BU2 A;  1QVF A;  4IOC A;  1XTD A;  3HOV H;  3KYH C;  4GLX A;  1VQF A;  4DV0 L;  4OX9 L;  2GVA A;  4LUO A;  3IRB A;  4BBR G;  4YY3 Q;  4H02 A;  2KHJ A;  2ZTD A;  2R7D A;  1NJI C;  3CXC A;  4EQ5 A;  3GTK H;  4HID A;  2L15 A;  4IOA A;  5JJL A;  2JA8 H;  3PO3 H;  1N34 L;  2JE6 I;  2UXC Q;  1YHA A;  2UXB Q;  1JB7 A;  1HZ9 A;  4YCU A;  2PMZ E;  1QUQ B;  5FLM G;  3HOW H;  2I5H A;  1A63 A;  1MJE A;  1Z47 A;  4L5R C;  2VNU D;  3ERS X;  1KC8 C;  5IP7 G;  2QGQ A;  3PIO A;  1EYG A;  1IYJ B;  1N33 Q;  2F4V Q;  1XMQ Q;  4DK6 C;  1E24 A;  3FHW A;  3CCU A;  3U4V A;  1SFO H;  3CC2 A;  3J81 j;  4KLK A;  4DNI A;  4JI6 Q;  2IY5 B;  3FKI G;  3EN2 A;  4QQB X;  1K8A C;  4FDB A;  4DV1 Q;  4QIW E;  3CME A;  3FKI H;  4JC0 A;  3CCE A;  1IBK Q;  4JBK A;  4WJ4 A;  1OXX K;  1SMX A;  1O7I A;  2JA5 H;  3PUY A;  1JMC A;  5K36 G;  2B63 G;  1VQE A;  5BR8 L;  1XPU A;  4KHP L;  2V1C C;  1XNQ L;  3K80 C;  3LGJ A;  3WWV A;  4A3F H;  1YBY A;  2PQA A;  2N8N A;  4OON A;  3RZO H;  1TWC H;  2WFW A;  1PA6 A;  1XPR A;  3S24 A;  4JOI A;  3T1H Q;  1N36 L;  4DR5 L;  3HKS A;  4A3M H;  3CQZ H;  1HNZ Q;  4K0K Q;  1PVO A;  1NMF A;  2H5X A;  3GD7 A;  4X66 L;  3E0E A;  4DKA C;  3I4N H;  2EQS A;  1PH4 A;  3M4O H;  4DR4 Q;  4IJH A;  4XIG S;  2JEA I;  2MO1 A;  1A62 A;  1SRU A;  1IL2 A;  3S1N H;  4B3R L;  4JI6 L;  2IT1 A;  3STB D;  1J5E Q;  1C9O A;  1L0W A;  5E7N A;  4P71 A;  4AYB G;  1TWF H;  2B3G A;  2D0P A;  2MQH A;  1K8G A;  5C0X G;  4YCV A;  2K75 A;  2YTV A;  3NBH B;  4NXN Q;  1NMG A;  5GRO A;  2UUB Q;  4A93 H;  2Z6K A;  3HKZ G;  3S17 H;  2NVX H;  2E2J H;  1VQL A;  4BY7 G;  1OXV A;  4DV6 L;  2AWO A;  3KFU A;  3HFZ B;  3JC6 6;  1Q86 C;  2HHH L;  1AE2 A;  1Q81 C;  1B8A A;  3D31 A;  4DPG A;  2NN6 I;  1EFW A;  4A75 A;  1C7Y A;  2BH2 A;  1K73 C;  1BBU A;  3I7F A;  3H0G H;  4DR4 L;  1P16 A;  1X54 A;  2IX0 A;  2I0Q A;  3D0F A;  1N34 Q;  1VQ9 A;  1EQR A;  2UXB L;  1UE6 A;  4K0K L;  4YWL A;  1I94 L;  2OWO A;  4P73 A;  4HJ9 A;  1K3R A;  1A8V A;  4A3K G;  4A3G H;  5DLQ E;  5ELN A;  3J81 c;  4DV7 Q;  1G51 A;  2CKZ B;  3CCJ A;  1TXY A;  2UUA L;  5JJK A;  4A3E G;  1XMO Q;  1B70 B;  2VL6 A;  1PH1 A;  2KHI A;  4IFD I;  2UUB L;  2XTI A;  1WYD A;  4A3D G;  2K52 A;  4B3M Q;  5JEA G;  2HIV A;  1IBL L;  3NEL A;  4A3I G;  4A3C G;  3I4M H;  1EWI A;  1XMQ L;  4DK3 C;  3I55 A;  4APV A;  2UUC Q;  5C0X I;  4BY7 H;  4X6A H;  3CPF A;  1NBW A;  5M3M H;  1FJG Q;  1BVS A;  4DUZ L;  4LF4 L;  2JJQ A;  2KBN A;  2OCE A;  3ULP A;  5M5W H;  2ZM6 L;  1PH7 A;  2N3S A;  4LWC A;  3H15 A;  2UXD L;  4POG A;  3PV0 A;  3CCQ A;  1SLJ A;  4B3T Q;  3M3Y H;  1VQD A;  2NVY H;  3F2B A;  2RHS B;  3BJU A;  2I5L X;  1CKN B;  4MNO A;  1UEB A;  2K14 A;  2E2H H;  2KCM A;  4GOP B;  4IFD G;  1XNQ Q;  1GVP A;  5JEA J;  1MJC A;  4QJF A;  1RL2 A;  3ULL A;  4DR3 Q;  1V1Q A;  2LXK A;  5C44 G;  4X65 L;  1KQS A;  4UP7 A;  3I4N G;  3AFP A;  3I4M G;  2OQ0 A;  1VQO A;  1VQ8 A;  2AMC B;  2Y0S G;  2OQK A;  4NXM Q;  2ZTE A;  3ICE A;  4A3C H;  4DV1 L;  4DUY Q;  4JI0 L;  3HOZ H;  1L2F A;  4UY8 C;  4A3D H;  3F2D A;  2A19 A;  3TQY A;  1EIF A;  1AE3 A;  2D0O A;  1MIU A;  4Y7N H;  4BA1 I;  4LF9 L;  4GN3 B;  3RN5 A;  3EIV A;  1YZ6 A;  4X64 Q;  3MXN B;  1OXT A;  1E22 A;  2K50 A;  1G29 1;  4JCV E;  5M5X H;  1VQH A;  2CCZ A;  3H3V I;  1YIT A;  1N8R C;  1K9M C;  2CWA A;  2QA4 A;  1X9N A;  4LUV A;  3S1R H;  4YWM A;  1VQJ A;  4IPH A;  2E5L L;  2ID0 A;  4JI3 Q;  3K7U C;  4DUZ Q;  1Y1W G;  4LF4 Q;  4JI7 Q;  3F1Z A;  3DLL A;  1X6O A;  4P72 A;  1N32 L;  1FVI A;  1IBL Q;  1I6H H;  4GLA C;  4LF8 Q;  1HNW L;  1VQP A;  3PF4 A;  3T1Y Q;  4JI2 Q;  1C0A A;  2R92 G;  1VQ6 A;  4LF5 Q;  4DR1 L;  2PQA B;  1Y14 B;  5FJ8 H;  4Y52 H;  5LMU L;  4A93 G;  4LF9 Q;  3JAM i;  1XNR L;  1AH9 A;  1GO3 E;  3PCO B;  4L5S A;  2F3I A;  3CC7 A;  1Q46 A;  1G6P A;  4AH6 A;  1X3F A;  1I94 Q;  4LF8 L;  1HNW Q;  3S16 H;  4YHH L;  2AKW B;  1OXU A;  4OWX B;  1TWH H;  1QZG A;  2K4K A;  4AIM A;  4HJA A;  1YJ9 A;  1VQ7 A;  5HGQ A;  3J80 i;  4A3J H;  4JI7 L;  1X65 A;  4KI0 A;  5H1S E;  4HIK A;  2Q2T A;  3K0X A;  2LSS A;  3KF8 B;  4C3H H;  3BZC A;  3H3V H;  5AJ3 Q;  4DV2 Q;  4GLV B;  1YJN A;  1VQK A;  1KHI A;  4A3M G;  2HIX A;  4JI3 L;  3RLF A;  3ER0 A;  2ZTC A;  3M7N A;  2ZJQ A;  2AWN A;  2IHF A;  2E8G A;  5IYD G;  2VQE L;  5C44 H;  2CQO A;  2K5H A;  4LF7 Q;  2QEX A;  1L1O B;  4ALP A;  2VZA A;  2EXD A;  1X3E A;  2WB1 G;  4PZ6 A;  1KRT A;  1IBM Q;  2MO0 A;  4JI0 Q;  1M1K C;  4P74 A;  3I4O A;  4YHH Q;  4JG2 A;  1VQA A;  1PH3 A;  4A3B H;  1NE3 A;  4BA2 I;  2IX1 A;  3F2C A;  1PYB A;  3A5U A;  1UE5 A;  4O0A A;  4DR3 L;  3TEH B;  1VQC A;  5FJ8 G;  4GOP C;  2RF4 A;  4JBW A;  1X56 A;  1PV4 A;  3HOY G;  3G4S A;  3F8T A;  5GAH C;  1S3O A;  1VQN A;  3HOW G;  3S1M H;  2Q2H A;  1FGU A;  2A1A A;  3GO5 A;  4R1J A;  1YJW A;  3CMA A;  5FLX c;  2JA8 G;  4HJ7 A;  4KHP Q;  1CKM A;  3PO3 G;  2K5N A;  1E1O A;  2Q2I A;  4OWT B;  2YYZ A;  4UP8 A;  3J7Z C;  4IPD A;  1FJG L;  4HJ8 A;  4DR2 Q;  3PUZ A;  2ZM6 Q;  1PH9 A;  4GOP A;  3EBE A;  2CWP A;  4L5Q A;  1YIJ A;  4A3G G;  1T9H A;  4A3K H;  2YTY A;  2E5L Q;  1J6Q A;  3U50 C;  1L1O A;  2VY3 A;  3AEV A;  1GD7 A;  3RLO A;  3K8A A;  3CAM A;  1U0L A;  2NN6 G;  4MZ9 A;  1NY4 A;  5IY0 A;  4BXX H;  2FXQ A;  3UDI A;  2R7F A;  1VQG A;  4EX5 A;  5EAY A;  1X3G A;  2F52 A;  4DUY L;  1GKH A;  1VS0 A;  1W3S A;  1X55 A;  3OYY A;  1QVG A;  