2YUIA

Solution structure of the n-terminal domain in human cytokine-induced apoptosis inhibitor anamorsin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
182
structure length
182
Chain Sequence
GSSGSSGMADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain in human cytokine-induced apoptosis inhibitor anamorsin
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Anamorsin
total genus 29
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yuiA00
2JH8A 2O57A 5E2AA 2ZWVA 3VYWA 2C7QA 2PGXA 4XUCA 5LQKA 3CJQA 1M6EX 2NP7A 1Q0SA 4H0NA 4POOA 4RTKA 5HZMA 1T43A 3UWPA 1KR5A 1RJFA 3KU1A 3LDUA 1NT2A 5BW4A 5GP1A 4FZVA 1WXXA 3PX2A 3OPNA 1NBIA 4MWZA 8MHTA 2PT6A 2ZIEA 3OU7A 3O4FA 5FUBA 2PXCA 3ID6C 2BM9A 2PKWA 2Z6QA 4OA8A 5EEGA 3E23A 1P1CA 1XXLA 4CKBA 3EVZA 2DPMA 3TOSA 1AV6A 3KPVA 5DTMA 1DCTA 5EOVA 1XCJA 3D2LA 3GIWA 5EHIA 4Z2YA 4RTPA 1G8AA 4EVIA 3F4KA 3B89A 5HOQA 4RVHA 5MHTA 3HVIA 3JWHA 3MB5A 4QQKA 4PYNA 2YR0A 2OB2A 1KPHA 3CJTA 3NTVA 4F85A 4HRAA 1N7IA 2KW5A 1L9KA 3OU6A 4E2WA 1VBFA 1EG2A 3A7DA 3LGAA 4WXHA 3R3HA 3KR0A 3ME5A 4EMSA 3OFKA 2YXDA 4PCAA 3SSOA 3NVKI 2JG3A 4HSGA 4GC5A 4HGZA 5JUWA 9MHTA 4EKGA 2ZBRA 1Y8CA 3EVFA 5ICCA 1XDZA 3PTAA 1L3CA 2NXJA 4V0RA 1XCLA 2UYCA 1JG2A 2CWWA 5GINE 1VE3A 1O9HA 2ZCJA 2BH2A 5KVAA 2VS1A 1R18A 2CL5A 3B7PA 3LECA 2EJTA 5DXJA 3M6VA 1JG3A 3GCZA 3EEOA 2I9KA 3ELWA 1NKVA 2OKCA 3LDGA 4RVGA 5E2BA 3BWYA 3AJDA 2N47A 2PXAA 1INLA 3HNRA 3Q7EA 5LR6A 4CTJA 2IDJA 2FYTA 1OR8A 2ZWAA 5DWQA 3SXJA 1RJGA 2B9EA 3KR2A 1RI5A 1NW8A 1NW3A 3DP7A 4AX8A 3AY0A 3CCFA 4JXJA 3QOWA 3NDIA 1NW5A 3A7EA 4KDCA 2E5WA 3UJ7A 1F38A 1RJDA 1U2ZA 1RI3A 3H2BA 4GOOD 3DMHA 4BLUA 3ER8A 3P9KA 3HCCA 1QANA 3MQ2A 2HWKA 4FR0A 2UYOA 1HMYA 2JHCA 1I1NA 4EQZA 2UYHA 3K0BA 3KQTA 3B3JA 4RSRA 1VIDA 2R3SA 3LHDA 3VC2A 2Z6AA 2QYOA 2PWPA 2IFTA 3PVCA 5CCBA 2AOWA 1EAMA 5U4XA 1R8YA 3I9FA 5E1OA 1SQFA 1D2GA 2AVDA 2ZVJA 4XUEA 5EKUA 5EZSA 5FA5A 2I62A 3C3YA 4Y30A 1R8XA 1X1DA 3AXTA 2G70A 1ZGJA 3CC8A 4E2YA 3IV6A 4HGYA 4AZSA 4E31A 2C7RA 2BM8A 1D2HA 4IWNA 3OZRA 3FPHA 2PY6A 3VC1A 3HTXA 3UJCA 1YUBA 2BR3A 2EX4A 5D1HA 4KWCA 3EEYA 3P97A 3FUUA 3O7WA 1JG1A 1I9GA 1R74A 2G8NA 3EVCA 3T7SA 2AN3A 4BLWA 4YUZA 5DSTA 2IBTA 3HEMA 3MAGA 2IPXA 3G89A 1SQGA 3ER9A 1RI2A 3G5LA 3ORHA 3MERA 5FA8A 3HP7A 1MHTA 3OE5A 3HCBA 3KPYA 1WS6A 2ORED 4HTFB 3FTCA 1FBNA 1M6YA 5E9WA 3SX0A 2UZ4A 3MHTA 2NXEA 2ZZNA 3OU2A 5DM0A 1JR4A 4RVDA 5B1SA 5DXAA 3I64A 2YUIA 3UA3A 3BXOA 5CD1A 1BOOA 5EHGA 5F2NA 1IXKA 4KW7A 2HMYB 3P2KA 3E05A 4YV0A 1ORIA 2P3OA 1KXZA 1UFKA 2JHPA 3P71T 3RIEA 5LSAA 1M0EA 2ADMA 5C1IA 3DXZA 1TPYA 5F2OA 3UZUA 1RI4A 4E32A 3ELDA 3REOA 4RTOA 4M7RA 3G2MA 4C06A 1N2XA 4P7GA 2R6ZA 3P9NA 5ICEA 2C7PA 3DUWA 3FRIA 4QPNA 2NXCA 4GQBA 3P9CA 1VP3A 3FUXA 2PJDA 3R24A 5FCDA 4RTJA 2HV9A 2O05A 1NV8A 3IHTA 3FPJA 5K8VA 4QPPA 1V39A 2AOXA 3S68A 5K09A 3FRHA 2AZTA 1WXWA 4ISCA 5FHRA 3DTNA 3PFGA 5GM2A 3FTEA 3HA5A 4RTNA 3G2PA 4U7PB 3HCFA 3JWIA 2Y1XA 3NMUF 3KQVA 5E8RA 3DLCA 3C0KA 1ZQ9A 2P40A 3HCEA 3MTEA 3M4XA 4PONA 2LD4A 5IH3A 2OBFA 1XTPA 2PVCA 2EJUA 2XBMA 2XYVA 1EQAA 5FQOA 4PNEA 10MHA 2YXLA 4RTRA 3B5IA 5GIPE 3TQSA 1IY9A 4KRGA 4R05A 2YQZA 2QE6A 2XYQA 4OBXA 4QDJA 3DULA 4X1OA 3TM5A 3JWJA 3R9XB 4ER5A 4RTSA 1P91A 4C03A 5KQSA 2G71A 2CMGA 2ESRA 2PT9A 3SSNA 1X19A 2P3QA 3MTIA 1P1BA 4PGGA 2VDUE 1ZHFA 2OZVA 1KPIA 3OCJA 5FADA 5LQJA 1B42A 2IIPA 3LKDA 4FP9A 3K6RA 4L7VA 4DA4A 5DPMA 2A14A 3BGIA 3I53A 4RTLA 3RODA 3RW9A 2QRVB 3P9IA 2CMHA 3LX6A 2EG5A 1L1EA 3KQPA 4KVZA 1KPGA 3KR1A 4MQ4A 4PYJA 3X0DA 5GIOE 4IKPA 5DT2A 3LSTA 4HH4A 1SVUA 5EPEA 3EMDA 4G56A 4QVKA 3GO4A 3MCTA 3T7TA 5EVJA 5HFJA 5HILA 2HNKA 2Q41A 2QY6A 3KQMA 1AF7A 4PYMA 5EIFA 3TR6A 5K0JA 1YFLA 3ERCA 1KYZA 4RVFA 2AOUA 3R6TA 2IH2A 1QAMA 3EVDA 4PIPA 4FS8A 2P7IA 4OBWA 5ICGA 3PFHA 3KPUA 4DKJA 3FUWA 3ANXA 3BKWA 4X63A 4PYOA 2GB4A 2V7EA 3NJRA 1ZGAA 4K6MA 3HVJA 2P8JA 5EIWA 1SG9A 1ZKDA 4FT2A 5CVDA 4RYLA 2ZBQA 4FSDA 5LQUA 2PV0A 4XUDA 2AOTB 5FULA 1MJFA 3EVGA 4MIKA 4X41A 5LQRA 3DXYA 5DM2A 2PLWA 3V97A 4KDRA 4M36A 3HA7A 5DX1A 5M5BA 5E1BA 1JTEA 3C6KA 3LBYA 3EPPA 3HCAA 3FPEA 4YUVA 1HNNA 3HVKA 4PCLA 5K03A 3M33A 3BWMA 2YX1A 2P3LA 3BT7A 3TKYA 3UBTA 2FK8A 2ZLBA 2YVLA 5E8JA 1NBHA 1UWVA 3KQQA 3DXXA 3EGEA 3LDFA 4CKCA 4YV1A 4GEKA 1BC5A 1VL5A 2CKDA 4AZVA 1FPQA 2PXXA 3A4TA 5CVUA 3IEIA 1Z3CA 3LCVB 3L8DA 5E9QA 5HIMA 4DMGA 1JSXA 3FYDA 1I4WA 3THRA 1EJ0A 1P39A 3AXSA 5EMKA 1TW2A 3UJBA 3EMBA 4YUWA 5FWDA 3UA4A 1VPTA 4C08A 4PYQA 4GF5A 2FHPA 4BP1A 5HEKA 5BP7A 3NVMB 2OYRA 1NE2A 2ONYA 5K0EA 3EGIA 4RV9A 1G6Q1 2BR5A 5K0FA 5IKMA 5FTWA 1RJEA 3DR5A 5ERGB 2WA2A 4PYLA 1AQIA 4U7TB 3EVBA 5DM1A 5KYGA 1YFJA 3OZTA 3TMAA 1FP1D 3GRZA 3I58A 1L3IA 3CGGA 5JR3A 3I5UA 5DX8A 4DF3A 3GDHA 7MHTA 3B3GA 2H11A 3B3FA 3BKXA 4OA5A 2UYQA 5T67A 4F84A 5K0LA 5CIYA 3CKKA 4E70A 3P2IA 4FT4A 2Z6UA 2XYRA 2OY0A 3DMFA 3EVEA 4QTTB 1X1CA 5EEHA 3C3PA 3M70A 3GRRA 3PB3A 2IGTA 2VDVE 4ATNA 3SMQA 4YMGA 4Y2HA 2AVNA 5DM4A 1DL5A 3BGVA 3O31A 4C4AA 4C05A 4YMHA 3CJRA 4PINA 2P7HA 1G8SA 2GAFA 5F2KA 5KS2A 4M38A 2BR4A 4BP3A 4A6DA 3FTFA 3G2OA 3KHKA 4P7JA 4X60A 4DZRA 4P58A 4ER3A 2B25A 4QDKA 5CUQA 