2YU9K

Rna polymerase ii elongation complex in 150 mm mg+2 with utp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
molecule tags Transcription,transferase/dna-rna hybrid
publication title Structural Basis of Transcription: Role of the Trigger Loop in Substrate Specificity and Catalysis
pubmed doi rcsb
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2yu9K00
3GTLK 2NVTK 3HOWC 3PO3C 4A93C 3I4NC 2CW0A 3S16C 3I4MK 3S1NK 1BDFA 2WB1L 2B63K 3S1MK 3M4OK 2Y0SL 5FLMC 3HOVK 1TWAC 2JA8C 4A3MC 1HQMA 2WAQL 4A3JK 4A3EK 3GTMC 4MEYA 3GTPC 3HOZK 1TWFK 3HOVC 4A3KK 3HKZL 3PO2K 3S16K 4X6AK 3GTPK 3S17C 5IP9C 3H0GC 4BY7K 2NVTC 1I6VA 5C4XK 3GTJK 4QIWD 2PPBA 3GTKK 1TWHC 3DXJA 2B63C 2JA7C 3M4OC 1R9TK 4A3CK 4OIQA 2JA5C 3H3VL 4A3LC 3HOWK 3PO3K 1Y1WK 4A93K 2E2IC 4A3FC 1TWGK 2R92K 2Y0SD 2NVXK 2A69A 5C3EK 4BY1C 2R7ZC 3S14C 1I50C 2NVYK 4A3GK 3HOUC 4A3EC 3S17K 3HOXC 5IYBC 5M3FK 4MEXA 4KN7A 5D4DA 5M5WK 2NVQK 4YFNA 5IYBK 1TWCC 4YFKA 5M3MK 5IYCC 1I3QC 3CQZK 2YU9C 4OIPA 4Q5SA 4XLNA 4A3IC 2A68A 3FKIC 3HOYC 3S2DK 4ZH4A 2R92C 3S1RK 1I6HK 4Y52K 3M3YK 2O5IA 1Y1WC 3I4NK 4XSZA 4A3FK 4GZYA 3K7AK 2E2JK 4Y52C 3S1RC 4Y7NC 2VUMC 3S2HC 4A3BC 1IW7A 3PO2C 4BXXC 1I6HC 4AYBD 1WCMK 4A3DC 3GTGC 3H0GK 4C3IK 2PMZL 5IYCK 5IP7C 4QJVB 4BY7C 4BBSC 4OINA 4G7OA 4A3IK 2A6EA 1Y1VC 3S1MC 3HOZC 5IP7K 4BBSK 3EQLA 2WAQD 2E2HC 3S15K 1WCMC 4A3DK 3HKZD 4JK1A 4XSXA 4BBRK 3GTQC 2O5JA 4Y7NK 5M5YK 5C44K 4OIOA 2E2IK 4KMUA 1TWGC 2NVYC 2JA7K 4A3LK 4A3CC 5C44C 4A3BK 5C4JC 4G7HA 2WB1D 1SFOK 4AYBL 3GTJC 3S15C 5C4XC 4Q4ZA 2PA8D 2PMZD 1I3QK 3S1NC 1K83K 4C3HK 1XPPA 2BE5A 1TWAK 2JA6K 2JA8K 4A3MK 4X6AC 1I50K 5IYDC 3RZOC 2VUMK 5FLMK 1TWFC 4YG2A 3S2HK 5FJ8K 5C4JK 2A6HA 1K83C 4LLGA 4XLPA 3H3VD 4C2MK 3GTGK 4C3JK 1R9TC 2JA5K 4BY1K 1YNJA 4NOIA 5TMCA 1TWHK 3HOYK 3K7AC 5M5XK 3S2DC 2E2JC 2PA8L 4OIRA 5IP9K 3S1QK 3GTLC 5IYDK 2E2HK 1YNNA 3GTOC 4LK0A 4MQ9A 4BBRC 3GTQK 3RZOK 2R93K 3RZDK 3CQZC 5TMFA 2YU9K 4QJVA 2JA6C 3S14K 3GTMK 4A3GC 2NVQC 1Y1VK 1TWCK 2R93C 2NVXC 2R7ZK 4A3KC 5C3EC 1SFOC 4KN4A 3GTOK 4A3JC 3HOUK 1ZYRA 3HOXK 4G7ZA 3S1QC 1SMYA 3RZDC 3M3YC 3WODA 4BXXK 4YFXA 4QIWL 3GTKC 4LJZA 3I4MC 3FKIK 4LK1A
chains in the Genus database with same CATH superfamily
