2YUNA

Solution structure of the sh3 domain of human nostrin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nostrin
molecule tags Protein transport
source organism Homo sapiens
publication title Solution structure of the SH3 domain of human Nostrin
rcsb
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yunA00
1UGVA 4D8DA 3R6NA 2JMCA 1MV0B 1VA7A 2EW3A 1KSWA 4ESRA 2DA9A 2JM9A 1ABOA 1AD5A 4CC3A 2EYZA 1I1JA 2CT4A 2LQWA 1AVZC 1UJ0A 4GBQA 2L3PA 1X6BA 2D1XA 2EQIA 4CC2A 1J3TA 1WXTA 3M0RA 1T3SA 2NUZA 1HJDA 2IIMA 2KBTA 3I5RA 2L3QA 4J9GA 2L3SA 2AZVA 4GLMA 1OEBA 2GGRA 2OI3A 2LJ3A 2K9GA 3CQTA 1KJWA 2K3BA 3EG1A 1WLPB 4OMNA 2MCNA 1TUCA 1SSHA 2KEAA 3REBB 4JJCA 1QCFA 2JTEA 2YDLA 4J9CA 1OPKA 1GFDA 2DE0X 3SHWA 4A63B 2D8JA 5IXFA 1ZSGA 1WXBA 2O2OA 2LJ1A 1AZGB 1QKXA 1M3BA 3EHRA 1WDXA 2W0ZA 2B86A 2M0YA 2K2MA 2RQVA 3EG2A 2CSIA 1NLPC 2RNAA 3ZL7C 4RTVA 2KE9A 1M3CA 1VYUA 3REAB 2YUNA 2KRNA 1X69A 1U5SA 1SHGA 1AZEA 1ZLMA 4Z8AA 1XOVA 1AEYA 1UHFA 2KYBA 1SEMA 1SRLA 2PTKA 4AFSC 2HEQA 2H8HA 2J6OA 1B3QA 3M0PA 1WXUA 2DLPA 2DYBA 1AWOA 2ABLA 4AFUC 5IH2A 4LUEA 1YN8A 2RPNA 3O5ZA 2PNIA 1UFFA 2FPDA 4F17A 1JXMA 2D8HA 1HD3A 2MIOA 4JZ3A 2BZYA 2ED1A 4RTXA 1VYTA 3RBBB 1EFNA 2DL8A 2BZXA 1OV3A 2C0IA 1E7OA 1WA7A 4E6RA 2RMOA 2W10A 1UDLA 1OPLA 1WIEA 2GTJA 3UATA 2OJ2A 1UE9A 4DEXA 1V1CA 2CDTA 2GNCA 1K76A 1Y57A 4DEYA 3TVTA 4RTYA 4M4ZA 1B07A 2LX7A 2LMJA 1GBRA 4K11A 5IHKA 2CT3A 2CUDA 2E5KA 4IIMA 2RF0A 4CC4B 5FWBA 2DL3A 2J06A 3VRZA 2LP5A 1Z9QA 2RQTA 2F2VA 4J9HA 2LJ0A 2FRYA 2C0OA 2JW4A 2LZ6B 1CKAA 2D0NA 1U3OA 2V1QA 3NPFA 1NLOC 2JM8A 2K7AA 2O9VA 4OMPA 1BBZA 2L0AA 1X2KA 2EKHA 4RTWA 2A37A 2PZ1A 1E6GA 2ROLA 1JXOA 2KR3A 1PNJA 2YUOA 2G6FX 1U06A 2DX1A 2DL4A 2VWFA 4QT7A 1H3HA 2LCSA 2CREA 1W70A 2A28A 2YT6A 2K79A 4LUDA 4AG1C 2LQNA 1ARKA 3EGUA 1UECA 2KNBB 2KRSA 2RQRA 1G2BA 3TSZA 4RTZA 4AG2C 3C0CA 3VS6A 4OMMA 1QWFA 1UG1A 2M51A 3VS7A 1PRLC 2DRMA 2OAWA 4F16A 2YUPA 4Z89A 1GBQA 2QDLA 1GCQC 1SHFA 2EYWA 1TUDA 1WYXA 1NM7A 1X27A 2GQIA 2CUBA 2KGTA 1NYFA 1AWXA 5EC7A 2DL5A 2YUQA 5IHIA 3VS5A 4AFQC 2EGAA 1T0HA 1ZUKA 2KYMA 3EG0A 2JT4A 2EGEA 4X1VA 1JEGA 1S1NA 1YCSB 3ULRB 3M0QA 2KROA 3JV3A 4RUGA 4OMQA 3PVQA 1MUZA 1RLPC 4FSSA 4J9BA 2FRWA 1GCPA 1GL5A 3VS2A 3NHNA 3UA7A 1SRMA 2O9SA 1M27C 3NMZC 4EIKA 2HSPA 1X2QA 2I0NA 4KRTA 2DBKA 1K1ZA 2SRCA 1PRMC 3EHQA 2KT1A 3I5SA 1AWWA 2VKNA 4WCIA 1UTIA 1HSQA 4IIOA 1GFCA 1ZUUA 4J9FA 2CSQA 4HVVA 1I0CA 1BU1A 2DILA 2X3XD 2DVJA 4RTUA 3THKA 1AWJA 2LNHB 3VS3A 4HCKA 2FPEA 1QWEA 5GJWB 2AK5A 2EPDA 3PE0A 3U23A 1QKWA 2AZSA 1KIKA 1X6GA 4JPBW 1H92A 2EYYA 1RLQC 2ESWA 1QLYA 4RTTA 2ED0A 4Y92A 1NYGA 4HVUA 1JO8A 3QWYA 4OMLA 2JS0A 1E6HA 3NGPA 2V1RA 1G83A 2X3WD 4ORZA 2EVRA 1RUWA 2DF6A 5I11A 3I35A 3VS4A 3H0HA 4HXJA 1UHCA 3IQLA 2EGCA 2J05A 2YSQA 2FPFA 1JQQA 2HBWA 4JJBA 1YWPA 1IO6A 2NWMA 2RN8A 2GBQA 5L23A 2DRKA 2L2PA 2CH4W 2ECZA 1NEGA 4JZ4A 3M0TA 4R0KA 1K9AA 3LH5A 4LN2A 4J9DA 3TSWA 2AKLA 1Z9ZA 2FG0A 4ZNXA 1BB9A 1K0XA 1UJYA 2KRMA 5ECAA 2JXBA 3KFVA 1PHTA 1YP5A 2GTOA 4D8KA 1NG2A 4LE9A 1FMKA 2DMOA 5FWCA 5GJVB 2JMAA 2ROTA 2HCKA 2MOXA 4LNPA 1A0NB 1OOTA 1PKTA 1W6XA 2DL7A 2XMFA 1M8MA 1AOJA 4J9EA 5I22A 1K0SA 2EYXA 3UF4A 5IXBA 1M3AA 2BTTA 4OMOA 1T3LA 3H41A 1TG0A 3UA6A 2FEIA 2C0TA 1K4US 2AKKA 1ZUYA 4HVWA 3M0UA 2KXDA 3PVLA 1T0JA 1ZX6A 2BZ8A 4Z88A 4AFZC 2JS2A 2RQWA 4F14A 1KFZA 2J6KA 1GCQA 1GRIA 1YWOA 1WX6A 1PWTA 3A98A 1YNZA 2J6FA 2FO0A 2J7IA 1UUEA 3SEMA 3QWXX 1CKBA 3RNJA 2F2WA 1N5ZA 2DNUA 1I07A 1W1FA 1CSKA 5HCKA 2A08A 2O31A 2CH4A 2K6DA 1WI7A 5IHNA 3VS1A 3H0IA 2DM1A 2DJQA 3VRYA 3EG3A 1BK2A 4JJDA 2HDAA 1ABQA 2ENMA 2P4RA 1VYVA 2EBPA 2KXCA 1H8KA 4CC7A 3FJ5A 3VS0A 2VVKA 3I9QA 2O88A 1RI9A 1MV3A 1X43A 2KT8A 2A36A 1SPKA 1LCKA 1ZBJA 1JU5C 3H0FA 1M30A 1NEBA 1PKSA 2RQUA 2DBMA 2SEMA 2F2XA 3M0SA 4J9IA 1Y0MA 1FYNA 3GBQA 5FW9A 1WFWA
chains in the Genus database with same CATH superfamily
1UGVA 2CZ6B 3S3MA 2K5LA 1I5LA 2X4XA 1N9SA 3UWNA 1VA7A 2EW3A 4DOVA 5GAN7 2D6FA 1IB8A 2DA9A 5DLQE 3JCMb 1ABOA 3QZ9B 1WHHA 1BCMA 1PCXA 2MMPA 2E4HA 3FRNA 1VQOT 1ZBXA 1IHWA 5GAOn 1D1BA 3SD4A 2EYZA 1K73C 4MDXA 2LQWA 1MMDA 1UJ0A 4CRIA 1J3TA 4M78A 2H3EB 4FW1A 1WXTA 5CR2A 2YLCA 2NUZA 2LX9A 3JCMg 4JRKA 2L3SA 3BFMA 5LJ3d 1V29B 2ZPEB 1W2BP 3CCSQ 3JCMP 2ZPGB 3CQTA 4PFPA 3RKXA 3GLXA 3M9QA 1UB4A 2K3BA 2E70A 1WLPB 2IPOB 4OMNA 1TUCA 2KEAA 3ER0A 4JJCA 2YDLA 4IUTA 1OPKA 3META 5LJ3j 3SHWA 1EX4A 1KK7A 3S3OA 4EMKB 2O2OA 2HL5C 2W0ZA 5KYUB 3TEEA 2RNAA 4RTVA 4F7UF 3REAB 4J6WA 2VB6A 1EZZB 2KRNA 3CC4Q 2BUDA 2E12A 1W4SA 2YXYA 1VOMA 5HKCA 1AEYA 5GAMe 2PTKA 5KYWB 2QQRA 5A0DA 1LVKA 1N8RC 2J6OA 3M0PA 3QIIA 1D09B 3MHXA 1X01A 2DLPA 5A0GA 2XK0A 1OQKA 1AWOA 4AFUC 2A7YA 4LUEA 2DEQA 3O5ZA 2FVUA 4A4FA 2MIOA 4JZ3A 4LDWA 5LJ5d 2JTMA 5GANe 2NUPA 3RBBB 1KQSA 2RJFA 1EFNA 2O4XB 3CPWP 2B8AA 2BZXA 3FDRA 3I56Q 4BACA 2DTOA 2EFIA 4FW2A 4HCBA 3CXCS 1UDLA 1OPLA 1Q7YC 4PK4A 3FEOA 2GTJA 2FL7A 4MMLA 5J39A 4PJOC 2OJ2A 4BDYA 2IVWA 2CP3A 3BDUA 3CEYA 1PC0A 2E41A 2CDTA 3J80E 1D3BB 3CCEQ 1TS9A 4DEYA 3TVTA 1RAFB 1UGRB 4C0GA 4J6XA 1B07A 1GBRA 2EQJA 4OF1A 2CUDA 2HMAA 3CCRT 2RF0A 5LJ5f 1RACB 3JCMd 4PJOD 3FB9A 1M5Q1 2YRVA 2LP5A 1U1TA 2HAXA 5LJ5h 1VQ6A 2FRYA 2C0OA 4J83A 3QUIA 2JW4A 2D0NA 1OU9A 3MP6A 2V1QA 1OZ3A 2K7AA 3CC2T 1X2KA 5KCHA 1JXOA 2V8KA 1QCNA 1PNJA 2F5KA 2KR3A 2YUOA 2DX1A 2DL4A 4J5YA 2E65A 2FZKB 2VWFA 4QT7A 4KH0B 4QQ6A 4M77C 3BE3A 3V8JA 5I21A 3X28B 3CCVA 3QKJA 2KRSA 2RQRA 4RKUE 2XHCA 2K2VA 3PNWC 3C0CA 3VS6A 4C0DB 5HK3A 4OMMA 4YTLA 1NJIU 1M2OA 3BW1A 2KDSA 2M51A 3VYHB 2ATCB 1WGSA 5GAN5 5J3BA 2E3HA 4F16A 4PKCC 3OYLA 2DTHA 3MKDA 2QDLA 1VQLQ 1GCQC 3FJPA 4RCCA 3TREA 1K73R 1TUDA 4KT0E 1NM7A 5CCAA 4B9WA 4KH1B 1G3SA 3OBWA 4QQGA 3OYBA 2CS7A 2CP2A 1K8AU 2CP5A 3GF5A 2JN0A 1D1CA 2JT4A 4KBMB 3OYAA 3CCMQ 2EJ9A 5KYWA 3MPUB 2DXTA 1RLPC 4J9BA 3NTHA 1GCPA 1Y7XA 3VS2A 3L1AA 2O9SA 1TUGB 1X2QA 2I0NA 3A8GB 4KRTA 2WSEE 3OW2P 1OX8A 3EHQA 5HK0A 1AWWA 2VKNA 1FWZA 3S6WA 4WCIA 1YBYA 1TTHB 2O4XA 1VUBA 2DILA 1BU1A 3EGXA 4RTUA 2LRQA 5KYXA 1IXDA 3HPWA 1O75A 3DB3A 3PE0A 3OYCA 1JJ2S 