1Q0TA 2ZSUA 4O29A 3FYCA 2OO3A 5DTRA 3UFBA 3FPGA 2DULA 3DOUA 3OE4A 4P7KA 3JWGA 5E1DA 3GRUA 2WA1A 1G60A 1UIRA 2OXTA 3G88A 3P2EA 1WG8A 3HVHA 3M6UA 3GWZA 5E1MA 2PWYA 3U81A 2FPOA 5EC8A 2P1DA 5CVEA 5EMMA 2AOVA 5GWXA 3TKAA 2H00A 3UJDA 4E2XA 4PWYA 5CVVA 5CCXA 2GH1A 2PX8A 4HTFA 4BLVA 5ICFA 1JTFA 2JJQA 3QOXA 1EIZA 3LCCA 4DCMA 4IV8A 5LQAA 3FUTA 3T7RA 4LWOA 3UJ8A 2O06A 3BWBA 1AQJA 2ONZA 5GM1A 1TW3A 1X1AA 3ELUA 1VLMA 2GLUA 4GBED 3SGLA 3ELYA 4OX9Y 1H1DA 1SUSA 3BZBA 5FQNA 5DTQA 2PSSA 3FZGA 5K0BA 2O07A 3E7PA 4PIMA 2GA9A 2NNWB 1QZZA 1XJ5A 3THSA 4LG1A 4R6WA 3FTDA 4HG2A 1RI1A 1NW6A 1XVAA 3G8AA 3GRYA 4F86A 2NP6A 4PGHA 1JG4A 4GOMD 4YUYA 5K05A 3C6MA 4NECA 1G55A 1QAQA 2AS0A 4DM3A 2P35A 1KP9A 2WK1A 3A26A 2AN5A 5D1NA 3LBFA 2VP3A 4C04A 3CBGA 3R0QA 2AN4A 3MGGA 4LECA 5BXYA 2P41A 5C9ZA 3BWCA 3OFJA 3PT9A 5DRTA 2IP2A 3IYLW 4RX1A 2C7OA 3SVZA 2AR0A 3HCDA 1XDSA 2ZULA 1X1BA 2NXNA 4E33A 3HM2A 5HIKA 2FRXA 1O9GA 2FK7A 1KYWA 1XDUA 2VDWA 2GS9A 2YTZA 4MTLA 3NW9A 5HIIA 2ERCA 1BKYA 3NDJA 2PBFA 3GNLA 3SM3A 3KQYA 1L3BA 3GU3A 2ZW9A 4CTKA 3NWBA 1QYRA 4RTMA 2ZZKA 3GGDA 5T64A 3SSMA 3A27A 2ZFUA 5EG5A 4CKEA 4AZWA 1YZHA 1SUIA 3EVAA 1N7JA 1PJZA 2G1PA 4ER6A 5LQNA 2BZGA 3TLJA 3EGVA 3KQWA 3PX3A 5E9JA 2O0LA 3UJ9A 1O54A 1NV9A 3KQOA 4QTUB 2H1RA 3FPFA 4GC9A 4ER0A 4RWZA 4M37A 2EFJA 5EMJA 4PYIA 4QQNA 3A25A 4R6XA 4PYKA 4CWAA 1IM8A 3UJ6A 5K0CA 2IH4A 4QVGA 5GOZA 2K4MA 2B78A 3Q87B 4HC4A 1SKMA 1PRYA 1DUSA 1JQDA 1BHJA 3NWEA 4R8SA 1JSZA 4WVLA 2AOUB 3TM4A 2FCAA 3GJYA 5DRYA 4R8RA 3LPMA 5P8WA 3CVOA 3DH0A 3M6WA 5K0GA 2PX5A 4EKIA 4GOND 1NW7A 4AZTA 3KPJA 2G72A 1FJXA 4UOEA 3LKZA 3PLAE 4XCXA 2ZZMA 4KIGA 5CM2Z 5EKXA 4YUXA 3DMGA 3T0IA 4IV0A 3KR9A 1ORHA 1WY7A 4DCGA 5LQCA 4LWPA 1YF3A 1D2CA 3WSTA 4AUKA 2B3TA 2NYUA 2I7CA 5FHQA 2ZBPA 3E8SA 4ER7A 3FUVA 5EZQA 1YB2A 2ZIFA 2V74B 1KIAA 3AWIA 3OZSA 1EJ6A 4DQ0A 5C0OE 4A6EA 2JHAA 5FWAA 3G8BA 2PX4A 3GRVA 2YXEA 2OB1A 1VQ1A 4KIFA 4X61A 3DLIA 5HIJA 2AOTA 2I6GA 5H02A 3TRKA 4V0QA 5T6BA 2XVMA 3PS9A 4EK9A 3TPZA 1YZ3A 2B2CA 2IDKA 4FSXA 3HA3A 3P8ZA 4B17A 2F8LA 4CXMA 5EGSA 2OPBA 3KPWA 4E2ZA 1ZG3A 5EQJB 4ZTBA 5DX0A 3MCZA 4OQEA 3M6XA 4FGZA 2JH9A 3V8VA 1FP2A 1VP9A 3BGDA 2ZTHA 2Y1WA 3KQSA 2HTEA 3VSEA 3KKZA 2GPYA 3LCUA 5DSXA 3UJAA 5CVJA 5G02A 4RTQA 5K01A 1G38A 4GOLD 1R00A 1QAOA 4OQDA 2ZIGA 4BY9E 4YV2A 3TFWA 5BW5A 3G2QA 4E30A 5KQRA 2IBSA 1JQ3A 3LL7A 2XVAA 3QV2A 4GUAA 5EMLA 1JQEA 1R6AA 3G5TA 3SR4A 2IH5A 3G7UA 2VZ9A 2QM3A 2HR1A 3GXOA 4P7FA 1KHHA 5DLYA 5K0NA 2PX2A 2QRVA 3BUSA 4C07A 1F3LA 1WZNA 4MHTA
chains in the Genus database with same CATH superfamily
1XQ9A 3O3NB 4M4SA 4X1IA 2C7QA 3A1TA 2OXFA 1TMOA 1EXMA 2A88A 5BUQA 1D1PA 2NO0A 3BH6A 1B8UA 3F6CA 1ZLYA 2E5LB 2I6QA 3JQDA 1MB3A 1YKGA 3WR5A 1Q0SA 4RL6A 3TB6A 4D0GA 4JI6B 4KQ9A 2VCYA 2Q9CA 5LZ8A 1V6AA 5B58T 3LMKA 5JZVA 2H54A 3DCJA 3ZE7A 3ZVLA 3AEUA 3GW8A 4A8JA 5HP4A 3VNUA 2O8BB 1ZISA 1B76A 4HS9A 3T9BA 1VHWA 4PE5B 2R5FA 3OOJA 5GAJA 3U9SA 2CK3A 2YHBA 1Y33E 3GOHA 4RSGA 1C1DA 5L7TA 1XAJA 3U3MA 3M4ZA 4NL4H 5BRJA 2W9XA 2RGXA 3R6WA 4BGVA 1NXPA 5CBPA 1EK2A 2L19A 1K5HA 2DFNA 4LYJA 3KPVA 1W5EA 5DTMA 2BF4A 4ZOLB 1G8PA 3TNYA 2H4JA 2C1ZA 3OZUA 4RSHA 2E5FA 4Z9AA 3R7AA 3X1WA 1YL6A 3L6BA 4EVIA 1FDOA 4MPRA 1T35A 4X1YA 1CS0B 1HEIA 1L5HB 4JI3B 1UXJA 2VHXA 4EPXA 4RA6B 1VKNA 2ILVA 4KYUA 4LXGA 2MSDB 2OB2A 1KPHA 2AI1A 5TR9A 3LBIA 3F5DA 1N7IA 3NGXA 3CCCA 4D4GA 1DBQA 1U0JA 3SHOA 1JU9A 1JYEA 1NSYA 1W4ZA 2Q2OA 2VQ6A 2J9XB 2VZEA 3RM3A 1P33A 4QOSA 1W35A 4G36A 2XYPA 4UU8A 3K1YA 5JPCA 2PL9A 4V0RA 3SKVA 4TTQA 3U40A 4E5UA 4QBGB 2NVBA 1LEHA 3Q7IA 1YB7A 2QT1A 3RQIA 4L5YA 4I1OA 1VPEA 4WRRA 1JA9A 3F3YA 1Z4OA 3LECA 2OHIA 3HB9A 4EGAA 5ADVA 5FI5A 1WCIA 3U80A 2FQYA 2JLZA 2RIRA 2JH3A 5HGXA 3KOZA 4PY2A 4G81A 1WIWA 1CUEA 1XTIA 2GSDA 2OHXA 3BGWA 5FKJA 4BAGA 5HA5A 3NOQA 2OMKA 1UZMA 2C1EA 4ZICA 1M2FA 3GELA 1PNRA 4PZYA 3D4OA 1VKZA 4FHZA 5J23A 1U2ZA 4PHFA 5BMVF 1T4DA 4QZVA 4G8BA 2O7QA 1JALA 2EG9A 2WQZA 3L7BA 4DWJA 4LX0A 1YRLA 3QFCA 4FR0A 3E9NA 2W2KA 1O03A 2UYOA 3A3NA 4MRSA 4V0LA 2DPXA 4U7DA 4TWZA 1O57A 3GCDA 3K0BA 4GZMA 4KXQA 4JJKA 5A4JA 3DPSA 3H9JA 3IOMA 3U3OA 4FMCF 1DEXA 3GFQA 2GCOA 3R77A 3U7IA 1DS6A 1UWLA 1VRWA 3LPAA 4L0DA 5FH9A 1TYZA 4KQKA 3AQ4A 1RXIA 4JIGA 3W4KA 4B7ZA 2VZ0A 3HZOA 4Q4CA 3N8NA 3OM1A 1RZVA 2NWQA 2OCDA 3HDTA 3VR5D 3WDSA 4B73A 1JGTA 1D8AA 1ZGCA 2DWQA 3IV6A 5F3DA 4AZSA 3JQCA 1NP3A 3G9ZA 4MI9A 3MSCA 2FEKA 2WUDA 3OZRA 1B7GO 1F2TA 4Z9XA 3WIDA 2XI4A 1Q14A 1N5RA 4X7PA 5B6JA 2IOQA 3GY0A 4GBJA 3O7WA 5GV7A 3FKQA 3EVCA 3H99A 3CEMA 3GYGA 2Z8ZA 3ZPXA 1E4EB 5FAKA 4NS1A 4OHUA 1RE1A 2BYTA 5L53A 3HSSA 2YWEA 3NV9A 1LDYA 5J58A 5E9WA 3ETDA 2C42A 2ORED 4G6ZA 4NNJA 1OAAA 3OETA 4OGLA 1ZRSA 4KQMA 3WKDA 4W9NC 3OCWA 4QG3A 2PX6A 2W2MA 3WOHA 3B52X 1UPFA 2HMYB 4XWWA 2E6KA 3QKWA 4C5CA 5BYAA 4U7HA 1DX6A 1JAIA 3HUTA 3NC0C 3WLRA 1HTTA 2OZKA 1YVRA 3BMQA 3FY4A 1DXQA 2JFVA 3JR3A 2F1OA 3SC2B 3HKEB 4O1IA 1BXRA 4QULA 1OH5A 4I9HA 3KG2A 3D54D 1K98A 4TLBA 5FJIA 1USIA 4BL5A 2DLDA 2JAUA 2WT9A 3IIEA 3OM0A 2A94A 4PPYA 2WUWE 4F5ZA 3PYXA 2HT1A 1PF7E 1Q7EA 3O95A 4TVBA 4XGRA 1Z8FA 3I2HA 3JAKA 5GJVC 4E7OA 4F92B 3MTBA 