4LOWA 3G4AA 1JQWA 5EGEA 3I4NC 3S1NK 2XCQA 2B63K 3HOVK 4A3MC 4GTDA 1G51A 2CFAB 4GTBA 4A3EK 3GTJA 4WILA 3GTPK 3S17C 5IP9C 3H0GC 4GT9A 4C3IC 1IL2A 4BY7K 1JVIA 1UV7A 5C4XK 1J98A 2B63C 2E2IC 5E68A 1O2FB 1TWCA 3GTLA 2A69A 4BY1C 3S14C 3HOUC 4A3EC 3S17K 3HOXC 5IYBC 4KM9A 2D6FC 5M5WK 1XZPB 2NVQK 1WOSA 2V6TA 4KATA 5EGHA 1Y1VA 1ISEA 2A68A 1I6HK 3V4GA 4GZYA 3K7AK 3S1RC 3S2HC 4Y7NC 3TFIA 1XXBA 4A3BC 1IW7A 3PO2C 4BXXC 4AYBD 4A3DC 3GSIA 2PMZL 4QJVB 2NVYA 3HOZC 5IP7K 4BBSK 3EQLA 1VGXA 1SFOA 3HXAA 2P5MA 4XSXA 3GTQC 2O5JA 1PJ6A 4Y7NK 1O26A 2NVYC 4A3BK 5C4XC 4C3JC 4Q4ZA 3TFJA 2JA7A 1K83K 2JH3A 4C3HK 3T00A 3GTOA 2V6UA 1L0WA 1TWAK 2JA6K 2JA8K 3SZYA 4X6AC 2P8TA 3CAGA 2VUMK 4KASA 2YU9A 4XLPA 5L46A 4C3JK 4KDDA 4KMHA 1B4BA 4NOIA 3BUEA 5TMCA 3N0BA 5IYDK 4OIRA 1WQGA 3GTLC 2E2HK 4FM9A 3GTOC 3VA7A 4LK0A 4BBRC 2R93K 4AH6A 2JA6C 4A3GC 3GDZA 1Y1VK 1F7UA 1WQHA 4KN4A 3L4KA 4A3JC 1XZQB 5IOQA 3M3YC 3OREA 4YFXA 4QIWL 1XZQA 3Q3QA 4LK1A 4KB4A 3GTLK 2NVTK 4A93C 2CW0A 3LAPA 3S16C 3S1MK 2WB1L 3M4OK 4C45A 3GTKA 4A3JK 1O27A 1BS2A 1TWFK 3HOVC 2ZFZA 3HKZL 2GSNA 3N0CA 3L4JA 4KMDA 2NVTC 2PPBA 1TWHC 2E2IA 1XZPA 3M4OC 2JA7C 3AD8C 1BGWA 4P5AA 1R9TK 1JOEA 1DCHA 1USMA 4A93K 2KWAA 1TWGK 1VJEA 4KC6A 2Y0SD 2NVXK 2R7ZC 5C3EK 1IBAA 5JVOA 3JSTA 3T02A 2FQTA 5IYBK 5IYCC 2Y3PA 1I3QC 2FQOA 4Q5SA 1F9NA 4XLNA 3FKIC 1EFWA 4Y52K 1IS1A 3A8KA 2O5IA 3I4NK 4XSZA 4C2MC 2R92A 3ADAC 1I6HC 2JA6A 4G0WA 5IYCK 1VH2A 4FZBA 4KMAA 3GTGA 4GTEA 4KARA 3S1MC 3GIRA 2WAQD 3S15K 2GAHC 4A3DK 5M5YK 4OIOA 2E2IK 1VRQC 5C4JC 3TFHA 4G7HA 1SFOK 1DCPA 4G0UA 4KB2A 1O2BA 1C0AA 1O28A 3T01A 1XPPA 5FJ8K 5C4JK 1K83C 1F7VA 3GTGK 3GTQA 2JA5K 1AB4A 4WJ3M 1GE9A 3K7AC 1VLOA 2PA8L 5IP9K 1J6XA 2R7ZA 1HI9A 1WQFA 1IE0A 1WOPA 3CQZC 2YU9K 1TWCK 2R93C 4A3KC 3GTOK 1IQ0A 3HOUK 3IPJA 3HOXK 4G7ZA 4LQYA 3GTKC 3I4MC 2NVXA 4GTLA 2Y0SL 5FLMC 3N3YA 1R9TA 1TWAC 2JA8C 4MEYA 1XXAA 4A3KK 3PO2K 4BLBA 4DDQA 3FOFA 3S16K 4X6AK 4J3NA 1I6VA 1EK8A 4XCHA 2ZUEA 3NUHA 3GTKK 3H0GA 3DXJA 4RMFA 4A3CK 4A3LC 4OIQA 3H3VL 2GSOA 4BLAA 1EI6A 1O24A 1J6WA 4A3GK 1WSRA 2NVYK 4MEXA 2V6SA 1KQ4A 4YFNA 4GTAA 3CQZK 2YU9C 3TTGA 2JA5A 4A3IC 5IORA 3HOYC 3LPXA 4ZH4A 3OEPA 2R93A 3M3YK 4KAWX 2EBBA 1BJTA 1O2AA 2GSUA 3CQZA 2E2JK 4Y52C 1I50A 2VUMC 1WCMK 1ZQ1C 3H0GK 4C3IK 1EQRA 4BY7C 3G4CA 4OINA 4G7OA 4A3IK 1V5VA 1XXCA 2VUMA 2E2HC 1TWAA 4JK1A 4BBRK 5C44K 3GEEA 4KMUA 