2YU9K

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2yu9K00
3S1QK 1I6VA 4A3KK 2VUMK 2NVXK 4A93C 1HQMA 3HOVK 1SFOC 2E2JK 3S2DC 1TWHC 3HOWK 4ZH4A 4YFXA 1Y1WK 3HOYK 2YU9K 4BXXC 2PMZL 3M4OC 2JA5K 4BBSC 3M3YC 2B63C 2A69A 4A3CC 1I3QC 4QIWL 1K83K 5TMCA 5IYCC 2CW0A 4KN7A 2E2HK 2NVTC 2JA6C 3EQLA 2R93C 4XLPA 5C4JC 4X6AC 1I50C 1IW7A 2Y0SL 3HOXC 3GTKK 4OIRA 1TWGC 3K7AK 3GTQC 4BBRC 5FLMC 3PO2K 3GTOC 3S1NC 4Y52K 3DXJA 5C44K 4A3MK 4A3EK 4OIQA 5M5XK 2BE5A 3PO3K 4A3DC 5D4DA 3GTMK 1Y1VK 3GTJC 4OIOA 3GTGK 5IYDK 4A3IK 2PPBA 5C3EC 2JA7C 2R92K 3S1RK 4NOIA 3S16K 2NVYK 3FKIK 3GTLK 4BY7C 4YFNA 2NVQC 3S1MK 3S15C 4A3CK 4OIPA 3HOUK 3I4NC 5FJ8K 5IP7K 4A3GK 5C4JK 3GTPK 4A3FK 1TWCK 3S17K 4A3JK 4BY1K 2PMZD 4G7ZA 3I4MC 4A3LC 1TWFK 3H0GC 4LK1A 4QIWD 1R9TC 1I6HK 4KMUA 4C3JK 2A68A 2E2IK 2JA8C 1TWAC 4G7OA 1WCMC 2Y0SD 5IP9K 3S14C 2WB1D 4Y7NC 4OINA 5M5YK 3S2HC 3CQZC 5C4XK 3WODA 4G7HA 5IYBC 3RZDC 5M3FK 2JA7K 2O5IA 3RZOC 1YNNA 1YNJA 2PA8L 2A6HA 2A6EA 2R7ZC 4MQ9A 3HOZK 4A3BC 3S1QC 4A93K 3S2DK 1SFOK 4A3KC 1TWHK 5M3MK 2NVXC 4LK0A 4BXXK 2E2JC 3HOWC 1Y1WC 3H3VL 3M4OK 4XSZA 2YU9C 3HOYC 4BBSK 3M3YK 2B63K 4C3IK 1I3QK 4LJZA 2JA5C 2JA6K 5IYCK 2WAQL 2NVTK 4AYBL 2R93K 1K83C 4C3HK 2E2HC 4X6AK 1I50K 3HOXK 4MEYA 4LLGA 3HKZL 4QJVA 1TWGK 4YG2A 3GTQK 4BBRK 5M5WK 5FLMK 3GTOK 3GTKC 3S1NK 3K7AC 3S2HK 4A3DK 1BDFA 5C44C 4A3MC 3PO3C 3RZOK 1XPPA 3GTJK 3GTMC 1Y1VC 5C3EK 3GTGC 4KN4A 5IYDC 5TMFA 4A3IC 2R92C 3S1RC 4QJVB 1SMYA 4C2MK 2NVYC 2VUMC 3S16C 4BY7K 2PA8D 4Q5SA 2NVQK 3FKIC 3I4NK 3HOVC 3GTLC 3S15K 4Q4ZA 4JK1A 4XSXA 3S1MC 1ZYRA 4MEXA 3HOUC 5IP7C 4A3GC 4XLNA 3GTPC 4A3FC 3I4MK 1TWCC 3H3VD 3H0GK 2WB1L 3S17C 4A3JC 4YFKA 4BY1C 4A3LK 1R9TK 1TWFC 2WAQD 1I6HC 2JA8K 4AYBD 1TWAK 2E2IC 1WCMK 3S14K 4Y7NK 4GZYA 3HKZD 3PO2C 4Y52C 3CQZK 3RZDK 5IP9C 5IYBK 4A3EC 2O5JA 5C4XC 2R7ZK 4A3BK 3HOZC
chains in the Genus database with same CATH superfamily
2CFAB 1I50A 2VUMK 3FOEA 1TWFA 3HOWK 4ZH4A 1Y1WK 4BXXC 2JA5K 4BBSC 2A69A 1K83K 5IYCC 3N3YA 4KN7A 4X6AC 1V5VA 3G4CA 3GTQC 4BBRC 5FLMC 3PO2K 3S1NC 4Y52K 3DXJA 2XCRB 2P5MA 1VGXA 3AD7C 4OIOA 3OEPA 5C3EC 4GTDA 2JA7C 2R92K 3H0GA 2R93A 4NOIA 4G0VA 5IOTA 3FKIK 3T00A 4BY7C 1WCMA 3BP3A 1XZQB 3OREA 4A3GK 3TTGA 4A3FK 3GTPK 3I4MC 4LR2A 4QIWD 3Q3QA 