4JD5A 4YAGA 4Y2TA 2AOXA 1ILEA 4CLRB 4CR8A 3OTHA 3RT1A 2I2DA 3DOIA 1N92A 2ODBA 3VPFA 1GKLA 2V7QD 4YLYA 1B15A 3PFGA 5F2EA 2FJ0A 4GI7A 4P0TA 2I9PA 2CV0A 5ITSA 1EMDA 4NYMR 1I36A 4IUCS 5KJCA 1G4UR 5KNCD 4M1KA 3K5PA 2XCTB 4MUBA 2A0XA 2FX3A 4YRSA 1EFAA 1AGRA 2W2LA 3VUEA 1KVUA 1CEYA 2VK4A 5GIPE 1EXDA 5DMHA 4L5IA 3E7XA 1SCQA 4OBXA 3KOWA 3O8OA 2I4LA 1FFXA 1HEYA 1NRJB 2DTXA 3D7NA 4XJSA 4ZHQA 5BWNA 3H97A 3ND7A 1Q11A 2ESRA 3SSNA 2XIJA 1TOAA 2NT3A 1UBJS 1AOXA 1D0SA 1TMGE 3KVOA 4IOKA 4OD0A 1HRDA 1TZKA 4CYMA 4DS3A 1M9NA 5EXSA 1B42A 1XX6A 3E27A 3H9UA 4I9FA 2VHZA 5EP4A 3RJ9A 2A14A 2HLHA 1TQ6A 2QAGA 3H11A 3J7TA 1EWKA 3GV0A 3R5FA 4YRRA 2VSNA 5JVDB 1N7HA 5IZCC 1VE1A 1N3IA 1EE2A 2OUIA 2ZJBA 3F4BA 4IRXA 2DR3A 4A1OA 3LY5A 1FFCA 5GIOE 1OX6A 3OO1A 1O94A 2J8ZA 2RCYA 1E7QA 1A69A 2VNIA 1Y4SA 1YZTA 3GHYA 3MWEA 3N7AA 4H9GA 2YUTA 4TLAA 5EJAA 1ZJWA 3D1JA 3N8IA 4M7PA 4N7JA 5K3BA 3URKA 5T8KC 3GLKA 3UKDA 1F0NA 3CUSA 2H2FA 2AUNA 3GPCA 4K9PA 1E9FA 1C4XA 4PIPA 4C2UA 1EI9A 4BQIA 1UBSB 4I4NA 4N0DA 1W5SA 2OBMA 2AI3A 3IUSA 1C1YA 4MRVA 1IY0A 1QF9A 2VHTA 2PSEA 1YR2A 1IJFA 4K40A 4PXAA 3RJTA 2O5EA 3COVA 5CVDA 1NP6A 4PZDA 4DQVA 1E2MA 1QIFA 1JHDA 1OGJA 1WDKA 1YOVB 3EZ9A 4UUBA 5DWVA 4D8XA 4DSAA 1UC5B 3C16C 4ZT4A 5TF4A 4B7CA 3IAEA 3KZVA 4GW3A 5DM2A 1IBCA 5BYKA 1QVZA 2H18A 2VXYA 4N12A 2AQIA 3VDRA 1S96A 5JZSA 1EFTA 2XMDA 3T5AA 3OPYB 3EG5A 2VSQA 3EXG1 3NHSA 4OQXA 4FVTA 1KRHA 3AR5A 2WZDA 4HKTA 4WZBE 2AW3A 4AJ4A 3CGWA 1TF7A 3GUHA 3S8EA 4CEIB 2VLBA 1LI4A 3C5WP 4NNOA 5KVCA 3KQQA 1X94A 2N1MA 4KUGA 2V98A 3OY2A 1BC5A 2CJXA 2B2NA 3Q1KA 1T2EA 1DOZA 1FF9A 2IYRA 5DBEX 1NLUA 3OQ6A 4H4EA 4B4WA 3NTRA 5EIXA 3EIWA 2YXNA 1X9GA 1KSFX 3L49A 1OXMA 2WJHA 2A86A 4BUZA 4IDGA 3GAAA 3VKVA 5FWNA 1GPLA 3M3HA 3K0HA 3PUVA 2NU8B 2XDYA 3OJCA 4A0SA 3O8NA 4R1PA 1E6KA 2OILA 2R8EA 3IVXA 4EJSA 4YCMA 5JRJA 2QQ0A 2LDBA 2DT8A 1HQKA 2XBLA 2YBEA 3A1UA 3C48A 3P2JA 1W0JD 3RCBA 3AUUA 1I6LA 1T9DA 2W71A 3GGCA 4M9QA 1SXJA 1FX0B 4XCQA 5B6PA 2B6HA 1EH5A 1QHHA 3E9ZA 5CTJA 1QP8A 2XAUA 1K4YA 4UHDA 3NVDA 2E82A 2RAUA 3ZHXA 4BE4A 2CE2X 2VRWA 1IAVA 1LW7A 4E70A 1II9A 2X9VA 1HT2E 2VYVA 4FDTA 4E1AA 3OA0A 1TT7A 4J3NA 3P9PA 3L6EA 2GM5A 1X1CA 1QKJA 2R96A 4FNAA 3ZX4A 4E5DA 5BQ3A 4EDFA 1KRWA 1N2IA 1L4YA 3GGSA 5C46F 1DL5A 1Y9AA 1Z6QA 2V58A 1U2GA 4BZXA 4LDZA 2CVHA 1E2GA 4BO2A 3QWBA 1HUQA 4P7JA 4OHYA 4GP7A 1T4CB 3LT2A 4K26A 1LFDB 2O50A 3ILYA 1OXXK 2JFZA 5BYJA 4TV8A 2E2WA 3T94A 4BGDA 4PNHA 3C4VA 2X2EA 3S1LA 3JWGA 4QXQA 3V5NA 1EFCA 1WKCA 2B1JA 4U2BA 5KJ6A 4QTYA 1FU4A 4NXNB 3HDHA 2QPOA 2AYXA 2ZDGA 5HR5A 2R60A 1R4AA 3ESDA 2HGSA 2Q5OA 3ZBPA 4HTFA 5GJCA 1GUYA 3UMBA 3ZBQA 1E2DA 5G3ZA 4D3YA 4L75A 3X44A 4D99A 5ELXA 2V0GA 2C7BA 3PKZA 2G17A 2YXPX 3T7RA 4A5SA 3AYZB 2Y6VA 3KXKA 3TOZA 3BL5A 1XRPA 1G4AE 2QTGA 3GP5A 4I3GA 1TW3A 2GKSA 4CM5A 3ELUA 1VECA 3S2SA 4BN5A 3AKYA 4IIVA 3NBAA 1I1OA 1R1DA 1GRNA 1W34A 4LHXA 2PSSA 2AMJA 4ARVA 3ZLBA 1LRKA 2O07A 4QEKA 3AKEA 1ZU5A 2PM8A 2Q0HA 4OMDA 3WS7A 1U5BB 1GGHA 3D8UA 3E1SA 3HMKA 1SBHA 4OXIA 4R6WA 4S0XA 4H77A 5BQPA 4AB1A 2ZBGA 2A8YA 3H4TA 3D4LA 3FYUA 4EA9A 4BQOA 3HVRA 1Z6PA 1HNXB 2FPIB 2RJ3A 3IMCA 3PQEA 3NUQA 4Q1VA 3SYLA 2AS0A 3K8QA 4W5TA 2Q45A 4K8RB 1L4GA 1RLJA 3LXRA 3CBGA 3VSBA 5FTKA 3SZOA 1QE3A 1UAYA 2BEUB 3RVMA 4CFYA 3LOUA 3Q98A 2QW8A 2WYVA 1EDBA 3MA0A 3HVUA 2DETA 5LVAA 1HSZA 1GZ6A 1PW5A 3BHNA 4HLDA 1FFHA 1HLDA 1H8HA 3ANYB 4L3WA 3EFHA 2WYHA 2P2LA 4N4AA 2F2TA 4Q47A 3DE5X 1QHYA 4N82A 3DUFA 1XDUA 3EEIA 2Y71A 3OEEA 1O95D 1Q16A 4N3BA 1P2FA 2OP0A 5DULA 2YHSA 1YK1A 4KN6A 3BYZA 1RAAA 2HXGA 2CLDX 4KLCA 5AM4A 4DCPA 1FQKA 5I9SA 4JLKA 4CT5A 5IWCA 1P9RA 1KDOA 3B53X 3K4QA 5CX4A 2JFOA 1XKXA 1M6HA 5IW8A 3SM3A 4KV9A 4U5QA 4ZCLA 1J0XO 2I6UA 2VH5R 2F43A 1I33A 5T64A 1D2NA 1P72A 3ROXA 1FK8A 2CLHB 3AG5A 2OO7A 4LPSA 5A03A 3AHIA 4YAWA 5KDOA 5FWXA 4AUEA 3LK7A 3PLNA 3GEIA 4KRYA 1ACJA 3N0TA 3VAAA 3FWPA 1NVEA 4JSTA 4E5MA 1C80A 1PJTA 4LW8A 4NU8X 3R8XA 1C8KA 2IITA 3V48A 1T0HB 3E3NA 1MB0A 5KOJB 4M37A 2ZRPA 3N0WA 1U7XA 1YZQA 1R9JA 3ECCA 4KCGA 3H2JA 5CYGA 1ZMTA 1DGQA 5JD6A 2IH4A 1JHRA 1SHKA 3BVPA 1SKMA 2B78A 2QYHA 1E1RA 3PXXA 2C84A 1OXUA 2O3QA 1L7NA 3OY7A 4H6PA 2ZUFA 3BA1A 1UQTA 5CMLA 5I4KA 2JBAB 1VSUA 2A1UB 4MYDA 1JZQA 5EXDA 3TD6A 5ADUS 1EA7A 1Z13A 1RQPA 4JR2A 1SU4A 3PRJA 3W34A 4HB4A 1ZNYA 5TV2A 1DEKA 5CM2Z 1HM5A 3W1WA 3F9CA 4RM3A 1M8KA 1WUHS 1JKJA 3V8QA 1JWBB 1UKCA 2Q50A 4URYR 5D3KA 4D3XA 4MOWA 4JJZA 2ZPTX 1GV0A 1I3KA 2JFXA 3GFBA 3ICPA 5BUCA 3E8SA 1HO3A 1A8IA 1XE3A 3ONEA 4NZNA 2LGJA 1YCGA 1E3TA 1YQWA 3NIGB 5C0OE 2XA1A 2NVUB 2JA2A 2IV2X 2BFBA 1UT8A 1YDEA 4P31A 3SEFA 1L4KA 5H02A 3NH9A 4QQ8A 3ILHA 1M1NB 3ORQA 1FFWA 5FP0A 5CXSA 2O59A 5EWJB 4JMPA 2OBBA 5EQFA 1DRWA 1AKRA 4PC1A 5EGSA 4UOZA 2GO1A 5F3WB 2OPBA 1L4HA 2DQKA 1ZG3A 4E07A 3B70A 4BMOB 3M6XA 4C4ZA 4Z1OA 1IXRC 4EFDA 4LXHA 1YJ5A 1OFGA 2Q1TA 3LCMA 3NJ4A 4IMRA 2X3UA 3VSEA 5JIBA 5LM3A 3IL2A 1UFOA 4FR5A 4KFRA 2H85A 1XMOB 1A9YA 1DNPA 1SZPA 3EN0A 4II3A 4LRSB 3RHSA 2LTAA 1Q95A 5KQRA 4W7HA 4HEHA 1TM2A 3LL7A 2XVAA 3R3UA 5K4AA 3U49A 3WWOA 1XTUA 5JNTA 2FWIA 3BG5A 1VGVA 4HDSB 4KFTA 1T8SA 1YZGA 2PZFA 4UUQA 4BJHB 