1TWGC 5CHPA 2B63A 2JA7K 3AQPA 1DD5A 4GFQA 4AYBL 3S15C 3GTPA 2PA8D 3FKIA 2PMZD 4ILDA 2BE5A 4P5BA 1PJ5A 1B4AA 1WOOA 4A3MK 1USOA 1WSVA 3A8IA 3RZOC 3S2HK 1WORA 4C2MK 5HL8A 1YNJA 3GEHA 3HOYK 3S1QK 1TWHA 1YNNA 1PJ7A 3GTQK 3RZOK 3RZDK 3S14K 3GTMK 2NVQC 2NVXC 2R7ZK 5C3EC 2GAGC 3AH5A 3S1QC 3WODA 1I3QA 4GTFA 3S1NC 1WIHA 3HOWC 3PO3C 1ZXOA 3I4MK 1BDFA 1INNA 3AD9C 3S0XA 1HQMA 2WAQL 3GTMC 3GTPC 3HOZK 3FOEA 3BP3A 1O29A 4LR2A 3GTJK 4QIWD 1ZBSA 2JA5C 2XCOA 3HOWK 3PO3K 1Y1WK 4A3FC 1YCLA 2CFAA 2R92K 3GTMA 1I50C 4GTCA 5M3FK 4KN7A 5D4DA 5IOTA 1EH1A 4C3HC 1TWCC 4YFKA 5M3MK 5TJ3A 1RU0A 4OIPA 3S2DK 2R92C 2PHCB 3S1RK 4PABA 1X31C 1Y1WC 4A3FK 1J6VA 1TWGA 4WJ4A 3GEIA 5IOSA 3SZZA 3GTGC 5IP7C 4BBSC 2ZUFA 1K83A 1ZVUA 2RGRA 2A6EA 1Y1VC 3QX3A 4PAAA 2W7VA 1WCMC 3HKZD 1Y1WA 4O2DA 4A3LK 2XCRB 4A3CC 5C44C 2WB1D 3GTJC 1TWFA 1I3QK 4BKWA 4KM8A 1DCOA 5CJ9A 3OPFA 1WCMA 3BP8C 1I50K 5IYDC 5FLMK 1TWFC 4YG2A 2A6HA 4M1XA 4LLGA 3AD7C 3H3VD 1R9TC 1O25A 4BY1K 3AQOA 5JFEA 2E2HA 1TWHK 3S2DC 5M5XK 1YX2A 2E2JC 1F93A 3A8JA 4MQ9A 5TMFA 4QJVA 3MMLB 4P9SA 3ERED 1SFOC 3LAJA 3FHZA 1ZYRA 4G0VA 1SMYA 3RZDC 4BXXK 4LJZA 3FKIK 2RH6A
chains in the Genus database with same CATH topology
3GTLK 2NVTK 3HOWC 3PO3C 4A93C 3I4NC 2CW0A 3S16C 3I4MK 3S1NK 1BDFA 2WB1L 2B63K 3S1MK 3M4OK 2Y0SL 5FLMC 3HOVK 1TWAC 2JA8C 4A3MC 1HQMA 2WAQL 4A3JK 4A3EK 3GTMC 4MEYA 3GTPC 3HOZK 1TWFK 3HOVC 4A3KK 3HKZL 3PO2K 3S16K 4X6AK 3GTPK 3S17C 5IP9C 3H0GC 4BY7K 2NVTC 1I6VA 5C4XK 3GTJK 4QIWD 2PPBA 3GTKK 1TWHC 3DXJA 2B63C 2JA7C 3M4OC 1R9TK 4A3CK 4OIQA 2JA5C 3H3VL 4A3LC 3HOWK 3PO3K 1Y1WK 4A93K 2E2IC 4A3FC 1TWGK 2R92K 2Y0SD 2NVXK 2A69A 5C3EK 4BY1C 2R7ZC 3S14C 1I50C 2NVYK 4A3GK 3HOUC 4A3EC 3S17K 3HOXC 5IYBC 5M3FK 4MEXA 4KN7A 5D4DA 5M5WK 2NVQK 4YFNA 5IYBK 1TWCC 4YFKA 5M3MK 5IYCC 1I3QC 3CQZK 2YU9C 4OIPA 4Q5SA 4XLNA 4A3IC 2A68A 3FKIC 3HOYC 3S2DK 4ZH4A 2R92C 3S1RK 1I6HK 4Y52K 3M3YK 2O5IA 1Y1WC 3I4NK 4XSZA 4A3FK 4GZYA 3K7AK 2E2JK 4Y52C 3S1RC 4Y7NC 2VUMC 3S2HC 4A3BC 1IW7A 3PO2C 4BXXC 1I6HC 4AYBD 1WCMK 4A3DC 3GTGC 3H0GK 4C3IK 2PMZL 5IYCK 5IP7C 4QJVB 4BY7C 4BBSC 4OINA 4G7OA 4A3IK 2A6EA 1Y1VC 3S1MC 3HOZC 5IP7K 4BBSK 3EQLA 2WAQD 2E2HC 3S15K 1WCMC 4A3DK 3HKZD 4JK1A 4XSXA 4BBRK 3GTQC 2O5JA 4Y7NK 5M5YK 5C44K 4OIOA 2E2IK 4KMUA 1TWGC 2NVYC 2JA7K 4A3LK 4A3CC 