2QEXT 4M7DF 1KQ1A 4D6WA 3CCRA 1ZA2B 1QLYA 4XTYA 3CC2Q 2E5QA 2JJ9A 2QQ9A 4M7AD 5GANd 3CCVT 2JS0A 1E6HA 2KI7A 1I81A 2X3WD 3EFOB 3OMCA 4ORZA 2DF6A 4M77E 4QKUA 3PMTA 5LL6S 1WJQA 1VQ4A 1VQNA 3DB4A 2RA2A 2M02A 2VGMA 1YWPA 1IO6A 2NWMA 3MEAA 4IURA 2CH4W 2L2PA 5FU6C 2KY9A 4C92C 3LH5A 4C5EA 3L42A 1M90R 2MI6A 4F7UB 3ZEHA 1Z9ZA 5LJ3g 2X4JA 4QVDA 2V8JA 1XTDA 1KC8C 4DA4A 3DLMA 2X4WA 3EFRA 5FWCA 5GJVB 1H641 2ROTA 2HCKA 2MOXA 3FIFA 3CC7T 1W6XA 1M2VB 2DL7A 4E2FB 4E7JA 3CMAA 2L8DA 2K3YA 4PLIA 2HQHA 2FZGB 3H41A 1QP2A 1BI1A 1B7TA 2FEIA 2IG0A 1VIFA 1WPYA 4EMKC 1YHQA 3LWHA 5A0LA 3GP8A 4N0AA 1MGQA 2RHIA 2CZ0B 4ZGDB 2QQSA 3EGDA 2LVMA 1KHCA 3OW2A 4ELZC 1C1AA 1VQOA 4BE0A 3RKWA 4EMKA 3MEUA 4KUIA 1M9SA 1I07A 1W1FA 3JCMX 1CSKA 1D0XA 3G71A 4F04B 2K6DA 4FYXB 1WI7A 3LWIA 1QVGP 1QCOA 1N6AA 2DJQA 2R58A 5CKHA 1M2VA 5GMKi 4M7AA 2EBPA 2KXCA 3RKYA 3VKIA 3VS0A 3WXMB 1RI9A 4OB3B 2PVOB 1X43A 2NUPB 4V2SA 3MJXA 1BIAA 3CC4T 1SPKA 1KD1U 4C0FA 3H0FA 3JCMf 4RCBA 1NEBA 1VQPA 2RQUA 2DBMA 3M0SA 1Y0MA 1Q86U 1QVGS 3OYIA 5FW9A 2MPXC 3G6EA 1LPLA 1WFWA 1HYOA 5FRMA 2Y4XA 4PFOA 1M1KU 3A1PA 2K57A 3SWNC 1Q7YU 3R6NA 2XG8D 2JMCA 2VV5A 1M1KR 1NBEB 4M78C 4M7AE 1OULA 2HQXA 3MEWA 1X6OA 2V8IA 1YJ9Q 1NPRA 2JM9A 4FCYA 1QMCA 1RL2A 3CCJQ 3P8DA 1SKUB 4WTOB 2LQKA 2KSSA 4M7AG 1BYMA 2RJEA 4J7IA 4PLLA 2BE9B 3CCUA 3I55Q 2JVVA 1VQNQ 2CT4A 1M1FA 1AVZC 1C0MA 5GAOr 1X6BA 2D1XA 2EQIA 4JLIA 1IZ6A 3QPHA 5KCOA 1WHGA 3M0RA 1HJDA 5GAN2 2IIMA 2KBTA 3I5RA 3QXEB 4J9GA 5D6WA 1YJNT 1OEBA 5CK9A 2RJDA 4A4HA 4KUDK 2OI3A 2LJ3A 2EIFA 4MDWA 2P0QA 1SSHA 1Y07A 1K73U 2DK3A 1GFDA 2K3XA 3D7SB 4B6MA 3MCAB 1VQ7T 1YJNQ 3HRTA 3NTIA 2OAUA 1QVFA 2KQWA 1QKXA 2EJFA 1M3BA 2B86A 3OA6A 2RHUA 4LDXA 3C95A 5FRNA 3FLGA 3CCLQ 3OYMA 3ZL7C 3CC7A 2NLUA 2H3JA 4O6JA 1R8OB 3JAME 4M78B 1BI0A 1ZLMA 4FYVB 1XOVA 1MMNA 2F5TX 2FB7A 2P4TA 1B3QA 2DTIA 2CKKA 4M7DA 3OSSC 3M57A 1WJSA 2JOYA 1Q7YR 2R57A 2PNIA 3OYJA 2WACA 1JXMA 1OYXA 4XTXA 1YI2T 2MWOA 2AIRB 1IGQA 1LOJA 3CMAT 1QVPA 4RTXA 4KGZB 1PSEA 5C0MA 2QA4Q 1OV3A 4MZPA 1AT1B 3A5ZB 1QVFS 1I4K1 3M54A 2X35A 3UATA 1U8RA 4DEXA 1BIBA 2QDYB 3M4GA 3ZFJA 3PIPA 1WNLA 5GAN4 1K76A 4BE2A 3BDLA 3SWNA 3QDRB 1VQPQ 1X75C 1WHLA 2LMJA 1S72T 2PUKB 5GMKl 2EWNA 3OYEA 3OS5A 4CC4B 2EJGA 2DL3A 2MF2A 2RQTA 4JUVA 3OY9A 4IUPA 5CKEA 1B34A 5KE3A 1Q81R 2LZ6B 1CKAA 1NLOC 2JM8A 4FSXA 2AHJB 2O9VA 4OMPA 2V26A 4C0DC 3M59A 1RAGB 2PZ1A 4OMFB 2GFAA 4BY6C 4DBRA 1KQSS 2PUOB 2VXFA 4ELYC 3QBYA 4FM4B 2YT6A 4C92B 2OX7A 3EGUA 3CCQQ 2OTJT 1YITT 3A8HB 1UG1A 4C92A 1YJNA 1PRLC 3OYHA 5DLOA 1KQSP 1OX9A 4Z89A 2RI5A 5LJ3f 5FU7B 5CAIA 3WVEB 3X25B 2CUBA 4NS5A 3E19A 1PM3A 2DL5A 2YUQA 3VU3C 4C5GA 2EGAA 1UGPB 4X9CA 2DEUA 3QO3A 1OI1A 4X1VA 1RADB 1K9MC 3JV3A 2KMTA 4RUGA 1UEBA 3BY7A 3QJYA 3NHNA 1ZA1B 1SRMA 3A8OB 5DY9A 3NMZC 3RMQA 1K1ZA 1YIJT 2RK1A 3HSBA 1PRMC 3JB9J 3CCJA 4KULA 5LJ3h 3T9NA 1TU0B 3PGGA 1Y96A 1ZUUA 5D7UA 3RIRA 4N4GA 5GAMj 2DPPB 3THKA 3L2UA 2ZPHB 3I55A 1KG1A 5FU7C 1PSFA 4M75E 2AK5A 2EPDA 3HRSA 5GANj 1SG5A 4M75F 4VUBA 3CC2A 2A3LA 1VQ9A 1QKWA 2LCLA 2RHXA 2WSCE 1YJ9A 3CCST 4Z02A 3EFOA 3GPLA 1KD1C 1NYGA 1TSFA 2BE7D 4BY6B 3JB9H 4MZMA 4OMLA 3NGPA 1VQ7A 2COZA 3G6ET 1G83A 4BI4A 3H0HA 1ZHIA 1HK9A 4Q5WA 2YSQA 4JRQA 1TH7A 1JQQA 1M4ZA 5L23A 2ECZA 3M0TA 1VIEA 3URGA 5CO7A 3TSWA 2AKLA 2FG0A 1BB9A 4ZTJA 4J8OA 1PHTA 3G71Q 3CXCP 1Q82U 3MO8A 2GTOA 3HRUA 2DAQA 4LE9A 2NYSA 1WQWA 2DMOA 3QYHB 2C06A 1PG5B 2DZCA 1LNXA 2JMAA 1VQNT 1D0YA 1JJ2A 1IGUA 4LDUA 4J9EA 2XU8A 2VC8A 2HSEB 3CBOA 3CMAQ 2YRCA 5KYYB 1T3LA 3PMIA 1TG0A 3G71T 3UA6A 2JNGA 2C0TA 5GAOl 1K4US 2QQAA 4E7KA 1RAIB 3PVLA 1YHQQ 1ZX6A 2MAMA 5HY6A 4AFZC 3CMET 2QYZA 3HFOA 4PL6A 1GCQA 2YLBA 1VQ5Q 5CKDA 4L6V5 3DKMA 2FO0A 4C8QE 2J7IA 3SEMA 3OYFA 3TU4K 1R0CB 2F2WA 1N5ZA 2DNUA 3EGDB 3JCMQ 5HCKA 2QG9B 1IREB 3QYGB 3H8ZA 2DM1A 4EPCA 2M9UA 1PD1A 8AT1B 4PJMA 4RG2A 1BK2A 4R55A 3UPUA 2HDAA 1ABQA 4HCZA 3OBYA 1VYVA 1M90U 4GY5A 4XTZA 4ME7A 4C92F 3I9QA 2O88A 3CCUQ 1WHJA 1RABB 2RH2A 2A36A 1LCKA 1JU5C 2VGNA 1YIJQ 1K9MU 3JB9F 3MEVA 3M4YA 2FZCB 3L2WA 4FT2A 3CBPA 2YWWA 5C6SA 1OZ2A 4LD6A 3L2RA 2QTXA 3GNGA 2M16A 4ZN3A 4QQDA 4ESRA 2FHDA 7AT1B 3JCMW 4A4KA 2NUTA 2P0PA 1QW1A 1MMGA 2QXFA 1VQ5A 1AD5A 4CC3A 2HQEA 3DLLA 3CCJT 1I1JA 2RM4A 1MNDA 4PJOA 3EAEA 3PIOA 3V8KA 4GBQA 2ZPIB 5I2SA 4CC2A 4C8QA 4OB0B 2CP0A 3CCQA 2LNVA 3CCMA 2A0FB 5D6YA 1Q86C 2L3QA 5AYFA 4M7DD 2AZVA 4GLMA 1I5OB 2RO0A 2GGRA 5KYNA 3LGLA 4E7LA 4N0AC 1VQ8A 3EG1A 1XNIA 3SWNB 4M7DG 4M7DE 3REBB 4C8QF 2EYQA 2DYIA 1VQ5T 1QCFA 2JTEA 4GLKA 1VQLA 4A63B 4P5NA 2LT4A 1PD0A 5IXFA 1ZSGA 1YHQT 3C94A 2LJ1A 3CPFA 1FXXA 3EHRA 3CMEA 1WDXA 1B34B 3EG2A 2RQVA 2K2MA 3TCJA 5GAN6 1NLPC 3CCVQ 4IUUA 4C92G 4XU1A 1M3CA 1VYUA 5GANh 5GAOq 2YUNA 2YHTA 1X69A 1U5SA 5GAMf 4IKFA 1AZEA 1G3TA 3JB9G 1ACMB 1UHFA 3CCUT 1VQKT 2KYBA 3L2QA 1SEMA 2HEQA 2XDBA 4X34A 1WXUA 2DVEA 5LJ5g 5IH2A 2HZYA 3E1SA 3SFMA 3AHUA 2RPNA 1UFFA 3VUBA 2QA4A 4F17A 1VQ6Q 1VQPT 1KC8U 2ED1A 4R56A 3A8MB 1VYTA 5FLXE 2C0IA 3KXTA 3QG1A 2CP7A 1WA7A 2EKOA 4E6RA 2RMOA 2EQUA 2W10A 4BI3A 1Q81U 1FX7A 3RUXA 4MMKA 3JRZA 3JCMJ 1UE9A 4FIBA 4WF2A 2GFUA 3EG9B 4M75A 2NUTB 3SB2A 5CVIA 3JCMc 4QVZA 2XKOC 2ZGWA 4L59A 4M4ZA 3CCRQ 1Y96B 2CP6A 3VJPA 4K11A 3CC7Q 2CT3A 3CCLA 2MK5A 3CCEA 4M77D 4C5IA 2J06A 4JS5A 3M56A 4C8QG 2F2VA 4ZTFA 2ZPFB 4J9HA 1XJWB 2LJ0A 1I8FA 3SDZA 1U3OA 3NPFA 4PJOE 2HBPA 4F7UG 2X9HA 3OS0A 1BBZA 2L0AA 2EKHA 3C12A 2QAZA 2A37A 3EFSA 2F69A 1XQHA 1RAEB 3M53A 5FU6B 1H3HA 2LCSA 2CREA 1W70A 2A28A 2K79A 4AMCA 3S3NA 4HA8A 1ZSZB 4M78D 2QK0A 3LYIA 1UECA 5KYXB 1HXDA 1G2BA 5LJ5j 5FROA 4JLGA 9ATCB 1QWFA 2VYTA 1VQMA 2RB6A 3VS7A 2E3IA 2DRMA 3CD6T 2OAWA 2JUFA 3R6OA 3ASKA 1VQ9T 1GBQA 3F70A 2PU9B 2EYWA 2DFUA 3Q1JA 4A4EA 2GQIA 3AT1B 4JDSA 1NYFA 5D6XA 2LTOA 1M1KC 2X4YA 4FT4A 2EAYA 5IHIA 2HL3A 3VS5A 3HHTB 4AFQC 2RK2A 1T0HA 2KYMA 1QP3A 2DXBA 2EGEA 1K8AC 1S1NA 4A4GA 3M0QA 3UDCA 3WVDB 2KROA 1SSFA 3I55T 3QDFA 4OMQA 1U1SA 3PVQA 3KUFA 2LDMA 1MUZA 4FSSA 2P84A 3N5BB 1GXIE 3CXCA 3RERA 1V76A 1M27C 3OYDA 2HSPA 3CCSA 3JCMe 4BDZA 3RR6A 1YJ9T 2SRCA 4N4IA 2WSFE 