5JAUA 3ROQA 1XTQA 2ZIZA 5H80A 3KVVA 3R20A 1Q5PA 2FZVA 1XP5A 4DUZB 4EPYA 5CBPB 1BZYA 3H83A 2CXRA 4JLNA 2GRUA 2RBEA 3WLAA 2QU7A 1OLXB 4K05A 1MB9A 2VHQA 2WTMA 4HHEA 4ZAZA 4PM4A 4B3GA 3OT4A 3UH1A 4P5DA 1ZCZA 2VUSA 3UW1A 1EIWA 3DBRB 1H0RA 1PKXA 3ZHTA 3PNOA 2XY4A 4F45A 7ABPA 3JQ9C 3NWOA 5ECYA 2CL6X 4GXQA 3UANA 4GMGA 3W2GA 3G1TA 1OU4A 4CCYB 1R4NB 1ZK0A 5EGNA 1PNVA 3TZCA 5MFPA 2PO5A 5EEGA 3MWJA 4KU4A 4XFKA 4B6RA 5B30A 3SVTA 1XDDA 2PGLA 2PLNA 4LC9A 3WMFA 1DCFA 4B32A 2GN2A 2WP0A 3HUDA 4F5EA 2ZRFA 5THQA 4FJ2A 3T7AA 2XT0A 4RTPA 2DWPA 2HREA 2OV6A 1S1MA 3BXEA 1T34A 3KZOA 3SIPA 1ZVJA 3D6JA 3DDWA 1WF6A 4H3KB 3QHPA 4OHOA 2LR0A 1U7DA 2VA9A 4XW2A 3DFUA 3CX4A 1XYGA 2P79A 3X1KA 4L57A 1M6WA 2VG8A 1NFRA 3OEHD 4IJ6A 2PPVA 2RGAA 2RCNA 5FXMA 3CURA 3NP9A 2H1CA 2WV7A 4IDBA 3PGKA 3PT5A 3SP1A 1YIAA 1WPQA 2OHHA 3MMNA 4LK2A 5IUJC 4G97A 1MDBA 2VRNA 4PCAA 3OP1A 1BCSA 1KEWA 2Q9AA 4A73A 1CIVA 3PUJA 9MHTA 3R9WA 1WMFA 3FMVA 2JASA 3G82C 5I9MA 1NBME 1VBKA 3L4BC 2HDHA 3CRMA 2Y0BA 4DE5A 4HGQA 2BH2A 1GL3A 5JROA 1VB5A 2RH4A 1AUXA 1C1XB 2GZRA 1PQPA 1OX4A 3B7PA 5K8TA 3W6NA 1XNQB 1LD3A 1PLJA 1SC9A 1TCAA 1X7WA 3M6VA 4IWYA 3BE5A 3CB4A 3PHGA 4RPGA 1N1EA 1V5IA 2JLBA 5HBRA 1VIAA 1KTIA 4HNQA 4FGWA 2WZBA 4M1OA 4RNCA 2ACEA 2ZAYA 4GHWA 3GJ6A 4UOQA 1PZNA 2FYTA 3I0NA 2X7HA 4QA9A 3U48A 2HO4A 3TJRA 3QW4B 4M9ZA 5JCOC 2UUOA 2ZOSA 3NIDB 1FJGB 2ZRIA 3V8BA 4JITA 4L50A 1T91A 4ZVKA 3AY0A 5A7HA 2QL7A 3QOWA 4OU4A 5HF9A 2EP7A 2X1MA 3OKPA 3W5UA 1AGYA 3ZWCA 1RI3A 3U44A 4G5OA 1Y6GA 3NASA 3O4VA 2ZSHA 2BTOA 1Z35A 1XXHA 4JSYA 2HWKA 2B69A 1PNTA 3NOOA 3H84A 1HMYA 4GR9A 4NU0A 2UV8A 4OQNA 5AYVA 5F1YA 1M0WA 4FC7A 2Y4NA 3I6QA 1DE0A 4HO1X 1GM5A 2ZWPA 3AL2A 5A4DA 1RHQA 2BRUA 2G7MC 3H5OA 3O21A 3OJWA 2QLBA 2WHQA 4JJGA 2AOWA 1XL1A 1ZIYA 2YIDA 4I5EA 4MQ6A 4NDAA 4AK9A 1QIHA 3EPHA 3K1AB 4DANA 4IDFA 2IHJA 1XCBA 2PEYA 4LDQA 1DRJA 4H18A 1MGPA 2BSAA 4Y30A 5DNEA 1QO7A 4X94A 2Q1WA 1ID8A 3QX7A 2ILTA 2D0OB 3KZCA 2XCIA 4PHTA 5F23A 2GZ3A 4QUKA 4WY5A 1JDTA 2EX4A 4BO0A 2J09A 1W9HA 4KWCA 4F8JA 1HFEL 1KZYC 2QLNA 5CT6A 1CF4A 4YUZA 2HT6A 1TUIA 3RYHB 1TQ8A 3EWAA 5J5AA 2WABA 3U4CA 2XOXA 5T41A 1XTBA 1M34E 2A1TS 2FG5A 4N49A 1FP4B 2OCGA 1OWMA 3GLIA 2YW2A 2EFGA 2WRZA 5ALWA 4NE9A 1BOOA 4DG9A 1DQZA 2ACKA 3QEMA 5C5CA 1M34B 2W6PA 3V55A 2Q5EA 3HFSA 2JHPA 3C3BA 1YS7A 1NQTA 3F7MA 3PQCA 1JKFA 1KHTA 2QAIA 1QQ6A 2RHDA 3AQIA 4DMFA 2I66A 3RVOA 2FWPA 4I1SA 2QGFA 4IS3A 4WFKA 3UZUA 2D0PB 3OURA 4E32A 1BCSB 1X7DA 4NH0A 1OXVA 2N1BA 3RRNA 3FB1A 4QX6A 2NO9A 3WKBA 3ZWNA 4F9TA 5JAZA 4KREA 5JNVA 2Z5LA 2ASEA 3OOHA 2B0JA 3CLSD 3DF9A 2O8FA 2X2PA 3UB3A 3AILA 4FHDA 3RAFC 2FG7C 2IBMA 2C9DA 1B2LA 3S8YA 2GF0A 3EZXA 4B74A 2FFJA 1TA0A 2D5LA 3O0DA 4JASB 4KX5A 5BSVA 4AKIA 2VJKA 4Q0MA 1ADFA 4X91A 3H2ZA 5ALKA 4B0PA 4DN6A 3WYAA 1Z4IA 5GOTA 4AQDA 4BRSA 1HYHA 4FFDA 4PX9A 4C7VA 3WYEA 4OJKA 3VNQA 5L45A 2RIPA 3GR6A 2V59A 2ZBVA 3I1FA 4CTNA 5IKXA 3WGQA 2JD2A 2XYVA 4C7JA 4C2AA 2A84A 3COYA 4QGGA 2X1VA 2YXLA 3LS2A 3BIXA 1CHNA 5IN4A 2QL5A 1V5EA 2QE6A 4V2UA 4HAWA 2P65A 2RAPA 4IX9A 5AKKA 5TRTA 4LJ6A 5EKSA 5C8ZA 3U9TA 1RKBA 1U2DA 1XVIA 1T3GA 4WBNF 1UMCB 5JALA 4PW0A 1MXFA 3RFFA 2BGJA 4IGFA 3G8YA 4KSYA 5FADA 4CL8A 2Q8QA 3IX7A 1N78A 4FDVA 2WHPA 1SKYE 1FU8A 1PQUA 3EXIA 3A6ZA 3GGJA 2ZVPX 4RTLA 2ISSD 4XWYA 3DD5A 3HV0A 2H2WA 3SCZA 2FP4A 1ADCA 1EFLA 2C2ZA 3KQPA 3GFFA 1MVNA 1R66A 2XX3A 1JEQB 2X1LA 3KJHA 2X19A 4E11A 2GJ8A 2WJGA 4RD6A 5KNCH 3DZCA 3IB3A 4YS6A 2PUAA 4CN9A 4CEJA 2QHXA 1C7RA 4GPEA 1G9TA 1MEEA 2I91A 2HUPA 4BX9A 1G7TA 2CNBA 3R23A 3J81k 1G6OA 3SJBA 3H87A 4MJ3A 1YA4A 2XR1A 3EXHB 4H7HA 4L4YA 1U2SA 1KVRA 3EEFA 3GLHB 4MKGA 4QU8A 3DCYA 2V9CA 3ANXA 2HI0A 4DEVA 3DGEC 2HCTA 1QYIA 3PGXA 3TSCA 4E08A 4WN3A 2ZEJA 2OM6A 2B5WA 4F4CA 3L0IB 4OHZA 1QHEA 2OV3A 4PV7A 1KJZA 3OQNA 2QVCA 2HSWA 2RHGB 3DXYA 1UFQA 3AP3A 1H65A 1HDZA 3HA7A 3ZCQA 4IIEA 3BQMB 3L0CA 4JB2A 1NVBA 1E61A 2H9AA 2ZTLA 4C2TA 4ETNA 2GKGA 3LNTA 4BNWA 1NVUQ 1I9CA 4GSYA 2RI6A 2AEFA 4QLAA 1TEXA 2Q1SA 4P54A 4KIJA 3H5RA 3ZQ6A 4B4VA 1BXKA 2WWHA 1DCMA 1UMDB 2Q62A 2DH5A 1DG1G 1WEKA 1NQVA 3IEIA 3O2QB 2FJUA 4LV8B 1IM5A 3ZQUA 1JE1A 1JJ7A 1JSXA 1ESCA 1UJNA 2PZMA 3NH6A 1XQVA 3U4IA 1E3IA 2V65A 2JA1A 4JP8A 4KLZA 4E5SA 5JNRA 4IIFA 3Q3JB 1TW2A 4GR5A 1MNQA 2EQAA 4HYQA 2G82A 5IASA 3PQ6A 1QPGA 4JZKA 4NZOA 5KWSA 2ZKLA 4EG7A 3ZV6A 1QUFA 1CRWG 1HG0A 3A3KA 3RTEA 3UMGA 3UK1A 2W2NA 1ZIXA 4RXTA 1R8QA 5CAEB 2BONA 1E0AA 3ONNA 5CDFA 5IKMA 1HC7A 5FTWA 3QVOA 5AW2A 4IICA 2V4ZA 4B35A 3CISA 1H2FA 5A4AA 5KYGA 3NTQA 3OZTA 3TMAA 3AIIA 1Q0UA 4X84A 3S40A 3ZU2A 2C29D 5HUJA 1A4IA 4WMLA 4J1SA 1LLFA 3I6IA 2VAXA 3A14A 3B1YA 3JRNA 1UPTA 4ZI7F 1DJNA 3EX7C 1AJEA 1QFXA 3DJYA 5EJ6A 4UATA 1B6GA 5I8ZA 3QQPA 4YGXB 2EEZA 3CX7A 3M70A 4OI1A 5IYZB 1C3VA 5F77A 2IGTA 3HJFA 4CG1A 3HYNA 1LLUA 4CEJB 4IXMA 1GITA 1RP1A 4QYSA 2OQRA 3H9CA 5DM4A 3UWOA 1WX1A 2YY6A 5J4KA 1IMJA 1U2EA 3KZKA 3OJXA 1V35A 3CJRA 3PEEA 4FE4A 3BIWA 2O9JA 3EQ6A 4MPPA 2RGYA 1YAJA 1U90A 4LS3A 1VSTA 4FNMA 4HNAA 3E8MA 3UNXA 4BKMA 1QBKC 3FBGA 3BFPA 2FE4A 3UFBA 5DNCA 2Y1LA 3T1NA 4Z4CA 2HJRA 4DTCA 1G60A 4UCXA 3U31A 3CF6R 3P2EA 3ER6A 4AFNA 