1I6HK 5IP9K 2YU9A 2WB1D 5M5YK 3S2HC 3CQZC 5C4XK 3RZOC 1YNNA 2R7ZC 1XXBA 4GTAA 1KQ4A 1SFOK 4A3KC 3MMLB 2NVXC 5IOSA 5EGEA 1IL2A 1J6WA 3H3VL 3HOYC 4C3IK 2JA6K 5JFEA 2NVTK 1Y1VA 3GIRA 1I50K 3GTGA 3LPXA 4MEYA 4QJVA 2VUMA 1DCPA 1WSRA 3GTLA 1DCHA 4A3MC 3PO3C 1DCOA 1Y1WA 1J6XA 1O28A 2PHCB 1X31C 4KB4A 1K83A 4QJVB 1SMYA 3S16C 2NVYC 4P5BA 2PA8D 4Q5SA 5E68A 3HOVC 4KAWX 1O29A 1JQWA 3H0GK 3QX3A 4A3JC 4BY1C 3S17C 1R9TK 1J6VA 1TWFC 2WAQD 4GTEA 2R92A 1TWAK 2E2IC 1WCMK 3S14K 4Y7NK 3HKZD 3FKIA 4PAAA 5IYBK 4A3EC 2O5JA 4KARA 2JH3A 2GSOA 3GTPA 2V6UA 1O2BA 2V6SA 3AQOA 1HQMA 1TWGA 3GTOA 2YU9K 3M4OC 1AB4A 2B63C 1I3QC 4QIWL 5TMCA 2E2HK 2GSUA 2R93C 4C3HC 1B4BA 1IW7A 3GTKK 4OIRA 3K7AK 1SFOA 3AD9C 3GTMK 1Y1VK 3GTJC 3GTGK 5IYDK 3S1RK 2ZUFA 1WOSA 3GTLK 2NVQC 3S1MK 3I4NC 1HI9A 4J3NA 5FJ8K 2PMZD 2ZFZA 4A3LC 2XCQA 1B4AA 2RGRA 4C3JK 4G7HA 3RZDC 2JA7K 2O5IA 1YNJA 2PA8L 3N0CA 2A6EA 4A3BC 4A93K 3S2DK 3LAJA 1TWHK 2V6TA 2ZUEA 4LK0A 1R9TA 1J98A 5CHPA 1Y1WC 3HOWC 4M1XA 4P5AA 3M3YK 1TWAA 3BUEA 2JA5C 3ERED 2WAQL 1K83C 3HOXK 1VH2A 1WQHA 3HKZL 1GE9A 1L0WA 1TWGK 3GTOK 1PJ7A 3G4AA 3S2HK 4A3DK 3RZOK 1XPPA 4KM9A 4BKWA 4KN4A 1ZVUA 3L4KA 2E2HA 2R92C 4C2MK 3GTKA 3FKIC 3S15K 4GTBA 4JK1A 4XSXA 4MEXA 2GSNA 1WOPA 4A3GC 3GTPC 4A3FC 3GTMA 3IPJA 1VRQC 3N0BA 4DDQA 1I6HC 2JA8K 1JVIA 5IP9C 4GTLA 5C4XC 1PJ6A 3S1QK 3GEIA 1I6VA 3LAPA 3HOVK 1SFOC 2E2JK 3GTQA 1O27A 3TFJA 4YFXA 2PMZL 4GFQA 4C3IC 4A3CC 3CAGA 2JA6C 2CW0A 1BGWA 2NVTC 3TFHA 3EQLA 4XLPA 5C4JC 2JA7A 1I50C 1XXCA 4KDDA 4LQYA 4KMAA 2FQTA 1TWHA 5C44K 3AQPA 4A3EK 5M5XK 2BE5A 5D4DA 4FM9A 5TJ3A 4A3IK 5IOQA 5JVOA 1O26A 1XZPA 1INNA 3AD8C 3OPFA 3HOUK 4GTCA 5HL8A 1ZBSA 3A8IA 2D6FC 5IP7K 1TWCK 2GAHC 2R7ZA 4G7ZA 4KM8A 3H0GC 1R9TC 3A8KA 2A68A 5L46A 4PABA 1TWAC 4G7OA 3ADAC 1EK8A 1WCMC 2Y0SD 3S14C 4Y7NC 3HXAA 4BLAA 5IYBC 5M3FK 2EBBA 3HOZK 1O24A 4KC6A 2A6HA 4BLBA 1DD5A 3A8JA 1EI6A 1IQ0A 4BXXK 3FHZA 4ILDA 1EFWA 4XSZA 2YU9C 4BBSK 5EGHA 4LJZA 5IYCK 1O2AA 3GSIA 2CFAA 4KB2A 4X6AK 2E2HC 4YG2A 3GTQK 4BBRK 5FLMK 3S1NK 3GTKC 1USOA 2NVYA 3K7AC 1F7VA 1EH1A 2Y3PA 3GTMC 1Y1VC 5IORA 3T02A 5C3EK 3GTGC 5IYDC 5TMFA 2P8TA 3S1RC 1WQFA 2VUMC 4BY7K 1C0AA 2E2IA 3GTLC 1UV7A 4Q4ZA 4KMDA 1WQGA 3S1MC 1VLOA 3SZZA 3I4MK 1WOOA 2FQOA 3L4JA 4YFKA 3SZYA 