4LDYA 4OB1B 4RMOA 4XU3A 1O9SA 2X51A 1UTIA 4IIOA 2RJCA 4Y28E 2KAFA 1UGSB 3X26B 4J9FA 1TOVA 2DVJA 1QVGA 4HCKA 2DJZA 1QWEA 3C4SA 5CKBA 4QVCA 3U23A 1KIKA 4QW2A 4PNOA 1H92A 4XTVA 4M7DB 1RLQC 4E7SA 4RTTA 4F7UE 3RMSA 1KHIA 1RAHB 3G7ZA 2DIGA 2ED0A 3L2VA 4HVUA 1BI2A 4E7IA 4PJOF 1JO8A 3VV0A 2DD4A 2V1RA 3E2UA 4F7UA 2P0KA 1RUWA 5I11A 5GAMg 3I35A 3VS4A 2VXEA 4IUQA 1YITA 3PFSA 3IQLA 1KD1R 5AT1B 4MZTA 2HBWA 4JJBA 2GBQA 3OW2S 2DRKA 4LXCA 1NEGA 4R0KA 1K9AA 5LJ5e 4LN2A 5KYUA 5GANg 1K0XA 1G8XA 3HKSA 2XDPA 1AHJB 1JB0E 1YP5A 4D8KA 4M78E 4M7AC 4E47A 4M75C 4PJOB 3J81E 5GAMd 1PKTA 1M8MA 1YFNA 1AOJA 5I22A 1K0SA 2EYXA 1EIFA 4HKEA 5IXBA 1M3AA 2K4YA 4OMOA 3EG9A 5GMKh 3JB9I 4X9DA 3V7SA 2AKKA 2K5IA 3GIBA 3M0UA 1Q86R 2CZ7B 2BZ8A 2R5MA 1VQKQ 2JS2A 3H6ZA 1G3WA 5GAN8 1SF9A 2RQWA 1VQMT 2J6KA 2JZ2A 1GRIA 1YWOA 3A98A 3X24B 2KVQG 1YNZA 2J6FA 3QWXX 1CKBA 1YCYA 2FYKA 3QZ5B 1S72Q 2DD5A 3LH0A 1JRIA 2O31A 2QASA 1FMVA 4PJJA 4EMHA 2QTVA 2ZCFB 3OQ5A 3G6EQ 5J26A 3EG3A 3RESA 4CC7A 1H8KA 1MV3A 2MWPA 1M1GA 6AT1B 5KE2A 1ZBJA 1VQ8T 1M30A 4J9IA 2K5FA 2F2XA 2SEMA 2DERA 3QJ6A 3UT1A 1FYNA 4HT9A 3GBQA 5DM7R 1N27A 1KC8R 1BCOA 2M1HA 1P92A 3MP8A 3X20B 2DXUA 3CCMT 2HD0A 3HTRA 4D8DA 5CQYA 2XD0A 2OTLT 3HL8A 1MV0B 4ZGJB 1VQ4T 1KSWA 4FYYB 1VQOQ 2GQVA 4II1A 4XK8E 5GANf 4XTWA 4N4HA 2F1LA 4XTUA 3CPWS 1LJOA 3M58A 4OVAA 2L3PA 2COWA 1QQJA 3PTAA 8ATCB 4NL2A 1T3SA 4ANJA 1WQ7A 4KGVB 1BI3A 4EDUA 1R0BG 2QGGA 4M75B 2E10A 4OB2B 4M7AB 2QEXQ 1WJRA 2K9GA 4Y91A 1KJWA 2MCNA 3CD6Q 3OMGA 1IRXA 3A8LB 1H3ZA 1D3BA 4J9CA 5GMKm 2DE0X 2R5AA 3ZBDA 2D8JA 1QVFP 1MHNA 1WXBA 4J7FA 2QI2A 3CCQT 1AZGB 3EH2A 2M0YA 2JTFA 1N8RR 2CSIA 4RG8A 1ZQ1A 3ME9A 1F1BB 2E64A 3RDVA 2KK4A 4XQ3A 2LT1A 3G4SA 2KE9A 4XAXB 1VQ4Q 1SHGA 2GCXA 3QHSA 1D1AA 4BD3A 4Z8AA 2G3RA 1NJIR 2RI2A 2OTLQ 3E9GA 1SRLA 4AFSC 4BE1A 1WZOA 1YJWT 2H8HA 1YJWQ 1MNEA 1W2BS 2DYBA 2ABLA 3CMEQ 1YN8A 5I2MA 3H9NA 2QGFB 3GOXA 5EG2A 3JCMV 4E7ZA 3I56A 3MP1A 4M77A 2FPDA 2D8HA 1HD3A 1KQ2A 3JCMh 4M7AF 2BZYA 3G1JA 4M78G 2DL8A 1VQ8Q 5GAN3 1K9MR 2BIVA 4FU6A 1E7OA 1K8AR 1WHMA 2E6ZA 1WIEA 1N9RA 4A54A 1VQMQ 4PJNA 4DBQA 3P8HA 3JSCA 2GF7A 1V1CA 2DZ9A 2LQ8A 4XU0A 2GNCA 1Y57A 4RTYA 4ZN1A 3OYKA 3PT9A 3CC4A 1R77A 2LX7A 4HT8A 5IHKA 4JJNK 2E5KA 4IIMA 5FWBA 2O01E 3VRZA 1NPPA 1Z9QA 3P8BB 2Y90A 5L8RE 1IHVA 2HNIA 1Q81C 3JB9D 3HFNA 2RD1A 2EQMA 2DKGA 4TVRA 3OSVA 4RTWA 2AT1B 1E6GA 2ROLA 4XU2A 1WHKA 3OS1A 2G6FX 1U06A 4ATOA 4M75G 2RHZA 3LGFA 1YIJA 2E6NA 3CCET 1YI2Q 4LUDA 4AG1C 2QQBA 2DXCA 2LQNA 4AT1B 3J7AF 1ARKA 2I2LA 1YJWA 1N8RU 2L89A 2KNBB 1G3YA 3LX7A 1VQKA 3TSZA 4RTZA 2MYSA 5IAYA 4AG2C 2RHYA 2OTLA 1MMAA 3I56T 3GNFB 2YUPA 5CIUA 4DBFA 1SHFA 1WYXA 4OGCA 1X27A 2KGTA 5LJ3e 3KBGA 5IN1A 2RI3A 1JJ2P 4M78F 1AWXA 5A2QE 5GMKe 4PFZA 3L2ZA 5EC7A 5GAMh 4JS4A 1ZUKA 3EG0A 1JEGA 1YCSB 3E9FA 3ULRB 4C8QD 1TWBA 4M77G 4CI0C 3FC3A 1JBMA 2E1HA 3OYGA 2FRWA 3CD6A 1GL5A 1YI2A 4BUGA 3UA7A 4EIKA 2QEXA 3M55A 2DBKA 3V8LA 2XI9A 3VUZA 3OYNA 2COYA 1D0ZA 2KT1A 3I5SA 1YITQ 3EH1A 1HSQA 4M7DC 1GFCA 2Y4YA 2CSQA 4HVVA 1I0CA 2X3XD 1OU8A 4BI8B 1AWJA 2LNHB 1W2BA 4JRPA 1Q95G 3VS3A 1ZSZA 2FPEA 5GJWB 2DIQA 4BB7A 2PVDB 2AZSA 2LC4A 4FYWB 4IUVA 4C8QC 1X6GA 4JPBW 2EYYA 2ESWA 4C0ZA 4PJOG 3NFCA 4M75D 4Y92A 4C5HA 2HKNA 3CBMA 3QWYA 3OYYA 3TQ7P 2EVRA 2D9TA 2OTJQ 1DJ7B 1M90C 1C6VX 1NJIC 4HXJA 2L3RA 3OB9A 5IT9E 1UHCA 4HCCA 2EGCA 2J05A 1VQ7Q 1G5VA 1Q82R 2ZAEA 2PVGB 3INZA 2FPFA 3VYGA 3M5AA 1S72A 2RN8A 4L5GA 4JZ4A 1VQLT 4J9DA 4DQ2A 1VQ9Q 4NOYA 5KYYA 5CKFA 4ZNXA 4DBHA 1UJYA 2KRMA 5ECAA 2JXBA 4O5VA 3KFVA 3OS2A 4UC4A 2LCCA 1NG2A 2QA4T 1M8VA 4C8QB 4M77F 1FMKA 2EQKA 2VUBA 3HP9A 3CPWA 2CYZB 3LW5E 4LNPA 3EGXB 1A0NB 1OOTA 2XMFA 2YRDA 5GAOm 2CZ1B 5GAOp 4B9XA 1ZSZC 3G4SQ 3UF4A 3V7CA 2BTTA 4M77B 1FMWA 5KH6A 2OTJA 1RI0A 1ZUYA 2M0OA 4HVWA 2KXDA 4LD9K 1T0JA 4Z88A 3NTKA 4ZGEB 4F14A 4NL3A 2VASA 1KFZA 1Y71A 4JRIA 1WX6A 1PWTA 1RAAB 4KGXB 2DETA 5GMKj 1UGQB 4C92E 3LLRA 3CCLT 1UUEA 3RNJA 3G4ST 4DOWA 4J6YA 3QSUA 2Z0WA 2XDDA 2HKQB 1VQ6T 2CGHA 2A08A 4E7HA 1NZ9A 2L5QA 2CH4A 2XICA 3V7RA 5IHNA 4C92D 3VS1A 2DO3A 3H0IA 2D0QB 2XIDA 4LDVA 3VRYA 4JJDA 4A53A 2ENMA 2P4RA 3FJ5A 2VVKA 5M9OA 3O8VA 2BKDN 4EMGA 2ZPBB 2KT8A 5CQXA 4PJLA 2ZZDA 4OGEA 1TXQA 2PQWA 1PKSA 1Q82C 1NE8A 1BKBA 4FL6A 4OP0A
chains in the Genus database with same CATH topology
1UGVA 4D8DA 3R6NA 2JMCA 1MV0B 1VA7A 2EW3A 1KSWA 4ESRA 2DA9A 2JM9A 1ABOA 1AD5A 4CC3A 2EYZA 1I1JA 2CT4A 2LQWA 1AVZC 1UJ0A 4GBQA 2L3PA 1X6BA 2D1XA 2EQIA 4CC2A 1J3TA 1WXTA 3M0RA 1T3SA 2NUZA 1HJDA 2IIMA 2KBTA 3I5RA 2L3QA 4J9GA 2L3SA 2AZVA 4GLMA 1OEBA 2GGRA 2OI3A 2LJ3A 2K9GA 3CQTA 1KJWA 2K3BA 3EG1A 1WLPB 4OMNA 2MCNA 1TUCA 1SSHA 2KEAA 3REBB 4JJCA 1QCFA 2JTEA 2YDLA 4J9CA 1OPKA 1GFDA 2DE0X 3SHWA 4A63B 2D8JA 5IXFA 1ZSGA 1WXBA 2O2OA 2LJ1A 1AZGB 1QKXA 1M3BA 3EHRA 1WDXA 2W0ZA 2B86A 2M0YA 2K2MA 2RQVA 3EG2A 2CSIA 1NLPC 2RNAA 3ZL7C 4RTVA 2KE9A 1M3CA 1VYUA 3REAB 2YUNA 2KRNA 1X69A 1U5SA 1SHGA 1AZEA 1ZLMA 4Z8AA 1XOVA 1AEYA 1UHFA 2KYBA 1SEMA 1SRLA 2PTKA 4AFSC 2HEQA 2H8HA 2J6OA 1B3QA 3M0PA 1WXUA 2DLPA 2DYBA 1AWOA 2ABLA 4AFUC 5IH2A 4LUEA 1YN8A 2RPNA 3O5ZA 2PNIA 1UFFA 2FPDA 4F17A 1JXMA 2D8HA 1HD3A 2MIOA 4JZ3A 2BZYA 2ED1A 4RTXA 1VYTA 3RBBB 1EFNA 2DL8A 2BZXA 1OV3A 2C0IA 1E7OA 1WA7A 4E6RA 2RMOA 2W10A 1UDLA 1OPLA 1WIEA 2GTJA 3UATA 2OJ2A 1UE9A 4DEXA 1V1CA 2CDTA 2GNCA 1K76A 1Y57A 4DEYA 3TVTA 4RTYA 4M4ZA 1B07A 2LX7A 2LMJA 1GBRA 4K11A 5IHKA 2CT3A 2CUDA 2E5KA 4IIMA 2RF0A 4CC4B 5FWBA 2DL3A 2J06A 3VRZA 2LP5A 1Z9QA 2RQTA 2F2VA 4J9HA 2LJ0A 2FRYA 2C0OA 2JW4A 2LZ6B 1CKAA 2D0NA 1U3OA 2V1QA 3NPFA 1NLOC 2JM8A 2K7AA 2O9VA 4OMPA 1BBZA 2L0AA 1X2KA 2EKHA 4RTWA 2A37A 2PZ1A 1E6GA 2ROLA 1JXOA 2KR3A 1PNJA 2YUOA 2G6FX 1U06A 2DX1A 2DL4A 2VWFA 4QT7A 1H3HA 2LCSA 2CREA 1W70A 2A28A 2YT6A 2K79A 4LUDA 4AG1C 2LQNA 1ARKA 3EGUA 1UECA 2KNBB 2KRSA 2RQRA 1G2BA 3TSZA 4RTZA 4AG2C 3C0CA 3VS6A 4OMMA 1QWFA 1UG1A 2M51A 3VS7A 1PRLC 2DRMA 2OAWA 4F16A 2YUPA 4Z89A 1GBQA 2QDLA 1GCQC 1SHFA 2EYWA 1TUDA 1WYXA 1NM7A 1X27A 2GQIA 2CUBA 2KGTA 1NYFA 1AWXA 5EC7A 2DL5A 2YUQA 5IHIA 3VS5A 4AFQC 