3H6KA 3H75A 2EATA 1U1DA 3TCXB 2ONKA 5E1MA 1PR4A 1XNGA 4BIIA 3WFJA 4X45A 3CLKA 2PKRA 3OX2A 1UZNA 1U5BA 3DYIA 4BLVA 1J2RA 2XUGA 5LB4A 3W77A 3FW1A 1JQ5A 2RI0A 3QVLA 4RO0A 1XWFA 5LQAA 3DDOA 3K9BA 1IAQA 1BHQ1 2YV5A 3RS8A 4HZUB 3TZLA 3JCZA 4BLRA 3W8NA 1M6VB 3MD0A 3MMPA 3V7UA 4B2IA 3E7PA 6REQB 3ZV3A 2HSEA 2NV2B 1NZFA 1QZZA 1QFZA 4G0NA 3VV3A 4FZ5A 2MMGA 1P45A 3P9QA 2G6TA 4I6JA 3CLSC 5IXYA 2Q5IA 3C74A 4UVDA 2W2TA 3BMCB 1SK9A 1LSJA 1C7JA 1GQQA 1LTHR 3L1VA 4OP2A 4YRAA 1XCOA 1WZEA 1VBNA 5CIWA 1FTNA 1DJLA 2H1LA 4YRKA 1T1IA 2JFBA 3HDJA 2LDXA 1FUUA 2UZAA 5TEVA 3BH7A 1GL7A 1E2QA 2PWZA 2LXNA 3N8KA 1IK6A 2ZULA 4W7SA 3NGMA 2BFDB 4ZO9A 1ZYUA 4JI2B 1Z33A 2FN4A 1R15A 2WT4A 3VVBA 2QX4A 5M04A 4M0MA 3MS7A 4KTTE 4MVJE 1XGKA 1A9ZA 1O9GA 4ZXPA 4LJ5A 1Z5WA 2XRFA 1ENOA 1P9LA 4Z9YA 4HEJA 1ZMBA 2X5XA 1JVBA 1VE6A 3DSRA 2XT6A 4KR9A 5LPNA 2LZ0A 4IVNA 3K6JA 5ELLA 1F0PA 3KQYA 2PAFA 4UVHA 1VCOA 1Y9EA 3KS9A 1Y5NA 2XD4A 1JQJC 3Q8WA 2Q28A 2BY4A 2A5GA 3JARB 3OCCA 1WD5A 2GF2A 2ZJYA 4NJEB 5HS6A 2M9MA 1QRUA 1PQ4A 3H2HA 2N46A 4ONEA 1IUNA 1CRZA 2Q5JA 3PJFA 2FQWA 4FLEA 3RAPR 1UAAA 1RAIA 4JBXA 2EV9A 1N5KA 3FPFA 4QT0A 4CUJA 3HLKA 4LDPA 2PRSA 3WKCA 3KQKA 4HVTA 4OHBA 2J3QA 3WICA 3I83A 1A9OA 4R16A 1U8XX 1XA0A 3DYBA 3TW0A 1XU7A 6Q21A 2K4MA 2OCIA 2ZE7A 4C30A 2Y3IA 4NVRA 3SN6A 3UXMA 3V46A 2HRDA 3DHEA 3OZ7A 4FQ8A 1HE8B 3GYBA 3M6WA 1JHOA 2PX5A 2VDPB 3VPDA 5HGJA 3X1DA 1AZWA 2ZUCA 4OLHA 4EJ0A 2Z4RA 1IM2A 3A3YA 4RBNA 4LIPD 5EKXA 4E4YA 2JDID 2BKLA 3HUFA 4MJXA 5BO5A 3FFXA 4NQZA 4LJ9A 1RKUA 1Y5MA 3EBOA 5LLSA 3ODGA 4LC0A 2YJ3A 4S2UA 3HUEA 4MVJM 4WXRA 2JKVA 4JEHA 4Y9UA 3OFSA 1NUUA 5L3RA 1FW6A 3GRVA 3C3DA 1VQ1A 2ZIWB 6REQA 1ESMA 5JCJA 4MDHA 3DKVA 2IYUA 3HXKA 5LQSA 1VLZA 3T5BA 3M89A 5JFGA 3PWSA 2XMZA 1DZIA 4LGVA 3C1OA 1KGDA 3SIXA 1E2PA 4FOTA 5CH5A 2HAEA 4I4TB 4I55F 3SOPA 4EGFA 1JPJA 2BUCA 3FIJA 1XZCA 2C5AA 5CVJA 2D1SA 2KB0A 5G02A 1MB2A 1R5OA 1TIPA 4I99A 4C3ZA 4WZBA 3B1FA 1IBLB 1YL5A 3SYTA 3TLGB 1J00A 4PCVA 3VBCA 4JKOA 1WOMA 5CEJA 3RE1A 1KVTA 1SXHA 2QS9A 4FKBA 3MWFA 3JD2A 4LQDA 2J9RA 4TS1A 2QNRA 2IIBA 3VFDA 3YASA 5IC4A 2W11A 3EDMA 2CEKA 2G1UA 3PD7A 4N7RA 1AGPA 4BN0A 1P2UA 5F21A 1OROA 2WYWA 5F9MA 1XZNA 1JPVA 3CMMA 5JXIA 3TVYA 4XVQA 5BXQC 1RXUA 1U8EA 2ZRKA 3OHSX 1JSRA 2ASVA 3MLEA 4EHHA 4ZGWA 3ZX5A 1DX9A 2BMWA 4ARZA 3VU1A 3ZJYA 4CRWB 3W9YA 3N7UA 1NDHA 1GPMA 3NCTA 3ESCA 3MYRA 2PT6A 3C5CA 3I8XA 3MYYA 5FUBA 4UMVA 2FPSA 1EK0A 2O7RA 4FS3A 1RSZA 4OLFA 4XIGS 3V80A 1TT5B 1F9AA 2DWUA 2PZBA 1DWOA 2L69A 5FFMA 3H4MA 3OKCA 3RWOA 3VOTA 3W8RA 4FILA 4E6EA 4OQZA 2E55A 4QTXA 4E5VA 1EGHA 5JDIC 1XDWA 3X3HA 1ZOOA 1SBIA 3CVJA 5M3BA 4EBBA 3MB5A 3P2YA 3GF4A 1AK1A 1D09A 1GLNA 2QTHA 3HFJA 1G64A 3QPUA 4RV4A 4TOIA 4ZMSA 5FEUA 4IMPA 1N5OX 2Z2KA 9ABPA 1UPCA 3OVMA 4BNNA 4E2WA 2WWFA 3I5YA 2SCUA 3JU3A 4XGQA 4MPJA 3RVBA 3JQRA 1T25A 3ONWA 4WXHA 2Y0EA 4XXHA 3DO5A 5FWYA 2B5OA 1AUVA 5IRCD 3R5HA 2H5EA 5KQPA 3QEAZ 1VJ0A 2EWMA 2IXBA 2W4IA 4RESA 5BRNA 1T10A 3A2NA 3PRHA 3RT9A 4DJFC 5DBIA 1MC1A 3KHTA 3HY4A 4R8VA 3PTAA 3ISTA 1XWWA 3ZCVA 3M7IA 4Q37A 3RVDA 5L95A 3FOCA 1XLTC 2ZXEA 3N5CA 1N5MA 3UC9A 2VS1A 4EPWA 4CFZA 4ZVLA 4FMBB 1UXHA 5DK6A 2A3NA 1JIQA 1JYFA 2XVXA 4KO2S 5EUQB 1CQIA 2Q6OA 4G85A 4LXYA 4R1QA 1GQ2A 4JLAA 5I7RA 2I9KA 2YMPA 3AJDA 4B5LA 3HNRA 4UHBA 2FW8A 2Q07A 4BZZA 3QKRB 1V1RB 4DAEA 5DP2A 1YSCA 3H1EA 4FFRA 4PLPA 4EZBA 5JZ9A 1SD1A 2WPNA 5EJGA 1XV5A 3F9RA 3AY3A 4IKOA 4K7JA 5FL3A 1M2OA 1KI9A 2IWHA 5LP6F 1YBVA 3ND5A 1GGNA 4WCVA 5B3JC 4KDCA 1T9AA 2V7BA 3H2BA 3EFOA 2PA0A 4LHEA 4MJ7A 4RIIA 5JTTA 4YHHB 4X6UA 2XMRA 2G9RA 1YK0A 3P1JA 3VGJA 1N8TA 4UXIA 3DEIA 3WB2A 1OWLA 2B4KA 1YKSA 1LV8A 4N0PA 4MAFA 1XI2A 5AICA 4M1WA 2PA3A 5JCPA 4MB0A 4S2EA 3OWOA 1L7OA 3X1ZA 1I32A 5COBA 1YDHA 1O5IA 3OTIA 1MORA 1SQFA 1U1FA 4F7WA 1G17A 2J5BA 5A5FA 4B4KA 4DBLE 1K97A 2NZUG 4X85A 1O5TA 3CH7A 4ARZB 1CVRA 2WHRA 2G70A 2NX2A 3CC8A 2R8OA 4V0MA 5ALNA 3KUCA 4ZC1A 1H2EA 3VR6A 4K2HA 2WMYA 4OJNA 2BM8A 1D2HA 3ZZUA 1NMXA 5CDTA 3DTTA 5KWVA 4UZSA 1AMOA 2Q29A 3WMWA 5KTYA 1K7FB 1MQAA 3FUUA 2XXBA 4M9RA 3TOVA 3AKDA 5H7XA 3QJGA 1Z4MA 3DO8A 5IT5A 5G4KA 5BNWA 3ZV7A 3IEUA 2XUZA 2XCUA 3ZN2A 4OSOA 2YFQA 2Z2JA 4PNZA 2VEDA 3A06A 4NMWA 1ODKA 2ZZNA 4R54A 1YS4A 4RVDA 4LI0A 4RDXA 2WWTA 1PZXA 5DXAA 4C4SA 1A2BA 3Q15C 1D5CA 4IYJA 1UOPA 4ZODA 1NJ1A 4DIDA 1YJAA 1DAEA 3OZGA 4JFAA 5BOVA 3ZCXA 1FYWA 5B7NA 4TZ6A 4RULA 4O63O 3FWHA 3GFRA 3JVUA 1ZH0A 3ZHQA 5IM4A 1QPZA 3HBAA 4HB2A 4UASA 1Y1SA 2KJQA 2NXWA 3RV3A 1XMPA 4TT3D 1SIUA 3TXXA 2PZEA 5KI6A 4ES6A 4D02A 1QU3A 3T4PA 1SVWA 4JLMA 2GZAA 2V4UA 1R3DA 2HEIA 5BSHA 3CVUA 4D4JA 2Y1KA 1Z16A 4WKNA 1EVLA 3O9ZA 4B4UA 2O05A 3K72B 4NWIA 1VMAA 1JHPA 4KKVA 2K2WA 3B6MA 4MQEA 4U63A 4WKOA 5IVPA 1UT6A 3S3TA 3HJGA 1ULTA 2JIZA 4X20A 2IWRA 3N2EA 4CDRA 2IXAA 3IKLA 5CDHA 1JFLA 3EFBA 4JU8A 3AJRA 4GOXA 4WJKB 2CHEA 4KYTA 1BJRE 1AKTA 1Q44A 4G1UC 2FHSA 4LHYA 1CYDA 1KYVA 2WICA 2QR2A 4C78A 4ZJPA 3TW8A 4QDUA 3MRTA 4CV0A 1R3UA 4OX9B 2O52A 1SJ9A 3PC7A 4DPMA 2VYNA 3I30X 3H4IA 2O19A 1F3OA 1KWKA 1XTVA 2CLCX 2RGNA 2ZSAA 4U2FA 1T8YA 1U3FA 2EJCA 2H4HA 1WLSA 3OH8A 1Z5ZA 3ZLTA 4B43A 1GU7A 4X1OA 