2YUNA

Solution structure of the sh3 domain of human nostrin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nostrin
publication title Solution structure of the SH3 domain of human Nostrin
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yunA00
2HCKA 1UTIA 1WX6A 2DL5A 1SRMA 1WYXA 4HCKA 2RQVA 1WFWA 1WXUA 4OMMA 1JO8A 2GBQA 1Z9QA 2BZYA 2DL3A 3NGPA 2KXDA 4LN2A 4J9FA 2JM8A 2DX1A 2O31A 2BTTA 4WCIA 3H0HA 1WLPB 1M3AA 2EYZA 2KEAA 1Y0MA 2BZ8A 1MUZA 2JTEA 1RLPC 2EQIA 2JS2A 1A0NB 1ZUKA 2DL4A 2JMAA 1Z9ZA 4J9EA 4Y92A 1ZBJA 1YWPA 4AG1C 1PWTA 3EG3A 3VS4A 1JXMA 1ZX6A 2KXCA 1FMKA 2YUPA 2EBPA 1E6HA 3TVTA 4X1VA 1I07A 2L3SA 1ZLMA 4K11A 5IHNA 2HDAA 2M0YA 4ZNXA 1JEGA 1OPLA 2DBMA 5I22A 1UHFA 2RN8A 4M4ZA 2FPFA 1VYUA 2L2PA 3M0SA 1W70A 2MCNA 3I5RA 1WI7A 1BBZA 4RTVA 2FRWA 1ABOA 4R0KA 4OMLA 1SRLA 4J9BA 1PKSA 2DYBA 2CH4W 2W0ZA 4ORZA 2KRMA 4OMOA 3UA7A 1UFFA 2EGEA 2EVRA 1PRLC 2P4RA 2DRMA 1GCQC 1HD3A 2W10A 5ECAA 1GBQA 2DL7A 1UE9A 1QKXA 3EG1A 2J6OA 2CT3A 2G6FX 3EG2A 4F17A 2V1QA 4D8KA 3UATA 2EKHA 3O5ZA 1M8MA 2K7AA 1V1CA 4OMQA 3EGUA 2RNAA 4HXJA 4CC3A 1BB9A 4RTZA 4AFQC 2J05A 1X2KA 1BK2A 4ESRA 2JMCA 2C0OA 3IQLA 4OMPA 4RTYA 3FJ5A 2AZVA 1NLPC 1NM7A 2YDLA 5FWCA 2DRKA 1YN8A 2DA9A 1GCQA 2ED0A 2EYYA 4AFUC 3H0FA 2DBKA 3EHQA 1MV0B 3JV3A 1Y57A 1J3TA 2HSPA 2MIOA 2XMFA 4F16A 2PNIA 1GBRA 1K76A 2GGRA 2RMOA 5IH2A 3NMZC 1I0CA 3LH5A 1FYNA 3U23A 3I5SA 2KE9A 2AZSA 1KIKA 2AKLA 1UUEA 1QLYA 5EC7A 4JZ3A 1SHFA 3NHNA 2ABLA 2D1XA 2A28A 2FPDA 4D8DA 3THKA 1GCPA 4HVWA 4E6RA 2GNCA 2PTKA 1X43A 2FEIA 2CUBA 2LZ6B 2DJQA 2KR3A 2J06A 2J6FA 4RTUA 2OJ2A 2KRSA 1PKTA 2DLPA 2NUZA 2OI3A 2PZ1A 2VVKA 4AFSC 1M30A 1K0SA 4OMNA 1ZSGA 2JW4A 4RUGA 4GBQA 4JZ4A 2X3WD 2GTJA 1T0JA 2RQRA 4JPBW 1KSWA 1UJYA 1OEBA 1S1NA 1W1FA 5I11A 2FG0A 3TSZA 2IIMA 1X6GA 2KYMA 5IHIA 2KYBA 2GTOA 2LJ1A 2K2MA 1B07A 2JT4A 4CC2A 4RTWA 3M0TA 1UJ0A 1X6BA 2KGTA 1CKBA 2YUNA 1KFZA 2AKKA 2FO0A 1HJDA 2LP5A 3QWXX 1AZEA 2A36A 1AWJA 2LNHB 4J9CA 1T3SA 3GBQA 1YCSB 1WDXA 2HBWA 2YUQA 1M3CA 1I1JA 3PVQA 1GRIA 1RI9A 1U06A 1K0XA 1SHGA 2C0TA 2DL8A 1TG0A 2CSQA 3ZL7C 1X2QA 2SEMA 1K4US 2DVJA 2HEQA 2YUOA 3VS3A 2K3BA 1CKAA 1QCFA 2D0NA 1X69A 2V1RA 4GLMA 3TSWA 2FRYA 4Z88A 4JJDA 2EYWA 2RQUA 1UGVA 2ROTA 2ROLA 1X27A 3M0RA 2CREA 1ZUYA 3VS1A 1K9AA 1JU5C 2RF0A 3VRYA 1MV3A 2BZXA 1ZUUA 2B86A 3CQTA 1TUCA 5L23A 3VS5A 1H3HA 2O2OA 2E5KA 4HVVA 3EHRA 4J9GA 2DNUA 2NWMA 4A63B 2H8HA 2F2XA 3VS2A 1VYTA 1M3BA 4KRTA 5IHKA 2LX7A 3RBBB 2VKNA 4JJBA 2X3XD 1NYGA 2CH4A 5HCKA 1AWOA 2KBTA 2F2WA 2LQNA 3EG0A 1H92A 2K6DA 4Z8AA 1G2BA 2D8JA 2KRNA 2YT6A 3C0CA 3PE0A 2SRCA 1CSKA 4F14A 3PVLA 3RNJA 2LJ0A 3REAB 2EW3A 2CSIA 1T3LA 4RTTA 1GL5A 5GJWB 3UA6A 1GFDA 5GJVB 2A37A 2F2VA 4LE9A 1NLOC 2LJ3A 3NPFA 4AFZC 1NEBA 2CUDA 1G83A 4J9HA 2RQWA 1SEMA 3VS6A 5IXBA 4Z89A 1N5ZA 1WXTA 3A98A 1ABQA 3REBB 2KT8A 3SHWA 1E6GA 2L0AA 4LUDA 1UHCA 1AOJA 1QKWA 4J9IA 3ULRB 3VS7A 5IXFA 2KT1A 4EIKA 2QDLA 2K9GA 2LCSA 1OV3A 4DEXA 1UDLA 1XOVA 2ENMA 1OPKA 5FWBA 5FW9A 3M0QA 1QWFA 3VRZA 1VA7A 1AZGB 2RPNA 4HVUA 1B3QA 3M0PA 2J6KA 1TUDA 1W6XA 1JQQA 3H41A 3R6NA 2MOXA 3QWYA 1SSHA 4RTXA 1UG1A 1WA7A 1NYFA 4LUEA 4IIMA 2J7IA 3I35A 2ESWA 3VS0A 1AD5A 2FPEA 1RLQC 2LMJA 4CC7A 3SEMA 1JXOA 1YP5A 1LCKA 1ARKA 3I9QA 1M27C 2KNBB 1EFNA 2CDTA 2CT4A 1RUWA 3H0IA 1U5SA 2EGCA 2YSQA 1UECA 3M0UA 4AG2C 1OOTA 2D8HA 2O9SA 4J9DA 1AEYA 2AK5A 4FSSA 1YNZA 1NG2A 2VWFA 1SPKA 2LQWA 2EGAA 1E7OA 2C0IA 1HSQA 2L3PA 4LNPA 2DE0X 1AWWA 1VYVA 2L3QA 4QT7A 2EYXA 1K1ZA 1WIEA 1KJWA 1GFCA 1U3OA 4IIOA 1IO6A 4CC4B 1AWXA 2KROA 1PNJA 2A08A 1T0HA 1H8KA 2I0NA 3UF4A 2JXBA 2M51A 4JJCA 1AVZC 2ED1A 2OAWA 2K79A 1PRMC 2DMOA 2ECZA 2O9VA 1WXBA 4DEYA 2EPDA 1YWOA 2RQTA 2DM1A 3KFVA 1PHTA 2DF6A 1NEGA 2DILA 2JM9A 2GQIA 1BU1A 1QWEA 2JS0A 2O88A
chains in the Genus database with same CATH superfamily
1I5OB 2DL5A 1RAGB 3A8GB 2CYZB 4C92D 3NGPA 2KXDA 4M7AC 3VUZA 5CKFA 1LPLA 3H0HA 3D7SB 1KQ2A 1SG5A 3OYDA 2KEAA 3TU4K 1PC0A 2EWNA 2JTEA 2Z0WA 2BIVA 2VGMA 3CC4A 4J9EA 4Y92A 4PJOD 1KQ1A 1IXDA 1ZBJA 3L2VA 3VS4A 1HXDA 3LWHA 1VQKQ 3MEWA 1VQ8Q 2L3SA 3CCVA 2M0YA 2M9UA 3JAME 3CD6T 2DBMA 5I22A 2LC4A 1UHFA 4M4ZA 2L2PA 1FX7A 1W70A 2DD4A 2MCNA 2KI7A 1M2VB 5GAOp 4IUVA 2EJ9A 4RTVA 2FRWA 1ABOA 2DTOA 1EZZB 1W2BA 4ELYC 3EFOA 4ORZA 4OMOA 5CKHA 1UFFA 1Y96A 1PRLC 2DRMA 1TTHB 2W10A 1GBQA 3V8KA 2FL7A 2K3YA 2CT3A 4JLGA 5GAOm 3A8HB 3HFNA 2K7AA 4C0GA 2HAXA 3GPLA 4FT2A 2J05A 2V26A 3QJ6A 1UB4A 2AZVA 1YJWT 2BE7D 3NTIA 1R77A 3A8OB 5LL6S 3S3OA 1FXXA 4AFUC 1D1BA 1RAAB 4N0AA 5A0LA 3AHUA 1Y57A 2LTOA 1ACMB 4A4EA 3CCQQ 3KUFA 4J7IA 1BCOA 5IH2A 1I0CA 4LDVA 2CS7A 5C6SA 1F1BB 2KSSA 3U23A 1VQ4T 1UUEA 3OS2A 4JZ3A 2GFUA 1KG1A 4IURA 4FT4A 2K5FA 4KULA 3QO3A 4D8DA 3CD6A 3M55A 3S3NA 2VC8A 2MPXC 2FEIA 3GNGA 3E19A 4M75B 2COZA 2ZPEB 3JCMX 2CP5A 3F70A 2J06A 2J6FA 4RTUA 3VKIA 1Q86U 2DIGA 2KRSA 2NUZA 2VVKA 2PZ1A 5FLXE 3CMET 1K0SA 3CCUT 3TEEA 5HKCA 2JW4A 1Q82R 2DTHA 4OVAA 2RI5A 4PKCC 4JPBW 3T9NA 2VASA 1OU9A 4NL2A 3L2ZA 1W1FA 5DLOA 5I11A 3G6EQ 1TSFA 3TSZA 5KCHA 4C8QD 4FSXA 3EFOB 5HY6A 3QYGB 2K4YA 2LJ1A 2K2MA 2KVQG 1RAFB 3OYLA 1YJ9T 1Y96B 5D7UA 4CC2A 4C5EA 4RTWA 3M0TA 5CR2A 1UJ0A 4E7IA 1YJWA 1M90C 5KYYA 2A36A 1RABB 2MF2A 3M59A 3EH2A 3DLLA 1WDXA 1K8AR 2YUQA 2OTJQ 4O5VA 1I1JA 3GLXA 3PVQA 1U06A 4J6XA 3CPWP 4FYYB 1TG0A 2CSQA 2QG9B 3C94A 2H3EB 1K4US 3VS3A 4ZGEB 2P0PA 4ZN3A 1CKAA 5GAOq 1X69A 4M78B 2FRYA 3I56T 4LXCA 4Z88A 3A5ZB 1WPYA 1QVPA 1VQ4A 1WHJA 1MNEA 2RQUA 2VXFA 3CCEA 1G3SA 1UGQB 1IRXA 2P0KA 2MK5A 3P8HA 2JN0A 3RESA 4JS5A 2QEXQ 3CQTA 4C0ZA 1TUCA 1H3HA 2WACA 5GMKj 2EKOA 3HRTA 3OYIA 3CCUA 4A63B 1VQOQ 1RAHB 3RUXA 1X01A 2OTLT 5LJ5h 4M77B 2DAQA 1YI2Q 4OB0B 2KAFA 3OW2P 1MMAA 2RK2A 2D8JA 1ZBXA 3FLGA 4QVZA 3CBMA 2EJFA 3M4YA 2LCLA 4F14A 5GANg 2WSCE 4MZPA 3LWIA 1YJNT 4M75C 1JJ2P 4RTTA 4FCYA 1PSEA 4LE9A 2FZKB 1NEBA 1YHQT 2XIDA 2RQWA 1KD1C 1N5ZA 3REBB 2XI9A 2KT8A 1WZOA 1AT1B 2L0AA 2QQRA 1O75A 3EG9B 3SFMA 3CD6Q 1YBYA 1EIFA 5KH6A 2JZ2A 3I56A 4PLIA 2OX7A 2ENMA 5FWBA 1D09B 1QWFA 4OF1A 5CAIA 4KT0E 4HVUA 3ZFJA 4GY5A 2DEUA 4HCCA 3FEOA 3H41A 5KYUB 2MOXA 3QWYA 3O8VA 4C0DB 1D1AA 4VUBA 2QQAA 3CCLA 3PTAA 3I35A 1M4ZA 2ESWA 2CZ7B 1I4K1 