2EGAA 1T0HA 1ZUKA 2KYMA 3EG0A 2JT4A 2EGEA 4X1VA 1JEGA 1S1NA 1YCSB 3ULRB 3M0QA 2KROA 3JV3A 4RUGA 4OMQA 3PVQA 1MUZA 1RLPC 4FSSA 4J9BA 2FRWA 1GCPA 1GL5A 3VS2A 3NHNA 3UA7A 1SRMA 2O9SA 1M27C 3NMZC 4EIKA 2HSPA 1X2QA 2I0NA 4KRTA 2DBKA 1K1ZA 2SRCA 1PRMC 3EHQA 2KT1A 3I5SA 1AWWA 2VKNA 4WCIA 1UTIA 1HSQA 4IIOA 1GFCA 1ZUUA 4J9FA 2CSQA 4HVVA 1I0CA 1BU1A 2DILA 2X3XD 2DVJA 4RTUA 3THKA 1AWJA 2LNHB 3VS3A 4HCKA 2FPEA 1QWEA 5GJWB 2AK5A 2EPDA 3PE0A 3U23A 1QKWA 2AZSA 1KIKA 1X6GA 4JPBW 1H92A 2EYYA 1RLQC 2ESWA 1QLYA 4RTTA 2ED0A 4Y92A 1NYGA 4HVUA 1JO8A 3QWYA 4OMLA 2JS0A 1E6HA 3NGPA 2V1RA 1G83A 2X3WD 4ORZA 2EVRA 1RUWA 2DF6A 5I11A 3I35A 3VS4A 3H0HA 4HXJA 1UHCA 3IQLA 2EGCA 2J05A 2YSQA 2FPFA 1JQQA 2HBWA 4JJBA 1YWPA 1IO6A 2NWMA 2RN8A 2GBQA 5L23A 2DRKA 2L2PA 2CH4W 2ECZA 1NEGA 4JZ4A 3M0TA 4R0KA 1K9AA 3LH5A 4LN2A 4J9DA 3TSWA 2AKLA 1Z9ZA 2FG0A 4ZNXA 1BB9A 1K0XA 1UJYA 2KRMA 5ECAA 2JXBA 3KFVA 1PHTA 1YP5A 2GTOA 4D8KA 1NG2A 4LE9A 1FMKA 2DMOA 5FWCA 5GJVB 2JMAA 2ROTA 2HCKA 2MOXA 4LNPA 1A0NB 1OOTA 1PKTA 1W6XA 2DL7A 2XMFA 1M8MA 1AOJA 4J9EA 5I22A 1K0SA 2EYXA 3UF4A 5IXBA 1M3AA 2BTTA 4OMOA 1T3LA 3H41A 1TG0A 3UA6A 2FEIA 2C0TA 1K4US 2AKKA 1ZUYA 4HVWA 3M0UA 2KXDA 3PVLA 1T0JA 1ZX6A 2BZ8A 4Z88A 4AFZC 2JS2A 2RQWA 4F14A 1KFZA 2J6KA 1GCQA 1GRIA 1YWOA 1WX6A 1PWTA 3A98A 1YNZA 2J6FA 2FO0A 2J7IA 1UUEA 3SEMA 3QWXX 1CKBA 3RNJA 2F2WA 1N5ZA 2DNUA 1I07A 1W1FA 1CSKA 5HCKA 2A08A 2O31A 2CH4A 2K6DA 1WI7A 5IHNA 3VS1A 3H0IA 2DM1A 2DJQA 3VRYA 3EG3A 1BK2A 4JJDA 2HDAA 1ABQA 2ENMA 2P4RA 1VYVA 2EBPA 2KXCA 1H8KA 4CC7A 3FJ5A 3VS0A 2VVKA 3I9QA 2O88A 1RI9A 1MV3A 1X43A 2KT8A 2A36A 1SPKA 1LCKA 1ZBJA 1JU5C 3H0FA 1M30A 1NEBA 1PKSA 2RQUA 2DBMA 2SEMA 2F2XA 3M0SA 4J9IA 1Y0MA 1FYNA 3GBQA 5FW9A 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGV A;  4D8D A;  3R6N A;  2JMC A;  1MV0 B;  1VA7 A;  2EW3 A;  1KSW A;  4ESR A;  2DA9 A;  2JM9 A;  1ABO A;  1AD5 A;  4CC3 A;  2EYZ A;  1I1J A;  2CT4 A;  2LQW A;  1AVZ C;  1UJ0 A;  4GBQ A;  2L3P A;  1X6B A;  2D1X A;  2EQI A;  4CC2 A;  1J3T A;  1WXT A;  3M0R A;  1T3S A;  2NUZ A;  1HJD A;  2IIM A;  2KBT A;  3I5R A;  2L3Q A;  4J9G A;  2L3S A;  2AZV A;  4GLM A;  1OEB A;  2GGR A;  2OI3 A;  2LJ3 A;  2K9G A;  3CQT A;  1KJW A;  2K3B A;  3EG1 A;  1WLP B;  4OMN A;  2MCN A;  1TUC A;  1SSH A;  2KEA A;  3REB B;  4JJC A;  1QCF A;  2JTE A;  2YDL A;  4J9C A;  1OPK A;  1GFD A;  2DE0 X;  3SHW A;  4A63 B;  2D8J A;  5IXF A;  1ZSG A;  1WXB A;  2O2O A;  2LJ1 A;  1AZG B;  1QKX A;  1M3B A;  3EHR A;  1WDX A;  2W0Z A;  2B86 A;  2M0Y A;  2K2M A;  2RQV A;  3EG2 A;  2CSI A;  1NLP C;  2RNA A;  3ZL7 C;  4RTV A;  2KE9 A;  1M3C A;  1VYU A;  3REA B;  2YUN A;  2KRN A;  1X69 A;  1U5S A;  1SHG A;  1AZE A;  1ZLM A;  4Z8A A;  1XOV A;  1AEY A;  1UHF A;  2KYB A;  1SEM A;  1SRL A;  2PTK A;  4AFS C;  2HEQ A;  2H8H A;  2J6O A;  1B3Q A;  3M0P A;  1WXU A;  2DLP A;  2DYB A;  1AWO A;  2ABL A;  4AFU C;  5IH2 A;  4LUE A;  1YN8 A;  2RPN A;  3O5Z A;  2PNI A;  1UFF A;  2FPD A;  4F17 A;  1JXM A;  2D8H A;  1HD3 A;  2MIO A;  4JZ3 A;  2BZY A;  2ED1 A;  4RTX A;  1VYT A;  3RBB B;  1EFN A;  2DL8 A;  2BZX A;  1OV3 A;  2C0I A;  1E7O A;  1WA7 A;  4E6R A;  2RMO A;  2W10 A;  1UDL A;  1OPL A;  1WIE A;  2GTJ A;  3UAT A;  2OJ2 A;  1UE9 A;  4DEX A;  1V1C A;  2CDT A;  2GNC A;  1K76 A;  1Y57 A;  4DEY A;  3TVT A;  4RTY A;  4M4Z A;  1B07 A;  2LX7 A;  2LMJ A;  1GBR A;  4K11 A;  5IHK A;  2CT3 A;  2CUD A;  2E5K A;  4IIM A;  2RF0 A;  4CC4 B;  5FWB A;  2DL3 A;  2J06 A;  3VRZ A;  2LP5 A;  1Z9Q A;  2RQT A;  2F2V A;  4J9H A;  2LJ0 A;  2FRY A;  2C0O A;  2JW4 A;  2LZ6 B;  1CKA A;  2D0N A;  1U3O A;  2V1Q A;  3NPF A;  1NLO C;  2JM8 A;  2K7A A;  2O9V A;  4OMP A;  1BBZ A;  2L0A A;  1X2K A;  2EKH A;  4RTW A;  2A37 A;  2PZ1 A;  1E6G A;  2ROL A;  1JXO A;  2KR3 A;  1PNJ A;  2YUO A;  2G6F X;  1U06 A;  2DX1 A;  2DL4 A;  2VWF A;  4QT7 A;  1H3H A;  2LCS A;  2CRE A;  1W70 A;  2A28 A;  2YT6 A;  2K79 A;  4LUD A;  4AG1 C;  2LQN A;  1ARK A;  3EGU A;  1UEC A;  2KNB B;  2KRS A;  2RQR A;  1G2B A;  3TSZ A;  4RTZ A;  4AG2 C;  3C0C A;  3VS6 A;  4OMM A;  1QWF A;  1UG1 A;  2M51 A;  3VS7 A;  1PRL C;  2DRM A;  2OAW A;  4F16 A;  2YUP A;  4Z89 A;  1GBQ A;  2QDL A;  1GCQ C;  1SHF A;  2EYW A;  1TUD A;  1WYX A;  1NM7 A;  1X27 A;  2GQI A;  2CUB A;  2KGT A;  1NYF A;  1AWX A;  5EC7 A;  2DL5 A;  2YUQ A;  5IHI A;  3VS5 A;  4AFQ C;  2EGA A;  1T0H A;  1ZUK A;  2KYM A;  3EG0 A;  2JT4 A;  2EGE A;  4X1V A;  1JEG A;  1S1N A;  1YCS B;  3ULR B;  3M0Q A;  2KRO A;  3JV3 A;  4RUG A;  4OMQ A;  3PVQ A;  1MUZ A;  1RLP C;  4FSS A;  4J9B A;  2FRW A;  1GCP A;  1GL5 A;  3VS2 A;  3NHN A;  3UA7 A;  1SRM A;  2O9S A;  1M27 C;  3NMZ C;  4EIK A;  2HSP A;  1X2Q A;  2I0N A;  4KRT A;  2DBK A;  1K1Z A;  2SRC A;  1PRM C;  3EHQ A;  2KT1 A;  3I5S A;  1AWW A;  2VKN A;  4WCI A;  1UTI A;  1HSQ A;  4IIO A;  1GFC A;  1ZUU A;  4J9F A;  2CSQ A;  4HVV A;  1I0C A;  1BU1 A;  2DIL A;  2X3X D;  2DVJ A;  4RTU A;  3THK A;  1AWJ A;  2LNH B;  3VS3 A;  4HCK A;  2FPE A;  1QWE A;  5GJW B;  2AK5 A;  2EPD A;  3PE0 A;  3U23 A;  1QKW A;  2AZS A;  1KIK A;  1X6G A;  4JPB W;  1H92 A;  2EYY A;  1RLQ C;  2ESW A;  1QLY A;  4RTT A;  2ED0 A;  4Y92 A;  1NYG A;  4HVU A;  1JO8 A;  3QWY A;  4OML A;  2JS0 A;  1E6H A;  3NGP A;  2V1R A;  1G83 A;  2X3W D;  4ORZ A;  2EVR A;  1RUW A;  2DF6 A;  5I11 A;  3I35 A;  3VS4 A;  3H0H A;  4HXJ A;  1UHC A;  3IQL A;  2EGC A;  2J05 A;  2YSQ A;  2FPF A;  1JQQ A;  2HBW A;  4JJB A;  1YWP A;  1IO6 A;  2NWM A;  2RN8 A;  2GBQ A;  5L23 A;  2DRK A;  2L2P A;  2CH4 W;  2ECZ A;  1NEG A;  4JZ4 A;  3M0T A;  4R0K A;  1K9A A;  3LH5 A;  4LN2 A;  4J9D A;  3TSW A;  2AKL A;  1Z9Z A;  2FG0 A;  4ZNX A;  1BB9 A;  1K0X A;  1UJY A;  2KRM A;  5ECA A;  2JXB A;  3KFV A;  1PHT A;  1YP5 A;  2GTO A;  4D8K A;  1NG2 A;  4LE9 A;  1FMK A;  2DMO A;  5FWC A;  5GJV B;  2JMA A;  2ROT A;  2HCK A;  2MOX A;  4LNP A;  1A0N B;  1OOT A;  1PKT A;  1W6X A;  2DL7 A;  2XMF A;  1M8M A;  1AOJ A;  4J9E A;  5I22 A;  1K0S A;  