4ZVUA 2IHVA 3H86A 4GEGA 4Q3BA 3R5JA 4AUNA 4RAOA 4UNNA 4RTSA 3LC1O 3KBOA 3ESQA 4UMEA 1R6XA 1PWZA 4CEHA 4MYHA 3J80A 1CFJA 4G26A 1E92A 1QDLB 3NALA 1UBTS 4NMLA 1VJ5A 2IIPA 3K0AA 4DA9A 1AXGA 3ROFA 4DV7B 1HDRA 2RJOA 4G8DA 1JF8A 1X14A 4XTRA 2YOHA 5ALVA 3I5AA 3FCOA 3RR2A 3FSGA 4YAJA 1RIFA 2BFFB 1YRQA 4MQ4A 4N5MA 1BKDR 3ZK9A 2KLHA 3IBGA 5DH9A 1JBEA 1LQTA 3G2NA 1DP4A 4QVKA 5A4KA 4D92A 4R2MA 3WK9A 1F9EA 4DCJA 3ERCA 3B6EA 1EB8A 3ICCA 3V9PA 4BZWA 1JH8A 4E03A 2IH2A 1U2GC 5A9SA 2G4CA 2Z3ZA 4V1CI 4GL2A 1O2DA 3RC2A 3MCUA 3OKAA 4MUKA 1TE2A 3ZHCA 4DSNA 1FL9A 4FTWA 4PYOA 2QZSA 4RK7A 4UU0A 5IJZA 3GDOA 3OX4A 4Q4LA 1YE8A 4IDNA 4H0FA 1JFFA 3O4IA 4MP8A 4DV0B 3V4RA 3A32A 4XX0B 3A37A 2V7PA 3VH4A 3VTKA 4LK3A 5LQUA 1KO7A 3NM5A 3K0CA 3CS3A 1P31A 1P7WA 4LUCA 5HCUA 3PXDA 2ODNA 3OWHA 4C1NA 1QV7A 3PDJA 1ABFA 4KDRA 2NU9B 3VBEA 4PQEA 5KDDA 1H2XA 4RPHA 5CT5A 1ORVA 3L18A 1YS9A 3DWFA 3VJLA 3TKYA 4YP0A 3T5GA 3UBTA 2ZLBA 3AKZA 1YMVA 4PS0A 2NAFA 2GBLC 1MIOB 3G2HA 4F93B 3AF6A 4G1MB 4WFQA 2QXTA 4WLEA 3RF7A 1W49A 5INTA 2ZYRA 1E6EA 4O0MA 5FFNA 3ZD8A 2QMEA 2EKDA 1HMPA 1YE3A 4CMEA 2DKNA 5IT4A 3G8CA 3L7LA 1MO4A 2QN2A 4GLOA 4Z4FA 5IANA 5C8DA 4A4DA 4Z99A 1FTWA 4YXWA 3OEWA 5I4CA 4RACA 1E1QD 1U0GA 1N5IA 3QU4A 3GJ4A 3TD9A 4DQXA 1K3FA 2OG1A 2I1QA 2WFLB 4Q1BA 1UADA 4Q4HB 3KRTA 1HQDA 2Q3EA 4M1QA 3OEYA 3E9YA 3IDOA 1JJIA 1BE1A 3GVPA 3SK0A 2FHPA 2Z5GA 4J9UE 5J9FA 3SQWA 2V7VA 1T15A 4XSVA 4DGQA 4UNRA 3ZHVA 2EU8A 4AMYA 5I01A 1I4OA 3RBVA 1XLWA 3DB2A 5K0FA 4I9UA 2F17A 1Q7TA 4HWGA 5KHLB 1D6SA 2QD3A 1QKIA 3B8HA 1AKWA 4GMFA 3RARA 3IGFA 1GAWA 4J7UA 1BVUA 3GRZA 3B36A 5JO0A 2XWJI 5ULLA 3FMGA 4EABA 1JMKC 1ZGBA 4EFKA 4TX1A 2JIZD 5AOAA 3IJRA 1NMQA 2VNAA 3MBOA 4MV1A 3VHQA 4BJ3A 5BSWA 3M3DA 2IYYA 1NR1A 4ENWA 2PSFA 4KYIB 1DJQA 2A9KA 2WKRA 4G0MA 4J2HA 3RSLA 1F2VA 1P2VA 1P4RA 2AT1A 2J0EA 3V4OA 1GSOA 5JC8A 3BRSA 1O4VA 2JFYA 3AM1A 4QFDA 4ZVOA 3EISA 5JECA 1SULA 3UOGA 1VYVA 5BN5A 1Z36A 2ZI7A 2G06A 4D0NA 3CKMA 1ODFA 1JLHA 2K6GA 5BUSA 2XODA 1G1MA 1SXIA 4I3FA 2OKGA 3KHKA 3EA4A 3W1VA 3X2FA 4C5BA 3EF0A 4D8YA 4QGSA 4HB3A 1ZM3A 1RFGE 4Z3DA 3GLUA 1K6JA 1QR2A 1JXMA 1YFZA 1Z8HA 3GRUA 3H5IA 4HQ6A 1GEGA 5E1DA 3GEMA 3O8QB 1MMFB 1ZRNA 2ZUUA 2Z9DA 1NNUA 1ULUA 4FMCB 4I7EA 3O8RA 1XZQA 3A6FA 1RRVA 2FPOA 3TKAA 3HO1A 1FUIA 4X95A 4E2XA 5JQGA 2E18A 4TRMA 4AWXA 3L9WA 4YHBA 3R5TA 2LUOA 5ICFA 3WQHA 4MCIA 2V54A 2GXAA 4BBJA 3ZE2B 2GD6A 1OD6A 1UP7A 1KKLA 2WKQA 3NBYC 4UPVA 4Z4IA 1KEVA 3TLBA 3VU9A 1AQJA 5J4VA 5DOVA 1BQ4A 1Y81A 2B36A 3MC1A 4M55A 4IHJB 3ZDQA 2GLUA 4CLXA 2EYUA 2PYZA 4DM4A 1MIOA 3EK2A 2IPMA 4KWHA 2BELA 1KDVA 3T1OA 2IJGX 4B40A 4YMVA 2H59A 3KFVA 3TE7A 5AW6A 1NBOA 5E0KB 5IAAA 2BEWB 1IUOA 3EEBA 4RCVA 5CA0B 4LZJA 3V33A 1IWPB 3FTDA 3FGNA 1R4MB 4O4LB 4DA8A 4ZMRA 2FPPB 3OF2A 3NBZC 1O5OA 4L85A 4NPAA 1XTJA 3Q7QA 1JG4A 5DBOA 4YUYA 2F8SA 4WK0B 4BB0A 1STOA 5LUAA 3K70B 2EL7A 2XXJA 5BPHA 5M7EA 2WK1A 2X4GA 3PE4A 1Y0BA 2VNKA 1CRQA 4D8VA 2R8PA 3AF3A 3IMFA 3O3MB 4C04A 2QUAA 4CTMA 5C9ZA 1IU9A 5CH8A 1IUPA 4EUHA 3CVXA 1BGXT 3UTCA 5I9BA 1SG0A 1MC8A 2VHUA 1FDTA 2OHGA 2FVXA 3HYRA 3PT9A 5DRTA 3VR2D 4GKKB 3HB1A 4I5FA 4YT5A 1AQLA 2OFFA 1NYTA 4AZ0B 1ECFA 1U7OA 2GLXA 2FRXA 2YHAA 4UDYX 4YPFA 4ZAWA 4RMGA 5IAEA 2OYCA 4DYHA 3TBKA 4O4IB 5EXPA 2FUEA 1JDBB 1I0ZA 4AY3A 1E7WA 3C3AA 2X0EA 4PS1A 1K4MA 5C4GB 2ANCA 1X87A 2DU8A 2A5YB 2ERCA 2NZXA 2R85A 3TRHA 1OOEA 2VWPA 3PXEA 5KSWB 2AMYA 3VHRA 4WESA 2ZZKA 4HDNB 2I4TA 3TG8A 4Y1EA 3QLVA 4F5DA 3VKGA 5EIEA 2J5KA 4OEHA 3DE3X 3KYCB 3I04M 4WNAB 3TAUA 1E7MA 2IHNA 1UKYA 4HLCA 1VSQA 4ER6A 1JB1A 5A04A 3FVVA 4ICIA 1MJ5A 2HF7A 3BHMA 2NUPA 3HG7A 3JQGA 4V0KA 1X8XA 3LIIA 1G20B 3UJ9A 3D6HA 5I3CA 2GN0A 1YQQA 5TXGA 4MDFA 1E1CB 1JAZA 1WTAA 4O3FA 1L8AA 3TOCA 3VPAA 4E5KA 4PO3X 1L7QA 1IVNA 1SXGA 2LIPA 5AVSA 4S05A 3E0XA 1NQUA 4O2BB 3ZHZA 4YRDA 3QVMA 1V5WA 5JFTA 3SJUA 1S2NA 4EFNA 1DUSA 1TVCA 3L0OA 1PQWA 3TFOA 4WVLA 1GKUB 1YZKA 3A1EA 4DRYA 4E3ZA 5KU1A 1FNCA 4R8RA 4ZRNA 4BC1A 4DR4B 1FYFA 3DTVD 1EM6A 2ZJ7A 3HU1A 1Y4UA 3QVKA 2G72A 4UTOA 1DFHA 2QP9X 4KYVA 2ZZMA 1CV2A 1FP6A 2D2FA 3DMGA 2JVIA 1KFJB 2O3TA 4HJXA 4LQLA 4XAQA 1ODIA 1VE7A 4YAKA 2C58A 2IX3A 2QBYB 2ZIAA 3VU9B 3D2CA 3QVWA 4AUKA 3TQTA 2PSJA 4CNQA 4TPKA 4ZARA 1RWWA 2IZ6A 1XZPA 4HI0E 2C82A 1JJFA 3PHHA 3COPA 2C3PA 2H57A 2YXEA 4E15A 4AJOA 5ER9A 2AOTA 4C4OA 3TRKA 5CJJA 5CW1A 3IPLA 4RZ3A 3ZE0B 4B84A 5ALOA 2CYAA 1VCHA 2EKBA 4O4LA 2WU8A 2EP5A 3RSQA 4MGIR 2JJ1D 1OFVA 3PNPA 4MKHA 4PLTA 5LP6C 2XWQA 1XOIA 1SC6A 3MRXA 4H1HA 4CKCB 1BA2A 1NWHA 2GDJA 5LU9A 3WGLA 1T36A 2AQHA 3U5TA 2XRZA 1XQYA 4OL9A 5MFZA 1JT9A 3LCUA 2CF6A 2FWRA 3IXQA 2X76A 3JYHA 4RTQA 2JHGA 3PPYA 2WG0A 3M1LA 2G04A 4TV9A 5EJFA 3D4IA 1E9SA 1WKVA 1Z7EA 3AI3A 4MUNA 4BJ5A 1WBBA 4WCDA 2P91A 1UCFA 3BGOS 4P32A 4RKEA 5EMLA 5IP5A 2CCJA 2D2EA 2FTKE 3FMPB 3SR4A 3TS1A 3UB2A 2X6QA 3IQEA 5DHTA 3MQFA 1B16A 3GNQA 3HWSA 4C07A 3K2EA 2VCEA 3L5OA 4RS3A 1ZC4A 1FRVA 5EXEA 2QX8A 4WXPA 4BVAA 2CUTA 2HEGA 3IBYA 4ZZIA 1G21E 5ERYA 1W36D 4IHJF 5FF9A 2R7MA 1FNDA 1QXSA 3NETA 4KIWA 4WESB 1C7IA 5A3SA 2B7BA 4M0KA 4R4JA 4WJLA 3UWPA 1RJFA 2WG2A 3QKUA 3CT4A 1XLUA 4HN2A 3SS7X 