5C44C 4A3BK 5C4JC 4G7HA 2WB1D 1SFOK 4AYBL 3GTJC 3S15C 5C4XC 4Q4ZA 2PA8D 2PMZD 1I3QK 3S1NC 1K83K 4C3HK 1XPPA 2BE5A 1TWAK 2JA6K 2JA8K 4A3MK 4X6AC 1I50K 5IYDC 3RZOC 2VUMK 5FLMK 1TWFC 4YG2A 3S2HK 5FJ8K 5C4JK 2A6HA 1K83C 4LLGA 4XLPA 3H3VD 4C2MK 3GTGK 4C3JK 1R9TC 2JA5K 4BY1K 1YNJA 4NOIA 5TMCA 1TWHK 3HOYK 3K7AC 5M5XK 3S2DC 2E2JC 2PA8L 4OIRA 5IP9K 3S1QK 3GTLC 5IYDK 2E2HK 1YNNA 3GTOC 4LK0A 4MQ9A 4BBRC 3GTQK 3RZOK 2R93K 3RZDK 3CQZC 5TMFA 2YU9K 4QJVA 2JA6C 3S14K 3GTMK 4A3GC 2NVQC 1Y1VK 1TWCK 2R93C 2NVXC 2R7ZK 4A3KC 5C3EC 1SFOC 4KN4A 3GTOK 4A3JC 3HOUK 1ZYRA 3HOXK 4G7ZA 3S1QC 1SMYA 3RZDC 3M3YC 3WODA 4BXXK 4YFXA 4QIWL 3GTKC 4LJZA 3I4MC 3FKIK 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL K;  2NVT K;  3HOW C;  3PO3 C;  4A93 C;  3I4N C;  2CW0 A;  3S16 C;  3I4M K;  3S1N K;  1BDF A;  2WB1 L;  2B63 K;  3S1M K;  3M4O K;  2Y0S L;  5FLM C;  3HOV K;  1TWA C;  2JA8 C;  4A3M C;  1HQM A;  2WAQ L;  4A3J K;  4A3E K;  3GTM C;  4MEY A;  3GTP C;  3HOZ K;  1TWF K;  3HOV C;  4A3K K;  3HKZ L;  3PO2 K;  3S16 K;  4X6A K;  3GTP K;  3S17 C;  5IP9 C;  3H0G C;  4BY7 K;  2NVT C;  1I6V A;  5C4X K;  3GTJ K;  4QIW D;  2PPB A;  3GTK K;  1TWH C;  3DXJ A;  2B63 C;  2JA7 C;  3M4O C;  1R9T K;  4A3C K;  4OIQ A;  2JA5 C;  3H3V L;  4A3L C;  3HOW K;  3PO3 K;  1Y1W K;  4A93 K;  2E2I C;  4A3F C;  1TWG K;  2R92 K;  2Y0S D;  2NVX K;  2A69 A;  5C3E K;  4BY1 C;  2R7Z C;  3S14 C;  1I50 C;  2NVY K;  4A3G K;  3HOU C;  4A3E C;  3S17 K;  3HOX C;  5IYB C;  5M3F K;  4MEX A;  4KN7 A;  5D4D A;  5M5W K;  2NVQ K;  4YFN A;  5IYB K;  1TWC C;  4YFK A;  5M3M K;  5IYC C;  1I3Q C;  3CQZ K;  2YU9 C;  4OIP A;  4Q5S A;  4XLN A;  4A3I C;  2A68 A;  3FKI C;  3HOY C;  3S2D K;  4ZH4 A;  2R92 C;  3S1R K;  1I6H K;  4Y52 K;  3M3Y K;  2O5I A;  1Y1W C;  3I4N K;  4XSZ A;  4A3F K;  4GZY A;  3K7A K;  2E2J K;  4Y52 C;  3S1R C;  4Y7N C;  2VUM C;  3S2H C;  4A3B C;  1IW7 A;  3PO2 C;  4BXX C;  1I6H C;  4AYB D;  1WCM K;  4A3D C;  3GTG C;  3H0G K;  4C3I K;  2PMZ L;  5IYC K;  5IP7 C;  4QJV B;  4BY7 C;  4BBS C;  4OIN A;  4G7O A;  4A3I K;  2A6E A;  1Y1V C;  3S1M C;  3HOZ C;  5IP7 K;  4BBS K;  3EQL A;  2WAQ D;  2E2H C;  3S15 K;  1WCM C;  4A3D K;  3HKZ D;  4JK1 A;  4XSX A;  4BBR K;  3GTQ C;  2O5J A;  4Y7N K;  5M5Y K;  5C44 K;  4OIO