1WGSA 3QHSA 2QYZA 1VIEA 3PMTA 4EMHA 1QVGS 1JXOA 1YP5A 3JCMh 2E70A 3WVEB 2OTLA 4E7HA 1VQMQ 1M27C 2ZPIB 2KNBB 2YLBA 4JRPA 2CDTA 2CT4A 2EGCA 4M78C 1UECA 2KDSA 3M0UA 2D8HA 5CVIA 2AK5A 4FSSA 4BDYA 1KQSA 3MJXA 5GAMh 3CC2T 2RI2A 2XDPA 1YJWQ 1HSQA 2L3PA 1Y7XA 1ZA1B 1G3WA 1AWWA 2L3QA 2F5TX 1Q81R 4MZTA 1YJNA 2M16A 4CC4B 1AWXA 3LLRA 3LYIA 5GAOl 2KROA 1PNJA 1H8KA 4LDYA 2JXBA 3OYHA 1WHKA 1AVZC 3KBGA 1YHQA 1VQKA 1KC8U 2ECZA 1WXBA 4FYXB 1Q86C 5FU7B 1D3BA 2LQ8A 1NEGA 2QGGA 5DM7R 2RJEA 2O88A 2VYTA 4M7AB 1N6AA 1WX6A 4HCKA 1WXUA 3X28B 4OMMA 4N4HA 3JCMP 1VQPT 4J5YA 2JM8A 2DX1A 5LJ5d 2V8JA 2BTTA 5HK3A 4V2SA 3CMEQ 1WLPB 1M3AA 3CCUQ 2LQKA 9ATCB 3M5AA 1M2OA 4EDUA 2QQBA 3V7RA 3G6ET 2FB7A 4ME7A 3V7CA 4EMKA 4FW1A 1YWPA 3V8JA 4M7DE 1ZX6A 2YUPA 2EBPA 1E6HA 3TVTA 1MNDA 1ZLMA 4ZNXA 1OPLA 3JSCA 3I55Q 5HK0A 1YJ9Q 2RN8A 1BI0A 1QVFS 4XAXB 3MO8A 3CC2A 1PCXA 3I5RA 1KQSP 1WI7A 4R0KA 5IN1A 4D6WA 4OMLA 2L89A 4PFZA 2DETA 2DYBA 4C0DC 2CH4W 1K9MR 1K73C 4JDSA 3CCQA 3UA7A 3FC3A 2VUBA 3P8BB 2XK0A 2P4RA 3L42A 3M57A 1GCQC 2MI6A 4BB7A 3JB9D 2V8IA 2DL7A 1M1KR 1UE9A 1QKXA 3OYYA 3EG1A 3CPFA 2PUKB 3VJPA 2X9HA 1VQNT 2MMPA 2DXUA 3CCSQ 4E7KA 3O5ZA 1M8MA 1V1CA 4OMQA 5D6WA 5FU6B 3EGXA 4CC3A 2JUFA 4M75D 3IQLA 4DOWA 3EGDA 3QUIA 2P84A 2JOYA 4PJMA 4O6JA 2DA9A 2EYYA 4IKFA 1MMNA 2DVEA 1VQOT 3EHQA 3OYFA 5LJ5f 3MP6A 4Y28E 3JCMd 5LJ3g 2DXCA 1MV0B 4QKUA 4A54A 2RH2A 2QGFB 1P92A 3PFSA 1J3TA 2K2VA 1NJIR 2MIOA 4HKEA 1YI2T 2RJDA 2PNIA 3L2RA 5CO7A 2XG8D 4X9DA 3QYHB 3G6EA 2OTLQ 4MMLA 4A4HA 1OULA 2CP0A 3C4SA 4YTLA 1LNXA 3LW5E 5FU7C 2AZSA 1KIKA 5EC7A 2VXEA 2FHDA 3FRNA 1RAEB 2D1XA 1GCPA 4HVWA 4EMKB 2PTKA 1TOVA 4L59A 2C06A 3RDVA 2LZ6B 1YJNQ 1YIJT 2OJ2A 1OZ3A 2DLPA 2WSEE 2RHUA 2OTJA 3WXMB 3M4GA 3NTKA 4BY6B 4RUGA 3MEAA 1QW1A 3OQ5A 3H8ZA 1N8RR 5GAOn 3OYNA 2RQRA 1YHQQ 4KGZB 4DQ2A 1UJYA 2PVGB 4LDUA 2F1LA 4C92E 4M78D 5I2MA 1YCYA 5IHIA 3BDUA 1B34A 1G3TA 1VQNA 2GTOA 3OB9A 1KD1U 5AYFA 1RACB 1B07A 4PL6A 3A1PA 3MP8A 5M9OA 3VUBA 2D9TA 3CEYA 4PJOE 1X6BA 1CKBA 1KFZA 4XQ3A 2AKKA 4B6MA 2QEXA 2EQJA 2LT1A 2X4XA 1AWJA 4NS5A 2KQWA 1T3SA 2PVOB 1VQ5Q 1NBEB 4Q5WA 1VQOA 5AT1B 4M77D 3G4ST 3JCMf 3EGDB 1KHIA 2JVVA 5CKBA 4FU6A 1VQMT 4QVCA 3RKWA 1YI2A 1X2QA 1BCMA 1UGPB 1WJQA 3JRZA 2DVJA 2O4XA 5GAMf 4ZGDB 4LD6A 3H9NA 2V1RA 4GLMA 3AT1B 3L1AA 4R56A 4JJDA 5FU6C 4JJNK 3PIOA 4C92F 1OZ2A 4C92A 1X27A 5FRMA 1TXQA 3CC2Q 4XTZA 3M0RA 3VS1A 2RF0A 1AHJB 2JJ9A 3VRYA 1KC8C 1OYXA 2DYIA 2LNVA 5L23A 3VS5A 2O2OA 1YIJA 4BI4A 4HVVA 2KY9A 3EHRA 4J9GA 4PJOF 4ATOA 1IHVA 3VS2A 1M3BA 4XTUA 4JJBA 2CH4A 1AWOA 3OYAA 4PJNA 2F2WA 3EAEA 3EG0A 1M1FA 3GOXA 4E47A 4XTVA 2K6DA 4L5GA 2KRNA 5A2QE 3C0CA 1WHMA 4P5NA 1TU0B 2BUDA 3VU3C 4X34A 2DJZA 1VUBA 2YXYA 2E64A 4EMKC 3FJPA 1VQPQ 4F7UE 1QP2A 5DY9A 1W2BP 1B34B 3QBYA 2L3RA 4BY6C 1RAIB 1ZSZA 2A37A 2F2VA 1ZHIA 4HT8A 1NLOC 3NPFA 2CUDA 2I2LA 5LJ5e 2LX9A 3G4SA 1SEMA 4F04B 5IXBA 4Z89A 3A98A 1WXTA 1H3ZA 1ABQA 2DFUA 4LUDA 4E7SA 2HL5C 1VQMA 3I55T 1K8AC 2DD5A 4J9IA 5LJ5j 3OBYA 4KGXB 3UDCA 4DBHA 2NLUA 3JCMc 5IXFA 2NYSA 4FYWB 4OP0A 2QDLA 2K9GA 4XU3A 2E3IA 1OPKA 3M0QA 1VA7A 4C8QE 1R8OB 2J6KA 4RCCA 1TUGB 4EPCA 1UG1A 1WA7A 1I81A 1NYFA 1PD0A 4LUEA 2AIRB 4E2FB 1UEBA 3VS0A 1M8VA 3CMAT 2PVDB 4F7UF 4F7UA 3CCST 1VQLQ 2Y4XA 2LMJA 3META 4CC7A 3QXEB 1K73U 3BY7A 1LCKA 2HKQB 3I9QA 1VQNQ 3E9FA 3HP9A 3HTRA 4M7AD 1EFNA 1N9SA 2EQKA 5GAOr 1U5SA 3CC7T 3OS1A 1PG5B 2QXFA 4J9DA 3UWNA 1YNZA 5GMKe 1QP3A 1M90R 1SPKA 2A3LA 2ZPBB 2LQWA 5J26A 4ANJA 3SDZA 2C0IA 5GANh 4LD9K 2DE0X 2LRQA 4QT7A 3OW2S 3LGLA 1K1ZA 1WIEA 3X26B 2KMTA 3CMEA 4IIOA 3TCJA 4Z02A 1WQWA 3J80E 4QQGA 1M5Q1 2QQSA 1VQ7T 4JJCA 5A0GA 3OA6A 3FB9A 4C8QF 4C8QA 2K79A 2X4YA 1JJ2S 1JRIA 4AT1B 3CXCA 3JCMe 2O9VA 4DEYA 3GIBA 1YWOA 1NZ9A 1WHHA 2RQTA 1JBMA 3MKDA 1PHTA 3I55A 2GQIA 2LT4A 3SWNA 2JS0A 1YJ9A 1SRMA 1WYXA 3M54A 2RQVA 4WF2A 4ZTJA 2WSFE 2E41A 4FM4B 1JO8A 2GBQA 2PUOB 1Z9QA 3QZ5B 2Y90A 1Q95G 4LN2A 4J9FA 4ZN1A 1Q7YR 2M1HA 2O31A 2CZ0B 1YIJQ 1QVGA 4WCIA 1BI3A 2HMAA 2JTMA 5D6YA 2YRDA 1XJWB 1FWZA 3WVDB 1RLPC 5GAN2 2EQIA 5CIUA 4C92G 3OYKA 1ZUKA 1Z9ZA 5KYYB 4XTXA 1VIFA 4R55A 3PMIA 1PWTA 3QZ9B 3EG3A 4IUPA 1XTDA 2QTVA 1OQKA 3CCSA 2KXCA 2Y4YA 1I07A 2G3RA 4RCBA 1N9RA 4K11A 5IHNA 3QKJA 3RMSA 2ZAEA 1JEGA 3CXCS 2RHXA 1BIBA 4PJOG 2JNGA 1VYUA 3CC7A 3JCMV 1MMDA 2EQUA 1YITQ 1VQ5T 1BBZA 2LDMA 1PD1A 2FZGB 2V8KA 1DJ7B 4JLIA 1SRLA 2NUPA 2K5LA 2W0ZA 3OYGA 2RA2A 1GXIE 3DB3A 2KRMA 5GAN8 3G4SQ 2EGEA 4C5GA 3DKMA 4JRQA 3HPWA 5ECAA 1Q81C 2J6OA 2QA4T 4F17A 4N0AC 3UATA 1QCOA 2EAYA 2EKHA 1YFNA 1HK9A 1G3YA 3MP1A 3EGUA 3GP8A 4HXJA 4AFQC 4FYVB 1BK2A 2JMCA 1OI1A 2H3JA 1NLPC 1MHNA 1QQJA 2MWOA 5CKEA 4II1A 3L2UA 5FWCA 2DRKA 5EG2A 4J83A 2ED0A 1S72T 4NOYA 3FIFA 3H0FA 2DBKA 2DK3A 3SWNB 2GFAA 3PGGA 4DBRA 4FIBA 1U1SA 2XMFA 4F16A 3QDFA 1GBRA 3SD4A 2GGRA 1I8FA 2RM4A 4XTYA 1QVFA 5GANd 3LH5A 1FYNA 3ME9A 3I5SA 2KE9A 4OB1B 3E1SA 1SHFA 3EFSA 2YRVA 2ABLA 8ATCB 2FPDA 2MAMA 2ZPFB 4RKUE 5GAN5 5GAN7 4MDWA 2K3XA 2GNCA 1C6VX 3M53A 4C5HA 4E6RA 4F7UG 1Q82U 2ZGWA 2VB6A 2CUBA 3X25B 4KUDK 1WJRA 3L2QA 2RHYA 3QG1A 4OGCA 1VQ5A 1N27A 4OMNA 1B7TA 1ZSGA 2RK1A 4GBQA 4JZ4A 4N4GA 4KBMB 2X3WD 4DOVA 1HYOA 2GTJA 4A4GA 1U8RA 1Q86R 2L8DA 1KSWA 5CQXA 1OEBA 1SF9A 4J8OA 5KYXA 4KH0B 1X6GA 1K9MC 3BDLA 2QAZA 3GF5A 4B9WA 3S6WA 5CK9A 3M56A 1WHGA 1K8AU 4QQDA 2HL3A 4C8QG 2YUNA 1RI0A 1HJDA 2FO0A 4RG8A 4LDXA 2LP5A 5DLQE 2GCXA 3QWXX 4FW2A 1U1TA 2EIFA 2RHIA 4C5IA 1PSFA 2R5MA 1KK7A 2HBWA 2A7YA 5LJ3h 3V7SA 1S72A 1VQLT 2YWWA 5IT9E 1WQ7A 1RI9A 1VQ6T 1NPRA 1K0XA 2DPPB 3CCMQ 1TS9A 2RD1A 3CMAQ 2C0TA 2DL8A 2HBPA 2RO0A 1IB8A 3DLMA 2QQ9A 3KXTA 2SEMA 4QVDA 2HEQA 3PT9A 2YUOA 2K3BA 3G1JA 1NPPA 1QCFA 5GANf 1M2VA 2D0NA 3TSWA 4M7DF 4M7DA 1SKUB 3CC7Q 2EYWA 2CGHA 3QDRB 2ROLA 4X9CA 3RMQA 1D3BB 2CREA 1VQPA 1K9AA 1K73R 3J81E 1H641 2BZXA 3LGFA 1ZUUA 2E5KA 3SWNC 2XD0A 3RERA 2DNUA 4OGEA 1I5LA 4HCZA 5J3BA 5GAMd 2NWMA 4M75E 2F2XA 2CZ6B 3HL8A 2HKNA 3BFMA 1VQ7Q 4ZTFA 4PJLA 3RBBB 2K5IA 3VYGA 1NYGA 5HCKA 2ATCB 2DXTA 3HHTB 2PU9B 2LQNA 1N8RC 4EMGA 4Z8AA 1G2BA 2YT6A 4AMCA 3PE0A 4RMOA 3JCMb 1CSKA 1WHLA 3REAB 2EW3A 2HQEA 5KYXB 2PQWA 3CBOA 1T3LA 5CKDA 3OS5A 4Y91A 3UA6A 3J7AF 5GMKi 