3JSTA 4AYBD 4C3JC 4GZYA 1XZQA 3PO2C 4Y52C 3CQZK 4WJ4A 2B63A 1I3QA 2R7ZK 1F93A 1TWCA 2XCOA 4XCHA 4A3KK 2NVXK 4A93C 3S2DC 2GAGC 1TWHC 1EQRA 1F7UA 3HOYK 1F9NA 3M3YC 3GTJA 2Y0SL 3HOXC 1RU0A 3GEHA 4GT9A 3GEEA 1TWGC 3GTOC 3S0XA 4A3MK 3PO3K 4OIQA 4A3DC 3TFIA 4G0WA 1WORA 4RMFA 2PPBA 1IS1A 1BJTA 1YX2A 3S16K 2NVYK 4C2MC 4KASA 4LOWA 4YFNA 1IBAA 4A3CK 3S15C 4OIPA 4WILA 4G0UA 5C4JK 3S17K 3VA7A 4A3JK 4BY1K 4O2DA 3V4GA 1TWFK 2KWAA 3NUHA 4LK1A 4KMUA 1WSVA 2E2IK 1O25A 2JA8C 2RH6A 3BP8C 4OINA 3WODA 2JA5A 1VJEA 4MQ9A 3S1QC 4AH6A 5M3MK 4WJ3M 1XXAA 2E2JC 1ZQ1C 3M4OK 2B63K 1I3QK 1PJ5A 1ZXOA 3CQZA 4AYBL 2R93K 4C3HK 4LLGA 1IE0A 5M5WK 4FZBA 3FOFA 2NVXA 1XZPB 1BDFA 3T01A 5C44C 3GDZA 1O2FB 3GTJK 4KATA 1G51A 1ISEA 4A3IC 1YCLA 2NVQK 3I4NK 1ZYRA 3HOUC 5IP7C 4C45A 1USMA 4XLNA 1TWCC 3H3VD 4A3LK 2WB1L 1BS2A 3AH5A 1JOEA 4P9SA 4KMHA 1WIHA 2W7VA 3RZDK 5CJ9A 4GTFA 2JA6A 4A3BK 3HOZC
chains in the Genus database with same CATH topology
3S1QK 1I6VA 4A3KK 2VUMK 2NVXK 4A93C 1HQMA 3HOVK 1SFOC 2E2JK 3S2DC 1TWHC 3HOWK 4ZH4A 4YFXA 1Y1WK 3HOYK 2YU9K 4BXXC 2PMZL 3M4OC 2JA5K 4BBSC 3M3YC 2B63C 2A69A 4A3CC 1I3QC 4QIWL 1K83K 5TMCA 5IYCC 2CW0A 4KN7A 2E2HK 2NVTC 2JA6C 3EQLA 2R93C 4XLPA 5C4JC 4X6AC 1I50C 1IW7A 2Y0SL 3HOXC 3GTKK 4OIRA 1TWGC 3K7AK 3GTQC 4BBRC 5FLMC 3PO2K 3GTOC 3S1NC 4Y52K 3DXJA 5C44K 4A3MK 4A3EK 4OIQA 5M5XK 2BE5A 3PO3K 4A3DC 5D4DA 3GTMK 1Y1VK 3GTJC 4OIOA 3GTGK 5IYDK 4A3IK 2PPBA 5C3EC 2JA7C 2R92K 3S1RK 4NOIA 3S16K 2NVYK 3FKIK 3GTLK 4BY7C 4YFNA 2NVQC 3S1MK 3S15C 4A3CK 4OIPA 3HOUK 3I4NC 5FJ8K 5IP7K 4A3GK 5C4JK 3GTPK 4A3FK 1TWCK 3S17K 4A3JK 4BY1K 2PMZD 4G7ZA 3I4MC 4A3LC 1TWFK 3H0GC 4LK1A 4QIWD 1R9TC 1I6HK 4KMUA 4C3JK 2A68A 2E2IK 2JA8C 1TWAC 4G7OA 1WCMC 2Y0SD 5IP9K 3S14C 2WB1D 4Y7NC 4OINA 5M5YK 3S2HC 3CQZC 5C4XK 3WODA 4G7HA 5IYBC 3RZDC 5M3FK 2JA7K 2O5IA 3RZOC 1YNNA 1YNJA 2PA8L 2A6HA 2A6EA 2R7ZC 4MQ9A 3HOZK 4A3BC 3S1QC 4A93K 3S2DK 1SFOK 4A3KC 1TWHK 5M3MK 2NVXC 4LK0A 4BXXK 2E2JC 3HOWC 1Y1WC 3H3VL 3M4OK 4XSZA 2YU9C 3HOYC 4BBSK 3M3YK 2B63K 4C3IK 1I3QK 4LJZA 2JA5C 2JA6K 5IYCK 2WAQL 2NVTK 4AYBL 2R93K 1K83C 4C3HK 2E2HC 4X6AK 1I50K 3HOXK 4MEYA 4LLGA 3HKZL 4QJVA 1TWGK 4YG2A 3GTQK 4BBRK 5M5WK 5FLMK 3GTOK 3GTKC 3S1NK 3K7AC 3S2HK 4A3DK 1BDFA 5C44C 4A3MC 3PO3C 