1J5E L;  2ALY B;  3HOU G;  3CW2 C;  3UDX A;  3HOY H;  4DR7 L;  3PUV A;  3G6E A;  4JBJ A;  4DV5 Q;  4QL5 A;  4RMF A;  3A5Z B;  1K83 H;  1LTL A;  5C3E H;  3OTO L;  3J80 c;  1JE5 A;  5IWA Q;  2LXJ A;  3G71 A;  2HHH Q;  5C4J H;  1W2B A;  2B29 A;  4DV6 Q;  1EUJ A;  3FP9 A;  4JI8 L;  2WAQ G;  4DV3 Q;  3JAM c;  1IXR A;  1FL0 A;  3TRE A;  5IT9 c;  5GAD C;  1B7Y B;  3PUX A;  1UE7 A;  3CPW A;  5LMN Q;  5IYC H;  4JI2 L;  5C4X G;  4BBS H;  1WCM H;  1PYS B;  2UXD Q;  3PGZ A;  4IPC A;  3HOU H;  3PO2 H;  2K5V A;  3GTL H;  4RG1 A;  4JI5 Q;  3HOZ G;  1JJ2 A;  3E9I A;  4DV4 Q;  5IP9 H;  4A3I H;  4GN5 A;  5J3B A;  1HR0 L;  4PG3 A;  3KOJ A;  4BXX G;  3RR5 A;  4GNX B;  4DAM A;  3HOX G;  1PH6 A;  2BA1 A;  2JK8 A;  1Z9F A;  1VQI A;  2B63 H;  2R6G A;  2JA5 G;  4NXM L;  2UUA Q;  4A3L H;  2JA6 G;  1L1O C;  2AHO B;  1CSQ A;  1OXS C;  3KF6 A;  3U58 A;  4DR5 Q;  4BBR H;  3S2H H;  5IWA L;  4B3S L;  3TS0 A;  1VCI A;  3KLW A;  4NB3 A;  4DV7 L;  1Q8K A;  3OW2 A;  4OXP A;  4DV5 L;  4JOI C;  4HIM A;  2JEB I;  1LM0 A;  1OTC A;  2Y0S E;  3H0G G;  5BR8 Q;  1PH5 A;  2WB1 E;  1WFQ A;  2ASB A;  3Q8D A;  1PFS A;  1HZA A;  3K7A H;  3PF5 A;  4B3T L;  1WOC A;  1TWA H;  1KAW A;  5IYB G;  2A8V A;  1WJJ A;  2R92 H;  2Z0S A;  1WI5 A;  4AQY Q;  4OX9 Q;  3E9H A;  2R93 G;  4GN4 B;  2NVT H;  4NXN L;  1VQ5 A;  5IYB H;  2UUC L;  2JQO A;  2ZJP A;  4LW1 A;  1BBW A;  4LFB L;  1CKN A;  3CCM A;  3S14 H;  3GTP H;  4POF A;  4HJ5 A;  1HR0 Q;  4DV4 L;  4DR6 Q;  2OTJ A;  4IJL A;  1YEZ A;  4O2D A;  2GN5 A;  2F4V L;  2DUD A;  1KL9 A;  3KDF B;  1Q7Y C;  2JA6 H;  1TWG H;  1JJC B;  4X66 Q;  3M9B A;  4DV3 L;  2ES2 A;  4A3L G;  1H95 A;  4TQU S;  3L2P A;  2PNH A;  1HNZ L;  3M85 A;  2WAQ E;  5IYD H;  4IO9 A;  1Y1V H;  2DGY A;  2VUM G;  4B3R Q;  2UXC L;  4DR2 L;  5LMN W;  3NEM A;  4IFD J;  4JI8 Q;  4LUZ A;  1Q12 A;  5GQO A;  3ULJ A;  2MFI A;  3RNU A;  3K81 C;  4P75 A;  3KJP A;  3T1H L;  1VQM A;  1N36 Q;  4B3S Q;  4NPS A;  5C4X H;  4DR7 Q;  1CSP A;  1V43 A;  1HJP A;  4UP9 A;  2ZJR A;  4BBS G;  2VW9 A;  5IYC G;  1E1T A;  2VQF Q;  3M4Q A;  2E2I H;  1KRS A;  4ME3 A;  2N78 A;  3UDG A;  3G48 A;  4R4Q A;  2XGT A;  1HZC A;  1NTG A;  1KD1 C;  2NZH A;  4LNQ A;  1EIY B;  1YHQ A;  1ASY A;  4A3B G;  4TVA B;  3AFQ A;  4XTC S;  1DGS A;  2VQE Q;  2VS1 A;  4PZ7 A;  3MEF A;  4C2M H;  4DR6 L;  2KEN A;  4AYB E;  1QZH A;  5C3E G;  3CF5 A;  1S40 A;  2R7Z H;  3GTQ H;  4LFB Q;  4LFA Q;  3RZD H;  4YWK A;  1HNX L;  2UU9 Q;  3CP0 A;  1I3Q H;  3CCS A;  4YCW A;  5M3M G;  3KDF A;  3CCV A;  3UE0 A;  3HOX H;  4LF7 L;  4OWW B;  2EIF A;  1SR3 A;  3M4P A;  4OO1 G;  1E3P A;  4LF6 L;  3PUW A;  1A0I A;  1K0R A;  5GAE C;  5FLM H;  1N33 L;  1VQ4 A;  2KCT A;  3DM3 A;  1Y1V G;  2RHQ B;  2VUM H;  2HQL A;  5HY6 A;  2ATW A;  1HH2 P;  5M5Y H;  3J7A 5;  1HNX Q;  4UPA A;  4GNX C;  4QY7 A;  2PI2 E;  5AJ3 L;  3CCR A;  4DV2 L;  1SE8 A;  4MTN A;  1YHB A;  4DV0 Q;  1U5K A;  3STB C;  5C0X J;  2JA7 G;  1YVC A;  3W1B A;  2RCN A;  3A0J A;  3CC4 A;  4JBM A;  1LUZ A;  4BY1 H;  1UWV A;  3A74 A;  1HZB A;  4WJ3 M;  4JI4 L;  3W1G A;  1GM5 A;  2VQF L;  5IE8 A;  1Q82 C;  4HIO A;  1QVC A;  4JI4 Q;  1V9P A;  5M3F H;  3S2D H;  4JV5 Q;  1N32 Q;  1I50 H;  1CKO A;  1MKH A;  4GNX A;  1PHJ A;  1IBM L;  4X62 Q;  4L5T A;  1RIP A;  3L7Z C;  1D8L A;  1KIX A;  3GTO H;  3AQQ A;  4JI5 L;  4DR1 Q;  2OTL A;  1JJG A;  3T1Y L;  1CUK A;  4LFC L;  1Q1E A;  3KF6 B;  3L0O A;  3GTM H;  3AYH B;  2BA0 A;  5LMN L;  2N49 A;  4JI1 L;  3S1Q H;  1Y1W H;  2NZO A;  3TRZ A;  4GKK Q;  2Z6K C;  4JYA Q;  3UE1 A;  3VDY A;  4BY1 G;  2BH8 A;  1R9T H;  1M90 C;  3W5O A;  2I5M X;  2HT1 A;  2JA7 H;  3SGI A;  3TS2 A;  3OTO Q;  3HOV G;  3CCL A;  4LFA L;  2WP8 J;  4GKJ Q;  4B3M L;  4YY3 L;  1PH2 A;  4X64 L;  3I56 A;  1LYL A;  1Q1B A;  3I2Z A;  4PZ8 A;  2YV5 A;  5IP9 G;  4AQY L;  3UDF A;  1SRO A;  2YTX A;  3J81 i;  3GTJ H;  1S72 A;  1EQQ A;  2JA9 A;  1JT8 A;  1WCM G;  3GTG H;  4A76 A;  2IHE A;  4LF5 L;  1XJV A; 
#chains in the Genus database with same CATH topology
 1YNX A;  1VQB A;  2Z6B A;  3NEN A;  1XPO A;  4UAI A;  2YU9 H;  2PI2 A;  5NUC A;  4R4I A;  4FVM A;  3CQZ B;  2R7Z G;  4X65 Q;  2EY6 A;  3GDE A;  1A3T A;  3PSI A;  2K1B A;  4GKJ L;  2EYF A;  1E7Z A;  4A4I A;  1CQV A;  4JI1 Q;  3SVM A;  4H7B A;  5IP7 H;  4JYA L;  1KXL A;  1CA6 A;  4JPB W;  1ROD A;  1GUG A;  3T4A C;  1NCV A;  2C35 B;  3J7A V;  3J80 E;  4OO1 I;  3G6J B;  5KYL A;  5M3F G;  3MFG A;  4JV5 L;  1XMO L;  3B6Y A;  4OGQ C;  4DV0 L;  1U4L A;  1EOT A;  4LUO A;  3IRB A;  3LWU A;  4F7X A;  4EQ5 A;  5JJL A;  5FO8 B;  4YCU A;  2PMZ E;  2NUC A;  4IQZ A;  3HOW H;  2I5H A;  1A63 A;  3QOL A;  4L5R C;  1EYG A;  1IYJ B;  1XMQ Q;  3GTM B;  3FHW A;  3A8I E;  4DNI A;  1SBB B;  2IY5 B;  4QQB X;  1QIL A;  5T1I A;  4DV1 Q;  4QIW E;  3FKI H;  4JC0 A;  5DM6 3;  1W6J A;  4JBK A;  5CV7 A;  4WJ4 A;  3PUY A;  1DJR D;  3U9O A;  4K2L A;  1XNQ L;  3K80 C;  2LS0 1;  3WWV A;  1YBY A;  2B2T A;  2N8N A;  3D4D A;  1TWC H;  2RDF A;  2WFW A;  1TT2 A;  4HTH A;  5EKL A;  3S24 A;  1L0X B;  4DR5 L;  4K0K Q;  1S5E D;  1PVO A;  2K33 A;  4X66 L;  1LT4 D;  4DKA C;  1G6Z A;  1PH4 A;  4C3I B;  1TQO A;  4IJH A;  2PCF B;  2IT1 A;  4X3T A;  4P71 A;  1TWF H;  2B2U C;  1B1Z A;  2EJM A;  3I90 A;  5EPK A;  1K8G A;  5KND A;  3R2T A;  3MXU A;  4A93 H;  5KNB A;  1G2S A;  4K2K A;  2G9D A;  4Z9C B;  4IUU A;  4DV6 L;  1Q86 C;  1I4P A;  1IW7 D;  