A;  2E2I K;  4KMU A;  1TWG C;  2NVY C;  2JA7 K;  4A3L K;  4A3C C;  5C44 C;  4A3B K;  5C4J C;  4G7H A;  2WB1 D;  1SFO K;  4AYB L;  3GTJ C;  3S15 C;  5C4X C;  4Q4Z A;  2PA8 D;  2PMZ D;  1I3Q K;  3S1N C;  1K83 K;  4C3H K;  1XPP A;  2BE5 A;  1TWA K;  2JA6 K;  2JA8 K;  4A3M K;  4X6A C;  1I50 K;  5IYD C;  3RZO C;  2VUM K;  5FLM K;  1TWF C;  4YG2 A;  3S2H K;  5FJ8 K;  5C4J K;  2A6H A;  1K83 C;  4LLG A;  4XLP A;  3H3V D;  4C2M K;  3GTG K;  4C3J K;  1R9T C;  2JA5 K;  4BY1 K;  1YNJ A;  4NOI A;  5TMC A;  1TWH K;  3HOY K;  3K7A C;  5M5X K;  3S2D C;  2E2J C;  2PA8 L;  4OIR A;  5IP9 K;  3S1Q K;  3GTL C;  5IYD K;  2E2H K;  1YNN A;  3GTO C;  4LK0 A;  4MQ9 A;  4BBR C;  3GTQ K;  3RZO K;  2R93 K;  3RZD K;  3CQZ C;  5TMF A;  2YU9 K;  4QJV A;  2JA6 C;  3S14 K;  3GTM K;  4A3G C;  2NVQ C;  1Y1V K;  1TWC K;  2R93 C;  2NVX C;  2R7Z K;  4A3K C;  5C3E C;  1SFO C;  4KN4 A;  3GTO K;  4A3J C;  3HOU K;  1ZYR A;  3HOX K;  4G7Z A;  3S1Q C;  1SMY A;  3RZD C;  3M3Y C;  3WOD A;  4BXX K;  4YFX A;  4QIW L;  3GTK C;  4LJZ A;  3I4M C;  3FKI K;  4LK1 A; 
#chains in the Genus database with same CATH topology
 4LOW A;  3G4A A;  1JQW A;  5EGE A;  3I4N C;  3S1N K;  2XCQ A;  2B63 K;  3HOV K;  4A3M C;  4GTD A;  1G51 A;  2CFA B;  4GTB A;  4A3E K;  3GTJ A;  4WIL A;  3GTP K;  3S17 C;  5IP9 C;  3H0G C;  4GT9 A;  4C3I C;  1IL2 A;  4BY7 K;  1JVI A;  1UV7 A;  5C4X K;  1J98 A;  2B63 C;  2E2I C;  5E68 A;  1O2F B;  1TWC A;  3GTL A;  2A69 A;  4BY1 C;  3S14 C;  3HOU C;  4A3E C;  3S17 K;  3HOX C;  5IYB C;  4KM9 A;  2D6F C;  5M5W K;  1XZP B;  2NVQ K;  1WOS A;  2V6T A;  4KAT A;  5EGH A;  1Y1V A;  1ISE A;  2A68 A;  1I6H K;  3V4G A;  4GZY A;  3K7A K;  3S1R C;  3S2H C;  4Y7N C;  3TFI A;  1XXB A;  4A3B C;  1IW7 A;  3PO2 C;  4BXX C;  4AYB D;  4A3D C;  3GSI A;  2PMZ L;  4QJV B;  2NVY A;  3HOZ C;  5IP7 K;  4BBS K;  3EQL A;  1VGX A;  1SFO A;  3HXA A;  2P5M A;  4XSX A;  3GTQ C;  2O5J A;  1PJ6 A;  4Y7N K;  1O26 A;  2NVY C;  4A3B K;  5C4X C;  4C3J C;  4Q4Z A;  3TFJ A;  2JA7 A;  1K83 K;  2JH3 A;  4C3H K;  3T00 A;  3GTO A;  2V6U A;  1L0W A;  1TWA K;  2JA6 K;  2JA8 K;  3SZY A;  4X6A C;  2P8T A;  3CAG A;  2VUM K;  4KAS A;  2YU9 A;  4XLP A;  5L46 A;  4C3J K;  4KDD A;  4KMH A;  1B4B A;  4NOI A;  3BUE A;  5TMC A;  