3RZOK 1XPPA 3GTJK 3GTMC 1Y1VC 5C3EK 3GTGC 4KN4A 5IYDC 5TMFA 4A3IC 2R92C 3S1RC 4QJVB 1SMYA 4C2MK 2NVYC 2VUMC 3S16C 4BY7K 2PA8D 4Q5SA 2NVQK 3FKIC 3I4NK 3HOVC 3GTLC 3S15K 4Q4ZA 4JK1A 4XSXA 3S1MC 1ZYRA 4MEXA 3HOUC 5IP7C 4A3GC 4XLNA 3GTPC 4A3FC 3I4MK 1TWCC 3H3VD 3H0GK 2WB1L 3S17C 4A3JC 4YFKA 4BY1C 4A3LK 1R9TK 1TWFC 2WAQD 1I6HC 2JA8K 4AYBD 1TWAK 2E2IC 1WCMK 3S14K 4Y7NK 4GZYA 3HKZD 3PO2C 4Y52C 3CQZK 3RZDK 5IP9C 5IYBK 4A3EC 2O5JA 5C4XC 2R7ZK 4A3BK 3HOZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q K;  1I6V A;  4A3K K;  2VUM K;  2NVX K;  4A93 C;  1HQM A;  3HOV K;  1SFO C;  2E2J K;  3S2D C;  1TWH C;  3HOW K;  4ZH4 A;  4YFX A;  1Y1W K;  3HOY K;  2YU9 K;  4BXX C;  2PMZ L;  3M4O C;  2JA5 K;  4BBS C;  3M3Y C;  2B63 C;  2A69 A;  4A3C C;  1I3Q C;  4QIW L;  1K83 K;  5TMC A;  5IYC C;  2CW0 A;  4KN7 A;  2E2H K;  2NVT C;  2JA6 C;  3EQL A;  2R93 C;  4XLP A;  5C4J C;  4X6A C;  1I50 C;  1IW7 A;  2Y0S L;  3HOX C;  3GTK K;  4OIR A;  1TWG C;  3K7A K;  3GTQ C;  4BBR C;  5FLM C;  3PO2 K;  3GTO C;  3S1N C;  4Y52 K;  3DXJ A;  5C44 K;  4A3M K;  4A3E K;  4OIQ A;  5M5X K;  2BE5 A;  3PO3 K;  4A3D C;  5D4D A;  3GTM K;  1Y1V K;  3GTJ C;  4OIO A;  3GTG K;  5IYD K;  4A3I K;  2PPB A;  5C3E C;  2JA7 C;  2R92 K;  3S1R K;  4NOI A;  3S16 K;  2NVY K;  3FKI K;  3GTL K;  4BY7 C;  4YFN A;  2NVQ C;  3S1M K;  3S15 C;  4A3C K;  4OIP A;  3HOU K;  3I4N C;  5FJ8 K;  5IP7 K;  4A3G K;  5C4J K;  3GTP K;  4A3F K;  1TWC K;  3S17 K;  4A3J K;  4BY1 K;  2PMZ D;  4G7Z A;  3I4M C;  4A3L C;  1TWF K;  3H0G C;  4LK1 A;  4QIW D;  1R9T C;  1I6H K;  4KMU A;  4C3J K;  2A68 A;  2E2I K;  2JA8 C;  1TWA C;  4G7O A;  1WCM C;  2Y0S D;  5IP9 K;  3S14 C;  2WB1 D;  4Y7N C;  4OIN A;  5M5Y K;  3S2H C;  3CQZ C;  5C4X K;  3WOD A;  4G7H A;  5IYB C;  3RZD C;  5M3F K;  2JA7 K;  2O5I A;  3RZO C;  1YNN A;  1YNJ A;  2PA8 L;  2A6H A;  2A6E A;  2R7Z C;  4MQ9 A;  3HOZ K;  4A3B C;  3S1Q C;  4A93 K;  3S2D K;  1SFO K;  4A3K C;  1TWH K;  5M3M K;  2NVX C;  4LK0 A;  4BXX K;  2E2J C;  3HOW C;  1Y1W C;  3H3V L;  3M4O K;  4XSZ A;  2YU9 C;  3HOY C;  4BBS K;  3M3Y K;  2B63 K;  4C3I K;  1I3Q K;  4LJZ A;  2JA5 C;  2JA6 K;  5IYC K;  2WAQ L;  2NVT K;  4AYB L;  2R93 K;  1K83 C;  4C3H K;  2E2H C;  