1AE2 A;  2EXZ A;  5D65 A;  1Q81 C;  1B8A A;  1EFW A;  2NN6 I;  4A75 A;  1KNE A;  1K73 C;  3D4W A;  3H0G H;  2IX0 A;  2I0Q A;  2KHS A;  1N34 Q;  1VQ9 A;  3V2T A;  4K0K L;  1KLU D;  3SE0 A;  4ODG A;  4HJ9 A;  5EQ0 A;  1K3R A;  4K5W A;  3VR4 A;  4QB4 A;  1G51 A;  4KJN A;  3T56 B;  1A3U A;  3CCJ A;  1X32 A;  4A3E G;  1PH1 A;  2YU9 B;  4IFD I;  2KHI A;  2WKC A;  2EY5 A;  1OO9 B;  1TWH B;  3VA5 A;  5I2Y A;  2HIV A;  4A3K B;  3IFD A;  3NEL A;  4RKL A;  4A3C G;  1K0S A;  3I55 A;  4APV A;  5C0X I;  3CPF A;  1BVS A;  4LF4 L;  2JJQ A;  1F2Y A;  2AQ2 B;  1PH7 A;  2UXD L;  1EWC A;  1SLJ A;  4HR7 B;  3M3Y H;  1JOR A;  1MBY A;  1D1K A;  2RHS B;  3MTS A;  4MNO A;  1UEB A;  2E2H H;  4IFD G;  1D1I A;  4QJF A;  1QNK A;  1RL2 A;  2LXK A;  3I4M G;  2OQ0 A;  4ID6 A;  4ULL A;  2AMC B;  2Y0S G;  3ICE A;  4DV1 L;  3KBG A;  5EJW A;  4JI0 L;  2EE1 A;  3F2D A;  1AE3 A;  4Y7N H;  1MIU A;  4BA1 I;  3RN5 A;  4G4K A;  1YZ6 A;  3AU7 A;  2NN6 H;  2F0U A;  4X64 Q;  3MXN B;  1PTO F;  2F0O A;  3H3V I;  4NKL A;  1HFG A;  1U4P A;  4OL7 A;  1BXT A;  2E5L L;  3K7U C;  3IAY A;  1ESR A;  4IN3 A;  1ENC A;  1B3A A;  2J0T D;  5DM7 3;  4P72 A;  4MIU A;  3HOX B;  1C0A A;  2R92 G;  1VQ6 A;  3FVQ A;  3J7A F;  2PQA B;  3A56 A;  3JAM i;  1AH9 A;  1IKM A;  3PCO B;  1HFN A;  2A69 D;  5C0X H;  1DOK A;  4NW2 A;  1V1P B;  1X3F A;  1I94 Q;  2AKW B;  2L55 A;  1CFM A;  2LMC B;  4OWX B;  3AMU A;  1VQ7 A;  1ZEQ X;  3G7L A;  2F1M A;  4FNF A;  2RSN A;  1S5F D;  5JVG 3;  5AJ3 Q;  1BR9 A;  1YNN D;  2HIX A;  1PRT B;  2XVS A;  5EKK A;  5CC4 A;  3K7A B;  4JI3 L;  3A8K E;  3OWE B;  4ZUJ A;  3V05 A;  5C3X A;  3M7N A;  2CQA A;  2SOB A;  1YNJ D;  2K5H A;  1H9S A;  4LF7 Q;  2QEX A;  1L1O B;  4L63 B;  5DAU A;  2VZA A;  2EXD A;  1X3E A;  2WB1 G;  1KRT A;  2AQ3 B;  2EJG C;  4L6T B;  4A3D B;  4JI0 Q;  1M1K C;  3I4O A;  4YHH Q;  3GTJ B;  3OHX C;  1GOZ A;  1WTP A;  1PH3 A;  3S14 B;  1UE5 A;  2HCI A;  3HOY G;  2F0F A;  4IZ8 A;  5GAH C;  1VQN A;  2PZU A;  4H13 C;  2RBM A;  1FGU A;  2A1A A;  3HRZ C;  1YJW A;  3CMA A;  5FLX c;  4CDE C;  4OWT B;  1XWE A;  3S1R B;  4HJ8 A;  4DR2 Q;  1XYI A;  2EVB A;  3EBE A;  3NBI A;  2F0G A;  1J6Q A;  1I4H A;  3AEV A;  3RLO A;  1TS5 A;  3V96 A;  2NN6 G;  4BXX H;  3K58 A;  1X3G A;  2DY8 A;  2P5Z X;  3HOU G;  1HXY D;  1SYB A;  4RMF A;  1SXT A;  2Q8I B;  3IKJ A;  3A7A B;  2HHH Q;  3G71 A;  4DV6 Q;  4JI8 L;  4X3K A;  4C3H B;  1SND A;  3CRL C;  3TRE A;  5IT9 c;  1UE7 A;  5C3E B;  1EFI D;  3BVG A;  5C4X G;  1WCM H;  4I65 A;  5FKA C;  4C2M B;  4X3S A;  2K5V A;  2JSO A;  1BCP C;  5ISR A;  4XYO A;  1LT5 D;  1PRT C;  2L0C A;  1VF5 C;  5EBD A;  1LTA D;  4KKS A;  2R6G A;  2JA5 G;  3QJY A;  1U9R A;  4A3L H;  2JA6 G;  5D3I B;  5I2X A;  2MP1 A;  2AHO B;  4DAV A;  4DR5 Q;  3M3Y B;  4DU9 A;  3KLW A;  4DV5 L;  1LM0 A;  5D3D A;  3NQI A;  5BR8 Q;  1KAB A;  1TWA H;  1KAW A;  4O1N A;  1X3P A;  4Y7N B;  2EYM A;  4BWG B;  1KLG D;  4AQY Q;  3VYR A;  1VDZ A;  3FDT A;  3DUZ A;  2NVT H;  4RWS C;  3OMG A;  1SYC A;  2M00 A;  1F9Q A;  4LW1 A;  1CKN A;  3CCM A;  1G8Z D;  4HJ5 A;  2NBF A;  4DV4 L;  4IJL A;  1YEZ A;  2DNE A;  5LHY 1;  3X3N A;  2F4V L;  2JA6 H;  2ICE C;  3HS0 C;  4A3L G;  4KKT A;  3L2P A;  2Z1C A;  5IYD H;  3HP3 A;  1B3Q A;  4GZY C;  2UXC L;  5CYU A;  5LMN W;  1PZJ D;  3NEM A;  4JI8 Q;  2IL8 A;  1GUN A;  1FR3 A;  4P75 A;  3T1H L;  1N36 Q;  4B3S Q;  1AZQ A;  1SEB D;  5KRU A;  5C4X H;  5JPN C;  1CSP A;  1LV9 A;  1HJP A;  1LTR D;  1PFM A;  2VQF Q;  3M4Q A;  2E2I H;  3UDG A;  1QCB D;  4ABN A;  1KD1 C;  2NZH A;  1EIY B;  1YHQ A;  1RJT A;  1TWF B;  1E2W A;  2VS1 A;  4PZ7 A;  1ZKO A;  4JVZ A;  2NZ1 D;  1S40 A;  3GTQ H;  4LFB Q;  1PZI D;  4N8F A;  4C3J G;  1I3Q H;  4YCW A;  3CCV A;  1EZ8 A;  2KVM A;  1D5M C;  2NVY B;  3M4P A;  3OPO A;  5IT9 L;  3ND8 A;  5CV9 A;  3BVZ A;  1Y1V G;  2RHQ B;  1HTL D;  2B63 B;  2PI2 E;  1SE8 A;  1U5K A;  2JA7 G;  1YVC A;  2RCN A;  3A0J A;  4ME5 A;  4JBM A;  1UWV A;  1HZB A;  5IGB A;  4WJ3 M;  3W1G A;  1ONL A;  3VYT A;  4O42 A;  4HIO A;  4RGT A;  4JI4 Q;  1N32 Q;  1CKO A;  5IGC A;  4GNX A;  3I4N B;  4KY5 A;  3I91 A;  2A6H D;  3AQQ A;  4RHS A;  4JI5 L;  1Q90 A;  1ET9 A;  2J4X A;  3DM1 A;  2NWG A;  1ET6 A;  1LT6 D;  2EYJ A;  2N49 A;  5FO7 B;  4CDF C;  1I6V C;  3HOY B;  3UE1 A;  1NSN S;  3SK8 A;  1EU4 A;  2B8F A;  2HT1 A;  3OTO Q;  2NB0 A;  2WP8 J;  4FF4 A;  4HMI A;  4B3M L;  1LYL A;  4F8M A;  3TSS A;  1KTK A;  2YV5 A;  5IP9 G;  1CTM A;  3UDF A;  4AQY L;  4A3I B;  4A3G B;  5JEA H;  1IW7 C;  1BDO A;  3GTG H;  3I73 A;  2IHE A;  1XJV A;  3NQT A;  1IBK Q;  4A3F G;  4JI2 L;  4C3J H;  1F2L A;  4J6H A;  2NVQ H;  2GVB A;  1EY6 A;  1UE1 A;  4ZKC B;  2KED A;  1MHW C;  1PH8 A;  3FEW X;  5LL6 S;  3ZJY C;  5CBE E;  1YI2 A;  1HUN A;  3K5M A;  2KEE A;  4GKK L;  3BYY B;  5AFW A;  2F0W A;  4BY7 B;  3PIP A;  1N9W A;  3L3O C;  3HKZ E;  4FO2 A;  1IBK L;  1ASZ A;  1LTG D;  4MHE A;  4PMW A;  2PMZ B;  2A73 B;  4R4C A;  4OHJ A;  4GLX A;  1KDA A;  2KHJ A;  1NJI C;  3SK4 A;  1NUC A;  5FO9 B;  2JA8 H;  4CDC C;  1PTO B;  3P1H A;  4KY6 A;  1JB7 A;  2XWB B;  1HPC A;  4QUC A;  5D14 A;  5CGK A;  1MJE A;  1TS3 A;  2VNU D;  3ERS X;  3PIO A;  2L12 A;  4DK6 C;  2MJ8 A;  3CCU A;  3CC2 A;  1CHP D;  1I3Q B;  3J81 j;  2XWJ B;  4JI6 Q;  2WAC A;  3EN2 A;  2A68 D;  4FDB A;  5I9O A;  3KLS A;  3CCE A;  5M3F B;  3S2D B;  4WRD A;  3BS1 A;  1OXX K;  4XYQ A;  2JA5 H;  