5GJVB 1D1CA 2F69A 3JB9F 2IVWA 3LH0A 1VQLA 3TQ7P 3A8LB 2E65A 4J9HA 3VS6A 3OYCA 1VQ6A 1TH7A 1PM3A 2DTIA 4GLKA 4UC4A 1IGQA 1AOJA 2EYQA 1QKWA 4M75F 1TWBA 4M75A 3ULRB 1YITT 4E7LA 2COYA 2KT1A 4IUTA 2DIQA 4PJJA 2LCSA 4BUGA 1VQ9Q 4DEXA 3MHXA 2QTXA 5C0MA 2M02A 5FW9A 1C0MA 2A0FB 3RKYA 2RPNA 1R0CB 4M78E 3EGXB 3M0PA 2K57A 3SB2A 1TUDA 3R6NA 4FL6A 1SSHA 4M7DB 4XK8E 3L2WA 1AD5A 1SSFA 3BE3A 3PNWC 4PK4A 2X4WA 3OS0A 1XNIA 1QCNA 3SEMA 4MMKA 2QA4Q 1ARKA 1XQHA 3G71Q 1RUWA 3H0IA 3EFRA 1BI2A 5IAYA 1OOTA 2O9SA 1Q81U 4M77E 5I2SA 5A0DA 1NG2A 2FZCB 2VWFA 5LJ3d 2XU8A 2YRCA 5KE2A 2OAUA 2HNIA 2QDYB 5CQYA 1KJWA 1S72Q 4PJOA 1GFCA 1U3OA 1IO6A 1X75C 1RADB 2JTFA 3A8MB 1IGUA 2E6NA 3N5BB 4A53A 3BW1A 1ZQ1A 3CPWA 2M51A 2CP3A 4M78F 5KYNA 4M78A 2R57A 2ED1A 3V8LA 1O9SA 1Q82C 1PRMC 1W2BS 5D6XA 2GQVA 3ZEHA 3JB9J 3JCMW 4TVRA 2D6FA 2DM1A 2E3HA 2DF6A 2DILA 5KCOA 1BU1A 1QWEA 2HD0A 4BE1A 2VV5A 2E4HA 1KC8R 2HCKA 3OYEA 4IUUA 1UTIA 3X20B 4CI0C 5GAN3 4DBFA 5GANe 1WFWA 1YITA 3CCET 4JUVA 2BZYA 2DL3A 1FMVA 1D0ZA 4M77F 4M77A 5GANj 2EYZA 4M7DG 1Y0MA 1D0YA 2BZ8A 1MUZA 3OMGA 2JS2A 1A0NB 3OMCA 2DL4A 2JMAA 3MPUB 4AG1C 2XDBA 1JXMA 4JRKA 1FMKA 4J6WA 3CPWS 4X1VA 3OW2A 2O01E 1IHWA 3PIPA 2CP7A 4KGVB 2HDAA 3JB9H 2FPFA 3M0SA 4A4FA 2O4XB 4DA4A 4XU1A 1G8XA 1W4SA 2R58A 1K9MU 3RIRA 5LJ3f 1JJ2A 2L5QA 3RR6A 1MGQA 4C92B 4J9BA 1M1KU 1Y07A 2RJCA 3CCMT 4E7JA 1PKSA 4M7DC 1UGSB 3S3MA 3CCJT 5I21A 1RL2A 2EVRA 2NUTA 1VQ6Q 1HD3A 4RG2A 3EG9A 2RB6A 3CCRT 3CC4Q 2KK4A 2G6FX 3EG2A 3GNFB 2V1QA 4D8KA 4QQ6A 4PJOB 1LJOA 3FDRA 4MDXA 2RNAA 3HRSA 3CCVQ 3RKXA 1BB9A 4RTZA 3JB9G 1X2KA 4ESRA 3C12A 2C0OA 4OMPA 4RTYA 5KYUA 3FJ5A 4BI3A 3UPUA 1NM7A 2F5KA 4OMFB 4ZGJB 4J6YA 2YDLA 1NJIU 1YN8A 2M0OA 1GCQA 3M58A 1UGRB 4M7AE 2R5AA 5CCAA 4M75G 2DZ9A 3JV3A 2BKDN 2D0QB 3MEVA 2HSPA 3CCLT 5GMKl 3JB9I 4XTWA 1OX8A 1K76A 1Q7YC 2RMOA 3NMZC 2HSEB 1ZSZB 1BYMA 2EQMA 4CRIA 5GAMe 4BI8B 2AKLA 3INZA 1QLYA 3NHNA 1LOJA 2A28A 3ASKA 4DBQA 3THKA 4B9XA 2AHJB 5GAMj 1X43A 4MZMA 1N8RU 1LVKA 3UT1A 5KYWA 4HCBA 2DJQA 2KR3A 1EX4A 1V29B 2OI3A 1PKTA 4AFSC 3NFCA 1M30A 2P0QA 1JB0E 4XU2A 4XU0A 1T0JA 2GF7A 2VGNA 3CCMA 1D0XA 3G7ZA 3CMAA 4BE2A 1QMCA 5LJ5g 3CCJA 1S1NA 2AT1B 1OU8A 4M7AF 2X4JA 1VQKT 4M7AA 5FROA 1V76A 2FG0A 2YHTA 2IIMA 3CCRA 2MYSA 1VQ8T 2KYMA 4HT9A 1NE8A 1VQ9T 2KYBA 2XHCA 4F7UB 1MMGA 2JT4A 2E5QA 2NUTB 1Y71A 2CKKA 3OYMA 3OYJA 4M78G 1WJSA 2KGTA 3HRUA 5GMKh 3OBWA 3E2UA 1KD1R 3M9QA 1AZEA 2LNHB 2CZ1B 3C95A 4J9CA 2MWPA 4PFPA 1BIAA 3GBQA 1YCSB 4C92C 2ZPHB 2FVUA 1M3CA 4KH1B 2QI2A 2QK0A 1GRIA 1VQ7A 2DO3A 3HFOA 2ZPGB 1SHGA 2P4TA 3OSSC 1M9SA 3ZL7C 3G71T 3HSBA 2EJGA 3ER0A 3CXCP 2DEQA 3VYHB 4PJOC 4M77G 3Q1JA 3NTHA 4C8QB 3H6ZA 4BDZA 1UGVA 2ROTA 4HA8A 5KE3A 1BKBA 1ZUYA 2IPOB 5FRNA 1JU5C 1KHCA 2LVMA 3EH1A 1ZA2B 3MEUA 1MV3A 3OYBA 4JRIA 2B86A 5LJ3e 1QVGP 1FMWA 4BACA 3E9GA 4A4KA 5L8RE 5GAN6 3CCQT 1OX9A 2H8HA 2E1HA 3QIIA 1VYTA 2COWA 4KRTA 2X35A 5IHKA 2LX7A 5KYWB 5LJ3j 2VKNA 8AT1B 7AT1B 2BE9B 2X3XD 3JCMg 1ZSZC 2KBTA 4M77C 1H92A 1WNLA 1VQ8A 1BI1A 1VQ9A 1VQ4Q 4L6V5 5GAMg 2SRCA 2X51A 3ZBDA 3PVLA 2YLCA 3RNJA 3X24B 2FYKA 3CCEQ 2LJ0A 1IREB 2E12A 4M7DD 2CSIA 1G5VA 4NL3A 1GL5A 3JCMJ 2CP6A 5GJWB 1KQSS 1GFDA 2E10A 2B8AA 2LJ3A 1VOMA 3LX7A 3CBPA 4AFZC 4C0FA 4OB3B 1IZ6A 1G83A 1R0BG 3TREA 2NUPB 4J7FA 2QA4A 3QPHA 3SHWA 1E6GA 1UHCA 3G71A 2EFIA 2DKGA 1M1KC 3URGA 3VS7A 2ZCFB 4EIKA 1C1AA 1M1GA 4BE0A 1OV3A 3QJYA 3QSUA 4PNOA 1UDLA 1XOVA 4ELZC 3OY9A 1X6OA 2LCCA 3VRZA 1AZGB 2IG0A 1B3QA 1W6XA 1JQQA 2QASA 2OTJT 4RTXA 4IIMA 3CC4T 2HQXA 2J7IA 3OSVA 4PLLA 2RI3A 4IUQA 3CCJQ 2FPEA 1RLQC 5GAN4 4BD3A 3CCRQ 4WTOB 3VV0A 1M90U 3CCVT 5GMKm 1NJIC 1QVFP 3DB4A 3HKSA 4N4IA 4LDWA 2YSQA 2CP2A 4AG2C 1AEYA 4JS4A 2DZCA 4C8QC 3JCMQ 2RHZA 6AT1B 2EGAA 1E7OA 3I56Q 4LNPA 2RJFA 1VYVA 2E6ZA 4M7AG 4QW2A 4E7ZA 2QEXT 2EYXA 2HZYA 5J39A 2XICA 4KUIA 3P8DA 2XKOC 2A08A 1T0HA 2XDDA 3R6OA 2I0NA 3UF4A 3CCLQ 2DXBA 2OAWA 2DERA 4PFOA 2DMOA 2HQHA 2EPDA 3KFVA 4OB2B 2JM9A 2ZZDA 1Q7YU 3MCAB
chains in the Genus database with same CATH topology
2HCKA 1UTIA 1WX6A 2DL5A 1SRMA 1WYXA 4HCKA 2RQVA 1WFWA 1WXUA 4OMMA 1JO8A 2GBQA 1Z9QA 2BZYA 2DL3A 3NGPA 2KXDA 4LN2A 4J9FA 2JM8A 2DX1A 2O31A 2BTTA 4WCIA 3H0HA 1WLPB 1M3AA 2EYZA 2KEAA 1Y0MA 2BZ8A 1MUZA 2JTEA 1RLPC 2EQIA 2JS2A 1A0NB 1ZUKA 2DL4A 2JMAA 1Z9ZA 4J9EA 4Y92A 1ZBJA 1YWPA 4AG1C 1PWTA 3EG3A 3VS4A 1JXMA 1ZX6A 2KXCA 1FMKA 2YUPA 2EBPA 1E6HA 3TVTA 4X1VA 1I07A 2L3SA 1ZLMA 4K11A 5IHNA 2HDAA 2M0YA 4ZNXA 1JEGA 1OPLA 2DBMA 5I22A 1UHFA 2RN8A 4M4ZA 2FPFA 1VYUA 2L2PA 3M0SA 1W70A 2MCNA 3I5RA 1WI7A 1BBZA 4RTVA 2FRWA 1ABOA 4R0KA 4OMLA 1SRLA 4J9BA 1PKSA 2DYBA 2CH4W 2W0ZA 4ORZA 2KRMA 4OMOA 3UA7A 1UFFA 2EGEA 2EVRA 1PRLC 2P4RA 2DRMA 1GCQC 1HD3A 2W10A 5ECAA 1GBQA 2DL7A 1UE9A 1QKXA 3EG1A 2J6OA 2CT3A 2G6FX 3EG2A 4F17A 2V1QA 4D8KA 3UATA 2EKHA 3O5ZA 1M8MA 2K7AA 1V1CA 4OMQA 3EGUA 2RNAA 4HXJA 4CC3A 1BB9A 4RTZA 4AFQC 2J05A 1X2KA 1BK2A 4ESRA 2JMCA 2C0OA 3IQLA 4OMPA 4RTYA 3FJ5A 2AZVA 1NLPC 1NM7A 2YDLA 5FWCA 2DRKA 1YN8A 2DA9A 1GCQA 2ED0A 2EYYA 4AFUC 3H0FA 2DBKA 3EHQA 1MV0B 3JV3A 1Y57A 1J3TA 2HSPA 2MIOA 2XMFA 4F16A 2PNIA 1GBRA 1K76A 2GGRA 2RMOA 5IH2A 3NMZC 1I0CA 3LH5A 1FYNA 3U23A 3I5SA 2KE9A 2AZSA 1KIKA 2AKLA 1UUEA 1QLYA 5EC7A 4JZ3A 1SHFA 3NHNA 2ABLA 2D1XA 2A28A 2FPDA 4D8DA 3THKA 1GCPA 4HVWA 4E6RA 2GNCA 2PTKA 1X43A 2FEIA 2CUBA 2LZ6B 2DJQA 2KR3A 2J06A 2J6FA 4RTUA 2OJ2A 2KRSA 1PKTA 2DLPA 2NUZA 2OI3A 2PZ1A 2VVKA 4AFSC 1M30A 1K0SA 4OMNA 1ZSGA 2JW4A 4RUGA 4GBQA 4JZ4A 2X3WD 2GTJA 1T0JA 2RQRA 4JPBW 1KSWA 1UJYA 1OEBA 1S1NA 1W1FA 5I11A 2FG0A 3TSZA 2IIMA 1X6GA 2KYMA 5IHIA 2KYBA 2GTOA 2LJ1A 2K2MA 1B07A 2JT4A 4CC2A 4RTWA 3M0TA 1UJ0A 1X6BA 2KGTA 1CKBA 2YUNA 1KFZA 2AKKA 2FO0A 1HJDA 2LP5A 3QWXX 1AZEA 2A36A 1AWJA 2LNHB 4J9CA 1T3SA 3GBQA 1YCSB 1WDXA 2HBWA 2YUQA 1M3CA 1I1JA 3PVQA 1GRIA 1RI9A 1U06A 1K0XA 1SHGA 2C0TA 2DL8A 1TG0A 2CSQA 3ZL7C 1X2QA 2SEMA 1K4US 2DVJA 2HEQA 2YUOA 3VS3A 2K3BA 1CKAA 1QCFA 2D0NA 1X69A 2V1RA 4GLMA 3TSWA 2FRYA 4Z88A 4JJDA 2EYWA 2RQUA 1UGVA 2ROTA 2ROLA 1X27A 3M0RA 2CREA 1ZUYA 3VS1A 1K9AA 1JU5C 2RF0A 3VRYA 1MV3A 2BZXA 1ZUUA 2B86A 3CQTA 1TUCA 5L23A 3VS5A 1H3HA 2O2OA 2E5KA 4HVVA 