2EYX A;  3UF4 A;  5IXB A;  1M3A A;  2BTT A;  4OMO A;  1T3L A;  3H41 A;  1TG0 A;  3UA6 A;  2FEI A;  2C0T A;  1K4U S;  2AKK A;  1ZUY A;  4HVW A;  3M0U A;  2KXD A;  3PVL A;  1T0J A;  1ZX6 A;  2BZ8 A;  4Z88 A;  4AFZ C;  2JS2 A;  2RQW A;  4F14 A;  1KFZ A;  2J6K A;  1GCQ A;  1GRI A;  1YWO A;  1WX6 A;  1PWT A;  3A98 A;  1YNZ A;  2J6F A;  2FO0 A;  2J7I A;  1UUE A;  3SEM A;  3QWX X;  1CKB A;  3RNJ A;  2F2W A;  1N5Z A;  2DNU A;  1I07 A;  1W1F A;  1CSK A;  5HCK A;  2A08 A;  2O31 A;  2CH4 A;  2K6D A;  1WI7 A;  5IHN A;  3VS1 A;  3H0I A;  2DM1 A;  2DJQ A;  3VRY A;  3EG3 A;  1BK2 A;  4JJD A;  2HDA A;  1ABQ A;  2ENM A;  2P4R A;  1VYV A;  2EBP A;  2KXC A;  1H8K A;  4CC7 A;  3FJ5 A;  3VS0 A;  2VVK A;  3I9Q A;  2O88 A;  1RI9 A;  1MV3 A;  1X43 A;  2KT8 A;  2A36 A;  1SPK A;  1LCK A;  1ZBJ A;  1JU5 C;  3H0F A;  1M30 A;  1NEB A;  1PKS A;  2RQU A;  2DBM A;  2SEM A;  2F2X A;  3M0S A;  4J9I A;  1Y0M A;  1FYN A;  3GBQ A;  5FW9 A;  1WFW A; 
#chains in the Genus database with same CATH topology
 1UGV A;  2CZ6 B;  3S3M A;  2K5L A;  1I5L A;  2X4X A;  1N9S A;  3UWN A;  1VA7 A;  2EW3 A;  4DOV A;  5GAN 7;  2D6F A;  1IB8 A;  2DA9 A;  5DLQ E;  3JCM b;  1ABO A;  3QZ9 B;  1WHH A;  1BCM A;  1PCX A;  2MMP A;  2E4H A;  3FRN A;  1VQO T;  1ZBX A;  1IHW A;  5GAO n;  1D1B A;  3SD4 A;  2EYZ A;  1K73 C;  4MDX A;  2LQW A;  1MMD A;  1UJ0 A;  4CRI A;  1J3T A;  4M78 A;  2H3E B;  4FW1 A;  1WXT A;  5CR2 A;  2YLC A;  2NUZ A;  2LX9 A;  3JCM g;  4JRK A;  2L3S A;  3BFM A;  5LJ3 d;  1V29 B;  2ZPE B;  1W2B P;  3CCS Q;  3JCM P;  2ZPG B;  3CQT A;  4PFP A;  3RKX A;  3GLX A;  3M9Q A;  1UB4 A;  2K3B A;  2E70 A;  1WLP B;  2IPO B;  4OMN A;  1TUC A;  2KEA A;  3ER0 A;  4JJC A;  2YDL A;  4IUT A;  1OPK A;  3MET A;  5LJ3 j;  3SHW A;  1EX4 A;  1KK7 A;  3S3O A;  4EMK B;  2O2O A;  2HL5 C;  2W0Z A;  5KYU B;  3TEE A;  2RNA A;  4RTV A;  4F7U F;  3REA B;  4J6W A;  2VB6 A;  1EZZ B;  2KRN A;  3CC4 Q;  2BUD A;  2E12 A;  1W4S A;  2YXY A;  1VOM A;  5HKC A;  1AEY A;  5GAM e;  2PTK A;  5KYW B;  2QQR A;  5A0D A;  1LVK A;  1N8R C;  2J6O A;  3M0P A;  3QII A;  1D09 B;  3MHX A;  1X01 A;  2DLP A;  5A0G A;  2XK0 A;  1OQK A;  1AWO A;  4AFU C;  2A7Y A;  4LUE A;  2DEQ A;  3O5Z A;  2FVU A;  4A4F A;  2MIO A;  4JZ3 A;  4LDW A;  5LJ5 d;  2JTM A;  5GAN e;  2NUP A;  3RBB B;  1KQS A;  2RJF A;  1EFN A;  2O4X B;  3CPW P;  2B8A A;  2BZX A;  3FDR A;  3I56 Q;  4BAC A;  2DTO A;  2EFI A;  4FW2 A;  4HCB A;  3CXC S;  1UDL A;  1OPL A;  1Q7Y C;  4PK4 A;  3FEO A;  2GTJ A;  2FL7 A;  4MML A;  5J39 A;  4PJO C;  2OJ2 A;  4BDY A;  2IVW A;  2CP3 A;  3BDU A;  3CEY A;  1PC0 A;  2E41 A;  2CDT A;  3J80 E;  1D3B B;  3CCE Q;  1TS9 A;  4DEY A;  3TVT A;  1RAF B;  1UGR B;  4C0G A;  4J6X A;  1B07 A;  1GBR A;  2EQJ A;  4OF1 A;  2CUD A;  2HMA A;  3CCR T;  2RF0 A;  5LJ5 f;  1RAC B;  3JCM d;  4PJO D;  3FB9 A;  1M5Q 1;  2YRV A;  2LP5 A;  1U1T A;  2HAX A;  5LJ5 h;  1VQ6 A;  2FRY A;  2C0O A;  4J83 A;  3QUI A;  2JW4 A;  2D0N A;  1OU9 A;  3MP6 A;  2V1Q A;  1OZ3 A;  2K7A A;  3CC2 T;  1X2K A;  5KCH A;  1JXO A;  2V8K A;  1QCN A;  1PNJ A;  2F5K A;  2KR3 A;  2YUO A;  2DX1 A;  2DL4 A;  4J5Y A;  2E65 A;  2FZK B;  2VWF A;  4QT7 A;  4KH0 B;  4QQ6 A;  4M77 C;  3BE3 A;  3V8J A;  5I21 A;  3X28 B;  3CCV A;  3QKJ A;  2KRS A;  2RQR A;  4RKU E;  2XHC A;  2K2V A;  3PNW C;  3C0C A;  3VS6 A;  4C0D B;  5HK3 A;  4OMM A;  4YTL A;  1NJI U;  1M2O A;  3BW1 A;  2KDS A;  2M51 A;  3VYH B;  2ATC B;  1WGS A;  5GAN 5;  5J3B A;  2E3H A;  4F16 A;  4PKC C;  3OYL A;  2DTH A;  3MKD A;  2QDL A;  1VQL Q;  1GCQ C;  3FJP A;  4RCC A;  3TRE A;  1K73 R;  1TUD A;  4KT0 E;  1NM7 A;  5CCA A;  4B9W A;  4KH1 B;  1G3S A;  3OBW A;  4QQG A;  3OYB A;  2CS7 A;  2CP2 A;  1K8A U;  2CP5 A;  3GF5 A;  2JN0 A;  1D1C A;  2JT4 A;  4KBM B;  3OYA A;  3CCM Q;  2EJ9 A;  5KYW A;  3MPU B;  2DXT A;  1RLP C;  4J9B A;  3NTH A;  1GCP A;  1Y7X A;  3VS2 A;  3L1A A;  2O9S A;  1TUG B;  1X2Q A;  2I0N A;  3A8G B;  4KRT A;  2WSE E;  3OW2 P;  1OX8 A;  3EHQ A;  5HK0 A;  1AWW A;  2VKN A;  1FWZ A;  3S6W A;  4WCI A;  1YBY A;  1TTH B;  2O4X A;  1VUB A;  2DIL A;  1BU1 A;  3EGX A;  4RTU A;  2LRQ A;  5KYX A;  1IXD A;  3HPW A;  1O75 A;  3DB3 A;  3PE0 A;  3OYC A;  1JJ2 S;  2QEX T;  4M7D F;  1KQ1 A;  4D6W A;  3CCR A;  1ZA2 B;  1QLY A;  4XTY A;  3CC2 Q;  2E5Q A;  2JJ9 A;  2QQ9 A;  4M7A D;  5GAN d;  3CCV T;  2JS0 A;  1E6H A;  2KI7 A;  1I81 A;  2X3W D;  3EFO B;  3OMC A;  4ORZ A;  2DF6 A;  4M77 E;  4QKU A;  3PMT A;  5LL6 S;  1WJQ A;  1VQ4 A;  1VQN A;  3DB4 A;  2RA2 A;  2M02 A;  2VGM A;  1YWP A;  1IO6 A;  2NWM A;  3MEA A;  4IUR A;  2CH4 W;  2L2P A;  5FU6 C;  2KY9 A;  4C92 C;  3LH5 A;  4C5E A;  3L42 A;  1M90 R;  2MI6 A;  4F7U B;  3ZEH A;  1Z9Z A;  5LJ3 g;  2X4J A;  4QVD A;  2V8J A;  1XTD A;  1KC8 C;  4DA4 A;  3DLM A;  2X4W A;  3EFR A;  5FWC A;  5GJV B;  1H64 1;  2ROT A;  2HCK A;  2MOX A;  3FIF A;  3CC7 T;  1W6X A;  1M2V B;  2DL7 A;  4E2F B;  4E7J A;  3CMA A;  2L8D A;  2K3Y A;  4PLI A;  2HQH A;  2FZG B;  3H41 A;  1QP2 A;  1BI1 A;  1B7T A;  2FEI A;  2IG0 A;  1VIF A;  1WPY A;  4EMK C;  1YHQ A;  3LWH A;  5A0L A;  3GP8 A;  4N0A A;  1MGQ A;  2RHI A;  2CZ0 B;  4ZGD B;  2QQS A;  3EGD A;  2LVM A;  1KHC A;  3OW2 A;  4ELZ C;  1C1A A;  1VQO A;  4BE0 A;  3RKW A;  4EMK A;  3MEU A;  4KUI A;  1M9S A;  1I07 A;  1W1F A;  3JCM X;  1CSK A;  1D0X A;  3G71 A;  4F04 B;  2K6D A;  4FYX B;  1WI7 A;  3LWI A;  1QVG P;  1QCO A;  1N6A A;  2DJQ A;  2R58 A;  5CKH A;  1M2V A;  5GMK i;  4M7A A;  2EBP A;  2KXC A;  3RKY A;  3VKI A;  3VS0 A;  3WXM B;  1RI9 A;  4OB3 B;  2PVO B;  1X43 A;  2NUP B;  4V2S A;  3MJX A;  1BIA A;  3CC4 T;  1SPK A;  1KD1 U;  4C0F A;  3H0F A;  3JCM f;  4RCB A;  1NEB A;  1VQP A;  2RQU A;  2DBM A;  3M0S A;  1Y0M A;  1Q86 U;  1QVG S;  3OYI A;  5FW9 A;  2MPX C;  3G6E A;  1LPL A;  1WFW A;  1HYO A;  5FRM A;  2Y4X A;  4PFO A;  1M1K U;  3A1P A;  2K57 A;  3SWN C;  1Q7Y U;  3R6N A;  2XG8 D;  2JMC A;  2VV5 A;  1M1K R;  1NBE B;  4M78 