1O7I A;  4EQN A;  1XPU A;  3E3X A;  5J39 A;  4OON A;  3RZO H;  1BOS A;  1ESF A;  2PYK A;  1PA6 A;  1XPR A;  2OXP A;  4JOI A;  1NR4 A;  1V1O A;  1HNZ Q;  2K28 A;  3E0E A;  1B53 A;  4B08 A;  4DR4 Q;  3MA2 B;  1SRU A;  1BF4 A;  4JI6 L;  1J5E Q;  1SJH D;  2CW0 C;  1TKW B;  4AYB G;  3GTO B;  2D0P A;  1O7Y A;  4DNT B;  2L5T A;  3HOV B;  5IGD A;  4A3E B;  1NMG A;  1STY A;  2K7V A;  1SSO A;  5C4Z A;  4IAL A;  3JC6 6;  2EYL A;  4K5X A;  2BH2 A;  1C7Y A;  2EPB A;  1HRJ A;  1BBU A;  1II3 A;  3I7F A;  3KBX A;  1EU3 A;  3NUC A;  4CJ0 B;  1UE6 A;  1I94 L;  4P73 A;  1L0Y B;  1A8V A;  3VR5 A;  4A3G H;  4N8X 1;  5ELN A;  1K28 A;  2BOS A;  2CKZ B;  1RD9 D;  1TXY A;  2UUA L;  2VL6 A;  1T5X D;  2LFN A;  2UUB L;  1WYD A;  5J1Z A;  1PTO C;  5EPL A;  1M8A A;  2GA4 B;  1EIG A;  4A3I G;  1EWI A;  4DN4 M;  5JOB A;  1XMQ L;  2UUC Q;  3NWS A;  4BY7 H;  4X6A H;  1SNM A;  5M3M H;  1FJG Q;  2OCE A;  4DK1 A;  2ZM6 L;  2N3S A;  4POG A;  1RKN A;  1ICW A;  2F0P A;  1XXG A;  4N9T A;  5G3L F;  3HOW B;  2I5L X;  2K14 A;  2KCM A;  1SYG A;  4GOP B;  5JEA J;  4DXG A;  1GUW A;  4DR3 Q;  3W3A A;  3OWF A;  5IGE A;  2VB2 X;  1Q8I A;  1KQS A;  2RVL A;  3I4N G;  3NPP A;  1VQ8 A;  3BVM A;  3GV3 A;  4A3C H;  1TY0 A;  3P7J A;  3H3V C;  3VYS A;  1STG A;  4DUY Q;  1A3V A;  1L2F A;  4RCO A;  4ZLT F;  1B9M A;  3KUP A;  4GN3 B;  4LF9 L;  4NDX A;  3A54 A;  4LJZ C;  5C4X B;  1SDF A;  2PW5 A;  5I9P A;  4TRD A;  1UAP A;  3EQL C;  1N8R C;  2R93 B;  3A55 A;  2ID0 A;  3SXH A;  4LF4 Q;  2RQX A;  3E0J A;  3K5L A;  2FIN B;  4DGZ A;  3DLL A;  1X6O A;  1DOL A;  4OO1 H;  1N32 L;  2KOL A;  2ZXR A;  1I6H H;  2G5D A;  4GLA C;  4LF8 Q;  5BN3 A;  3T1Y Q;  1SJE D;  2PZT A;  4JI2 Q;  1GHK A;  4XXE A;  3LNN A;  2JA5 B;  1ZXT A;  4ZYS A;  1RTO A;  2NVX B;  1GO3 E;  2JA6 B;  1BUV T;  2A5H A;  1IHZ A;  1G6P A;  4AH6 A;  3S16 H;  1OXU A;  4AIM A;  5JVH 3;  5HGQ A;  4KI0 A;  5CMD A;  3KF8 B;  1I4Q A;  2LSS A;  4FXG C;  1UUP A;  3BZD B;  3FPU B;  3H3V H;  3C1F A;  5KGU A;  3QOJ A;  2G9H D;  2CVR A;  3RLF A;  2ZTC A;  2IHF A;  2VQE L;  5C44 H;  2CQO A;  2K04 A;  4C1N K;  4EQP A;  1SNO A;  3SR1 A;  4PZ6 A;  2IPK D;  3EA6 A;  4KN7 C;  1G2T A;  3R93 A;  1VQA A;  4A3B H;  4BA2 I;  3HOU B;  2IX1 A;  5FK9 C;  3A5U A;  2EYO A;  5FJ8 G;  4GOP C;  4EVO A;  1SAP A;  4JBW A;  4AYB B;  5A2Q E;  2Q2H A;  2NTS A;  1FNU A;  4CKC A;  1BBX C;  4PQX A;  2Q2I A;  2YYZ A;  2PW7 A;  2CWP A;  1T9H A;  4A3K H;  1DM0 B;  3K57 A;  2E5L Q;  2VY3 A;  3VR3 A;  2JN4 A;  1YNJ C;  3K8A A;  1WD0 A;  1TS2 A;  3CAM A;  4A3J B;  3UI2 A;  5IY0 A;  1WTR A;  2R7F A;  3ITP A;  5EAY A;  4PNY A;  2F52 A;  2F0T A;  3NSW A;  1GKH A;  4KHV A;  4DUY L;  1W3S A;  2A6H C;  2ALY B;  3UDX A;  4ILW A;  3HOY H;  4V0B A;  3PUV A;  5EPJ A;  3J80 L;  4DV5 Q;  1FYC A;  3FMC A;  5C3E H;  1PTO H;  2X69 A;  1KDB A;  1SNC A;  3TZD A;  2VB3 X;  4DA2 A;  3PUX A;  3CPW A;  2B2V A;  4CJ1 B;  2K5W A;  1PYS B;  1WTH A;  4WJW A;  4JI5 Q;  1K3B C;  3I72 A;  1ILP A;  3F2U A;  4HCE A;  5J3B A;  3CHB D;  5CV6 A;  3RR5 A;  2D5D A;  4GNX B;  4DAM A;  1DZ1 A;  4RH6 A;  1Z9F A;  1EY5 A;  2WV6 D;  5ELD A;  5C4H A;  2UUA Q;  4NXM L;  3KLS X;  4HAE A;  5K36 H;  1CSQ A;  1A2U A;  3S2H H;  1I6H B;  1J8I A;  3OW2 A;  3R8B A;  2Y0S E;  4CKB A;  1DYQ A;  1PH5 A;  2WB1 E;  2OT2 A;  3K7A H;  1EY9 A;  3DMU A;  3Q8D A;  3PF5 A;  5IYB G;  2A8V A;  3RD4 A;  2B2W A;  1VMC A;  4GN4 B;  4RGO S;  1UEA B;  1VQ5 A;  5IYB H;  3R3O A;  1FNV A;  4U67 3;  1SFO B;  1LAB A;  1SE4 A;  3BDO A;  4KY7 A;  3S14 H;  3GTP H;  4POF A;  1HR0 Q;  4DAY A;  2WB1 B;  4TKO B;  1RF2 D;  1R9T B;  3TZU A;  1TWG H;  4X66 Q;  1H95 A;  2DNC A;  3T16 A;  1HNZ L;  3EJI A;  4IO9 A;  2DGY A;  2VUM G;  2AQ1 B;  3QG1 A;  3NHH A;  2X6L A;  2R3Z A;  1Q12 A;  5GQO A;  1VQM A;  4QF4 A;  2O2L D;  3MXG A;  1B4O A;  4XT1 B;  4UP9 A;  2N78 A;  4RA8 A;  1QB5 D;  3G48 A;  4LNQ A;  1B44 D;  4TVA B;  3AFQ A;  2VQE Q;  3PO2 B;  1QZH A;  4XQQ A;  4YWK A;  2UU9 Q;  1V8Q A;  3CP0 A;  2RDG A;  4J8Q A;  3CCS A;  5M3M G;  3KDF A;  3UE0 A;  2K32 A;  3NTI A;  4LF7 L;  5IGG A;  4OWW B;  2A6E C;  3DWA A;  4OO1 G;  2Z4I A;  5FLM H;  2KEC A;  2NTT A;  2VUM H;  5M5Y H;  3J7A 5;  2JXM B;  1EY4 A;  1S5D D;  4UPA A;  5BN5 A;  5AJ3 L;  5IIF A;  2A69 C;  4EGV A;  1NR2 A;  4MN3 A;  2C5C A;  4IUR A;  5I6Y A;  3AB9 A;  1GM5 A;  2VQF L;  3K59 A;  5IE8 A;  1Q82 C;  3D3R A;  1QVC A;  1V9P A;  3S1N B;  3CU7 A;  2ENB A;  1PHJ A;  1IBM L;  1KIX A;  3L7Z C;  1D8L A;  4YIJ A;  5E1F A;  3CRK C;  3T1Y L;  3WOF A;  1DD2 A;  3AYH B;  5M5W B;  5F2D A;  1Y1W H;  4GKK Q;  5KIX A;  4KKU A;  1A6X A;  1PRT D;  2BH8 A;  1BCP D;  2I5M X;  3SGI A;  4S3S A;  2K03 A;  4X64 L;  2O5J C;  4PZ8 A;  5EGT A;  3S16 B;  1SRO A;  3HOZ B;  1JT8 A;  3K6O A;  4A76 A;  3PO2 G;  4KTA A;  4C3I H;  4A3J G;  1XNR Q;  2XRS D;  5LMU Q;  1RHP A;  4FF1 A;  1RTN A;  3CD6 A;  2F0E A;  4KHZ A;  1EOV A;  3C3L A;  1MD2 D;  5GAG C;  2SDF A;  5L37 A;  1P8L A;  3SHL A;  1D6E C;  4GS3 A;  2CFM A;  4OEM B;  5ELO A;  2K01 A;  2R93 H;  4LK1 C;  2ZT9 C;  3RLN A;  3BZK A;  2F3V A;  2Q2U A;  1JWU D;  3EVQ A;  4IPG A;  3RZD B;  4QGU A;  1STB A;  4X62 L;  1QVF A;  1HA5 A;  1PDQ A;  1XTD A;  2F0I A;  3FKI B;  4YY3 Q;  4H02 A;  3WDN A;  4Q0F A;  5J22 A;  3CXC A;  3QB3 A;  2LY7 A;  2L15 A;  1GJX A;  4CBV A;  5JPM C;  3ONA B;  1N34 L;  2UXC Q;  1YHA A;  1JB3 A;  3E5S A;  1HZ9 