3T5DA 4AKHA 4R71A 2WD9A 3RVLA 3K0EA 3PHBE 4DBZA 4KMSA 8MHTA 3HGTA 1EA5A 1WBJB 4NICA 3DE6X 3EPRA 2GBIA 4G0PA 3QPWA 2XVYA 4O3MA 3A31A 2O2HA 1OU0A 2DPGA 3DBVO 3T9DA 1P1CA 2B9VA 3SSAA 3LF2A 5IEJA 1AV6A 4DLVA 2QG6A 3TDKA 4QSHA 3EAQA 3FN4A 3HXLA 2SECE 3JTEA 2PD6A 4XGNA 1YIDA 3A05A 4J0DA 2G83A 1J0AA 1RPJA 3RUCA 5HOQA 4HUJA 3LGSA 1XDBA 3WYNA 1Y3IA 1HLFA 3JWHA 1MO6A 3H13A 3VJKA 3F6BX 2PO7A 1H3FA 4KLNA 3VU3A 4Z0NA 1ESZA 1GT6A 1E3JA 1X42A 2QTWB 2Z6VA 3CJTA 1SUAA 4JQYA 1UDAA 1KMNA 3GFGA 1J2JA 3ZBTA 1CQIB 4TTAA 1O08A 2C04A 2CHFA 3VH1A 3CEAA 4PAWA 3RB8A 1NVWQ 4G1BA 3ZLUA 4D8WA 3OFKA 1QCDA 4JLOA 4EMSA 1QTQA 3F8WA 1UBGA 4GC5A 1MO5A 3B6KA 4HGZA 5AKHA 1HOTA 2M6SA 3Q11A 3K9NA 1AHPA 1YAHA 1T9CA 2ST1A 2H1FA 4JB3A 5GINE 1R0BA 2NYVA 3P9YA 3VO1A 1F2UB 1KO4A 2ZSEA 4HNVA 3SHTA 5LJLA 3OZBA 1BDIA 4CM9A 5I48A 3DPIA 4WOPA 2R48A 5TE9A 2YQ5A 5LYJA 2VHCA 3NKVA 1TM3E 1XU4A 2N47A 1NNLA 2F48A 4AN4A 1D0VA 4RMJA 2C59A 2ZWAA 1QRAA 3ADPA 2J31A 3RTBA 1X7XA 3AVPA 2YWCA 1H1LA 1M83A 3GRFA 5GV8A 5HRCA 3OOEA 1SOVA 2HUNA 3RJ5A 1B4DA 1BD3A 1KK0A 4BMPB 1PFYA 2QVLA 1XZAA 2WHEA 1PT7A 3A7EA 5DBFA 5J4YA 1F38A 1AQ6A 1RJDA 4GOOD 2IUUA 1DIBA 4JUFA 2O4UX 3LX5A 1KARA 2XIQA 3L6DA 4HMPA 1QGUB 1FOEB 4OKNA 1DG3A 2VWQA 5L4LA 3TRIA 1J06A 4DMRA 2PUGA 4UNPA 4A7PA 2VDRB 3L02A 1BWRA 3B1XA 3FNFA 4YJHB 2FI1A 4YASA 1AO0A 2IFTA 3L1UA 3B5EA 4RH3A 3TNFA 5J47A 1AKYA 2HXSA 4BNLA 2FFRA 2YC2C 2R62A 3L4EA 5AXBA 5TQ0B 2O54A 5KIAA 1EUQA 3T7DA 4HUQB 2R11A 3ZEIA 1YHYA 2JAWA 2VDOB 3GZNB 2CB0A 3DMPA 3I9LA 2XV1A 3NOXA 2PKQP 2BBSA 3QE0A 2P90A 4FOLA 3GLGA 3WB1A 3P2OA 2GZ1A 3QKSA 2H1IA 1I9GA 1XZFA 2G8NA 1Z38A 1ZWKA 4JEMA 4KMMA 3RH0A 1KTVA 2IPXA 3U9LA 1NYRA 1JFVA 2H9YA 5AUQA 5A3VA 4DYVA 2P6RA 1EVYA 3P9SA 3V3KA 4U1RA 5TPWB 3MHTA 1OZGA 5IUNC 4RE5A 3MPOA 1L6RA 2DR2A 4HDKA 3MTAA 4DG5A 1H4QA 3DBOB 5EHGA 1FMJA 1XF1A 2E4UA 3CR7A 1ZS9A 4LA4A 5CJPA 5F2NA 4XJTA 1UINA 4U02A 5IK2D 1UDCA 2ZBUA 4MWOA 4Y9DA 2JLXA 1XPOA 3BS4A 3W04A 4I6GA 4DPKA 3LWBA 5F2OA 5KYUB 2UDPA 2GM3A 2CNWD 4BQFA 5CH3A 4BFLA 2CXSA 5AOVA 1NZJA 2Y0CA 1JIKA 4NYJR 4QUBA 4ZU6X 4BX3A 2C7PA 3HWX1 4QPNA 2OBYA 3BXHA 4PLCA 1QP0A 1YZLA 4KGXA 4US0R 4HWKA 5FCDA 1QQ7A 4RTJA 3WLFA 4M9SA 2RH9B 4FBMA 5K8VA 1DHTA 2XUQA 1J8MF 2BUAA 4B8WA 1M1YB 3PQ8A 5LYJB 3G9UA 3SF8B 5TMEA 1NPTO 2FN3A 4JQCA 4DJ5X 4FE3A 4L9WA 2H4ZA 4L72A 1OLUB 3ETJA 4BB5A 4XSHA 3H1GA 4KQEA 1NBMD 4BO5A 2WNHA 1LDEA 3Q0IA 4N01A 4NBSA 1TJPB 2C2XA 3PEYA 2Q6VA 5H16A 4XJXA 2PUEA 3NHYA 2LD4A 4KN8A 2ZYGA 2FPGB 4XCVA 3RSZA 1MV8A 3A3PA 4EG1A 2Z8YA 5ESWA 2QJOA 3R0IA 1Y5RA 4NQRA 3B5IA 4V1CB 1UK6A 1XKLA 3A2MA 3ZGYA 1SURA 2E4YA 4MCJA 1N6IA 2RHHA 1VG9B 4GGPA 3TRFA 3BORA 2BGKA 4RLFA 3D7KA 3DWGA 1QCZA 4YYEA 3T7KA 4GX0A 4EAQA 3L0DA 2BMVA 3H8JA 5BSKA 1CY4A 3NR2A 4AW9A 3ZWQA 1DG9A 3AEKB 4ZV7A 4ZA2A 1L5MA 2W37A 2CV1A 4ZD6A 5F4BA 5EHXA 1YGPA 2JEYA 1QV9A 3RW9A 3HKBB 2JAQA 2JZCA 4KVZA 5DHSA 5E7JA 1B73A 3A36A 1KPGA 4WA8A 5G0WA 3X0DA 2Z58A 2FZ4A 5K0TA 4J0EA 1P2TA 4TUYA 3UKJA 3GEGA 2DY0A 1S4QA 3G1WA 1E2LA 4GNKA 1FNSA 4IXWA 4KUHA 3QF4B 1ABBA 4CMHA 1JEAA 4H59A 5HKAA 1G20E 4DSUA 4BJ1A 5K0SA 3FNBA 1TNDA 2CE7A 4NSNA 4GG1A 4Q39A 2FPRA 4MX8A 4BASA 1XZLA 1TTPB 5HTKA 5ARCA 3ILXA 5JDCA 5K6TA 4HH3C 1Q17A 5HKOA 1KZ4A 3UTDA 4A3SA 1YRWA 4L08A 1R9MA 4BB6A 2R7AA 4JQSA 2IYVA 1H23A 1KAHA 2D5AA 2P8JA 2V9PA 4K9QA 1TKCA 4N3AA 4PRYA 2W58A 3T41A 1C81A 4ZDWA 4ZOLA 3ZI4A 1SVSA 5AJTA 2P27A 2PV0A 3MUEA 3HKDB 4XUDA 5GQSA 3BTVA 3LQKA 4C3VA 2ZB3A 1JTEA 2FUKA 1A71A 2PYIA 3GMIA 3LUGA 3CQ9A 4RU1A 2BKXA 4QBFA 4AY5A 4F9FA 2E1PA 3PD0A 1XNHA 5EWLA 3J7AC 4G2NA 3OTQA 4HJRA 4AN0A 4KR2A 2WB4A 1BTOA 1T2VA 3FWKA 4RIHA 2QTVB 1M1YA 2CKDA 4OHXA 4JCOA 4TL7A 5CB4A 4GLBA 3GGOA 3NO4A 2Q7XA 4YJ2B 5B53A 5HIMA 3HNPA 3IMGA 2PG3A 2NQ2C 1I0IA 4B0OA 2L82A 3IE0A 4EIWA 2AFHE 3PZBA 1IY8A 3R7WA 5E4YA 3NBXX 3VI3B 3E18A 1W88A 3W5AA 5AKGA 1H9BA 3NHKA 3BXZA 3AERB 4LYEA 1NVDA 4OQFA 1M1XB 1ZW1A 4INPA 2FMTA 3UGKA 4YAIA 1KJQA 4IVRA 2H16A 4PYQA 2WJ3A 1ZZEA 1KFEB 4IFEA 1FVFA 1NN5A 2XMSA 3NAMA 5TB5A 3TH5A 4BP1A 1K86A 4V1CA 1UR5A 1GGMA 1XCGB 4QECA 1FU7A 3MCAA 1XTKA 2D5CA 4M7OA 4BBZA 1LXCA 3RC7A 3SNHA 1H2YA 1P1IA 1V1MA 1ZJZA 3FWYA 3KE9A 3G59A 5K4GA 3DEKA 2E4VA 1NVVR 5JR3A 4IMIB 5EL0A 3W78A 3BKXA 4OA5A 3WGGA 1PT9A 4DLRA 2XADA 2IHBA 3CKKA 3SC6A 1AVTA 3RVKA 2V6GA 3IVCA 4QOJA 4JLJA 2RC6A 2ID9A 2VJMB 4N54A 3HCPA 3CU5A 5H5JA 3WISA 2Y0PA 3GRRA 4X64B 1CHDA 5CXQA 5FX2A 1QMGA 2YWFA 3VPCA 3V8MA 1BMFA 2IYPA 2VZ8A 4ZREA 3TSAA 3VO8A 4F8EA 2Y6UA 2IOHA 1V7PC 2Q6TA 2CBXA 3O83A 4PCUA 2ZI4A 4TWJA 1Y4AE 2HMUA 1IVYA 4F2WA 5HRUA 4BS9A 5KYNA 1JLLA 3LC2O 1QIEA 2RJNA 1T8WA 2WMOB 5E9AA 1Z0SA 4O29A 3OLWA 2CVFA 4YLGA 2A5LA 1PFWA 1C8BA 3NTLA 4P7KA 1K4KA 2VDKB 5FR2A 3ZDFA 3MB8A 3UAXA 1GG8A 1PBNA 2GZSA 1B6SA 4WKBA 3SHFA 3M6UA 5JADA 5LZ7A 1CNMA 3Q85A 3FR8A 3S55A 4HZGA 3GZ4A 4IJQA 5FNZA 1OTYA 1SN7A 2PMEA 3VHXB 2PE5A 1M6NA 1K68A 4MGKR 2PR7A 2GTHA 1U6KA 3I6ZA 5A0TA 3L7IA 1XAIA 2C7GA 2JJQA 2L18A 3ROTA 4YDSA 1L7AA 4CQLA 2Z1MA 4HN4B 3WJ7A 4RIGA 1RZRD 2BHNA 1G8MA 5GM1A 4CLDA 4AQ7A 5H3HA 1H2HA 1HGXA 1JMYA 1KMMA 1LUAA 4OX9Y 1RIIA 1SUSA 3BZBA 5K8CA 