4X6A K;  1I50 K;  3HOX K;  4MEY A;  4LLG A;  3HKZ L;  4QJV A;  1TWG K;  4YG2 A;  3GTQ K;  4BBR K;  5M5W K;  5FLM K;  3GTO K;  3GTK C;  3S1N K;  3K7A C;  3S2H K;  4A3D K;  1BDF A;  5C44 C;  4A3M C;  3PO3 C;  3RZO K;  1XPP A;  3GTJ K;  3GTM C;  1Y1V C;  5C3E K;  3GTG C;  4KN4 A;  5IYD C;  5TMF A;  4A3I C;  2R92 C;  3S1R C;  4QJV B;  1SMY A;  4C2M K;  2NVY C;  2VUM C;  3S16 C;  4BY7 K;  2PA8 D;  4Q5S A;  2NVQ K;  3FKI C;  3I4N K;  3HOV C;  3GTL C;  3S15 K;  4Q4Z A;  4JK1 A;  4XSX A;  3S1M C;  1ZYR A;  4MEX A;  3HOU C;  5IP7 C;  4A3G C;  4XLN A;  3GTP C;  4A3F C;  3I4M K;  1TWC C;  3H3V D;  3H0G K;  2WB1 L;  3S17 C;  4A3J C;  4YFK A;  4BY1 C;  4A3L K;  1R9T K;  1TWF C;  2WAQ D;  1I6H C;  2JA8 K;  4AYB D;  1TWA K;  2E2I C;  1WCM K;  3S14 K;  4Y7N K;  4GZY A;  3HKZ D;  3PO2 C;  4Y52 C;  3CQZ K;  3RZD K;  5IP9 C;  5IYB K;  4A3E C;  2O5J A;  5C4X C;  2R7Z K;  4A3B K;  3HOZ C; 
#chains in the Genus database with same CATH topology
 2CFA B;  1I50 A;  2VUM K;  3FOE A;  1TWF A;  3HOW K;  4ZH4 A;  1Y1W K;  4BXX C;  2JA5 K;  4BBS C;  2A69 A;  1K83 K;  5IYC C;  3N3Y A;  4KN7 A;  4X6A C;  1V5V A;  3G4C A;  3GTQ C;  4BBR C;  5FLM C;  3PO2 K;  3S1N C;  4Y52 K;  3DXJ A;  2XCR B;  2P5M A;  1VGX A;  3AD7 C;  4OIO A;  3OEP A;  5C3E C;  4GTD A;  2JA7 C;  2R92 K;  3H0G A;  2R93 A;  4NOI A;  4G0V A;  5IOT A;  3FKI K;  3T00 A;  4BY7 C;  1WCM A;  3BP3 A;  1XZQ B;  3ORE A;  4A3G K;  3TTG A;  4A3F K;  3GTP K;  3I4M C;  4LR2 A;  4QIW D;  3Q3Q A;  1I6H K;  5IP9 K;  2YU9 A;  2WB1 D;  5M5Y K;  3S2H C;  3CQZ C;  5C4X K;  3RZO C;  1YNN A;  2R7Z C;  1XXB A;  4GTA A;  1KQ4 A;  1SFO K;  4A3K C;  3MML B;  2NVX C;  5IOS A;  5EGE A;  1IL2 A;  1J6W A;  3H3V L;  3HOY C;  4C3I K;  2JA6 K;  5JFE A;  2NVT K;  1Y1V A;  3GIR A;  1I50 K;  3GTG A;  3LPX A;  4MEY A;  4QJV A;  2VUM A;  1DCP A;  1WSR A;  3GTL A;  1DCH A;  4A3M C;  3PO3 C;  1DCO A;  1Y1W A;  1J6X A;  1O28 A;  2PHC B;  1X31 C;  4KB4 A;  1K83 A;  4QJV B;  1SMY A;  3S16 C;  2NVY C;  4P5B A;  2PA8 D;  4Q5S A;  5E68 A;  3HOV C;  4KAW X;  1O29 A;  1JQW A;  3H0G K;  3QX3 A;  4A3J C;  4BY1 C;  3S17 C;  1R9T K;  1J6V A;  1TWF C;  2WAQ D;  4GTE A;  2R92 A;  1TWA K;  2E2I C;  1WCM K;  3S14 K;  4Y7N K;  