A;  1QUQ B;  1H9M A;  5IP7 G;  2F4V Q;  3GTQ B;  1E24 A;  2EY1 A;  1SFO H;  1Y69 U;  3I4M B;  2B2U A;  3GTG B;  1G91 A;  1KAA A;  2F0Q A;  4FP5 D;  3CME A;  3Q23 A;  2F0J A;  1SMX A;  3NK9 A;  2B63 G;  5K36 G;  4XQJ A;  2J7Z A;  2D9U A;  1VF7 A;  4A3F H;  2PQA A;  1GHJ A;  5KEE A;  3N6R A;  3T1H Q;  1N36 L;  3HKS A;  4A3M H;  1DOM A;  3CQZ H;  4H0L C;  5M9O A;  2H5X A;  3GD7 A;  3VYU A;  3I4N H;  2F0V A;  2IWH A;  2EQS A;  3OOC A;  4XIG S;  3LWE A;  3QR8 A;  3HZX A;  2R61 A;  3STB D;  4LMQ D;  1C9O A;  1H9J A;  5E7N A;  3FPP A;  2B3G A;  2MQH A;  3RUZ A;  4ZUI A;  2K75 A;  2YTV A;  3NBH B;  2UUB Q;  4R8I A;  3HKZ G;  1TVX A;  3S17 H;  3BG3 A;  1VQL A;  4BY7 G;  1OXV A;  3JAM E;  1CZG A;  1I4R A;  4MTK A;  2AWO A;  1AFP A;  2B2T C;  4DPG A;  2L9H A;  1LT3 D;  3MC0 B;  1P16 A;  1TS4 A;  4I7Z C;  3D6W A;  1EQR A;  2QDB A;  4A3K G;  3ND9 A;  5ELF A;  1SYF A;  1XMO Q;  1B70 B;  1SYE A;  3P20 A;  4A3D G;  5JEA G;  1YNN C;  1F9R A;  1IBL L;  2MGS A;  4DK3 C;  2F0K A;  3MXN A;  3TP7 A;  4V19 0;  3GQB A;  4XDX A;  1NBW A;  1J9O A;  4DUZ L;  2JA8 B;  2KBN A;  5M5W H;  2NVT B;  3H15 A;  3TBI B;  3CCQ A;  1QJO A;  3NTH A;  1HUM A;  1NNX A;  4B3T Q;  1VQD A;  3F2B A;  3BJU A;  1CI3 M;  1CKN B;  4KK7 A;  1GVP A;  2B2Y A;  2ZXO A;  4L8J A;  1Y8N B;  3ULL A;  3A8J E;  5C44 G;  2RA4 A;  4X65 L;  3AFP A;  2E74 C;  2OQK A;  1LTT D;  3K5O A;  4R8N A;  3HOZ H;  2FHT A;  2OEO A;  2PZW A;  4DK0 A;  2A19 A;  3TQY A;  5C44 B;  3EIV A;  4IUV A;  1AP0 A;  1JWM D;  2B2V C;  1R4P B;  1E22 A;  2K50 A;  2O5I C;  1VQH A;  1YIT A;  4F88 A;  1K9M C;  3NP8 A;  1X9N A;  4LUV A;  2JP1 A;  3S1R H;  1JWS D;  1GUT A;  4IPH A;  2R92 B;  3IL8 A;  4JI3 Q;  2LKV A;  4JI7 Q;  3F1Z A;  1GUO A;  2F0M A;  1TWG B;  1FVI A;  3H09 A;  1HNW L;  3PF4 A;  3GTP B;  5FJ8 H;  4Y52 H;  5LMU L;  2PQE A;  3H91 A;  4B9W A;  1XNR L;  2FMC A;  2F4I A;  2XNA C;  1Q3L A;  1SMY D;  1HHV A;  4G7O C;  1HNW Q;  4YHH L;  1TWH H;  1ENF A;  1QZG A;  2K4K A;  1YJ9 A;  4JI7 L;  1WTQ A;  1X65 A;  5H1S E;  2HQE A;  2Q2T A;  5C5L A;  1SYD A;  4C3H H;  3NBH A;  4DV2 Q;  1YJN A;  2QCP X;  2H4O A;  2WAQ B;  4DNR B;  1CA5 A;  1WD1 A;  4PMB A;  1I4X A;  2ZJQ A;  5EBC A;  1QNU A;  2E8G A;  5IYD G;  1EZ6 A;  2EZV A;  4KJO A;  2HDL A;  1Z7T A;  3TP5 A;  2MO0 A;  1O80 A;  1M4V A;  4P74 A;  2E2D C;  5T1G A;  3F2C A;  1PYW D;  4XQN A;  4C1N I;  4NP5 A;  3M4Y A;  1CHQ D;  4DR3 L;  3TEH B;  1VQC A;  4RAU C;  1X56 A;  3F8T A;  1QWY A;  3S1M H;  1Y1V B;  4OEL B;  1XTC D;  1STH A;  4R1J A;  5I4D A;  1TR5 A;  3URY A;  4HJ7 A;  2JA8 G;  4KHP Q;  4M8A A;  3PO3 G;  4H44 C;  1E1O A;  4UP8 A;  4IPD A;  1FJG L;  1D2B A;  2ZM6 Q;  4GOP A;  5I6W A;  4L5Q A;  1YIJ A;  4A3G G;  3S1M B;  1CZW A;  3S2H B;  3C46 A;  3NWT A;  3CKI B;  3J7Y W;  5M3M B;  2EY2 A;  2E2I B;  2XIW A;  3PIP 3;  2FXQ A;  2TMP A;  3MAQ A;  4EX5 A;  1VQG A;  3J81 E;  1DON A;  1VS0 A;  1QVG A;  1TU2 B;  1LTS D;  4I7A A;  4UDU C;  1JCK B;  3CW2 C;  4DR7 L;  3G6E A;  1IL8 A;  4JBJ A;  1GUS A;  4QL5 A;  3MZ5 A;  1JOK A;  3A5Z B;  1LTL A;  2XN9 C;  4M1U B;  3OTO L;  3A7L A;  3J80 c;  2F0D A;  5IWA Q;  2LXJ A;  5C4J H;  2B29 A;  3DXJ C;  3K5N A;  3TP8 A;  1EY0 A;  2WAQ G;  1I50 B;  4UHV A;  4DV3 Q;  1IXR A;  3HKZ B;  5GAD C;  1B50 A;  1K83 B;  2QDL A;  3I8Z A;  2UXD Q;  3PGZ A;  4IPC A;  3HOU H;  3HEJ A;  4PMC A;  1WTV A;  3E9I A;  1JJ2 A;  5IP9 H;  2Y0S B;  4GN5 A;  3KOJ A;  4BXX G;  5CR3 A;  2M2L A;  2BA1 A;  2JK8 A;  1VQI A;  1WTW A;  4LAA A;  1F77 A;  4P2C B;  1OXS C;  3N52 A;  4BBR H;  1RCV D;  2K5Q A;  4DAP A;  3KF8 A;  1Q8K A;  1CM9 A;  2BE5 C;  4HIM A;  2JEB I;  2F0H A;  1W6K A;  1PFS A;  1HZA A;  1BO0 A;  1WOC A;  1LO5 D;  4N9P A;  2R92 H;  1H9S B;  1WI5 A;  4A3B B;  4OX9 Q;  3E9H A;  2JQO A;  1HCZ A;  2ZXP A;  1BBW A;  4LFB L;  2HD3 A;  4DR6 Q;  2KCC A;  4K8J A;  2OTJ A;  4O2D A;  2DUD A;  1KL9 A;  3KDF B;  4ZQ3 A;  3VR6 A;  2ES2 A;  4K6L A;  3NE5 B;  4TQU S;  2PNH A;  3M85 A;  2WAQ E;  5C5M A;  4TSS A;  4ZK9 B;  1Y1V H;  4B3R Q;  4DR2 L;  2VUM B;  4LUZ A;  2EOT A;  3K81 C;  4KN4 C;  3KJP A;  1LTB D;  2BCO A;  3LX0 A;  4KMU C;  1V43 A;  1EYD A;  2VW9 A;  3ZYY X;  1K8M A;  4ME3 A;  1F9P A;  4OIJ A;  2XGT A;  1HZC A;  1ASY A;  4IUN A;  5LL6 X;  1Y8O B;  3MEF A;  2AUJ D;  4C2M H;  2KEN A;  4AYB E;  4K6D A;  4LFA Q;  1HNX L;  2RCF A;  1SE2 A;  5JJZ A;  2PPB C;  3J81 L;  5DEH A;  4CHT B;  1O78 A;  1SR3 A;  1K0R A;  3D8G A;  2RKS A;  3T13 A;  1MSG A;  5GAE C;  1VQ4 A;  3DM3 A;  2L1B A;  1HH2 P;  2IX3 A;  4Q5V A;  1HNX Q;  1O7Z A;  1AW7 A;  2I07 B;  4MTN A;  3T53 B;  5C6A A;  4DV0 Q;  4KD4 A;  3STB C;  3MEH A;  3W1B A;  3SK5 A;  3CC4 A;  5E4X A;  4FXD A;  1STE A;  4CJ2 C;  2F0L A;  1MKH A;  1D5Z C;  3QIA A;  3MWY W;  4L5T A;  1RIP A;  2KCN A;  4BS9 A;  5KYI A;  2NYZ D;  4DR1 Q;  2OTL A;  1F2M A;  3M7G A;  1Q1E A;  3KF6 B;  3GTM H;  2A74 C;  5LMN L;  4JI1 L;  3S1Q H;  2QEJ C;  2NZO A;  4JYA Q;  4RCN A;  3VDY A;  3I70 A;  5FLX L;  1R9T H;  2H1E A;  3W5O A;  1ILQ A;  1M90 C;  2JA7 H;  2E2J B;  5FOB B;  3HOV G;  3CCL A;  1ICF B;  4LFA L;  2AUK A;  1PH2 A;  3I56 A;  4K5V A;  3I2Z A;  5EKI A;  1I4G A;  1R4Q B;  2YTX A;  3GTJ H;  1EQQ A;  2JA9 A;  1WCM G;  4BBS B;  4LF5 L;  1NAP A;  4DAY B;  4QIW B;  4A3E H;  5G3L D;  1EEI D;  2CH4 W;  4R4O A;  2CH4 A;  3KJO A;  4LFC Q;  3U4Z A;  1QUQ A;  2C9O A;  4J15 A;  4R4T