3EHRA 4J9GA 2DNUA 2NWMA 4A63B 2H8HA 2F2XA 3VS2A 1VYTA 1M3BA 4KRTA 5IHKA 2LX7A 3RBBB 2VKNA 4JJBA 2X3XD 1NYGA 2CH4A 5HCKA 1AWOA 2KBTA 2F2WA 2LQNA 3EG0A 1H92A 2K6DA 4Z8AA 1G2BA 2D8JA 2KRNA 2YT6A 3C0CA 3PE0A 2SRCA 1CSKA 4F14A 3PVLA 3RNJA 2LJ0A 3REAB 2EW3A 2CSIA 1T3LA 4RTTA 1GL5A 5GJWB 3UA6A 1GFDA 5GJVB 2A37A 2F2VA 4LE9A 1NLOC 2LJ3A 3NPFA 4AFZC 1NEBA 2CUDA 1G83A 4J9HA 2RQWA 1SEMA 3VS6A 5IXBA 4Z89A 1N5ZA 1WXTA 3A98A 1ABQA 3REBB 2KT8A 3SHWA 1E6GA 2L0AA 4LUDA 1UHCA 1AOJA 1QKWA 4J9IA 3ULRB 3VS7A 5IXFA 2KT1A 4EIKA 2QDLA 2K9GA 2LCSA 1OV3A 4DEXA 1UDLA 1XOVA 2ENMA 1OPKA 5FWBA 5FW9A 3M0QA 1QWFA 3VRZA 1VA7A 1AZGB 2RPNA 4HVUA 1B3QA 3M0PA 2J6KA 1TUDA 1W6XA 1JQQA 3H41A 3R6NA 2MOXA 3QWYA 1SSHA 4RTXA 1UG1A 1WA7A 1NYFA 4LUEA 4IIMA 2J7IA 3I35A 2ESWA 3VS0A 1AD5A 2FPEA 1RLQC 2LMJA 4CC7A 3SEMA 1JXOA 1YP5A 1LCKA 1ARKA 3I9QA 1M27C 2KNBB 1EFNA 2CDTA 2CT4A 1RUWA 3H0IA 1U5SA 2EGCA 2YSQA 1UECA 3M0UA 4AG2C 1OOTA 2D8HA 2O9SA 4J9DA 1AEYA 2AK5A 4FSSA 1YNZA 1NG2A 2VWFA 1SPKA 2LQWA 2EGAA 1E7OA 2C0IA 1HSQA 2L3PA 4LNPA 2DE0X 1AWWA 1VYVA 2L3QA 4QT7A 2EYXA 1K1ZA 1WIEA 1KJWA 1GFCA 1U3OA 4IIOA 1IO6A 4CC4B 1AWXA 2KROA 1PNJA 2A08A 1T0HA 1H8KA 2I0NA 3UF4A 2JXBA 2M51A 4JJCA 1AVZC 2ED1A 2OAWA 2K79A 1PRMC 2DMOA 2ECZA 2O9VA 1WXBA 4DEYA 2EPDA 1YWOA 2RQTA 2DM1A 3KFVA 1PHTA 2DF6A 1NEGA 2DILA 2JM9A 2GQIA 1BU1A 1QWEA 2JS0A 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCK A;  1UTI A;  1WX6 A;  2DL5 A;  1SRM A;  1WYX A;  4HCK A;  2RQV A;  1WFW A;  1WXU A;  4OMM A;  1JO8 A;  2GBQ A;  1Z9Q A;  2BZY A;  2DL3 A;  3NGP A;  2KXD A;  4LN2 A;  4J9F A;  2JM8 A;  2DX1 A;  2O31 A;  2BTT A;  4WCI A;  3H0H A;  1WLP B;  1M3A A;  2EYZ A;  2KEA A;  1Y0M A;  2BZ8 A;  1MUZ A;  2JTE A;  1RLP C;  2EQI A;  2JS2 A;  1A0N B;  1ZUK A;  2DL4 A;  2JMA A;  1Z9Z A;  4J9E A;  4Y92 A;  1ZBJ A;  1YWP A;  4AG1 C;  1PWT A;  3EG3 A;  3VS4 A;  1JXM A;  1ZX6 A;  2KXC A;  1FMK A;  2YUP A;  2EBP A;  1E6H A;  3TVT A;  4X1V A;  1I07 A;  2L3S A;  1ZLM A;  4K11 A;  5IHN A;  2HDA A;  2M0Y A;  4ZNX A;  1JEG A;  1OPL A;  2DBM A;  5I22 A;  1UHF A;  2RN8 A;  4M4Z A;  2FPF A;  1VYU A;  2L2P A;  3M0S A;  1W70 A;  2MCN A;  3I5R A;  1WI7 A;  1BBZ A;  4RTV A;  2FRW A;  1ABO A;  4R0K A;  4OML A;  1SRL A;  4J9B A;  1PKS A;  2DYB A;  2CH4 W;  2W0Z A;  4ORZ A;  2KRM A;  4OMO A;  3UA7 A;  1UFF A;  2EGE A;  2EVR A;  1PRL C;  2P4R A;  2DRM A;  1GCQ C;  1HD3 A;  2W10 A;  5ECA A;  1GBQ A;  2DL7 A;  1UE9 A;  1QKX A;  3EG1 A;  2J6O A;  2CT3 A;  2G6F X;  3EG2 A;  4F17 A;  2V1Q A;  4D8K A;  3UAT A;  2EKH A;  3O5Z A;  1M8M A;  2K7A A;  1V1C A;  4OMQ A;  3EGU A;  2RNA A;  4HXJ A;  4CC3 A;  1BB9 A;  4RTZ A;  4AFQ C;  2J05 A;  1X2K A;  1BK2 A;  4ESR A;  2JMC A;  2C0O A;  3IQL A;  4OMP A;  4RTY A;  3FJ5 A;  2AZV A;  1NLP C;  1NM7 A;  2YDL A;  5FWC A;  2DRK A;  1YN8 A;  2DA9 A;  1GCQ A;  2ED0 A;  2EYY A;  4AFU C;  3H0F A;  2DBK A;  3EHQ A;  1MV0 B;  3JV3 A;  1Y57 A;  1J3T A;  2HSP A;  2MIO A;  2XMF A;  4F16 A;  2PNI A;  1GBR A;  1K76 A;  2GGR A;  2RMO A;  5IH2 A;  3NMZ C;  1I0C A;  3LH5 A;  1FYN A;  3U23 A;  3I5S A;  2KE9 A;  2AZS A;  1KIK A;  2AKL A;  1UUE A;  1QLY A;  5EC7 A;  4JZ3 A;  1SHF A;  3NHN A;  2ABL A;  2D1X A;  2A28 A;  2FPD A;  4D8D A;  3THK A;  1GCP A;  4HVW A;  4E6R A;  2GNC A;  2PTK A;  1X43 A;  2FEI A;  2CUB A;  2LZ6 B;  2DJQ A;  2KR3 A;  2J06 A;  2J6F A;  4RTU A;  2OJ2 A;  2KRS A;  1PKT A;  2DLP A;  2NUZ A;  2OI3 A;  2PZ1 A;  2VVK A;  4AFS C;  1M30 A;  1K0S A;  4OMN A;  1ZSG A;  2JW4 A;  4RUG A;  4GBQ A;  4JZ4 A;  2X3W D;  2GTJ A;  1T0J A;  2RQR A;  4JPB W;  1KSW A;  1UJY A;  1OEB A;  1S1N A;  1W1F A;  5I11 A;  2FG0 A;  3TSZ A;  2IIM A;  1X6G A;  2KYM A;  5IHI A;  2KYB A;  2GTO A;  2LJ1 A;  2K2M A;  1B07 A;  2JT4 A;  4CC2 A;  4RTW A;  3M0T A;  1UJ0 A;  1X6B A;  2KGT A;  1CKB A;  2YUN A;  1KFZ A;  2AKK A;  2FO0 A;  1HJD A;  2LP5 A;  3QWX X;  1AZE A;  2A36 A;  1AWJ A;  2LNH B;  4J9C A;  1T3S A;  3GBQ A;  1YCS B;  1WDX A;  2HBW A;  2YUQ A;  1M3C A;  1I1J A;  3PVQ A;  1GRI A;  1RI9 A;  1U06 A;  1K0X A;  1SHG A;  2C0T A;  2DL8 A;  1TG0 A;  2CSQ A;  3ZL7 C;  1X2Q A;  2SEM A;  1K4U S;  2DVJ A;  2HEQ A;  2YUO A;  3VS3 A;  2K3B A;  1CKA A;  1QCF A;  2D0N A;  1X69 A;  2V1R A;  4GLM A;  3TSW A;  2FRY A;  4Z88 A;  4JJD A;  2EYW A;  2RQU A;  1UGV A;  2ROT A;  2ROL A;  1X27 A;  3M0R A;  2CRE A;  1ZUY A;  3VS1 A;  1K9A A;  1JU5 C;  2RF0 A;  3VRY A;  1MV3 A;  2BZX A;  1ZUU A;  2B86 A;  3CQT A;  1TUC A;  5L23 A;  3VS5 A;  1H3H A;  2O2O A;  2E5K A;  4HVV A;  3EHR A;  4J9G A;  2DNU A;  2NWM A;  4A63 B;  2H8H A;  2F2X A;  3VS2 A;  1VYT A;  1M3B A;  4KRT A;  5IHK A;  2LX7 A;  3RBB B;  2VKN A;  4JJB A;  2X3X D;  1NYG A;  2CH4 A;  5HCK A;  1AWO A;  2KBT A;  2F2W A;  2LQN A;  3EG0 A;  1H92 A;  2K6D A;  4Z8A A;  1G2B A;  2D8J A;  2KRN A;  2YT6 A;  3C0C A;  3PE0 A;  2SRC A;  1CSK A;  4F14 A;  3PVL A;  3RNJ A;  2LJ0 A;  3REA B;  2EW3 A;  2CSI A;  1T3L A;  4RTT A;  1GL5 A;  5GJW B;  3UA6 A;  1GFD A;  5GJV B;  2A37 A;  2F2V A;  4LE9 A;  1NLO C;  2LJ3 A;  3NPF A;  4AFZ C;  1NEB A;  2CUD A;  1G83 A;  4J9H A;  2RQW A;  1SEM A;  3VS6 A;  5IXB A;  4Z89 A;  1N5Z A;  1WXT A;  3A98 A;  1ABQ A;  3REB B;  2KT8 A;  3SHW A;  1E6G A;  2L0A A;  4LUD A;  1UHC A;  1AOJ A;  1QKW A;  4J9I A;  3ULR B;  3VS7 A;  5IXF A;  2KT1 A;  4EIK A;  2QDL A;  2K9G A;  2LCS A;  1OV3 A;  4DEX A;  1UDL A;  1XOV A;  2ENM A;  1OPK A;  5FWB A;  5FW9 A;  3M0Q A;  1QWF A;  3VRZ A;  1VA7 A;  1AZG B;  2RPN A;  4HVU A;  1B3Q A;  3M0P A;  2J6K A;  1TUD A;  1W6X A;  1JQQ A;  3H41 A;  3R6N A;  2MOX A;  3QWY A;  1SSH A;  4RTX A;  1UG1 A;  1WA7 A;  1NYF A;  4LUE A;  4IIM A;  2J7I A;  3I35 A;  2ESW A;  3VS0 A;  1AD5 A;  2FPE A;  1RLQ C;  2LMJ A;  4CC7 A;  3SEM A;  1JXO A;  1YP5 A;  1LCK A;  1ARK A;  3I9Q A;  1M27 C;  2KNB B;  1EFN A;  2CDT A;  2CT4 A;  1RUW A;  3H0I A;  1U5S A;  2EGC A;  2YSQ A;  1UEC A;  3M0U A;  4AG2 C;  1OOT A;  2D8H A;  2O9S A;  4J9D A;  1AEY A;  2AK5 A;  4FSS A;  1YNZ A;  1NG2 A;  2VWF A;  1SPK A;  2LQW A;  2EGA A;  1E7O A;  2C0I A;  1HSQ A;  2L3P A;  4LNP A;  2DE0 X;  1AWW A;  1VYV A;  2L3Q A;  4QT7 A;  2EYX A;  1K1Z A;  1WIE A;  1KJW A;  1GFC A;  1U3O A;  4IIO A;  1IO6 A;  4CC4 B;  1AWX A;  2KRO A;  1PNJ A;  2A08 A;  1T0H A;  1H8K A;  2I0N A;  3UF4 A;  2JXB A;  2M51 A;  4JJC A;  1AVZ C;  2ED1 A;  2OAW A;  2K79 A;  1PRM C;  2DMO A;  2ECZ A;  2O9V A;  1WXB A;  4DEY A;  2EPD A;  1YWO A;  2RQT A;  2DM1 A;  3KFV A;  1PHT A;  2DF6 A;  1NEG A;  2DIL A;  2JM9 A;  2GQI A;  1BU1 A;  1QWE A;  2JS0 A;  2O88 A; 