3N0B A;  5IYD K;  4OIR A;  1WQG A;  3GTL C;  2E2H K;  4FM9 A;  3GTO C;  3VA7 A;  4LK0 A;  4BBR C;  2R93 K;  4AH6 A;  2JA6 C;  4A3G C;  3GDZ A;  1Y1V K;  1F7U A;  1WQH A;  4KN4 A;  3L4K A;  4A3J C;  1XZQ B;  5IOQ A;  3M3Y C;  3ORE A;  4YFX A;  4QIW L;  1XZQ A;  3Q3Q A;  4LK1 A;  4KB4 A;  3GTL K;  2NVT K;  4A93 C;  2CW0 A;  3LAP A;  3S16 C;  3S1M K;  2WB1 L;  3M4O K;  4C45 A;  3GTK A;  4A3J K;  1O27 A;  1BS2 A;  1TWF K;  3HOV C;  2ZFZ A;  3HKZ L;  2GSN A;  3N0C A;  3L4J A;  4KMD A;  2NVT C;  2PPB A;  1TWH C;  2E2I A;  1XZP A;  3M4O C;  2JA7 C;  3AD8 C;  1BGW A;  4P5A A;  1R9T K;  1JOE A;  1DCH A;  1USM A;  4A93 K;  2KWA A;  1TWG K;  1VJE A;  4KC6 A;  2Y0S D;  2NVX K;  2R7Z C;  5C3E K;  1IBA A;  5JVO A;  3JST A;  3T02 A;  2FQT A;  5IYB K;  5IYC C;  2Y3P A;  1I3Q C;  2FQO A;  4Q5S A;  1F9N A;  4XLN A;  3FKI C;  1EFW A;  4Y52 K;  1IS1 A;  3A8K A;  2O5I A;  3I4N K;  4XSZ A;  4C2M C;  2R92 A;  3ADA C;  1I6H C;  2JA6 A;  4G0W A;  5IYC K;  1VH2 A;  4FZB A;  4KMA A;  3GTG A;  4GTE A;  4KAR A;  3S1M C;  3GIR A;  2WAQ D;  3S15 K;  2GAH C;  4A3D K;  5M5Y K;  4OIO A;  2E2I K;  1VRQ C;  5C4J C;  3TFH A;  4G7H A;  1SFO K;  1DCP A;  4G0U A;  4KB2 A;  1O2B A;  1C0A A;  1O28 A;  3T01 A;  1XPP A;  5FJ8 K;  5C4J K;  1K83 C;  1F7V A;  3GTG K;  3GTQ A;  2JA5 K;  1AB4 A;  4WJ3 M;  1GE9 A;  3K7A C;  1VLO A;  2PA8 L;  5IP9 K;  1J6X A;  2R7Z A;  1HI9 A;  1WQF A;  1IE0 A;  1WOP A;  3CQZ C;  2YU9 K;  1TWC K;  2R93 C;  4A3K C;  3GTO K;  1IQ0 A;  3HOU K;  3IPJ A;  3HOX K;  4G7Z A;  4LQY A;  3GTK C;  3I4M C;  2NVX A;  4GTL A;  2Y0S L;  5FLM C;  3N3Y A;  1R9T A;  1TWA C;  2JA8 C;  4MEY A;  1XXA A;  4A3K K;  3PO2 K;  4BLB A;  4DDQ A;  3FOF A;  3S16 K;  4X6A K;  4J3N A;  1I6V A;  1EK8 A;  4XCH A;  2ZUE A;  3NUH A;  3GTK K;  3H0G A;  3DXJ A;  4RMF A;  4A3C K;  4A3L C;  4OIQ A;  3H3V L;  2GSO A;  4BLA A;  1EI6 A;  1O24 A;  1J6W A;  4A3G K;  1WSR A;  2NVY K;  4MEX A;  2V6S A;  1KQ4 A;  4YFN A;  4GTA A;  3CQZ K;  2YU9 C;  3TTG A;  2JA5 A;  4A3I C;  5IOR A;  3HOY C;  3LPX A;  4ZH4 A;  3OEP A;  2R93 A;  3M3Y K;  4KAW X;  2EBB A;  1BJT A;  1O2A A;  2GSU A;  3CQZ A;  2E2J K;  4Y52 C;  1I50 A;  2VUM C;  1WCM K;  1ZQ1 C;  3H0G K;  4C3I K;  1EQR A;  4BY7 C;  3G4C A;  4OIN A;  4G7O