A;  2QW7 A;  4R9W A;  1PXU A;  2QF7 A;  1IZ6 A;  1BCP F;  1PTO D;  1AZP A;  2UU9 L;  2Q8T A;  3JAM L;  1BKB A;  1HR0 W;  1CQF A;  1I5F A;  4ZCK A;  1SN8 A;  2D62 A;  1DXM A;  2VXW A;  3H6M A;  3MFY A;  1XX8 A;  3RZO B;  5JJI A;  1D7Q A;  3WOE A;  1UNS A;  1EY8 A;  3DWQ A;  3RN2 A;  4FYD A;  1H9K A;  3S15 H;  1ENA A;  2MNA A;  4HSV A;  3BU2 A;  1LTI D;  3IFT A;  4IOC A;  1WTX A;  3HOV H;  3KYH C;  1VQF A;  2B2Y C;  2FMM A;  3T51 B;  3ERO A;  4OX9 L;  2GVA A;  4BBR G;  1JC7 A;  5TSS A;  2ZTD A;  2R7D A;  5M5Y B;  2A68 C;  3GTK H;  1E2Z A;  4HID A;  4IOA A;  3L9A X;  4HED A;  3PO3 H;  2UXB Q;  2JE6 I;  2E2H B;  5FLM G;  4IUT A;  1Z47 A;  3PIO 3;  1KC8 C;  1PLF A;  2HDM A;  2QGQ A;  1N33 Q;  5ELB A;  2B2W C;  4X3U A;  5CBA E;  1EYA A;  3U4V A;  4KLK A;  3FKI G;  3Q6S A;  2SNM A;  1K8A C;  2KQ3 A;  2SEB D;  2WKD A;  1JMC A;  2F0S A;  1VQE A;  5BR8 L;  1Y1W B;  2V1C C;  4KHP L;  3LGJ A;  3OMC A;  2MHV A;  4C56 C;  1ZYR D;  4FF2 A;  5C4J B;  1S5B D;  3RMH A;  5C3W A;  1F2Z A;  1NMF A;  4C3J B;  3M4O H;  3I3C A;  2NVQ B;  1U4R A;  3S17 B;  2JEA I;  2MO1 A;  1A62 A;  3OSO A;  1IL2 A;  3S1N H;  4IFD H;  4B3R L;  3DHQ A;  1VMP A;  3NTK A;  2EYP A;  2MPM A;  3P75 A;  1L0W A;  1EL0 A;  1S5C D;  4ZAI A;  5C0X G;  4YCV A;  1EWH A;  4KV6 A;  4NXN Q;  2KJX A;  1EY7 A;  2N55 A;  5GRO A;  4B9X A;  2Z6K A;  2NVX H;  2RDH A;  3R2I A;  2E2J H;  3O13 A;  1KDC A;  3KFU A;  3HFZ B;  2D2C C;  2HHH L;  1SNP A;  3D31 A;  4IUQ A;  2TSS A;  5COY A;  3I4L A;  1WTO A;  3QWN A;  5KNC A;  4DR4 L;  3KLR A;  1X54 A;  2EDG A;  3D0F A;  2UXB L;  1D5X C;  2R7Z B;  4YWL A;  2OWO A;  2ICI A;  5DLQ E;  3S1Q B;  4U68 A;  3J81 c;  4DV7 Q;  2PNR C;  5JJK A;  4G7H C;  5DNF A;  2KA7 A;  2XTI A;  2K52 A;  4B3M Q;  3GTL B;  3S15 B;  4RHR A;  3DEP A;  3I4M H;  1MGS A;  3FRP B;  2I46 A;  3ULP A;  2JA7 B;  4LWC A;  3PV0 A;  2NVY H;  4JW0 A;  5ELC A;  1XNQ Q;  1MJC A;  5IGF A;  1V1Q A;  4HCS A;  4UP7 A;  4WFN 3;  1VQO A;  3BDL A;  3U9S A;  3VA7 A;  4NXM Q;  2ZTE A;  3OIQ A;  2F0N A;  2SNS A;  2FJ2 A;  4UY8 C;  4A3D H;  1EIF A;  1QE6 A;  2D0O A;  2BE5 D;  3SEB A;  3EFX D;  2IJ0 A;  1OXT A;  5M5X H;  1G29 1;  4JCV E;  2CCZ A;  2E75 C;  1C8C A;  2CWA A;  2QA4 A;  3BYT B;  5CV5 A;  4YWM A;  1VQJ A;  4DUZ Q;  1Y1W G;  1T5E A;  1MI2 A;  1F9S A;  4G7Z C;  1IBL Q;  3SK6 A;  1VQP A;  1HQR D;  4LF5 Q;  4DR1 L;  2IW3 A;  1Y14 B;  3TN2 A;  3DWP A;  4A93 G;  4LF9 Q;  3H94 A;  4IUP A;  4L5S A;  2F3I A;  3TP6 A;  3CC7 A;  1Q46 A;  1LAC A;  2JYO A;  4LF8 L;  1X3Q A;  1O7L A;  2E76 C;  2A6E D;  4HJA A;  4RKB A;  3J80 i;  4C3I G;  3Q24 A;  4A3J H;  4HIK A;  2B8G A;  3K0X A;  1B9N A;  2Q8R E;  3D6C A;  3BZC A;  1HTP A;  1VQK A;  4GLV B;  1E2V A;  1KHI A;  4A3M G;  2WII B;  3ER0 A;  1PZK D;  2AWN A;  3SDZ A;  4KD3 A;  4ALP A;  1KNA A;  4PV1 C;  2EYH A;  1IBM Q;  3X3M A;  1GXD C;  1Z6H A;  5E3F A;  2RSO A;  1EQV A;  4JG2 A;  1NE3 A;  1WCM B;  1PYB A;  1EEF D;  4O0A A;  1E0B A;  5IT9 E;  2RF4 A;  4ZKB B;  1PV4 A;  3G4S A;  1SMY C;  2PO4 A;  1JQY D;  5HGT A;  1S3O A;  3HOW G;  5CV8 A;  1WVL A;  1PFN A;  2K6A A;  3GO5 A;  3KK7 A;  4C3H G;  1TWA B;  1CKM A;  4G57 A;  2K5N A;  3J7Z C;  3M4O B;  2BDO A;  2FFK B;  3PUZ A;  1PH9 A;  3C1E A;  1FD7 D;  3K0Y A;  4RGM A;  5E4W C;  4CKE A;  4DFA A;  4BBR B;  2YTY A;  3U50 C;  1L1O A;  2B39 A;  3Q22 A;  1GD7 A;  4K14 A;  4CDD C;  1S4Z A;  1U0L A;  4MZ9 A;  1NY4 A;  4A93 B;  2WIN B;  2XRQ D;  1LLR D;  1Y8P B;  3UDI A;  5IOD A;  5JAV A;  3OIP A;  2F3W A;  1X55 A;  4RGN A;  3OYY A;  2M9V A;  1J5E L;  4BY1 B;  5CV4 A;  2HCC A;  1JOO A;  3NXW A;  4J1M A;  2KUM A;  5COR A;  1CT1 D;  1K83 H;  5FLX E;  1QG7 A;  3PO3 B;  4RFB A;  3TDQ A;  2MUY A;  1JE5 A;  3BDC A;  1JR0 D;  2CHB D;  1TWC B;  1W2B A;  5A35 A;  4QUF A;  2F03 A;  1EUJ A;  3FP9 A;  4OIK A;  1K8O A;  3JAM c;  1FL0 A;  1PRT F;  4QMG A;  1B7Y B;  4FXK C;  5K5P A;  5LMN Q;  5IYC H;  4BBS H;  1SNQ A;  3PO2 H;  3GTL H;  2BDN A;  4RG1 A;  3HOZ G;  4A3I H;  4DV4 Q;  1TY2 A;  1HR0 L;  1A15 A;  4PG3 A;  2QKI C;  5IOC A;  3ERQ A;  2L11 A;  3HOX G;  1PH6 A;  3HG9 A;  2L4N A;  2B63 H;  2DJG C;  1MSH A;  1HA6 A;  1L1O C;  3KF6 A;  4EQO A;  3U58 A;  5IWA L;  4A3M B;  4B3S L;  3TS0 A;  1VCI A;  4NB3 A;  4DV7 L;  3C2P A;  4QCL A;  4OXP A;  4JOI C;  4JK1 C;  1OTC A;  5M5X B;  1FGB D;  3H0G G;  1SE3 A;  1WFQ A;  2N88 A;  2OF1 A;  2X6G A;  4B3T L;  1STA A;  2ASB A;  1JIC A;  3E6Z X;  1WJJ A;  2Z0S A;  3VR2 A;  2R93 G;  4A3F B;  4HN7 A;  4NXN L;  2UUC L;  2ZJP A;  2Z4H A;  3PQI A;  1QOH A;  4LF6 Q;  1JOQ A;  1ML0 D;  1STN A;  1H9R A;  2GN5 A;  1Q7Y C;  1JJC B;  3M9B A;  1PFB A;  4DV3 L;  3S9W A;  5HUR A;  1AN8 A;  2CW0 D;  4IFD J;  2DN8 A;  3RNU A;  3MVV A;  3ULJ A;  2MFI A;  1BNZ A;  5ELE A;  2K5D A;  4NPS A;  4DR7 Q;  2DJF C;  1BQQ T;  2ZJR A;  4BBS G;  2Z9H A;  1C48 A;  1E1T A;  5IYC G;  1KRS A;  3HGB A;  4R4Q A;  1HQM C;  1NTG A;  4XT3 B;  4A3B G;  3DEO A;  4XTC S;  1DGS A;  4DR6 L;  2HUG A;  1CK1 A;  5C3E G;  3CF5 A;  2R7Z H;  1DCZ A;  1JE4 A;  2EJF C;  3RZD H;  4HMJ A;  1A2T A;  1U4M A;  1IYV A;  3HOX H;  1AEX A;  1B2T A;  4NMZ A;  4DF7 A;  2EIF A;  2V4D A;  1E3P A;  4LF6 L;  3PUW A;  2DY7 A;  1A0I A;  1BCP B;  1N33 L;  4GKJ Q;  2KCT A;  1V1P A;  2HQL A;  4WOR A;  5HY6 A;  2ATW A;  1EYC A;  2XSC A;  4FF3 A;  1C4Q A;  4GNX C;  4QY7 A;  3CCR A;  4DV2 L;  3MXP A;  1YHB A;  5C0X J;  4DXF A;  2O4X A;  1PMR A;  1LUZ A;  4BY1 H;  3QO2 A;  4E6I A;  1EQT A;  3A74 A;  4JI4 L;  3PMF A;  4HSP A;  5A2Q L;  5M3F H;  3S2D H;  4JV5 Q;  1I50 H;  1ZYR C;  4X62 Q;  3Q0A A;  3GTO H;  3D4R A;  1JJG A;  1CUK A;  4LFC L;  3L0O A;  3GV6 A;  2BA0 A;  2QIL A;  3H0G B;  3MHB A;  4F87 A;  1IYU A;  3TRZ A;  2Z6K C;  2Z8L A;  4BY1 G;  4CGY B;  3TS2 A;  3W2D A;  1TII D;  4K8I A;  2K05 A;  3GTK B;  3OW7 A;  4YY3 L;  1IKL A;  5BN4 A;  1Q1B A;  1EIH A;  1RDP D;  3GP7 A;  1FNW A;  3J81 i;  1S72 A;  4ZRZ A;  3TME A; 