C;  4M7A E;  1OUL A;  2HQX A;  3MEW A;  1X6O A;  2V8I A;  1YJ9 Q;  1NPR A;  2JM9 A;  4FCY A;  1QMC A;  1RL2 A;  3CCJ Q;  3P8D A;  1SKU B;  4WTO B;  2LQK A;  2KSS A;  4M7A G;  1BYM A;  2RJE A;  4J7I A;  4PLL A;  2BE9 B;  3CCU A;  3I55 Q;  2JVV A;  1VQN Q;  2CT4 A;  1M1F A;  1AVZ C;  1C0M A;  5GAO r;  1X6B A;  2D1X A;  2EQI A;  4JLI A;  1IZ6 A;  3QPH A;  5KCO A;  1WHG A;  3M0R A;  1HJD A;  5GAN 2;  2IIM A;  2KBT A;  3I5R A;  3QXE B;  4J9G A;  5D6W A;  1YJN T;  1OEB A;  5CK9 A;  2RJD A;  4A4H A;  4KUD K;  2OI3 A;  2LJ3 A;  2EIF A;  4MDW A;  2P0Q A;  1SSH A;  1Y07 A;  1K73 U;  2DK3 A;  1GFD A;  2K3X A;  3D7S B;  4B6M A;  3MCA B;  1VQ7 T;  1YJN Q;  3HRT A;  3NTI A;  2OAU A;  1QVF A;  2KQW A;  1QKX A;  2EJF A;  1M3B A;  2B86 A;  3OA6 A;  2RHU A;  4LDX A;  3C95 A;  5FRN A;  3FLG A;  3CCL Q;  3OYM A;  3ZL7 C;  3CC7 A;  2NLU A;  2H3J A;  4O6J A;  1R8O B;  3JAM E;  4M78 B;  1BI0 A;  1ZLM A;  4FYV B;  1XOV A;  1MMN A;  2F5T X;  2FB7 A;  2P4T A;  1B3Q A;  2DTI A;  2CKK A;  4M7D A;  3OSS C;  3M57 A;  1WJS A;  2JOY A;  1Q7Y R;  2R57 A;  2PNI A;  3OYJ A;  2WAC A;  1JXM A;  1OYX A;  4XTX A;  1YI2 T;  2MWO A;  2AIR B;  1IGQ A;  1LOJ A;  3CMA T;  1QVP A;  4RTX A;  4KGZ B;  1PSE A;  5C0M A;  2QA4 Q;  1OV3 A;  4MZP A;  1AT1 B;  3A5Z B;  1QVF S;  1I4K 1;  3M54 A;  2X35 A;  3UAT A;  1U8R A;  4DEX A;  1BIB A;  2QDY B;  3M4G A;  3ZFJ A;  3PIP A;  1WNL A;  5GAN 4;  1K76 A;  4BE2 A;  3BDL A;  3SWN A;  3QDR B;  1VQP Q;  1X75 C;  1WHL A;  2LMJ A;  1S72 T;  2PUK B;  5GMK l;  2EWN A;  3OYE A;  3OS5 A;  4CC4 B;  2EJG A;  2DL3 A;  2MF2 A;  2RQT A;  4JUV A;  3OY9 A;  4IUP A;  5CKE A;  1B34 A;  5KE3 A;  1Q81 R;  2LZ6 B;  1CKA A;  1NLO C;  2JM8 A;  4FSX A;  2AHJ B;  2O9V A;  4OMP A;  2V26 A;  4C0D C;  3M59 A;  1RAG B;  2PZ1 A;  4OMF B;  2GFA A;  4BY6 C;  4DBR A;  1KQS S;  2PUO B;  2VXF A;  4ELY C;  3QBY A;  4FM4 B;  2YT6 A;  4C92 B;  2OX7 A;  3EGU A;  3CCQ Q;  2OTJ T;  1YIT T;  3A8H B;  1UG1 A;  4C92 A;  1YJN A;  1PRL C;  3OYH A;  5DLO A;  1KQS P;  1OX9 A;  4Z89 A;  2RI5 A;  5LJ3 f;  5FU7 B;  5CAI A;  3WVE B;  3X25 B;  2CUB A;  4NS5 A;  3E19 A;  1PM3 A;  2DL5 A;  2YUQ A;  3VU3 C;  4C5G A;  2EGA A;  1UGP B;  4X9C A;  2DEU A;  3QO3 A;  1OI1 A;  4X1V A;  1RAD B;  1K9M C;  3JV3 A;  2KMT A;  4RUG A;  1UEB A;  3BY7 A;  3QJY A;  3NHN A;  1ZA1 B;  1SRM A;  3A8O B;  5DY9 A;  3NMZ C;  3RMQ A;  1K1Z A;  1YIJ T;  2RK1 A;  3HSB A;  1PRM C;  3JB9 J;  3CCJ A;  4KUL A;  5LJ3 h;  3T9N A;  1TU0 B;  3PGG A;  1Y96 A;  1ZUU A;  5D7U A;  3RIR A;  4N4G A;  5GAM j;  2DPP B;  3THK A;  3L2U A;  2ZPH B;  3I55 A;  1KG1 A;  5FU7 C;  1PSF A;  4M75 E;  2AK5 A;  2EPD A;  3HRS A;  5GAN j;  1SG5 A;  4M75 F;  4VUB A;  3CC2 A;  2A3L A;  1VQ9 A;  1QKW A;  2LCL A;  2RHX A;  2WSC E;  1YJ9 A;  3CCS T;  4Z02 A;  3EFO A;  3GPL A;  1KD1 C;  1NYG A;  1TSF A;  2BE7 D;  4BY6 B;  3JB9 H;  4MZM A;  4OML A;  3NGP A;  1VQ7 A;  2COZ A;  3G6E T;  1G83 A;  4BI4 A;  3H0H A;  1ZHI A;  1HK9 A;  4Q5W A;  2YSQ A;  4JRQ A;  1TH7 A;  1JQQ A;  1M4Z A;  5L23 A;  2ECZ A;  3M0T A;  1VIE A;  3URG A;  5CO7 A;  3TSW A;  2AKL A;  2FG0 A;  1BB9 A;  4ZTJ A;  4J8O A;  1PHT A;  3G71 Q;  3CXC P;  1Q82 U;  3MO8 A;  2GTO A;  3HRU A;  2DAQ A;  4LE9 A;  2NYS A;  1WQW A;  2DMO A;  3QYH B;  2C06 A;  1PG5 B;  2DZC A;  1LNX A;  2JMA A;  1VQN T;  1D0Y A;  1JJ2 A;  1IGU A;  4LDU A;  4J9E A;  2XU8 A;  2VC8 A;  2HSE B;  3CBO A;  3CMA Q;  2YRC A;  5KYY B;  1T3L A;  3PMI A;  1TG0 A;  3G71 T;  3UA6 A;  2JNG A;  2C0T A;  5GAO l;  1K4U S;  2QQA A;  4E7K A;  1RAI B;  3PVL A;  1YHQ Q;  1ZX6 A;  2MAM A;  5HY6 A;  4AFZ C;  3CME T;  2QYZ A;  3HFO A;  4PL6 A;  1GCQ A;  2YLB A;  1VQ5 Q;  5CKD A;  4L6V 5;  3DKM A;  2FO0 A;  4C8Q E;  2J7I A;  3SEM A;  3OYF A;  3TU4 K;  1R0C B;  2F2W A;  1N5Z A;  2DNU A;  3EGD B;  3JCM Q;  5HCK A;  2QG9 B;  1IRE B;  3QYG B;  3H8Z A;  2DM1 A;  4EPC A;  2M9U A;  1PD1 A;  8AT1 B;  4PJM A;  4RG2 A;  1BK2 A;  4R55 A;  3UPU A;  2HDA A;  1ABQ A;  4HCZ A;  3OBY A;  1VYV A;  1M90 U;  4GY5 A;  4XTZ A;  4ME7 A;  4C92 F;  3I9Q A;  2O88 A;  3CCU Q;  1WHJ A;  1RAB B;  2RH2 A;  2A36 A;  1LCK A;  1JU5 C;  2VGN A;  1YIJ Q;  1K9M U;  3JB9 F;  3MEV A;  3M4Y A;  2FZC B;  3L2W A;  4FT2 A;  3CBP A;  2YWW A;  5C6S A;  1OZ2 A;  4LD6 A;  3L2R A;  2QTX A;  3GNG A;  2M16 A;  4ZN3 A;  4QQD A;  4ESR A;  2FHD A;  7AT1 B;  3JCM W;  4A4K A;  2NUT A;  2P0P A;  1QW1 A;  1MMG A;  2QXF A;  1VQ5 A;  1AD5 A;  4CC3 A;  2HQE A;  3DLL A;  3CCJ T;  1I1J A;  2RM4 A;  1MND A;  4PJO A;  3EAE A;  3PIO A;  3V8K A;  4GBQ A;  2ZPI B;  5I2S A;  4CC2 A;  4C8Q A;  4OB0 B;  2CP0 A;  3CCQ A;  2LNV A;  3CCM A;  2A0F B;  5D6Y A;  1Q86 C;  2L3Q A;  5AYF A;  4M7D D;  2AZV A;  4GLM A;  1I5O B;  2RO0 A;  2GGR A;  5KYN A;  3LGL A;  4E7L A;  4N0A C;  1VQ8 A;  3EG1 A;  1XNI A;  3SWN B;  4M7D G;  4M7D E;  3REB B;  4C8Q F;  2EYQ A;  2DYI A;  1VQ5 T;  1QCF A;  2JTE A;  4GLK A;  1VQL A;  4A63 B;  4P5N A;  2LT4 A;  1PD0 A;  5IXF A;  1ZSG A;  1YHQ T;  3C94 A;  2LJ1 A;  3CPF A;  1FXX A;  3EHR A;  3CME A;  1WDX A;  1B34 B;  3EG2 A;  2RQV A;  2K2M A;  3TCJ A;  5GAN 6;  1NLP C;  3CCV Q;  4IUU A;  4C92 G;  4XU1 A;  1M3C A;  1VYU A;  5GAN h;  5GAO q;  2YUN A;  2YHT A;  1X69 A;  1U5S A;  5GAM f;  4IKF A;  1AZE A;  1G3T A;  3JB9 G;  1ACM B;  1UHF A;  3CCU T;  1VQK T;  2KYB A;  3L2Q A;  1SEM A;  2HEQ A;  2XDB A;  4X34 A;  1WXU A;  2DVE A;  5LJ5 g;  5IH2 A;  2HZY A;  3E1S A;  3SFM A;  3AHU A;  2RPN A;  1UFF A;  3VUB A;  2QA4 A;  4F17 A;  1VQ6 Q;  1VQP T;  1KC8 U;  2ED1 A;  4R56 A;  3A8M B;  1VYT A;  5FLX E;  2C0I A;  3KXT A;  3QG1 A;  2CP7 A;  1WA7 A;  2EKO A;  4E6R A;  2RMO A;  2EQU A;  2W10 A;  4BI3 A;  1Q81 U;  1FX7 A;  3RUX A;  4MMK A;  3JRZ A;  3JCM J;  1UE9 A;  4FIB A;  4WF2 A;  2GFU A;  3EG9 B;  4M75 A;  2NUT B;  3SB2 A;  5CVI A;  3JCM c;  4QVZ A;  2XKO C;  2ZGW A;  4L59 A;  4M4Z A;  3CCR Q;  1Y96 B;  2CP6 A;  3VJP A;  4K11 A;  3CC7 Q;  2CT3 A;  3CCL