3HKZ D;  3FKI A;  4PAA A;  5IYB K;  4A3E C;  2O5J A;  4KAR A;  2JH3 A;  2GSO A;  3GTP A;  2V6U A;  1O2B A;  2V6S A;  3AQO A;  1HQM A;  1TWG A;  3GTO A;  2YU9 K;  3M4O C;  1AB4 A;  2B63 C;  1I3Q C;  4QIW L;  5TMC A;  2E2H K;  2GSU A;  2R93 C;  4C3H C;  1B4B A;  1IW7 A;  3GTK K;  4OIR A;  3K7A K;  1SFO A;  3AD9 C;  3GTM K;  1Y1V K;  3GTJ C;  3GTG K;  5IYD K;  3S1R K;  2ZUF A;  1WOS A;  3GTL K;  2NVQ C;  3S1M K;  3I4N C;  1HI9 A;  4J3N A;  5FJ8 K;  2PMZ D;  2ZFZ A;  4A3L C;  2XCQ A;  1B4A A;  2RGR A;  4C3J K;  4G7H A;  3RZD C;  2JA7 K;  2O5I A;  1YNJ A;  2PA8 L;  3N0C A;  2A6E A;  4A3B C;  4A93 K;  3S2D K;  3LAJ A;  1TWH K;  2V6T A;  2ZUE A;  4LK0 A;  1R9T A;  1J98 A;  5CHP A;  1Y1W C;  3HOW C;  4M1X A;  4P5A A;  3M3Y K;  1TWA A;  3BUE A;  2JA5 C;  3ERE D;  2WAQ L;  1K83 C;  3HOX K;  1VH2 A;  1WQH A;  3HKZ L;  1GE9 A;  1L0W A;  1TWG K;  3GTO K;  1PJ7 A;  3G4A A;  3S2H K;  4A3D K;  3RZO K;  1XPP A;  4KM9 A;  4BKW A;  4KN4 A;  1ZVU A;  3L4K A;  2E2H A;  2R92 C;  4C2M K;  3GTK A;  3FKI C;  3S15 K;  4GTB A;  4JK1 A;  4XSX A;  4MEX A;  2GSN A;  1WOP A;  4A3G C;  3GTP C;  4A3F C;  3GTM A;  3IPJ A;  1VRQ C;  3N0B A;  4DDQ A;  1I6H C;  2JA8 K;  1JVI A;  5IP9 C;  4GTL A;  5C4X C;  1PJ6 A;  3S1Q K;  3GEI A;  1I6V A;  3LAP A;  3HOV K;  1SFO C;  2E2J K;  3GTQ A;  1O27 A;  3TFJ A;  4YFX A;  2PMZ L;  4GFQ A;  4C3I C;  4A3C C;  3CAG A;  2JA6 C;  2CW0 A;  1BGW A;  2NVT C;  3TFH A;  3EQL A;  4XLP A;  5C4J C;  2JA7 A;  1I50 C;  1XXC A;  4KDD A;  4LQY A;  4KMA A;  2FQT A;  1TWH A;  5C44 K;  3AQP A;  4A3E K;  5M5X K;  2BE5 A;  5D4D A;  4FM9 A;  5TJ3 A;  4A3I K;  5IOQ A;  5JVO A;  1O26 A;  1XZP A;  1INN A;  3AD8 C;  3OPF A;  3HOU K;  4GTC A;  5HL8 A;  1ZBS A;  3A8I A;  2D6F C;  5IP7 K;  1TWC K;  2GAH C;  2R7Z A;  4G7Z A;  4KM8 A;  3H0G C;  1R9T C;  3A8K A;  2A68 A;  5L46 A;  4PAB A;  1TWA C;  4G7O A;  3ADA C;  1EK8 A;  1WCM C;  2Y0S D;  3S14 C;  4Y7N C;  3HXA A;  4BLA A;  5IYB C;  5M3F K;  2EBB A;  3HOZ K;  1O24 A;  4KC6 A;  2A6H A;  4BLB A;  1DD5 A;  3A8J A;  1EI6 A;  1IQ0 A;  4BXX K;  3FHZ A;  4ILD A;  1EFW A;  4XSZ A;  2YU9 C;  4BBS K;  5EGH A;  4LJZ A;  5IYC K;  1O2A A;  3GSI A;  2CFA A;  4KB2 A;  4X6A K;  2E2H C;  4YG2 