#chains in the Genus database with same CATH homology
 3PO2 G;  4DAY B;  4A3F G;  1YNX A;  1VQB A;  3NEN A;  4C3J H;  4A3E H;  1XPO A;  4C3I H;  2PI2 A;  2GVB A;  4A3J G;  2YU9 H;  1XNR Q;  5LMU Q;  2NVQ H;  4R4I A;  2R7Z G;  1UE1 A;  4X65 Q;  3CD6 A;  4KHZ A;  4R4O A;  1EOV A;  1PH8 A;  3GDE A;  3PSI A;  3KJO A;  3ZJY C;  4LFC Q;  4GKJ L;  3U4Z A;  5GAG C;  1YI2 A;  1QUQ A;  4J15 A;  1E7Z A;  4R4T A;  4A4I A;  4LF6 Q;  1P8L A;  1IZ6 A;  4JI1 Q;  2UU9 L;  4GS3 A;  2CFM A;  1BKB A;  5IP7 H;  1HR0 W;  4GKK L;  1I5F A;  4JYA L;  1KXL A;  1SN8 A;  5ELO A;  2R93 H;  2D62 A;  5JJI A;  1D7Q A;  3RLN A;  3BZK A;  2Q2U A;  3PIP A;  1N9W A;  4IPG A;  2C35 B;  3RN2 A;  3HKZ E;  4OO1 I;  5M3F G;  1IBK L;  1ASZ A;  3S15 H;  4JV5 L;  4PMW A;  1XMO L;  4QGU A;  4R4C A;  2MNA A;  4X62 L;  3B6Y A;  3BU2 A;  1QVF A;  4IOC A;  1XTD A;  3HOV H;  3KYH C;  4GLX A;  1VQF A;  4DV0 L;  4OX9 L;  2GVA A;  4LUO A;  3IRB A;  4BBR G;  4YY3 Q;  4H02 A;  2KHJ A;  2ZTD A;  2R7D A;  1NJI C;  3CXC A;  4EQ5 A;  3GTK H;  4HID A;  2L15 A;  4IOA A;  5JJL A;  2JA8 H;  3PO3 H;  1N34 L;  2JE6 I;  2UXC Q;  1YHA A;  2UXB Q;  1JB7 A;  1HZ9 A;  4YCU A;  2PMZ E;  1QUQ B;  5FLM G;  3HOW H;  2I5H A;  1A63 A;  1MJE A;  1Z47 A;  4L5R C;  2VNU D;  3ERS X;  1KC8 C;  5IP7 G;  2QGQ A;  3PIO A;  1EYG A;  1IYJ B;  1N33 Q;  2F4V Q;  1XMQ Q;  4DK6 C;  1E24 A;  3FHW A;  3CCU A;  3U4V A;  1SFO H;  3CC2 A;  3J81 j;  4KLK A;  4DNI A;  4JI6 Q;  2IY5 B;  3FKI G;  3EN2 A;  4QQB X;  1K8A C;  4FDB A;  4DV1 Q;  4QIW E;  3CME A;  3FKI H;  4JC0 A;  3CCE A;  1IBK Q;  4JBK A;  4WJ4 A;  1OXX K;  1SMX A;  1O7I A;  2JA5 H;  3PUY A;  1JMC A;  5K36 G;  2B63 G;  1VQE A;  5BR8 L;  1XPU A;  4KHP L;  2V1C C;  1XNQ L;  3K80 C;  3LGJ A;  3WWV A;  4A3F H;  1YBY A;  2PQA A;  2N8N A;  4OON A;  3RZO H;  1TWC H;  2WFW A;  1PA6 A;  1XPR A;  3S24 A;  4JOI A;  3T1H Q;  1N36 L;  4DR5 L;  3HKS A;  4A3M H;  3CQZ H;  1HNZ Q;  4K0K Q;  1PVO A;  1NMF A;  2H5X A;  3GD7 A;  4X66 L;  3E0E A;  4DKA C;  3I4N H;  2EQS A;  1PH4 A;  3M4O H;  4DR4 Q;  4IJH A;  4XIG S;  2JEA I;  2MO1 A;  1A62 A;  1SRU A;  1IL2 A;  3S1N H;  4B3R L;  4JI6 L;  2IT1 A;  3STB D;  1J5E Q;  1C9O A;  1L0W A;  5E7N A;  4P71 A;  4AYB G;  1TWF H;  2B3G A;  2D0P A;  2MQH A;  1K8G A;  5C0X G;  4YCV A;  2K75 A;  2YTV A;  3NBH B;  4NXN Q;  1NMG A;  5GRO A;  2UUB Q;  4A93 H;  2Z6K A;  3HKZ G;  3S17 H;  2NVX H;  2E2J H;  1VQL A;  4BY7 G;  1OXV A;  4DV6 L;  2AWO A;  3KFU A;  3HFZ B;  3JC6 6;  1Q86 C;  2HHH L;  1AE2 A;  1Q81 C;  1B8A A;  3D31 A;  4DPG A;  2NN6 I;  1EFW A;  4A75 A;  1C7Y A;  2BH2 A;  1K73 C;  1BBU A;  3I7F A;  3H0G H;  4DR4 L;  1P16 A;  1X54 A;  2IX0 A;  2I0Q A;  3D0F A;  1N34 Q;  1VQ9 A;  1EQR A;  2UXB L;  1UE6 A;  4K0K L;  4YWL A;  1I94 L;  2OWO A;  4P73 A;  4HJ9 A;  1K3R A;  1A8V A;  4A3K G;  4A3G H;  5DLQ E;  5ELN A;  3J81 c;  4DV7 Q;  1G51 A;  2CKZ B;  3CCJ A;  1TXY A;  2UUA L;  5JJK A;  4A3E G;  1XMO Q;  1B70 B;  2VL6 A;  1PH1 A;  2KHI A;  4IFD I;  2UUB L;  2XTI A;  1WYD A;  4A3D G;  2K52 A;  4B3M Q;  5JEA G;  2HIV A;  1IBL L;  3NEL A;  4A3I G;  4A3C G;  3I4M H;  1EWI A;  1XMQ L;  4DK3 C;  3I55 A;  4APV A;  2UUC Q;  5C0X I;  4BY7 H;  4X6A H;  3CPF A;  1NBW A;  5M3M H;  1FJG Q;  1BVS A;  4DUZ L;  4LF4 L;  2JJQ A;  2KBN A;  2OCE A;  3ULP A;  5M5W H;  2ZM6 L;  1PH7 A;  2N3S A;  4LWC A;  3H15 A;  2UXD L;  4POG A;  3PV0 A;  3CCQ A;  1SLJ A;  4B3T Q;  3M3Y H;  1VQD A;  2NVY H;  3F2B A;  2RHS B;  3BJU A;  2I5L X;  1CKN B;  4MNO A;  1UEB A;  2K14 A;  2E2H H;  2KCM A;  4GOP B;  4IFD G;  1XNQ Q;  1GVP A;  5JEA J;  1MJC A;  4QJF A;  1RL2 A;  3ULL A;  4DR3 Q;  1V1Q A;  2LXK A;  5C44 G;  4X65 L;  1KQS A;  4UP7 A;  3I4N G;  3AFP A;  3I4M G;  2OQ0 A;  1VQO A;  1VQ8 A;  2AMC B;  2Y0S G;  2OQK A;  4NXM Q;  2ZTE A;  3ICE A;  4A3C H;  4DV1 L;  4DUY Q;  4JI0 L;  3HOZ H;  1L2F A;  4UY8 C;  4A3D H;  3F2D A;  2A19 A;  3TQY A;  1EIF A;  1AE3 A;  2D0O A;  1MIU A;  4Y7N H;  4BA1 I;  4LF9 L;  4GN3 B;  3RN5 A;  3EIV A;  1YZ6 A;  4X64 Q;  3MXN B;  1OXT A;  1E22 A;  2K50 A;  1G29 1;  4JCV E;  5M5X H;  1VQH A;  2CCZ A;  3H3V I;  1YIT A;  1N8R C;  1K9M C;  2CWA A;  2QA4 A;  1X9N A;  4LUV A;  3S1R H;  4YWM A;  1VQJ A;  4IPH A;  2E5L L;  2ID0 A;  4JI3 Q;  3K7U C;  4DUZ Q;  1Y1W G;  4LF4 Q;  4JI7 Q;  3F1Z A;  3DLL A;  1X6O A;  4P72 A;  1N32 L;  1FVI A;  1IBL Q;  1I6H H;  4GLA C;  4LF8 Q;  1HNW L;  1VQP A;  3PF4 A;  3T1Y Q;  4JI2 Q;  1C0A A;  2R92 G;  1VQ6 A;  4LF5 Q;  4DR1 L;  2PQA B;  1Y14 B;  5FJ8 H;  4Y52 H;  5LMU L;  4A93 G;  4LF9 Q;  3JAM i;  1XNR L;  1AH9 A;  1GO3 E;  3PCO B;  4L5S A;  2F3I A;  3CC7 A;  1Q46 A;  1G6P A;  4AH6 A;  1X3F A;  1I94 Q;  4LF8 L;  1HNW Q;  3S16 H;  4YHH L;  2AKW B;  1OXU A;  4OWX B;  1TWH H;  1QZG A;  2K4K A;  4AIM A;  4HJA A;  1YJ9 A;  1VQ7 A;  5HGQ A;  3J80 i;  4A3J H;  4JI7 