A;  2MK5 A;  3CCE A;  4M77 D;  4C5I A;  2J06 A;  4JS5 A;  3M56 A;  4C8Q G;  2F2V A;  4ZTF A;  2ZPF B;  4J9H A;  1XJW B;  2LJ0 A;  1I8F A;  3SDZ A;  1U3O A;  3NPF A;  4PJO E;  2HBP A;  4F7U G;  2X9H A;  3OS0 A;  1BBZ A;  2L0A A;  2EKH A;  3C12 A;  2QAZ A;  2A37 A;  3EFS A;  2F69 A;  1XQH A;  1RAE B;  3M53 A;  5FU6 B;  1H3H A;  2LCS A;  2CRE A;  1W70 A;  2A28 A;  2K79 A;  4AMC A;  3S3N A;  4HA8 A;  1ZSZ B;  4M78 D;  2QK0 A;  3LYI A;  1UEC A;  5KYX B;  1HXD A;  1G2B A;  5LJ5 j;  5FRO A;  4JLG A;  9ATC B;  1QWF A;  2VYT A;  1VQM A;  2RB6 A;  3VS7 A;  2E3I A;  2DRM A;  3CD6 T;  2OAW A;  2JUF A;  3R6O A;  3ASK A;  1VQ9 T;  1GBQ A;  3F70 A;  2PU9 B;  2EYW A;  2DFU A;  3Q1J A;  4A4E A;  2GQI A;  3AT1 B;  4JDS A;  1NYF A;  5D6X A;  2LTO A;  1M1K C;  2X4Y A;  4FT4 A;  2EAY A;  5IHI A;  2HL3 A;  3VS5 A;  3HHT B;  4AFQ C;  2RK2 A;  1T0H A;  2KYM A;  1QP3 A;  2DXB A;  2EGE A;  1K8A C;  1S1N A;  4A4G A;  3M0Q A;  3UDC A;  3WVD B;  2KRO A;  1SSF A;  3I55 T;  3QDF A;  4OMQ A;  1U1S A;  3PVQ A;  3KUF A;  2LDM A;  1MUZ A;  4FSS A;  2P84 A;  3N5B B;  1GXI E;  3CXC A;  3RER A;  1V76 A;  1M27 C;  3OYD A;  2HSP A;  3CCS A;  3JCM e;  4BDZ A;  3RR6 A;  1YJ9 T;  2SRC A;  4N4I A;  2WSF E;  4LDY A;  4OB1 B;  4RMO A;  4XU3 A;  1O9S A;  2X51 A;  1UTI A;  4IIO A;  2RJC A;  4Y28 E;  2KAF A;  1UGS B;  3X26 B;  4J9F A;  1TOV A;  2DVJ A;  1QVG A;  4HCK A;  2DJZ A;  1QWE A;  3C4S A;  5CKB A;  4QVC A;  3U23 A;  1KIK A;  4QW2 A;  4PNO A;  1H92 A;  4XTV A;  4M7D B;  1RLQ C;  4E7S A;  4RTT A;  4F7U E;  3RMS A;  1KHI A;  1RAH B;  3G7Z A;  2DIG A;  2ED0 A;  3L2V A;  4HVU A;  1BI2 A;  4E7I A;  4PJO F;  1JO8 A;  3VV0 A;  2DD4 A;  2V1R A;  3E2U A;  4F7U A;  2P0K A;  1RUW A;  5I11 A;  5GAM g;  3I35 A;  3VS4 A;  2VXE A;  4IUQ A;  1YIT A;  3PFS A;  3IQL A;  1KD1 R;  5AT1 B;  4MZT A;  2HBW A;  4JJB A;  2GBQ A;  3OW2 S;  2DRK A;  4LXC A;  1NEG A;  4R0K A;  1K9A A;  5LJ5 e;  4LN2 A;  5KYU A;  5GAN g;  1K0X A;  1G8X A;  3HKS A;  2XDP A;  1AHJ B;  1JB0 E;  1YP5 A;  4D8K A;  4M78 E;  4M7A C;  4E47 A;  4M75 C;  4PJO B;  3J81 E;  5GAM d;  1PKT A;  1M8M A;  1YFN A;  1AOJ A;  5I22 A;  1K0S A;  2EYX A;  1EIF A;  4HKE A;  5IXB A;  1M3A A;  2K4Y A;  4OMO A;  3EG9 A;  5GMK h;  3JB9 I;  4X9D A;  3V7S A;  2AKK A;  2K5I A;  3GIB A;  3M0U A;  1Q86 R;  2CZ7 B;  2BZ8 A;  2R5M A;  1VQK Q;  2JS2 A;  3H6Z A;  1G3W A;  5GAN 8;  1SF9 A;  2RQW A;  1VQM T;  2J6K A;  2JZ2 A;  1GRI A;  1YWO A;  3A98 A;  3X24 B;  2KVQ G;  1YNZ A;  2J6F A;  3QWX X;  1CKB A;  1YCY A;  2FYK A;  3QZ5 B;  1S72 Q;  2DD5 A;  3LH0 A;  1JRI A;  2O31 A;  2QAS A;  1FMV A;  4PJJ A;  4EMH A;  2QTV A;  2ZCF B;  3OQ5 A;  3G6E Q;  5J26 A;  3EG3 A;  3RES A;  4CC7 A;  1H8K A;  1MV3 A;  2MWP A;  1M1G A;  6AT1 B;  5KE2 A;  1ZBJ A;  1VQ8 T;  1M30 A;  4J9I A;  2K5F A;  2F2X A;  2SEM A;  2DER A;  3QJ6 A;  3UT1 A;  1FYN A;  4HT9 A;  3GBQ A;  5DM7 R;  1N27 A;  1KC8 R;  1BCO A;  2M1H A;  1P92 A;  3MP8 A;  3X20 B;  2DXU A;  3CCM T;  2HD0 A;  3HTR A;  4D8D A;  5CQY A;  2XD0 A;  2OTL T;  3HL8 A;  1MV0 B;  4ZGJ B;  1VQ4 T;  1KSW A;  4FYY B;  1VQO Q;  2GQV A;  4II1 A;  4XK8 E;  5GAN f;  4XTW A;  4N4H A;  2F1L A;  4XTU A;  3CPW S;  1LJO A;  3M58 A;  4OVA A;  2L3P A;  2COW A;  1QQJ A;  3PTA A;  8ATC B;  4NL2 A;  1T3S A;  4ANJ A;  1WQ7 A;  4KGV B;  1BI3 A;  4EDU A;  1R0B G;  2QGG A;  4M75 B;  2E10 A;  4OB2 B;  4M7A B;  2QEX Q;  1WJR A;  2K9G A;  4Y91 A;  1KJW A;  2MCN A;  3CD6 Q;  3OMG A;  1IRX A;  3A8L B;  1H3Z A;  1D3B A;  4J9C A;  5GMK m;  2DE0 X;  2R5A A;  3ZBD A;  2D8J A;  1QVF P;  1MHN A;  1WXB A;  4J7F A;  2QI2 A;  3CCQ T;  1AZG B;  3EH2 A;  2M0Y A;  2JTF A;  1N8R R;  2CSI A;  4RG8 A;  1ZQ1 A;  3ME9 A;  1F1B B;  2E64 A;  3RDV A;  2KK4 A;  4XQ3 A;  2LT1 A;  3G4S A;  2KE9 A;  4XAX B;  1VQ4 Q;  1SHG A;  2GCX A;  3QHS A;  1D1A A;  4BD3 A;  4Z8A A;  2G3R A;  1NJI R;  2RI2 A;  2OTL Q;  3E9G A;  1SRL A;  4AFS C;  4BE1 A;  1WZO A;  1YJW T;  2H8H A;  1YJW Q;  1MNE A;  1W2B S;  2DYB A;  2ABL A;  3CME Q;  1YN8 A;  5I2M A;  3H9N A;  2QGF B;  3GOX A;  5EG2 A;  3JCM V;  4E7Z A;  3I56 A;  3MP1 A;  4M77 A;  2FPD A;  2D8H A;  1HD3 A;  1KQ2 A;  3JCM h;  4M7A F;  2BZY A;  3G1J A;  4M78 G;  2DL8 A;  1VQ8 Q;  5GAN 3;  1K9M R;  2BIV A;  4FU6 A;  1E7O A;  1K8A R;  1WHM A;  2E6Z A;  1WIE A;  1N9R A;  4A54 A;  1VQM Q;  4PJN A;  4DBQ A;  3P8H A;  3JSC A;  2GF7 A;  1V1C A;  2DZ9 A;  2LQ8 A;  4XU0 A;  2GNC A;  1Y57 A;  4RTY A;  4ZN1 A;  3OYK A;  3PT9 A;  3CC4 A;  1R77 A;  2LX7 A;  4HT8 A;  5IHK A;  4JJN K;  2E5K A;  4IIM A;  5FWB A;  2O01 E;  3VRZ A;  1NPP A;  1Z9Q A;  3P8B B;  2Y90 A;  5L8R E;  1IHV A;  2HNI A;  1Q81 C;  3JB9 D;  3HFN A;  2RD1 A;  2EQM A;  2DKG A;  4TVR A;  3OSV A;  4RTW A;  2AT1 B;  1E6G A;  2ROL A;  4XU2 A;  1WHK A;  3OS1 A;  2G6F X;  1U06 A;  4ATO A;  4M75 G;  2RHZ A;  3LGF A;  1YIJ A;  2E6N A;  3CCE T;  1YI2 Q;  4LUD A;  4AG1 C;  2QQB A;  2DXC A;  2LQN A;  4AT1 B;  3J7A F;  1ARK A;  2I2L A;  1YJW A;  1N8R U;  2L89 A;  2KNB B;  1G3Y A;  3LX7 A;  1VQK A;  3TSZ A;  4RTZ A;  2MYS A;  5IAY A;  4AG2 C;  2RHY A;  2OTL A;  1MMA A;  3I56 T;  3GNF B;  2YUP A;  5CIU A;  4DBF A;  1SHF A;  1WYX A;  4OGC A;  1X27 A;  2KGT A;  5LJ3 e;  3KBG A;  5IN1 A;  2RI3 A;  1JJ2 P;  4M78 F;  1AWX A;  5A2Q E;  5GMK e;  4PFZ A;  3L2Z A;  5EC7 A;  5GAM h;  4JS4 A;  1ZUK A;  3EG0 A;  1JEG A;  1YCS B;  3E9F A;  3ULR B;  4C8Q D;  1TWB A;  4M77 G;  4CI0 C;  3FC3 A;  1JBM A;  2E1H A;  3OYG A;  2FRW A;  3CD6 A;  1GL5 A;  1YI2 A;  4BUG A;  3UA7 A;  4EIK A;  2QEX A;  3M55 A;  2DBK A;  3V8L A;  2XI9 A;  3VUZ A;  3OYN A;  2COY A;  1D0Z A;  2KT1 A;  3I5S A;  1YIT Q;  3EH1 A;  1HSQ A;  4M7D C;  1GFC A;  2Y4Y A;  2CSQ A;  4HVV A;  1I0C A;  2X3X D;  1OU8 A;  4BI8 B;  1AWJ A;  2LNH B;  1W2B A;  4JRP A;  1Q95 G;  3VS3 A;  1ZSZ A;  2FPE A;  5GJW B;  2DIQ A;  4BB7 A;  2PVD B;  2AZS A;  2LC4 A;  4FYW B;  4IUV A;  4C8Q C;  1X6G A;  4JPB W;  2EYY A;  2ESW