A;  3GTQ K;  4BBR K;  5FLM K;  3S1N K;  3GTK C;  1USO A;  2NVY A;  3K7A C;  1F7V A;  1EH1 A;  2Y3P A;  3GTM C;  1Y1V C;  5IOR A;  3T02 A;  5C3E K;  3GTG C;  5IYD C;  5TMF A;  2P8T A;  3S1R C;  1WQF A;  2VUM C;  4BY7 K;  1C0A A;  2E2I A;  3GTL C;  1UV7 A;  4Q4Z A;  4KMD A;  1WQG A;  3S1M C;  1VLO A;  3SZZ A;  3I4M K;  1WOO A;  2FQO A;  3L4J A;  4YFK A;  3SZY A;  3JST A;  4AYB D;  4C3J C;  4GZY A;  1XZQ A;  3PO2 C;  4Y52 C;  3CQZ K;  4WJ4 A;  2B63 A;  1I3Q A;  2R7Z K;  1F93 A;  1TWC A;  2XCO A;  4XCH A;  4A3K K;  2NVX K;  4A93 C;  3S2D C;  2GAG C;  1TWH C;  1EQR A;  1F7U A;  3HOY K;  1F9N A;  3M3Y C;  3GTJ A;  2Y0S L;  3HOX C;  1RU0 A;  3GEH A;  4GT9 A;  3GEE A;  1TWG C;  3GTO C;  3S0X A;  4A3M K;  3PO3 K;  4OIQ A;  4A3D C;  3TFI A;  4G0W A;  1WOR A;  4RMF A;  2PPB A;  1IS1 A;  1BJT A;  1YX2 A;  3S16 K;  2NVY K;  4C2M C;  4KAS A;  4LOW A;  4YFN A;  1IBA A;  4A3C K;  3S15 C;  4OIP A;  4WIL A;  4G0U A;  5C4J K;  3S17 K;  3VA7 A;  4A3J K;  4BY1 K;  4O2D A;  3V4G A;  1TWF K;  2KWA A;  3NUH A;  4LK1 A;  4KMU A;  1WSV A;  2E2I K;  1O25 A;  2JA8 C;  2RH6 A;  3BP8 C;  4OIN A;  3WOD A;  2JA5 A;  1VJE A;  4MQ9 A;  3S1Q C;  4AH6 A;  5M3M K;  4WJ3 M;  1XXA A;  2E2J C;  1ZQ1 C;  3M4O K;  2B63 K;  1I3Q K;  1PJ5 A;  1ZXO A;  3CQZ A;  4AYB L;  2R93 K;  4C3H K;  4LLG A;  1IE0 A;  5M5W K;  4FZB A;  3FOF A;  2NVX A;  1XZP B;  1BDF A;  3T01 A;  5C44 C;  3GDZ A;  1O2F B;  3GTJ K;  4KAT A;  1G51 A;  1ISE A;  4A3I C;  1YCL A;  2NVQ K;  3I4N K;  1ZYR A;  3HOU C;  5IP7 C;  4C45 A;  1USM A;  4XLN A;  1TWC C;  3H3V D;  4A3L K;  2WB1 L;  1BS2 A;  3AH5 A;  1JOE A;  4P9S A;  4KMH A;  1WIH A;  2W7V A;  3RZD K;  5CJ9 A;  4GTF A;  2JA6 A;  4A3B K;  3HOZ C; 
#chains in the Genus database with same CATH homology
 3S1Q K;  1I6V A;  4A3K K;  2VUM K;  2NVX K;  4A93 C;  1HQM A;  3HOV K;  1SFO C;  2E2J K;  3S2D C;  1TWH C;  3HOW K;  4ZH4 A;  4YFX A;  1Y1W K;  3HOY K;  2YU9 K;  4BXX C;  2PMZ L;  3M4O C;  2JA5 K;  4BBS C;  3M3Y C;  2B63 C;  2A69 A;  4A3C C;  1I3Q C;  4QIW L;  1K83 K;  5TMC A;  5IYC C;  2CW0 A;  4KN7 A;  2E2H K;  2NVT C;  2JA6 C;  3EQL A;  2R93 C;  4XLP A;  5C4J C;  4X6A C;  1I50 C;  1IW7 A;  2Y0S L;  3HOX C;  3GTK K;  4OIR A;  