L;  1X65 A;  4KI0 A;  5H1S E;  4HIK A;  2Q2T A;  3K0X A;  2LSS A;  3KF8 B;  4C3H H;  3BZC A;  3H3V H;  5AJ3 Q;  4DV2 Q;  4GLV B;  1YJN A;  1VQK A;  1KHI A;  4A3M G;  2HIX A;  4JI3 L;  3RLF A;  3ER0 A;  2ZTC A;  3M7N A;  2ZJQ A;  2AWN A;  2IHF A;  2E8G A;  5IYD G;  2VQE L;  5C44 H;  2CQO A;  2K5H A;  4LF7 Q;  2QEX A;  1L1O B;  4ALP A;  2VZA A;  2EXD A;  1X3E A;  2WB1 G;  4PZ6 A;  1KRT A;  1IBM Q;  2MO0 A;  4JI0 Q;  1M1K C;  4P74 A;  3I4O A;  4YHH Q;  4JG2 A;  1VQA A;  1PH3 A;  4A3B H;  1NE3 A;  4BA2 I;  2IX1 A;  3F2C A;  1PYB A;  3A5U A;  1UE5 A;  4O0A A;  4DR3 L;  3TEH B;  1VQC A;  5FJ8 G;  4GOP C;  2RF4 A;  4JBW A;  1X56 A;  1PV4 A;  3HOY G;  3G4S A;  3F8T A;  5GAH C;  1S3O A;  1VQN A;  3HOW G;  3S1M H;  2Q2H A;  1FGU A;  2A1A A;  3GO5 A;  4R1J A;  1YJW A;  3CMA A;  5FLX c;  2JA8 G;  4HJ7 A;  4KHP Q;  1CKM A;  3PO3 G;  2K5N A;  1E1O A;  2Q2I A;  4OWT B;  2YYZ A;  4UP8 A;  3J7Z C;  4IPD A;  1FJG L;  4HJ8 A;  4DR2 Q;  3PUZ A;  2ZM6 Q;  1PH9 A;  4GOP A;  3EBE A;  2CWP A;  4L5Q A;  1YIJ A;  4A3G G;  1T9H A;  4A3K H;  2YTY A;  2E5L Q;  1J6Q A;  3U50 C;  1L1O A;  2VY3 A;  3AEV A;  1GD7 A;  3RLO A;  3K8A A;  3CAM A;  1U0L A;  2NN6 G;  4MZ9 A;  1NY4 A;  5IY0 A;  4BXX H;  2FXQ A;  3UDI A;  2R7F A;  1VQG A;  4EX5 A;  5EAY A;  1X3G A;  2F52 A;  4DUY L;  1GKH A;  1VS0 A;  1W3S A;  1X55 A;  3OYY A;  1QVG A;  1J5E L;  2ALY B;  3HOU G;  3CW2 C;  3UDX A;  3HOY H;  4DR7 L;  3PUV A;  3G6E A;  4JBJ A;  4DV5 Q;  4QL5 A;  4RMF A;  3A5Z B;  1K83 H;  1LTL A;  5C3E H;  3OTO L;  3J80 c;  1JE5 A;  5IWA Q;  2LXJ A;  3G71 A;  2HHH Q;  5C4J H;  1W2B A;  2B29 A;  4DV6 Q;  1EUJ A;  3FP9 A;  4JI8 L;  2WAQ G;  4DV3 Q;  3JAM c;  1IXR A;  1FL0 A;  3TRE A;  5IT9 c;  5GAD C;  1B7Y B;  3PUX A;  1UE7 A;  3CPW A;  5LMN Q;  5IYC H;  4JI2 L;  5C4X G;  4BBS H;  1WCM H;  1PYS B;  2UXD Q;  3PGZ A;  4IPC A;  3HOU H;  3PO2 H;  2K5V A;  3GTL H;  4RG1 A;  4JI5 Q;  3HOZ G;  1JJ2 A;  3E9I A;  4DV4 Q;  5IP9 H;  4A3I H;  4GN5 A;  5J3B A;  1HR0 L;  4PG3 A;  3KOJ A;  4BXX G;  3RR5 A;  4GNX B;  4DAM A;  3HOX G;  1PH6 A;  2BA1 A;  2JK8 A;  1Z9F A;  1VQI A;  2B63 H;  2R6G A;  2JA5 G;  4NXM L;  2UUA Q;  4A3L H;  2JA6 G;  1L1O C;  2AHO B;  1CSQ A;  1OXS C;  3KF6 A;  3U58 A;  4DR5 Q;  4BBR H;  3S2H H;  5IWA L;  4B3S L;  3TS0 A;  1VCI A;  3KLW A;  4NB3 A;  4DV7 L;  1Q8K A;  3OW2 A;  4OXP A;  4DV5 L;  4JOI C;  4HIM A;  2JEB I;  1LM0 A;  1OTC A;  2Y0S E;  3H0G G;  5BR8 Q;  1PH5 A;  2WB1 E;  1WFQ A;  2ASB A;  3Q8D A;  1PFS A;  1HZA A;  3K7A H;  3PF5 A;  4B3T L;  1WOC A;  1TWA H;  1KAW A;  5IYB G;  2A8V A;  1WJJ A;  2R92 H;  2Z0S A;  1WI5 A;  4AQY Q;  4OX9 Q;  3E9H A;  2R93 G;  4GN4 B;  2NVT H;  4NXN L;  1VQ5 A;  5IYB H;  2UUC L;  2JQO A;  2ZJP A;  4LW1 A;  1BBW A;  4LFB L;  1CKN A;  3CCM A;  3S14 H;  3GTP H;  4POF A;  4HJ5 A;  1HR0 Q;  4DV4 L;  4DR6 Q;  2OTJ A;  4IJL A;  1YEZ A;  4O2D A;  2GN5 A;  2F4V L;  2DUD A;  1KL9 A;  3KDF B;  1Q7Y C;  2JA6 H;  1TWG H;  1JJC B;  4X66 Q;  3M9B A;  4DV3 L;  2ES2 A;  4A3L G;  1H95 A;  4TQU S;  3L2P A;  2PNH A;  1HNZ L;  3M85 A;  2WAQ E;  5IYD H;  4IO9 A;  1Y1V H;  2DGY A;  2VUM G;  4B3R Q;  2UXC L;  4DR2 L;  5LMN W;  3NEM A;  4IFD J;  4JI8 Q;  4LUZ A;  1Q12 A;  5GQO A;  3ULJ A;  2MFI A;  3RNU A;  3K81 C;  4P75 A;  3KJP A;  3T1H L;  1VQM A;  1N36 Q;  4B3S Q;  4NPS A;  5C4X H;  4DR7 Q;  1CSP A;  1V43 A;  1HJP A;  4UP9 A;  2ZJR A;  4BBS G;  2VW9 A;  5IYC G;  1E1T A;  2VQF Q;  3M4Q A;  2E2I H;  1KRS A;  4ME3 A;  2N78 A;  3UDG A;  3G48 A;  4R4Q A;  2XGT A;  1HZC A;  1NTG A;  1KD1 C;  2NZH A;  4LNQ A;  1EIY B;  1YHQ A;  1ASY A;  4A3B G;  4TVA B;  3AFQ A;  4XTC S;  1DGS A;  2VQE Q;  2VS1 A;  4PZ7 A;  3MEF A;  4C2M H;  4DR6 L;  2KEN A;  4AYB E;  1QZH A;  5C3E G;  3CF5 A;  1S40 A;  2R7Z H;  3GTQ H;  4LFB Q;  4LFA Q;  3RZD H;  4YWK A;  1HNX L;  2UU9 Q;  3CP0 A;  1I3Q H;  3CCS A;  4YCW A;  5M3M G;  3KDF A;  3CCV A;  3UE0 A;  3HOX H;  4LF7 L;  4OWW B;  2EIF A;  1SR3 A;  3M4P A;  4OO1 G;  1E3P A;  4LF6 L;  3PUW A;  1A0I A;  1K0R A;  5GAE C;  5FLM H;  1N33 L;  1VQ4 A;  2KCT A;  3DM3 A;  1Y1V G;  2RHQ B;  2VUM H;  2HQL A;  5HY6 A;  2ATW A;  1HH2 P;  5M5Y H;  3J7A 5;  1HNX Q;  4UPA A;  4GNX C;  4QY7 A;  2PI2 E;  5AJ3 L;  3CCR A;  4DV2 L;  1SE8 A;  4MTN A;  1YHB A;  4DV0 Q;  1U5K A;  3STB C;  5C0X J;  2JA7 G;  1YVC A;  3W1B A;  2RCN A;  3A0J A;  3CC4 A;  4JBM A;  1LUZ A;  4BY1 H;  1UWV A;  3A74 A;  1HZB A;  4WJ3 M;  4JI4 L;  3W1G A;  1GM5 A;  2VQF L;  5IE8 A;  1Q82 C;  4HIO A;  1QVC A;  4JI4 Q;  1V9P A;  5M3F H;  3S2D H;  4JV5 Q;  1N32 Q;  1I50 H;  1CKO A;  1MKH A;  4GNX A;  1PHJ A;  1IBM L;  4X62 Q;  4L5T A;  1RIP A;  3L7Z C;  1D8L A;  1KIX A;  3GTO H;  3AQQ A;  4JI5 L;  4DR1 Q;  2OTL A;  1JJG A;  3T1Y L;  1CUK A;  4LFC L;  1Q1E A;  3KF6 B;  3L0O A;  3GTM H;  3AYH B;  2BA0 A;  5LMN L;  2N49 A;  4JI1 L;  3S1Q H;  1Y1W H;  2NZO A;  3TRZ A;  4GKK Q;  2Z6K C;  4JYA Q;  3UE1 A;  3VDY A;  4BY1 G;  2BH8 A;  1R9T H;  1M90 C;  3W5O A;  2I5M X;  2HT1 A;  2JA7 H;  3SGI A;  3TS2 A;  3OTO Q;  3HOV G;  3CCL A;  4LFA L;  2WP8 J;  4GKJ Q;  4B3M L;  4YY3 L;  1PH2 A;  4X64 L;  3I56 A;  1LYL A;  1Q1B A;  3I2Z A;  4PZ8 A;  2YV5 A;  5IP9 G;  4AQY L;  3UDF A;  1SRO A;  2YTX A;  3J81 i;  3GTJ H;  1S72 A;  1EQQ A;  2JA9 A;  1JT8 A;  1WCM G;  3GTG H;  4A76 A;  2IHE A;  4LF5 L;  1XJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...