#chains in the Genus database with same CATH topology
 1I5O B;  2DL5 A;  1RAG B;  3A8G B;  2CYZ B;  4C92 D;  3NGP A;  2KXD A;  4M7A C;  3VUZ A;  5CKF A;  1LPL A;  3H0H A;  3D7S B;  1KQ2 A;  1SG5 A;  3OYD A;  2KEA A;  3TU4 K;  1PC0 A;  2EWN A;  2JTE A;  2Z0W A;  2BIV A;  2VGM A;  3CC4 A;  4J9E A;  4Y92 A;  4PJO D;  1KQ1 A;  1IXD A;  1ZBJ A;  3L2V A;  3VS4 A;  1HXD A;  3LWH A;  1VQK Q;  3MEW A;  1VQ8 Q;  2L3S A;  3CCV A;  2M0Y A;  2M9U A;  3JAM E;  3CD6 T;  2DBM A;  5I22 A;  2LC4 A;  1UHF A;  4M4Z A;  2L2P A;  1FX7 A;  1W70 A;  2DD4 A;  2MCN A;  2KI7 A;  1M2V B;  5GAO p;  4IUV A;  2EJ9 A;  4RTV A;  2FRW A;  1ABO A;  2DTO A;  1EZZ B;  1W2B A;  4ELY C;  3EFO A;  4ORZ A;  4OMO A;  5CKH A;  1UFF A;  1Y96 A;  1PRL C;  2DRM A;  1TTH B;  2W10 A;  1GBQ A;  3V8K A;  2FL7 A;  2K3Y A;  2CT3 A;  4JLG A;  5GAO m;  3A8H B;  3HFN A;  2K7A A;  4C0G A;  2HAX A;  3GPL A;  4FT2 A;  2J05 A;  2V26 A;  3QJ6 A;  1UB4 A;  2AZV A;  1YJW T;  2BE7 D;  3NTI A;  1R77 A;  3A8O B;  5LL6 S;  3S3O A;  1FXX A;  4AFU C;  1D1B A;  1RAA B;  4N0A A;  5A0L A;  3AHU A;  1Y57 A;  2LTO A;  1ACM B;  4A4E A;  3CCQ Q;  3KUF A;  4J7I A;  1BCO A;  5IH2 A;  1I0C A;  4LDV A;  2CS7 A;  5C6S A;  1F1B B;  2KSS A;  3U23 A;  1VQ4 T;  1UUE A;  3OS2 A;  4JZ3 A;  2GFU A;  1KG1 A;  4IUR A;  4FT4 A;  2K5F A;  4KUL A;  3QO3 A;  4D8D A;  3CD6 A;  3M55 A;  3S3N A;  2VC8 A;  2MPX C;  2FEI A;  3GNG A;  3E19 A;  4M75 B;  2COZ A;  2ZPE B;  3JCM X;  2CP5 A;  3F70 A;  2J06 A;  2J6F A;  4RTU A;  3VKI A;  1Q86 U;  2DIG A;  2KRS A;  2NUZ A;  2VVK A;  2PZ1 A;  5FLX E;  3CME T;  1K0S A;  3CCU T;  3TEE A;  5HKC A;  2JW4 A;  1Q82 R;  2DTH A;  4OVA A;  2RI5 A;  4PKC C;  4JPB W;  3T9N A;  2VAS A;  1OU9 A;  4NL2 A;  3L2Z A;  1W1F A;  5DLO A;  5I11 A;  3G6E Q;  1TSF A;  3TSZ A;  5KCH A;  4C8Q D;  4FSX A;  3EFO B;  5HY6 A;  3QYG B;  2K4Y A;  2LJ1 A;  2K2M A;  2KVQ G;  1RAF B;  3OYL A;  1YJ9 T;  1Y96 B;  5D7U A;  4CC2 A;  4C5E A;  4RTW A;  3M0T A;  5CR2 A;  1UJ0 A;  4E7I A;  1YJW A;  1M90 C;  5KYY A;  2A36 A;  1RAB B;  2MF2 A;  3M59 A;  3EH2 A;  3DLL A;  1WDX A;  1K8A R;  2YUQ A;  2OTJ Q;  4O5V A;  1I1J A;  3GLX A;  3PVQ A;  1U06 A;  4J6X A;  3CPW P;  4FYY B;  1TG0 A;  2CSQ A;  2QG9 B;  3C94 A;  2H3E B;  1K4U S;  3VS3 A;  4ZGE B;  2P0P A;  4ZN3 A;  1CKA A;  5GAO q;  1X69 A;  4M78 B;  2FRY A;  3I56 T;  4LXC A;  4Z88 A;  3A5Z B;  1WPY A;  1QVP A;  1VQ4 A;  1WHJ A;  1MNE A;  2RQU A;  2VXF A;  3CCE A;  1G3S A;  1UGQ B;  1IRX A;  2P0K A;  2MK5 A;  3P8H A;  2JN0 A;  3RES A;  4JS5 A;  2QEX Q;  3CQT A;  4C0Z A;  1TUC A;  1H3H A;  2WAC A;  5GMK j;  2EKO A;  3HRT A;  3OYI A;  3CCU A;  4A63 B;  1VQO Q;  1RAH B;  3RUX A;  1X01 A;  2OTL T;  5LJ5 h;  4M77 B;  2DAQ A;  1YI2 Q;  4OB0 B;  2KAF A;  3OW2 P;  1MMA A;  2RK2 A;  2D8J A;  1ZBX A;  3FLG A;  4QVZ A;  3CBM A;  2EJF A;  3M4Y A;  2LCL A;  4F14 A;  5GAN g;  2WSC E;  4MZP A;  3LWI A;  1YJN T;  4M75 C;  1JJ2 P;  4RTT A;  4FCY A;  1PSE A;  4LE9 A;  2FZK B;  1NEB A;  1YHQ T;  2XID A;  2RQW A;  1KD1 C;  1N5Z A;  3REB B;  2XI9 A;  2KT8 A;  1WZO A;  1AT1 B;  2L0A A;  2QQR A;  1O75 A;  3EG9 B;  3SFM A;  3CD6 Q;  1YBY A;  1EIF A;  5KH6 A;  2JZ2 A;  3I56 A;  4PLI A;  2OX7 A;  2ENM A;  5FWB A;  1D09 B;  1QWF A;  4OF1 A;  5CAI A;  4KT0 E;  4HVU A;  3ZFJ A;  4GY5 A;  2DEU A;  4HCC A;  3FEO A;  3H41 A;  5KYU B;  2MOX A;  3QWY A;  3O8V A;  4C0D B;  1D1A A;  4VUB A;  2QQA A;  3CCL A;  3PTA A;  3I35 A;  1M4Z A;  2ESW A;  2CZ7 B;  1I4K 1;  1WGS A;  3QHS A;  2QYZ A;  1VIE A;  3PMT A;  4EMH A;  1QVG S;  1JXO A;  1YP5 A;  3JCM h;  2E70 A;  3WVE B;  2OTL A;  4E7H A;  1VQM Q;  1M27 C;  2ZPI B;  2KNB B;  2YLB A;  4JRP A;  2CDT A;  2CT4 A;  2EGC A;  4M78 C;  1UEC A;  2KDS A;  3M0U A;  2D8H A;  5CVI A;  2AK5 A;  4FSS A;  4BDY A;  1KQS A;  3MJX A;  5GAM h;  3CC2 T;  2RI2 A;  2XDP A;  1YJW Q;  1HSQ A;  2L3P A;  1Y7X A;  1ZA1 B;  1G3W A;  1AWW A;  2L3Q A;  2F5T X;  1Q81 R;  4MZT A;  1YJN A;  2M16 A;  4CC4 B;  1AWX A;  3LLR A;  3LYI A;  5GAO l;  2KRO A;  1PNJ A;  1H8K A;  4LDY A;  2JXB A;  3OYH A;  1WHK A;  1AVZ C;  3KBG A;  1YHQ A;  1VQK A;  1KC8 U;  2ECZ A;  1WXB A;  4FYX B;  1Q86 C;  5FU7 B;  1D3B A;  2LQ8 A;  1NEG A;  2QGG A;  5DM7 R;  2RJE A;  2O88 A;  2VYT A;  4M7A B;  1N6A A;  1WX6 A;  4HCK A;  1WXU A;  3X28 B;  4OMM A;  4N4H A;  3JCM P;  1VQP T;  4J5Y A;  2JM8 A;  2DX1 A;  5LJ5 d;  2V8J A;  2BTT A;  5HK3 A;  4V2S A;  3CME Q;  1WLP B;  1M3A A;  3CCU Q;  2LQK A;  9ATC B;  3M5A A;  1M2O A;  4EDU A;  2QQB A;  3V7R A;  3G6E T;  2FB7 A;  4ME7 A;  3V7C A;  4EMK A;  4FW1 A;  1YWP A;  3V8J A;  4M7D E;  1ZX6 A;  2YUP A;  2EBP A;  1E6H A;  3TVT A;  1MND A;  1ZLM A;  4ZNX A;  1OPL A;  3JSC A;  3I55 Q;  5HK0 A;  1YJ9 Q;  2RN8 A;  1BI0 A;  1QVF S;  4XAX B;  3MO8 A;  3CC2 A;  1PCX A;  3I5R A;  1KQS P;  1WI7 A;  4R0K A;  5IN1 A;  4D6W A;  4OML A;  2L89 A;  4PFZ A;  2DET A;  2DYB A;  4C0D C;  2CH4 W;  1K9M R;  1K73 C;  4JDS A;  3CCQ A;  3UA7 A;  3FC3 A;  2VUB A;  3P8B B;  2XK0 A;  2P4R A;  3L42 A;  3M57 A;  1GCQ C;  2MI6 A;  4BB7 A;  3JB9 D;  2V8I A;  2DL7 A;  1M1K R;  1UE9 A;  1QKX A;  3OYY A;  3EG1 A;  3CPF A;  2PUK B;  3VJP A;  2X9H A;  1VQN T;  2MMP A;  2DXU A;  3CCS Q;  4E7K A;  3O5Z A;  1M8M A;  1V1C A;  4OMQ A;  5D6W A;  5FU6 B;  3EGX A;  4CC3 A;  2JUF A;  4M75 D;  3IQL A;  4DOW A;  3EGD A;  3QUI A;  2P84 A;  2JOY A;  4PJM A;  4O6J A;  2DA9 A;  2EYY A;  4IKF A;  1MMN A;  2DVE A;  1VQO T;  3EHQ A;  3OYF A;  5LJ5 f;  3MP6 A;  4Y28 E;  3JCM d;  5LJ3 g;  2DXC A;  1MV0 B;  4QKU A;  