1TWG C;  3K7A K;  3GTQ C;  4BBR C;  5FLM C;  3PO2 K;  3GTO C;  3S1N C;  4Y52 K;  3DXJ A;  5C44 K;  4A3M K;  4A3E K;  4OIQ A;  5M5X K;  2BE5 A;  3PO3 K;  4A3D C;  5D4D A;  3GTM K;  1Y1V K;  3GTJ C;  4OIO A;  3GTG K;  5IYD K;  4A3I K;  2PPB A;  5C3E C;  2JA7 C;  2R92 K;  3S1R K;  4NOI A;  3S16 K;  2NVY K;  3FKI K;  3GTL K;  4BY7 C;  4YFN A;  2NVQ C;  3S1M K;  3S15 C;  4A3C K;  4OIP A;  3HOU K;  3I4N C;  5FJ8 K;  5IP7 K;  4A3G K;  5C4J K;  3GTP K;  4A3F K;  1TWC K;  3S17 K;  4A3J K;  4BY1 K;  2PMZ D;  4G7Z A;  3I4M C;  4A3L C;  1TWF K;  3H0G C;  4LK1 A;  4QIW D;  1R9T C;  1I6H K;  4KMU A;  4C3J K;  2A68 A;  2E2I K;  2JA8 C;  1TWA C;  4G7O A;  1WCM C;  2Y0S D;  5IP9 K;  3S14 C;  2WB1 D;  4Y7N C;  4OIN A;  5M5Y K;  3S2H C;  3CQZ C;  5C4X K;  3WOD A;  4G7H A;  5IYB C;  3RZD C;  5M3F K;  2JA7 K;  2O5I A;  3RZO C;  1YNN A;  1YNJ A;  2PA8 L;  2A6H A;  2A6E A;  2R7Z C;  4MQ9 A;  3HOZ K;  4A3B C;  3S1Q C;  4A93 K;  3S2D K;  1SFO K;  4A3K C;  1TWH K;  5M3M K;  2NVX C;  4LK0 A;  4BXX K;  2E2J C;  3HOW C;  1Y1W C;  3H3V L;  3M4O K;  4XSZ A;  2YU9 C;  3HOY C;  4BBS K;  3M3Y K;  2B63 K;  4C3I K;  1I3Q K;  4LJZ A;  2JA5 C;  2JA6 K;  5IYC K;  2WAQ L;  2NVT K;  4AYB L;  2R93 K;  1K83 C;  4C3H K;  2E2H C;  4X6A K;  1I50 K;  3HOX K;  4MEY A;  4LLG A;  3HKZ L;  4QJV A;  1TWG K;  4YG2 A;  3GTQ K;  4BBR K;  5M5W K;  5FLM K;  3GTO K;  3GTK C;  3S1N K;  3K7A C;  3S2H K;  4A3D K;  1BDF A;  5C44 C;  4A3M C;  3PO3 C;  3RZO K;  1XPP A;  3GTJ K;  3GTM C;  1Y1V C;  5C3E K;  3GTG C;  4KN4 A;  5IYD C;  5TMF A;  4A3I C;  2R92 C;  3S1R C;  4QJV B;  1SMY A;  4C2M K;  2NVY C;  2VUM C;  3S16 C;  4BY7 K;  2PA8 D;  4Q5S A;  2NVQ K;  3FKI C;  3I4N K;  3HOV C;  3GTL C;  3S15 K;  4Q4Z A;  4JK1 A;  4XSX A;  3S1M C;  1ZYR A;  4MEX A;  3HOU C;  5IP7 C;  4A3G C;  4XLN A;  3GTP C;  4A3F C;  3I4M K;  1TWC C;  3H3V D;  3H0G K;  2WB1 L;  3S17 C;  4A3J C;  4YFK A;  4BY1 C;  4A3L K;  1R9T K;  1TWF C;  2WAQ D;  1I6H C;  2JA8 K;  4AYB D;  1TWA K;  2E2I C;  1WCM K;  3S14 K;  4Y7N K;  4GZY A;  3HKZ D;  3PO2 C;  4Y52 C;  3CQZ K;  3RZD K;  5IP9 C;  5IYB K;  4A3E C;  2O5J A;  5C4X C;  2R7Z K;  4A3B K;  3HOZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...