A;  4A3I K;  1V5V A;  1XXC A;  2VUM A;  2E2H C;  1TWA A;  4JK1 A;  4BBR K;  5C44 K;  3GEE A;  4KMU A;  1TWG C;  5CHP A;  2B63 A;  2JA7 K;  3AQP A;  1DD5 A;  4GFQ A;  4AYB L;  3S15 C;  3GTP A;  2PA8 D;  3FKI A;  2PMZ D;  4ILD A;  2BE5 A;  4P5B A;  1PJ5 A;  1B4A A;  1WOO A;  4A3M K;  1USO A;  1WSV A;  3A8I A;  3RZO C;  3S2H K;  1WOR A;  4C2M K;  5HL8 A;  1YNJ A;  3GEH A;  3HOY K;  3S1Q K;  1TWH A;  1YNN A;  1PJ7 A;  3GTQ K;  3RZO K;  3RZD K;  3S14 K;  3GTM K;  2NVQ C;  2NVX C;  2R7Z K;  5C3E C;  2GAG C;  3AH5 A;  3S1Q C;  3WOD A;  1I3Q A;  4GTF A;  3S1N C;  1WIH A;  3HOW C;  3PO3 C;  1ZXO A;  3I4M K;  1BDF A;  1INN A;  3AD9 C;  3S0X A;  1HQM A;  2WAQ L;  3GTM C;  3GTP C;  3HOZ K;  3FOE A;  3BP3 A;  1O29 A;  4LR2 A;  3GTJ K;  4QIW D;  1ZBS A;  2JA5 C;  2XCO A;  3HOW K;  3PO3 K;  1Y1W K;  4A3F C;  1YCL A;  2CFA A;  2R92 K;  3GTM A;  1I50 C;  4GTC A;  5M3F K;  4KN7 A;  5D4D A;  5IOT A;  1EH1 A;  4C3H C;  1TWC C;  4YFK A;  5M3M K;  5TJ3 A;  1RU0 A;  4OIP A;  3S2D K;  2R92 C;  2PHC B;  3S1R K;  4PAB A;  1X31 C;  1Y1W C;  4A3F K;  1J6V A;  1TWG A;  4WJ4 A;  3GEI A;  5IOS A;  3SZZ A;  3GTG C;  5IP7 C;  4BBS C;  2ZUF A;  1K83 A;  1ZVU A;  2RGR A;  2A6E A;  1Y1V C;  3QX3 A;  4PAA A;  2W7V A;  1WCM C;  3HKZ D;  1Y1W A;  4O2D A;  4A3L K;  2XCR B;  4A3C C;  5C44 C;  2WB1 D;  3GTJ C;  1TWF A;  1I3Q K;  4BKW A;  4KM8 A;  1DCO A;  5CJ9 A;  3OPF A;  1WCM A;  3BP8 C;  1I50 K;  5IYD C;  5FLM K;  1TWF C;  4YG2 A;  2A6H A;  4M1X A;  4LLG A;  3AD7 C;  3H3V D;  1R9T C;  1O25 A;  4BY1 K;  3AQO A;  5JFE A;  2E2H A;  1TWH K;  3S2D C;  5M5X K;  1YX2 A;  2E2J C;  1F93 A;  3A8J A;  4MQ9 A;  5TMF A;  4QJV A;  3MML B;  4P9S A;  3ERE D;  1SFO C;  3LAJ A;  3FHZ A;  1ZYR A;  4G0V A;  1SMY A;  3RZD C;  4BXX K;  4LJZ A;  3FKI K;  2RH6 A; 
#chains in the Genus database with same CATH homology
 3GTL K;  2NVT K;  3HOW C;  3PO3 C;  4A93 C;  3I4N C;  2CW0 A;  3S16 C;  3I4M K;  3S1N K;  1BDF A;  2WB1 L;  2B63 K;  3S1M K;  3M4O K;  2Y0S L;  5FLM C;  3HOV K;  1TWA C;  2JA8 C;  4A3M C;  1HQM A;  2WAQ L;  4A3J K;  4A3E K;  3GTM C;  4MEY A;  3GTP C;  3HOZ K;  1TWF K;  3HOV C;  4A3K K;  3HKZ L;  3PO2 K;  3S16 K;  4X6A K;  3GTP K;  3S17 C;  5IP9 C;  3H0G C;  4BY7 K;  2NVT C;  1I6V A;  5C4X