4A54 A;  2RH2 A;  2QGF B;  1P92 A;  3PFS A;  1J3T A;  2K2V A;  1NJI R;  2MIO A;  4HKE A;  1YI2 T;  2RJD A;  2PNI A;  3L2R A;  5CO7 A;  2XG8 D;  4X9D A;  3QYH B;  3G6E A;  2OTL Q;  4MML A;  4A4H A;  1OUL A;  2CP0 A;  3C4S A;  4YTL A;  1LNX A;  3LW5 E;  5FU7 C;  2AZS A;  1KIK A;  5EC7 A;  2VXE A;  2FHD A;  3FRN A;  1RAE B;  2D1X A;  1GCP A;  4HVW A;  4EMK B;  2PTK A;  1TOV A;  4L59 A;  2C06 A;  3RDV A;  2LZ6 B;  1YJN Q;  1YIJ T;  2OJ2 A;  1OZ3 A;  2DLP A;  2WSE E;  2RHU A;  2OTJ A;  3WXM B;  3M4G A;  3NTK A;  4BY6 B;  4RUG A;  3MEA A;  1QW1 A;  3OQ5 A;  3H8Z A;  1N8R R;  5GAO n;  3OYN A;  2RQR A;  1YHQ Q;  4KGZ B;  4DQ2 A;  1UJY A;  2PVG B;  4LDU A;  2F1L A;  4C92 E;  4M78 D;  5I2M A;  1YCY A;  5IHI A;  3BDU A;  1B34 A;  1G3T A;  1VQN A;  2GTO A;  3OB9 A;  1KD1 U;  5AYF A;  1RAC B;  1B07 A;  4PL6 A;  3A1P A;  3MP8 A;  5M9O A;  3VUB A;  2D9T A;  3CEY A;  4PJO E;  1X6B A;  1CKB A;  1KFZ A;  4XQ3 A;  2AKK A;  4B6M A;  2QEX A;  2EQJ A;  2LT1 A;  2X4X A;  1AWJ A;  4NS5 A;  2KQW A;  1T3S A;  2PVO B;  1VQ5 Q;  1NBE B;  4Q5W A;  1VQO A;  5AT1 B;  4M77 D;  3G4S T;  3JCM f;  3EGD B;  1KHI A;  2JVV A;  5CKB A;  4FU6 A;  1VQM T;  4QVC A;  3RKW A;  1YI2 A;  1X2Q A;  1BCM A;  1UGP B;  1WJQ A;  3JRZ A;  2DVJ A;  2O4X A;  5GAM f;  4ZGD B;  4LD6 A;  3H9N A;  2V1R A;  4GLM A;  3AT1 B;  3L1A A;  4R56 A;  4JJD A;  5FU6 C;  4JJN K;  3PIO A;  4C92 F;  1OZ2 A;  4C92 A;  1X27 A;  5FRM A;  1TXQ A;  3CC2 Q;  4XTZ A;  3M0R A;  3VS1 A;  2RF0 A;  1AHJ B;  2JJ9 A;  3VRY A;  1KC8 C;  1OYX A;  2DYI A;  2LNV A;  5L23 A;  3VS5 A;  2O2O A;  1YIJ A;  4BI4 A;  4HVV A;  2KY9 A;  3EHR A;  4J9G A;  4PJO F;  4ATO A;  1IHV A;  3VS2 A;  1M3B A;  4XTU A;  4JJB A;  2CH4 A;  1AWO A;  3OYA A;  4PJN A;  2F2W A;  3EAE A;  3EG0 A;  1M1F A;  3GOX A;  4E47 A;  4XTV A;  2K6D A;  4L5G A;  2KRN A;  5A2Q E;  3C0C A;  1WHM A;  4P5N A;  1TU0 B;  2BUD A;  3VU3 C;  4X34 A;  2DJZ A;  1VUB A;  2YXY A;  2E64 A;  4EMK C;  3FJP A;  1VQP Q;  4F7U E;  1QP2 A;  5DY9 A;  1W2B P;  1B34 B;  3QBY A;  2L3R A;  4BY6 C;  1RAI B;  1ZSZ A;  2A37 A;  2F2V A;  1ZHI A;  4HT8 A;  1NLO C;  3NPF A;  2CUD A;  2I2L A;  5LJ5 e;  2LX9 A;  3G4S A;  1SEM A;  4F04 B;  5IXB A;  4Z89 A;  3A98 A;  1WXT A;  1H3Z A;  1ABQ A;  2DFU A;  4LUD A;  4E7S A;  2HL5 C;  1VQM A;  3I55 T;  1K8A C;  2DD5 A;  4J9I A;  5LJ5 j;  3OBY A;  4KGX B;  3UDC A;  4DBH A;  2NLU A;  3JCM c;  5IXF A;  2NYS A;  4FYW B;  4OP0 A;  2QDL A;  2K9G A;  4XU3 A;  2E3I A;  1OPK A;  3M0Q A;  1VA7 A;  4C8Q E;  1R8O B;  2J6K A;  4RCC A;  1TUG B;  4EPC A;  1UG1 A;  1WA7 A;  1I81 A;  1NYF A;  1PD0 A;  4LUE A;  2AIR B;  4E2F B;  1UEB A;  3VS0 A;  1M8V A;  3CMA T;  2PVD B;  4F7U F;  4F7U A;  3CCS T;  1VQL Q;  2Y4X A;  2LMJ A;  3MET A;  4CC7 A;  3QXE B;  1K73 U;  3BY7 A;  1LCK A;  2HKQ B;  3I9Q A;  1VQN Q;  3E9F A;  3HP9 A;  3HTR A;  4M7A D;  1EFN A;  1N9S A;  2EQK A;  5GAO r;  1U5S A;  3CC7 T;  3OS1 A;  1PG5 B;  2QXF A;  4J9D A;  3UWN A;  1YNZ A;  5GMK e;  1QP3 A;  1M90 R;  1SPK A;  2A3L A;  2ZPB B;  2LQW A;  5J26 A;  4ANJ A;  3SDZ A;  2C0I A;  5GAN h;  4LD9 K;  2DE0 X;  2LRQ A;  4QT7 A;  3OW2 S;  3LGL A;  1K1Z A;  1WIE A;  3X26 B;  2KMT A;  3CME A;  4IIO A;  3TCJ A;  4Z02 A;  1WQW A;  3J80 E;  4QQG A;  1M5Q 1;  2QQS A;  1VQ7 T;  4JJC A;  5A0G A;  3OA6 A;  3FB9 A;  4C8Q F;  4C8Q A;  2K79 A;  2X4Y A;  1JJ2 S;  1JRI A;  4AT1 B;  3CXC A;  3JCM e;  2O9V A;  4DEY A;  3GIB A;  1YWO A;  1NZ9 A;  1WHH A;  2RQT A;  1JBM A;  3MKD A;  1PHT A;  3I55 A;  2GQI A;  2LT4 A;  3SWN A;  2JS0 A;  1YJ9 A;  1SRM A;  1WYX A;  3M54 A;  2RQV A;  4WF2 A;  4ZTJ A;  2WSF E;  2E41 A;  4FM4 B;  1JO8 A;  2GBQ A;  2PUO B;  1Z9Q A;  3QZ5 B;  2Y90 A;  1Q95 G;  4LN2 A;  4J9F A;  4ZN1 A;  1Q7Y R;  2M1H A;  2O31 A;  2CZ0 B;  1YIJ Q;  1QVG A;  4WCI A;  1BI3 A;  2HMA A;  2JTM A;  5D6Y A;  2YRD A;  1XJW B;  1FWZ A;  3WVD B;  1RLP C;  5GAN 2;  2EQI A;  5CIU A;  4C92 G;  3OYK A;  1ZUK A;  1Z9Z A;  5KYY B;  4XTX A;  1VIF A;  4R55 A;  3PMI A;  1PWT A;  3QZ9 B;  3EG3 A;  4IUP A;  1XTD A;  2QTV A;  1OQK A;  3CCS A;  2KXC A;  2Y4Y A;  1I07 A;  2G3R A;  4RCB A;  1N9R A;  4K11 A;  5IHN A;  3QKJ A;  3RMS A;  2ZAE A;  1JEG A;  3CXC S;  2RHX A;  1BIB A;  4PJO G;  2JNG A;  1VYU A;  3CC7 A;  3JCM V;  1MMD A;  2EQU A;  1YIT Q;  1VQ5 T;  1BBZ A;  2LDM A;  1PD1 A;  2FZG B;  2V8K A;  1DJ7 B;  4JLI A;  1SRL A;  2NUP A;  2K5L A;  2W0Z A;  3OYG A;  2RA2 A;  1GXI E;  3DB3 A;  2KRM A;  5GAN 8;  3G4S Q;  2EGE A;  4C5G A;  3DKM A;  4JRQ A;  3HPW A;  5ECA A;  1Q81 C;  2J6O A;  2QA4 T;  4F17 A;  4N0A C;  3UAT A;  1QCO A;  2EAY A;  2EKH A;  1YFN A;  1HK9 A;  1G3Y A;  3MP1 A;  3EGU A;  3GP8 A;  4HXJ A;  4AFQ C;  4FYV B;  1BK2 A;  2JMC A;  1OI1 A;  2H3J A;  1NLP C;  1MHN A;  1QQJ A;  2MWO A;  5CKE A;  4II1 A;  3L2U A;  5FWC A;  2DRK A;  5EG2 A;  4J83 A;  2ED0 A;  1S72 T;  4NOY A;  3FIF A;  3H0F A;  2DBK A;  2DK3 A;  3SWN B;  2GFA A;  3PGG A;  4DBR A;  4FIB A;  1U1S A;  2XMF A;  4F16 A;  3QDF A;  1GBR A;  3SD4 A;  2GGR A;  1I8F A;  2RM4 A;  4XTY A;  1QVF A;  5GAN d;  3LH5 A;  1FYN A;  3ME9 A;  3I5S A;  2KE9 A;  4OB1 B;  3E1S A;  1SHF A;  3EFS A;  2YRV A;  2ABL A;  8ATC B;  2FPD A;  2MAM A;  2ZPF B;  4RKU E;  5GAN 5;  5GAN 7;  4MDW A;  2K3X A;  2GNC A;  1C6V X;  3M53 A;  4C5H A;  4E6R A;  4F7U G;  1Q82 U;  2ZGW A;  2VB6 A;  2CUB A;  3X25 B;  4KUD K;  1WJR A;  3L2Q A;  2RHY A;  3QG1 A;  4OGC A;  1VQ5 A;  1N27 A;  4OMN A;  1B7T A;  1ZSG A;  2RK1 A;  4GBQ A;  4JZ4 A;  4N4G A;  4KBM B;  2X3W D;  4DOV A;  1HYO A;  2GTJ A;  4A4G A;  1U8R A;  1Q86 R;  2L8D A;  1KSW A;  5CQX A;  1OEB A;  1SF9 A;  4J8O A;  5KYX A;  4KH0 B;  1X6G A;  1K9M C;  3BDL A;  2QAZ A;  3GF5 A;  4B9W A;  3S6W A;  5CK9 A;  3M56 A;  1WHG A;  1K8A U;  4QQD A;  2HL3 A;  4C8Q G;  2YUN A;  1RI0 A;  1HJD A;  2FO0 A;  4RG8 A;  4LDX A;  2LP5 A;  5DLQ E;  2GCX A;  3QWX X;  4FW2 A;  1U1T A;  2EIF A;  2RHI A;  4C5I A;  1PSF A;  2R5M A;  1KK7 A;  2HBW A;  2A7Y A;  5LJ3 h;  3V7S A;  1S72 A;  1VQL T;  2YWW A;  5IT9 E;  1WQ7 A;  1RI9 