4WLVA 2QMYA 2WNIA 1J4AA 4QELA 2N0SA 3QU9A 2GA9A 3R7LA 3KTAA 4UDNA 4TTSA 4W99A 4GD3Q 4G86A 1IN5A 5DCLA 3V2GA 5T5QA 5K3FA 2NP6A 2QM7A 4IZHA 4AVYA 4ZI7B 3PHLA 3ZWPA 4MP6A 4RF5A 2AKEA 4TV8F 1E3WB 3S2UA 2AN5A 4IGAA 5AJUA 2KBFA 2Z08A 4KE7A 4BGIA 1Z5NA 5DIFA 4H17A 1S3GA 2BV3A 1RQGA 3GVIA 2IP2A 2C7OA 3AU9A 1F5NA 3A11A 4FN5A 4CF6A 1KFBB 1GAEO 4W63A 1DJMA 1P77A 4FC6A 1YB4A 1N6RA 4UD2A 1YZUA 1VFPA 1YVUA 2ZXFA 4HAXA 2PL1A 4Q1AA 4MHOA 3K0CC 3ZIAA 2IRWA 2XGSA 5JCJD 1ZD5A 3K9WA 3PP8A 1RQXA 2BEVA 1CC1S 1V8PA 3DFZA 1L4NA 2X3FA 4C21A 3U3JA 2PBFA 3GNLA 3QJYA 5TS2A 3G0BA 4Q01A 1BMDA 1NXVA 5HMLA 4ZGGA 1XZMA 1G5FA 1TO1E 2GUGA 2O2CA 4ALNA 4E7PA 4CQMD 4EVQA 3MPUA 3KO8A 4OHKA 2H9IA 4JUBA 1SRRA 3OJFA 2AHOA 3P20A 5DT9A 5E2IA 5EG5A 4BWYA 1WMDA 3AEUB 4BE9A 1GKKA 1PJZA 2GPSA 3LFTA 4QFMA 2QTRA 2Q4TA 3NT4A 4NABA 5EHQA 3PXGA 5E6SB 2C92A 3TLJA 3TN7A 1OX5A 1T0UA 3ILVA 5HQ3A 3OLZA 2DSTA 1RXCA 3GFTA 3NANA 4RA9B 1OHHD 3BQ9A 3Q0EA 1W5BA 1SXPA 4B3TB 2VYCA 1ODLA 4RWZA 3F6YA 1RMTA 4KGZA 4OOFA 2JZOA 1FTSA 5CB4B 4R83A 2Y66A 2C7VA 1HDEA 4F60A 2OXCA 3CWQA 4R7GA 3HB5X 1YJBA 3IUBA 3PXCX 2MR5A 5GOZA 3TAHA 2JDIA 3Q87B 4AX8A 1KEUA 1ZAYA 4GPIB 4MYSA 3BD7A 3QXSA 2B1RA 3NONA 4IH4A 5E7IA 2AOUB 1O9BA 5FPQA 4WBNB 4M9UA 2REQB 3FAZA 4AS3A 2R0QC 2R6R1 2X9NA 1X1RA 4LXQA 4UOEA 1KRXA 3HB0A 3IB6A 1JG6A 1FPMA 3H1FA 1QP4A 3SICE 4FNOA 1KOFA 3HH8A 3QLUA 2Q8NA 4XB6B 5LQCA 5AVVA 1YZNA 4H35A 4RF3A 1V6CA 2EZ8A 2NYUA 4CLEA 4Z3KA 4FD2A 4UHJA 3VDXA 3G79A 3OZSA 2PIDA 3RABA 4QEDA 2Q9UA 2RHMA 2W00A 2XB6A 1GZUA 1WHSA 1J56A 3MUFA 4I4LA 5EE5B 3VNSA 4ZYVA 4NCIA 2QPTA 1O95A 2W6MA 1VI2A 5EE9A 3L7CA 1FIUA 1C3OB 1US8B 3HLTA 4KXVA 4J49A 3KALA 2B2CA 1KI6A 3ZXSA 2ES4A 3KJFA 3ZHYA 4RHFA 3ZCTA 1BD4A 2OCKA 2ZJ6A 3ZZ1A 2PZJA 2RONA 3WAKA 3LC0A 1NOJA 1FVXA 3WK5A 4ESEA 4TMYA 5BV1A 2UYCA 3Q8MA 2B21A 4IIJA 3CXUA 4IOLA 5KNBA 2C8LA 4IYRA 3WL6A 5JJLA 4IDEA 4Q9JA 1GGKA 3RPEA 2O6LA 4ZT7A 1P60A 4AYWA 4NNPA 1I3LA 4HVLA 1GNTA 1QIGA 2I3BA 1PVOA 3GUUA 3QUCA 4I8DA 3UEOA 4RDHA 4IEIA 2AWNA 1C4KA 1VBMA 3G2QA 1B00A 1RQNA 1JQ3A 4MR8A 2QMZA 5H1YA 1G6KA 1K1EA 3C5VA 1D0IA 2ZYAA 3K9LA 2W2KB 4HQRA 1I3CA 3A28A 5EPOA 4DZTA 4GZLA 4RQBA 3U3RA 3IP7A 3IPYA 1NVTA 2HC9A 1KHHA 1DIRA 1QX3A 2HNAA 2PX2A 2ZSBA 3BUSA 3ELBA 4NHEA 4PFQA 3QVGB 4MCHA 3TJZA 4EQ6A 3FMIA 1WA5A 3VYVA 2FQXA 1JLSA 3D3EA 4XUCA 5KYXB 4WX2B 2VXOA 1U0HC 1UODA 2YDXA 1N6KA 4Q4JB 3CMCO 2NP7A 3V1MA 4MS3A 5E6UA 1YJ8A 4IW3B 1K7SN 3PC8C 2XE8A 3IIKA 1JDSA 1L7XA 5H68A 1EGMB 1X15A 2ZYWX 4I50F 2YIJA 4U7FA 1G8YA 2BPOA 3I04A 3S27A 5KTNA 1AK2A 2AC7A 2PXCA 3W5SA 5CFLA 1Z56C 2PKWA 2A2ZA 5IF3A 1FNBA 2WAMA 4OA8A 1QRRA 3E23A 5CPFA 4EB3A 1CZHA 2FCRA 1T6BY 3LM8A 3S5JA 4MRAA 1RWVA 2BGIA 3OLCX 3HI6A 5EOVA 2QTTA 1XCJA 5H82A 1WQ3A 2G25A 2QN1A 3S2GA 1DAOA 1EX9A 3F4KA 4NLLA 5ALTA 3VZRA 4B3HA 1MQSA 1M73E 1E9RA 4KV7A 4Z7OB 1E9BA 3VTAA 3A6KA 3IUJA 1GJRA 1UEJA 1DPFA 3LO5A 4YRZA 1WW8A 3GLIE 1HYGA 2YR0A 3CSSA 1DTSA 1EB9A 4COKA 3NTVA 3QG5A 2O8EB 2DFTA 4P8RA 3S5UA 2CCGA 3TL2A 4RPCA 5FBRB 3GRCA 1P0CA 3KWLA 3O2SB 1E59A 3PQ3A 2XNJA 3OKFA 4DSTA 3NWPA 2XCLA 1TLFA 4KR6A 1G8FA 1EFVB 3ME5A 1JILA 3ZI7A 3KL4A 3W6ZA 3FNHA 3KWMA 4IDCA 1DB3A 2ZJ4A 5AVWA 1E6WA 1E3MA 2GAJA 4QYXA 3PCRB 4A23A 1VG1A 1T9BA 3CF0A 4CMIA 3N0XA 3ABOB 1J8VA 1JG2A 3NTUA 3O4HA 4UTXA 2W7TA 1HL3A 3S70A 5KVAA 1EZZA 5IUKC 3CEJA 3V9AA 5BPFA 1GTZA 5K9ZA 3C7AA 2QGNA 2C5SA 3HZRA 5F1KA 2XDQA 2G6BA 2OOKA 4RVGA 4WN9B 5E2BA 5A9TA 4PLFA 2X4DA 9GPBA 1P62B 1PDOA 2X42A 3G02A 1L7MA 1YBHA 2QVYX 3SXJA 5FPPA 2CDRA 3ZVNA 3UK7A 1WPXA 2XGJA 2OM2A 1CJTC 1LVGA 3NDIA 4U3JA 5ETJA 1D04A 1XLTA 2E5WA 1KFKB 1E3QA 2C2WA 2P6PA 3AKCA 3ED1A 3ESBA 3DMHA 3IRVA 4QJ4A 1ZEJA 1T4BA 3AINA 2JIBA 1ENZA 4RK4A 1QCCA 2P9CA 3I12A 4I6EA 4DCTA 3GT0A 2V03A 3HV2A 2HK8A 3LUDA 3QVVA 3VR4A 2UYHA 3PNBA 4NZYA 1RVDA 1FC0A 1MT3A 4IRMA 2ID7A 1E9EA 4MKZA 4RSRA 2ZI3A 3DE4X 3NM4A 4JT9A 2B8NA 1Y6RA 3HR8A 1RXWA 3H4VA 1SC1A 4CBVA 5JT1A 3EAGA 2LCFA 3PU6A 5TT0A 4R9VA 5CNIA 3H6GA 1E5TA 1S5PA 2ZVJA 4BU1A 3WL7A 4PO1A 4GBGA 2GD0A 4M8SA 1A04A 1AZTA 4IBOA 4X7BA 2F67A 4P98A 2O2GA 2PMKA 1WHTB 3LW7A 1K5DA 5EP1A 4JQZA 3TBHA 5JVDA 4C7KA 4F6LA 5BRAA 1P3DA 1YC2A 2GR9A 3UN1A 4XPIB 1ZK3A 4ETWA 3CVYA 2VAVA 3DBHB 4HUTA 1IZ0A 4QKQA 1UDBA 2V7QA 4H08A 3L82B 1N33B 4PXSA 1JAHA 1B0ZA 4UU1A 4GZ6A 4S1NA 5BWOA 1KYYA 4HADA 4CKBB 1CVIA 1U7ZA 2QKYA 3C3MA 4NR0A 1QYCA 2JNWA 3P96A 4IXNA 4M6WB 5DLDA 3SX0A 4MWEA 1M6YA 1OWNA 4IZ6A 3A10A 4MW9A 5AVTA 4IEEA 5DM0A 4YCBA 3DXFA 5JAHA 1NVVQ 3V6LA 5K2OA 1A5AB 1XCMA 3T0GA 3IOEA 4KW7A 2X13A 2J4FA 3P2KA 1BGVA 3MJ4A 5FOUA 1W47A 3UOWA 1NDQA 1QGDA 1ML4A 3TTTA 1VC2A 1WABA 3MCVA 4R2IA 1I24A 4YMUA 3UUGA 1EFVA 2GX6A 2WF5A 2OUKA 3TRJA 3KVYA 2IXDA 4IJ5A 2C4TA 1C14A 1WB6A 1AN9A 2ACVA 3KKNA 1H0HA 3BWVA 4GX1A 2FSVA 4C06A 3IIIA 4GX5A 1RQ7A 4K81B 1NVKA 2MYTA 4MW5A 3VDNB 5HS4A 1A3CA 2VPYA 3LNCA 2J3KA 1EEXB 1I0LA 1TU4A 2PUVA 3L7DA 3R24A 4JYMA 1QJ4A 2XB4A 3E5HA 4MW6A 1TCUA 4WKPA 4BFWA 1KL7A 4F3CA 3IKMB 1NQ5A 5FD8A 1RS0A 4LOJA 1DDOA 4Z5XA 5CB6A 2O1EA 4NAUA 4Y7CA 1DT5A 4L6CA 3WJAA 1EJBA 3D5TA 4OP1A 3MMXA 4G5GA 1KZ7B 4OUDA 3R9XA 1ZSNA 1CBUA