K;  3GTJ K;  4QIW D;  2PPB A;  3GTK K;  1TWH C;  3DXJ A;  2B63 C;  2JA7 C;  3M4O C;  1R9T K;  4A3C K;  4OIQ A;  2JA5 C;  3H3V L;  4A3L C;  3HOW K;  3PO3 K;  1Y1W K;  4A93 K;  2E2I C;  4A3F C;  1TWG K;  2R92 K;  2Y0S D;  2NVX K;  2A69 A;  5C3E K;  4BY1 C;  2R7Z C;  3S14 C;  1I50 C;  2NVY K;  4A3G K;  3HOU C;  4A3E C;  3S17 K;  3HOX C;  5IYB C;  5M3F K;  4MEX A;  4KN7 A;  5D4D A;  5M5W K;  2NVQ K;  4YFN A;  5IYB K;  1TWC C;  4YFK A;  5M3M K;  5IYC C;  1I3Q C;  3CQZ K;  2YU9 C;  4OIP A;  4Q5S A;  4XLN A;  4A3I C;  2A68 A;  3FKI C;  3HOY C;  3S2D K;  4ZH4 A;  2R92 C;  3S1R K;  1I6H K;  4Y52 K;  3M3Y K;  2O5I A;  1Y1W C;  3I4N K;  4XSZ A;  4A3F K;  4GZY A;  3K7A K;  2E2J K;  4Y52 C;  3S1R C;  4Y7N C;  2VUM C;  3S2H C;  4A3B C;  1IW7 A;  3PO2 C;  4BXX C;  1I6H C;  4AYB D;  1WCM K;  4A3D C;  3GTG C;  3H0G K;  4C3I K;  2PMZ L;  5IYC K;  5IP7 C;  4QJV B;  4BY7 C;  4BBS C;  4OIN A;  4G7O A;  4A3I K;  2A6E A;  1Y1V C;  3S1M C;  3HOZ C;  5IP7 K;  4BBS K;  3EQL A;  2WAQ D;  2E2H C;  3S15 K;  1WCM C;  4A3D K;  3HKZ D;  4JK1 A;  4XSX A;  4BBR K;  3GTQ C;  2O5J A;  4Y7N K;  5M5Y K;  5C44 K;  4OIO A;  2E2I K;  4KMU A;  1TWG C;  2NVY C;  2JA7 K;  4A3L K;  4A3C C;  5C44 C;  4A3B K;  5C4J C;  4G7H A;  2WB1 D;  1SFO K;  4AYB L;  3GTJ C;  3S15 C;  5C4X C;  4Q4Z A;  2PA8 D;  2PMZ D;  1I3Q K;  3S1N C;  1K83 K;  4C3H K;  1XPP A;  2BE5 A;  1TWA K;  2JA6 K;  2JA8 K;  4A3M K;  4X6A C;  1I50 K;  5IYD C;  3RZO C;  2VUM K;  5FLM K;  1TWF C;  4YG2 A;  3S2H K;  5FJ8 K;  5C4J K;  2A6H A;  1K83 C;  4LLG A;  4XLP A;  3H3V D;  4C2M K;  3GTG K;  4C3J K;  1R9T C;  2JA5 K;  4BY1 K;  1YNJ A;  4NOI A;  5TMC A;  1TWH K;  3HOY K;  3K7A C;  5M5X K;  3S2D C;  2E2J C;  2PA8 L;  4OIR A;  5IP9 K;  3S1Q K;  3GTL C;  5IYD K;  2E2H K;  1YNN A;  3GTO C;  4LK0 A;  4MQ9 A;  4BBR C;  3GTQ K;  3RZO K;  2R93 K;  3RZD K;  3CQZ C;  5TMF A;  2YU9 K;  4QJV A;  2JA6 C;  3S14 K;  3GTM K;  4A3G C;  2NVQ C;  1Y1V K;  1TWC K;  2R93 C;  2NVX C;  2R7Z K;  4A3K C;  5C3E C;  1SFO C;  4KN4 A;  3GTO K;  4A3J C;  3HOU K;  1ZYR A;  3HOX K;  4G7Z A;  3S1Q C;  1SMY A;  3RZD C;  3M3Y C;  3WOD A;  4BXX K;  4YFX A;  4QIW L;  3GTK C;  4LJZ A;  3I4M C;  3FKI K;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...