A;  1VQ6 T;  1NPR A;  1K0X A;  2DPP B;  3CCM Q;  1TS9 A;  2RD1 A;  3CMA Q;  2C0T A;  2DL8 A;  2HBP A;  2RO0 A;  1IB8 A;  3DLM A;  2QQ9 A;  3KXT A;  2SEM A;  4QVD A;  2HEQ A;  3PT9 A;  2YUO A;  2K3B A;  3G1J A;  1NPP A;  1QCF A;  5GAN f;  1M2V A;  2D0N A;  3TSW A;  4M7D F;  4M7D A;  1SKU B;  3CC7 Q;  2EYW A;  2CGH A;  3QDR B;  2ROL A;  4X9C A;  3RMQ A;  1D3B B;  2CRE A;  1VQP A;  1K9A A;  1K73 R;  3J81 E;  1H64 1;  2BZX A;  3LGF A;  1ZUU A;  2E5K A;  3SWN C;  2XD0 A;  3RER A;  2DNU A;  4OGE A;  1I5L A;  4HCZ A;  5J3B A;  5GAM d;  2NWM A;  4M75 E;  2F2X A;  2CZ6 B;  3HL8 A;  2HKN A;  3BFM A;  1VQ7 Q;  4ZTF A;  4PJL A;  3RBB B;  2K5I A;  3VYG A;  1NYG A;  5HCK A;  2ATC B;  2DXT A;  3HHT B;  2PU9 B;  2LQN A;  1N8R C;  4EMG A;  4Z8A A;  1G2B A;  2YT6 A;  4AMC A;  3PE0 A;  4RMO A;  3JCM b;  1CSK A;  1WHL A;  3REA B;  2EW3 A;  2HQE A;  5KYX B;  2PQW A;  3CBO A;  1T3L A;  5CKD A;  3OS5 A;  4Y91 A;  3UA6 A;  3J7A F;  5GMK i;  5GJV B;  1D1C A;  2F69 A;  3JB9 F;  2IVW A;  3LH0 A;  1VQL A;  3TQ7 P;  3A8L B;  2E65 A;  4J9H A;  3VS6 A;  3OYC A;  1VQ6 A;  1TH7 A;  1PM3 A;  2DTI A;  4GLK A;  4UC4 A;  1IGQ A;  1AOJ A;  2EYQ A;  1QKW A;  4M75 F;  1TWB A;  4M75 A;  3ULR B;  1YIT T;  4E7L A;  2COY A;  2KT1 A;  4IUT A;  2DIQ A;  4PJJ A;  2LCS A;  4BUG A;  1VQ9 Q;  4DEX A;  3MHX A;  2QTX A;  5C0M A;  2M02 A;  5FW9 A;  1C0M A;  2A0F B;  3RKY A;  2RPN A;  1R0C B;  4M78 E;  3EGX B;  3M0P A;  2K57 A;  3SB2 A;  1TUD A;  3R6N A;  4FL6 A;  1SSH A;  4M7D B;  4XK8 E;  3L2W A;  1AD5 A;  1SSF A;  3BE3 A;  3PNW C;  4PK4 A;  2X4W A;  3OS0 A;  1XNI A;  1QCN A;  3SEM A;  4MMK A;  2QA4 Q;  1ARK A;  1XQH A;  3G71 Q;  1RUW A;  3H0I A;  3EFR A;  1BI2 A;  5IAY A;  1OOT A;  2O9S A;  1Q81 U;  4M77 E;  5I2S A;  5A0D A;  1NG2 A;  2FZC B;  2VWF A;  5LJ3 d;  2XU8 A;  2YRC A;  5KE2 A;  2OAU A;  2HNI A;  2QDY B;  5CQY A;  1KJW A;  1S72 Q;  4PJO A;  1GFC A;  1U3O A;  1IO6 A;  1X75 C;  1RAD B;  2JTF A;  3A8M B;  1IGU A;  2E6N A;  3N5B B;  4A53 A;  3BW1 A;  1ZQ1 A;  3CPW A;  2M51 A;  2CP3 A;  4M78 F;  5KYN A;  4M78 A;  2R57 A;  2ED1 A;  3V8L A;  1O9S A;  1Q82 C;  1PRM C;  1W2B S;  5D6X A;  2GQV A;  3ZEH A;  3JB9 J;  3JCM W;  4TVR A;  2D6F A;  2DM1 A;  2E3H A;  2DF6 A;  2DIL A;  5KCO A;  1BU1 A;  1QWE A;  2HD0 A;  4BE1 A;  2VV5 A;  2E4H A;  1KC8 R;  2HCK A;  3OYE A;  4IUU A;  1UTI A;  3X20 B;  4CI0 C;  5GAN 3;  4DBF A;  5GAN e;  1WFW A;  1YIT A;  3CCE T;  4JUV A;  2BZY A;  2DL3 A;  1FMV A;  1D0Z A;  4M77 F;  4M77 A;  5GAN j;  2EYZ A;  4M7D G;  1Y0M A;  1D0Y A;  2BZ8 A;  1MUZ A;  3OMG A;  2JS2 A;  1A0N B;  3OMC A;  2DL4 A;  2JMA A;  3MPU B;  4AG1 C;  2XDB A;  1JXM A;  4JRK A;  1FMK A;  4J6W A;  3CPW S;  4X1V A;  3OW2 A;  2O01 E;  1IHW A;  3PIP A;  2CP7 A;  4KGV B;  2HDA A;  3JB9 H;  2FPF A;  3M0S A;  4A4F A;  2O4X B;  4DA4 A;  4XU1 A;  1G8X A;  1W4S A;  2R58 A;  1K9M U;  3RIR A;  5LJ3 f;  1JJ2 A;  2L5Q A;  3RR6 A;  1MGQ A;  4C92 B;  4J9B A;  1M1K U;  1Y07 A;  2RJC A;  3CCM T;  4E7J A;  1PKS A;  4M7D C;  1UGS B;  3S3M A;  3CCJ T;  5I21 A;  1RL2 A;  2EVR A;  2NUT A;  1VQ6 Q;  1HD3 A;  4RG2 A;  3EG9 A;  2RB6 A;  3CCR T;  3CC4 Q;  2KK4 A;  2G6F X;  3EG2 A;  3GNF B;  2V1Q A;  4D8K A;  4QQ6 A;  4PJO B;  1LJO A;  3FDR A;  4MDX A;  2RNA A;  3HRS A;  3CCV Q;  3RKX A;  1BB9 A;  4RTZ A;  3JB9 G;  1X2K A;  4ESR A;  3C12 A;  2C0O A;  4OMP A;  4RTY A;  5KYU A;  3FJ5 A;  4BI3 A;  3UPU A;  1NM7 A;  2F5K A;  4OMF B;  4ZGJ B;  4J6Y A;  2YDL A;  1NJI U;  1YN8 A;  2M0O A;  1GCQ A;  3M58 A;  1UGR B;  4M7A E;  2R5A A;  5CCA A;  4M75 G;  2DZ9 A;  3JV3 A;  2BKD N;  2D0Q B;  3MEV A;  2HSP A;  3CCL T;  5GMK l;  3JB9 I;  4XTW A;  1OX8 A;  1K76 A;  1Q7Y C;  2RMO A;  3NMZ C;  2HSE B;  1ZSZ B;  1BYM A;  2EQM A;  4CRI A;  5GAM e;  4BI8 B;  2AKL A;  3INZ A;  1QLY A;  3NHN A;  1LOJ A;  2A28 A;  3ASK A;  4DBQ A;  3THK A;  4B9X A;  2AHJ B;  5GAM j;  1X43 A;  4MZM A;  1N8R U;  1LVK A;  3UT1 A;  5KYW A;  4HCB A;  2DJQ A;  2KR3 A;  1EX4 A;  1V29 B;  2OI3 A;  1PKT A;  4AFS C;  3NFC A;  1M30 A;  2P0Q A;  1JB0 E;  4XU2 A;  4XU0 A;  1T0J A;  2GF7 A;  2VGN A;  3CCM A;  1D0X A;  3G7Z A;  3CMA A;  4BE2 A;  1QMC A;  5LJ5 g;  3CCJ A;  1S1N A;  2AT1 B;  1OU8 A;  4M7A F;  2X4J A;  1VQK T;  4M7A A;  5FRO A;  1V76 A;  2FG0 A;  2YHT A;  2IIM A;  3CCR A;  2MYS A;  1VQ8 T;  2KYM A;  4HT9 A;  1NE8 A;  1VQ9 T;  2KYB A;  2XHC A;  4F7U B;  1MMG A;  2JT4 A;  2E5Q A;  2NUT B;  1Y71 A;  2CKK A;  3OYM A;  3OYJ A;  4M78 G;  1WJS A;  2KGT A;  3HRU A;  5GMK h;  3OBW A;  3E2U A;  1KD1 R;  3M9Q A;  1AZE A;  2LNH B;  2CZ1 B;  3C95 A;  4J9C A;  2MWP A;  4PFP A;  1BIA A;  3GBQ A;  1YCS B;  4C92 C;  2ZPH B;  2FVU A;  1M3C A;  4KH1 B;  2QI2 A;  2QK0 A;  1GRI A;  1VQ7 A;  2DO3 A;  3HFO A;  2ZPG B;  1SHG A;  2P4T A;  3OSS C;  1M9S A;  3ZL7 C;  3G71 T;  3HSB A;  2EJG A;  3ER0 A;  3CXC P;  2DEQ A;  3VYH B;  4PJO C;  4M77 G;  3Q1J A;  3NTH A;  4C8Q B;  3H6Z A;  4BDZ A;  1UGV A;  2ROT A;  4HA8 A;  5KE3 A;  1BKB A;  1ZUY A;  2IPO B;  5FRN A;  1JU5 C;  1KHC A;  2LVM A;  3EH1 A;  1ZA2 B;  3MEU A;  1MV3 A;  3OYB A;  4JRI A;  2B86 A;  5LJ3 e;  1QVG P;  1FMW A;  4BAC A;  3E9G A;  4A4K A;  5L8R E;  5GAN 6;  3CCQ T;  1OX9 A;  2H8H A;  2E1H A;  3QII A;  1VYT A;  2COW A;  4KRT A;  2X35 A;  5IHK A;  2LX7 A;  5KYW B;  5LJ3 j;  2VKN A;  8AT1 B;  7AT1 B;  2BE9 B;  2X3X D;  3JCM g;  1ZSZ C;  2KBT A;  4M77 C;  1H92 A;  1WNL A;  1VQ8 A;  1BI1 A;  1VQ9 A;  1VQ4 Q;  4L6V 5;  5GAM g;  2SRC A;  2X51 A;  3ZBD A;  3PVL A;  2YLC A;  3RNJ A;  3X24 B;  2FYK A;  3CCE Q;  2LJ0 A;  1IRE B;  2E12 A;  4M7D D;  2CSI A;  1G5V A;  4NL3 A;  1GL5 A;  3JCM J;  2CP6 A;  5GJW B;  1KQS S;  1GFD A;  2E10 A;  2B8A A;  2LJ3 A;  1VOM A;  3LX7 A;  3CBP A;  4AFZ C;  4C0F A;  4OB3 B;  1IZ6 A;  1G83 A;  1R0B G;  3TRE A;  2NUP B;  4J7F A;  2QA4 A;  3QPH A;  3SHW A;  1E6G A;  1UHC A;  3G71 A;  2EFI A;  2DKG A;  1M1K C;  3URG A;  3VS7 A;  2ZCF B;  4EIK A;  1C1A A;  1M1G A;  4BE0 A;  1OV3 A;  3QJY A;  3QSU A;  4PNO A;  1UDL A;  1XOV A;  4ELZ C;  3OY9 A;  1X6O A;  2LCC A;  3VRZ A;  1AZG B;  2IG0 A;  1B3Q A;  1W6X A;  1JQQ A;  2QAS A;  2OTJ T;  4RTX A;  4IIM A;  3CC4 T;  2HQX A;  2J7I A;  3OSV A;  4PLL A;  2RI3 A;  4IUQ A;  3CCJ Q;  2FPE A;  1RLQ C;  5GAN 4;  4BD3 A;  3CCR Q;  4WTO B;  3VV0 A;  1M90 U;  3CCV T;  5GMK m;  1NJI C;  1QVF P;  3DB4 A;  3HKS A;  4N4I A;  4LDW A;  2YSQ A;  2CP2 A;  4AG2 C;  1AEY A;  4JS4 A;  2DZC A;  4C8Q C;  3JCM Q;  2RHZ A;  6AT1 B;  2EGA A;  1E7O A;  3I56 Q;  4LNP A;  2RJF A;  1VYV A;  2E6Z A;  4M7A G;  4QW2 A;  4E7Z A;  2QEX T;  2EYX A;  2HZY A;  5J39 A;  2XIC A;  4KUI A;  3P8D A;  2XKO C;  2A08 A;  1T0H A;  2XDD A;  3R6O A;  2I0N A;  3UF4 A;  3CCL Q;  2DXB A;  2OAW A;  2DER A;  4PFO A;  2DMO A;  2HQH A;  2EPD A;  3KFV A;  4OB2 B;  2JM9 A;  2ZZD A;  1Q7Y U;  3MCA B; 
#chains in the Genus database with same CATH homology
 2HCK A;  1UTI A;  1WX6 A;  2DL5 A;  1SRM A;  1WYX A;  4HCK A;  2RQV A;  1WFW A;  1WXU A;  4OMM A;  1JO8 A;  2GBQ A;  1Z9Q A;  2BZY A;  2DL3 A;  3NGP A;  2KXD A;  4LN2 A;  4J9F A;  2JM8 A;  2DX1 A;  2O31 A;  2BTT A;  4WCI A;  3H0H A;  1WLP B;  1M3A A;  2EYZ A;  2KEA A;  1Y0M A;  2BZ8 A;  1MUZ A;  2JTE A;  1RLP C;  2EQI A;  2JS2 A;  1A0N B;  1ZUK A;  2DL4 A;  2JMA A;  1Z9Z A;  4J9E A;  4Y92 A;  1ZBJ A;  1YWP A;  4AG1 C;  1PWT A;  3EG3 A;  3VS4 A;  1JXM A;  1ZX6 A;  2KXC A;  1FMK A;  2YUP A;  2EBP A;  1E6H A;  3TVT A;  4X1V A;  1I07 A;  2L3S A;  1ZLM A;  4K11 A;  5IHN A;  2HDA A;  2M0Y A;  4ZNX A;  1JEG A;  1OPL A;  2DBM A;  5I22 A;  1UHF A;  2RN8 A;  4M4Z A;  2FPF A;  1VYU A;  2L2P A;  3M0S A;  1W70 A;  2MCN A;  3I5R A;  1WI7 A;  1BBZ A;  4RTV A;  2FRW A;  1ABO A;  4R0K A;  4OML A;  1SRL A;  4J9B A;  1PKS A;  2DYB A;  2CH4 W;  2W0Z A;  4ORZ A;  2KRM A;  4OMO A;  3UA7 A;  1UFF A;  2EGE A;  2EVR A;  1PRL C;  2P4R A;  2DRM A;  1GCQ C;  1HD3 A;  2W10 A;  5ECA A;  1GBQ A;  2DL7 A;  1UE9 A;  1QKX A;  3EG1 A;  2J6O A;  2CT3 A;  2G6F X;  3EG2 A;  4F17 A;  2V1Q A;  4D8K A;  3UAT A;  2EKH A;  3O5Z A;  1M8M A;  2K7A A;  1V1C A;  4OMQ A;  3EGU A;  2RNA A;  4HXJ A;  4CC3 A;  1BB9 A;  4RTZ A;  4AFQ C;  2J05 A;  1X2K A;  1BK2 A;  4ESR A;  2JMC A;  2C0O A;  3IQL A;  4OMP A;  4RTY A;  3FJ5 A;  2AZV A;  1NLP C;  1NM7 A;  2YDL A;  5FWC A;  2DRK A;  1YN8 A;  2DA9 A;  1GCQ A;  2ED0 A;  2EYY A;  4AFU C;  3H0F A;  2DBK A;  3EHQ A;  1MV0 B;  3JV3 A;  1Y57 A;  1J3T A;  2HSP A;  2MIO A;  2XMF A;  4F16 A;  2PNI A;  1GBR A;  1K76 A;  2GGR A;  2RMO A;  5IH2 A;  3NMZ C;  1I0C A;  3LH5 A;  1FYN A;  3U23 A;  3I5S A;  2KE9 A;  2AZS A;  1KIK A;  2AKL A;  1UUE A;  1QLY A;  5EC7 A;  4JZ3 A;  1SHF A;  3NHN A;  2ABL A;  2D1X A;  2A28 A;  2FPD A;  4D8D A;  3THK A;  1GCP A;  4HVW A;  4E6R A;  2GNC A;  2PTK A;  1X43 A;  2FEI A;  2CUB A;  2LZ6 B;  2DJQ A;  2KR3 A;  2J06 A;  2J6F A;  4RTU A;  2OJ2 A;  2KRS A;  1PKT A;  2DLP A;  2NUZ A;  2OI3 A;  2PZ1 A;  2VVK A;  4AFS C;  1M30 A;  1K0S A;  4OMN A;  1ZSG A;  2JW4 A;  4RUG A;  4GBQ A;  4JZ4 A;  2X3W D;  2GTJ A;  1T0J A;  2RQR A;  4JPB W;  1KSW A;  1UJY A;  1OEB A;  1S1N A;  1W1F A;  5I11 A;  2FG0 A;  3TSZ A;  2IIM A;  1X6G A;  2KYM A;  5IHI A;  2KYB A;  2GTO A;  2LJ1 A;  2K2M A;  1B07 A;  2JT4 A;  4CC2 A;  4RTW A;  3M0T A;  1UJ0 A;  1X6B A;  2KGT A;  1CKB A;  2YUN A;  1KFZ A;  2AKK A;  2FO0 A;  1HJD A;  2LP5 A;  3QWX X;  1AZE A;  2A36 A;  1AWJ A;  2LNH B;  4J9C A;  1T3S A;  3GBQ A;  1YCS B;  1WDX A;  2HBW A;  2YUQ A;  1M3C A;  1I1J A;  3PVQ A;  1GRI A;  1RI9 A;  1U06 A;  1K0X A;  1SHG A;  2C0T A;  2DL8 A;  1TG0 A;  2CSQ A;  3ZL7 C;  1X2Q A;  2SEM A;  1K4U S;  2DVJ A;  2HEQ A;  2YUO A;  3VS3 A;  2K3B A;  1CKA A;  1QCF A;  2D0N A;  1X69 A;  2V1R A;  4GLM A;  3TSW A;  2FRY A;  4Z88 A;  4JJD A;  2EYW A;  2RQU A;  1UGV A;  2ROT A;  2ROL A;  1X27 A;  3M0R A;  2CRE A;  1ZUY A;  3VS1 A;  1K9A A;  1JU5 C;  2RF0 A;  3VRY A;  1MV3 A;  2BZX A;  1ZUU A;  2B86 A;  3CQT A;  1TUC A;  5L23 A;  3VS5 A;  1H3H A;  2O2O A;  2E5K A;  4HVV A;  3EHR A;  4J9G A;  2DNU A;  2NWM A;  4A63 B;  2H8H A;  2F2X A;  3VS2 A;  1VYT A;  1M3B A;  4KRT A;  5IHK A;  2LX7 A;  3RBB B;  2VKN A;  4JJB A;  2X3X D;  1NYG A;  2CH4 A;  5HCK A;  1AWO A;  2KBT A;  2F2W A;  2LQN A;  3EG0 A;  1H92 A;  2K6D A;  4Z8A A;  1G2B A;  2D8J A;  2KRN A;  2YT6 A;  3C0C A;  3PE0 A;  2SRC A;  1CSK A;  4F14 A;  3PVL A;  3RNJ A;  2LJ0 A;  3REA B;  2EW3 A;  2CSI A;  1T3L A;  4RTT A;  1GL5 A;  5GJW B;  3UA6 A;  1GFD A;  5GJV B;  2A37 A;  2F2V A;  4LE9 A;  1NLO C;  2LJ3 A;  3NPF A;  4AFZ C;  1NEB A;  2CUD A;  1G83 A;  4J9H A;  2RQW A;  1SEM A;  3VS6 A;  5IXB A;  4Z89 A;  1N5Z A;  1WXT A;  3A98 A;  1ABQ A;  3REB B;  2KT8 A;  3SHW A;  1E6G A;  2L0A A;  4LUD A;  1UHC A;  1AOJ A;  1QKW A;  4J9I A;  3ULR B;  3VS7 A;  5IXF A;  2KT1 A;  4EIK A;  2QDL A;  2K9G A;  2LCS A;  1OV3 A;  4DEX A;  1UDL A;  1XOV A;  2ENM A;  1OPK A;  5FWB A;  5FW9 A;  3M0Q A;  1QWF A;  3VRZ A;  1VA7 A;  1AZG B;  2RPN A;  4HVU A;  1B3Q A;  3M0P A;  2J6K A;  1TUD A;  1W6X A;  1JQQ A;  3H41 A;  3R6N A;  2MOX A;  3QWY A;  1SSH A;  4RTX A;  1UG1 A;  1WA7 A;  1NYF A;  4LUE A;  4IIM A;  2J7I A;  3I35 A;  2ESW A;  3VS0 A;  1AD5 A;  2FPE A;  1RLQ C;  2LMJ A;  4CC7 A;  3SEM A;  1JXO A;  1YP5 A;  1LCK A;  1ARK A;  3I9Q A;  1M27 C;  2KNB B;  1EFN A;  2CDT A;  2CT4 A;  1RUW A;  3H0I A;  1U5S A;  2EGC A;  2YSQ A;  1UEC A;  3M0U A;  4AG2 C;  1OOT A;  2D8H A;  2O9S A;  4J9D A;  1AEY A;  2AK5 A;  4FSS A;  1YNZ A;  1NG2 A;  2VWF A;  1SPK A;  2LQW A;  2EGA A;  1E7O A;  2C0I A;  1HSQ A;  2L3P A;  4LNP A;  2DE0 X;  1AWW A;  1VYV A;  2L3Q A;  4QT7 A;  2EYX A;  1K1Z A;  1WIE A;  1KJW A;  1GFC A;  1U3O A;  4IIO A;  1IO6 A;  4CC4 B;  1AWX A;  2KRO A;  1PNJ A;  2A08 A;  1T0H A;  1H8K A;  2I0N A;  3UF4 A;  2JXB A;  2M51 A;  4JJC A;  1AVZ C;  2ED1 A;  2OAW A;  2K79 A;  1PRM C;  2DMO A;  2ECZ A;  2O9V A;  1WXB A;  4DEY A;  2EPD A;  1YWO A;  2RQT A;  2DM1 A;  3KFV A;  1PHT A;  2DF6 A;  1NEG A;  2DIL A;  2JM9 A;  2GQI A;  1BU1 A;  1QWE A;  2JS0 A;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...