A;  4C0Z A;  4PJO G;  3NFC A;  4M75 D;  4Y92 A;  4C5H A;  2HKN A;  3CBM A;  3QWY A;  3OYY A;  3TQ7 P;  2EVR A;  2D9T A;  2OTJ Q;  1DJ7 B;  1M90 C;  1C6V X;  1NJI C;  4HXJ A;  2L3R A;  3OB9 A;  5IT9 E;  1UHC A;  4HCC A;  2EGC A;  2J05 A;  1VQ7 Q;  1G5V A;  1Q82 R;  2ZAE A;  2PVG B;  3INZ A;  2FPF A;  3VYG A;  3M5A A;  1S72 A;  2RN8 A;  4L5G A;  4JZ4 A;  1VQL T;  4J9D A;  4DQ2 A;  1VQ9 Q;  4NOY A;  5KYY A;  5CKF A;  4ZNX A;  4DBH A;  1UJY A;  2KRM A;  5ECA A;  2JXB A;  4O5V A;  3KFV A;  3OS2 A;  4UC4 A;  2LCC A;  1NG2 A;  2QA4 T;  1M8V A;  4C8Q B;  4M77 F;  1FMK A;  2EQK A;  2VUB A;  3HP9 A;  3CPW A;  2CYZ B;  3LW5 E;  4LNP A;  3EGX B;  1A0N B;  1OOT A;  2XMF A;  2YRD A;  5GAO m;  2CZ1 B;  5GAO p;  4B9X A;  1ZSZ C;  3G4S Q;  3UF4 A;  3V7C A;  2BTT A;  4M77 B;  1FMW A;  5KH6 A;  2OTJ A;  1RI0 A;  1ZUY A;  2M0O A;  4HVW A;  2KXD A;  4LD9 K;  1T0J A;  4Z88 A;  3NTK A;  4ZGE B;  4F14 A;  4NL3 A;  2VAS A;  1KFZ A;  1Y71 A;  4JRI A;  1WX6 A;  1PWT A;  1RAA B;  4KGX B;  2DET A;  5GMK j;  1UGQ B;  4C92 E;  3LLR A;  3CCL T;  1UUE A;  3RNJ A;  3G4S T;  4DOW A;  4J6Y A;  3QSU A;  2Z0W A;  2XDD A;  2HKQ B;  1VQ6 T;  2CGH A;  2A08 A;  4E7H A;  1NZ9 A;  2L5Q A;  2CH4 A;  2XIC A;  3V7R A;  5IHN A;  4C92 D;  3VS1 A;  2DO3 A;  3H0I A;  2D0Q B;  2XID A;  4LDV A;  3VRY A;  4JJD A;  4A53 A;  2ENM A;  2P4R A;  3FJ5 A;  2VVK A;  5M9O A;  3O8V A;  2BKD N;  4EMG A;  2ZPB B;  2KT8 A;  5CQX A;  4PJL A;  2ZZD A;  4OGE A;  1TXQ A;  2PQW A;  1PKS A;  1Q82 C;  1NE8 A;  1BKB A;  4FL6 A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 1UGV A;  4D8D A;  3R6N A;  2JMC A;  1MV0 B;  1VA7 A;  2EW3 A;  1KSW A;  4ESR A;  2DA9 A;  2JM9 A;  1ABO A;  1AD5 A;  4CC3 A;  2EYZ A;  1I1J A;  2CT4 A;  2LQW A;  1AVZ C;  1UJ0 A;  4GBQ A;  2L3P A;  1X6B A;  2D1X A;  2EQI A;  4CC2 A;  1J3T A;  1WXT A;  3M0R A;  1T3S A;  2NUZ A;  1HJD A;  2IIM A;  2KBT A;  3I5R A;  2L3Q A;  4J9G A;  2L3S A;  2AZV A;  4GLM A;  1OEB A;  2GGR A;  2OI3 A;  2LJ3 A;  2K9G A;  3CQT A;  1KJW A;  2K3B A;  3EG1 A;  1WLP B;  4OMN A;  2MCN A;  1TUC A;  1SSH A;  2KEA A;  3REB B;  4JJC A;  1QCF A;  2JTE A;  2YDL A;  4J9C A;  1OPK A;  1GFD A;  2DE0 X;  3SHW A;  4A63 B;  2D8J A;  5IXF A;  1ZSG A;  1WXB A;  2O2O A;  2LJ1 A;  1AZG B;  1QKX A;  1M3B A;  3EHR A;  1WDX A;  2W0Z A;  2B86 A;  2M0Y A;  2K2M A;  2RQV A;  3EG2 A;  2CSI A;  1NLP C;  2RNA A;  3ZL7 C;  4RTV A;  2KE9 A;  1M3C A;  1VYU A;  3REA B;  2YUN A;  2KRN A;  1X69 A;  1U5S A;  1SHG A;  1AZE A;  1ZLM A;  4Z8A A;  1XOV A;  1AEY A;  1UHF A;  2KYB A;  1SEM A;  1SRL A;  2PTK A;  4AFS C;  2HEQ A;  2H8H A;  2J6O A;  1B3Q A;  3M0P A;  1WXU A;  2DLP A;  2DYB A;  1AWO A;  2ABL A;  4AFU C;  5IH2 A;  4LUE A;  1YN8 A;  2RPN A;  3O5Z A;  2PNI A;  1UFF A;  2FPD A;  4F17 A;  1JXM A;  2D8H A;  1HD3 A;  2MIO A;  4JZ3 A;  2BZY A;  2ED1 A;  4RTX A;  1VYT A;  3RBB B;  1EFN A;  2DL8 A;  2BZX A;  1OV3 A;  2C0I A;  1E7O A;  1WA7 A;  4E6R A;  2RMO A;  2W10 A;  1UDL A;  1OPL A;  1WIE A;  2GTJ A;  3UAT A;  2OJ2 A;  1UE9 A;  4DEX A;  1V1C A;  2CDT A;  2GNC A;  1K76 A;  1Y57 A;  4DEY A;  3TVT A;  4RTY A;  4M4Z A;  1B07 A;  2LX7 A;  2LMJ A;  1GBR A;  4K11 A;  5IHK A;  2CT3 A;  2CUD A;  2E5K A;  4IIM A;  2RF0 A;  4CC4 B;  5FWB A;  2DL3 A;  2J06 A;  3VRZ A;  2LP5 A;  1Z9Q A;  2RQT A;  2F2V A;  4J9H A;  2LJ0 A;  2FRY A;  2C0O A;  2JW4 A;  2LZ6 B;  1CKA A;  2D0N A;  1U3O A;  2V1Q A;  3NPF A;  1NLO C;  2JM8 A;  2K7A A;  2O9V A;  4OMP A;  1BBZ A;  2L0A A;  1X2K A;  2EKH A;  4RTW A;  2A37 A;  2PZ1 A;  1E6G A;  2ROL A;  1JXO A;  2KR3 A;  1PNJ A;  2YUO A;  2G6F X;  1U06 A;  2DX1 A;  2DL4 A;  2VWF A;  4QT7 A;  1H3H A;  2LCS A;  2CRE A;  1W70 A;  2A28 A;  2YT6 A;  2K79 A;  4LUD A;  4AG1 C;  2LQN A;  1ARK A;  3EGU A;  1UEC A;  2KNB B;  2KRS A;  2RQR A;  1G2B A;  3TSZ A;  4RTZ A;  4AG2 C;  3C0C A;  3VS6 A;  4OMM A;  1QWF A;  1UG1 A;  2M51 A;  3VS7 A;  1PRL C;  2DRM A;  2OAW A;  4F16 A;  2YUP A;  4Z89 A;  1GBQ A;  2QDL A;  1GCQ C;  1SHF A;  2EYW A;  1TUD A;  1WYX A;  1NM7 A;  1X27 A;  2GQI A;  2CUB A;  2KGT A;  1NYF A;  1AWX A;  5EC7 A;  2DL5 A;  2YUQ A;  5IHI A;  3VS5 A;  4AFQ C;  2EGA A;  1T0H A;  1ZUK A;  2KYM A;  3EG0 A;  2JT4 A;  2EGE A;  4X1V A;  1JEG A;  1S1N A;  1YCS B;  3ULR B;  3M0Q A;  2KRO A;  3JV3 A;  4RUG A;  4OMQ A;  3PVQ A;  1MUZ A;  1RLP C;  4FSS A;  4J9B A;  2FRW A;  1GCP A;  1GL5 A;  3VS2 A;  3NHN A;  3UA7 A;  1SRM A;  2O9S A;  1M27 C;  3NMZ C;  4EIK A;  2HSP A;  1X2Q A;  2I0N A;  4KRT A;  2DBK A;  1K1Z A;  2SRC A;  1PRM C;  3EHQ A;  2KT1 A;  3I5S A;  1AWW A;  2VKN A;  4WCI A;  1UTI A;  1HSQ A;  4IIO A;  1GFC A;  1ZUU A;  4J9F A;  2CSQ A;  4HVV A;  1I0C A;  1BU1 A;  2DIL A;  2X3X D;  2DVJ A;  4RTU A;  3THK A;  1AWJ A;  2LNH B;  3VS3 A;  4HCK A;  2FPE A;  1QWE A;  5GJW B;  2AK5 A;  2EPD A;  3PE0 A;  3U23 A;  1QKW A;  2AZS A;  1KIK A;  1X6G A;  4JPB W;  1H92 A;  2EYY A;  1RLQ C;  2ESW A;  1QLY A;  4RTT A;  2ED0 A;  4Y92 A;  1NYG A;  4HVU A;  1JO8 A;  3QWY A;  4OML A;  2JS0 A;  1E6H A;  3NGP A;  2V1R A;  1G83 A;  2X3W D;  4ORZ A;  2EVR A;  1RUW A;  2DF6 A;  5I11 A;  3I35 A;  3VS4 A;  3H0H A;  4HXJ A;  1UHC A;  3IQL A;  2EGC A;  2J05 A;  2YSQ A;  2FPF A;  1JQQ A;  2HBW A;  4JJB A;  1YWP A;  1IO6 A;  2NWM A;  2RN8 A;  2GBQ A;  5L23 A;  2DRK A;  2L2P A;  2CH4 W;  2ECZ A;  1NEG A;  4JZ4 A;  3M0T A;  4R0K A;  1K9A A;  3LH5 A;  4LN2 A;  4J9D A;  3TSW A;  2AKL A;  1Z9Z A;  2FG0 A;  4ZNX A;  1BB9 A;  1K0X A;  1UJY A;  2KRM A;  5ECA A;  2JXB A;  3KFV A;  1PHT A;  1YP5 A;  2GTO A;  4D8K A;  1NG2 A;  4LE9 A;  1FMK A;  2DMO A;  5FWC A;  5GJV B;  2JMA A;  2ROT A;  2HCK A;  2MOX A;  4LNP A;  1A0N B;  1OOT A;  1PKT A;  1W6X A;  2DL7 A;  2XMF A;  1M8M A;  1AOJ A;  4J9E A;  5I22 A;  1K0S A;  2EYX A;  3UF4 A;  5IXB A;  1M3A A;  2BTT A;  4OMO A;  1T3L A;  3H41 A;  1TG0 A;  3UA6 A;  2FEI A;  2C0T A;  1K4U S;  2AKK A;  1ZUY A;  4HVW A;  3M0U A;  2KXD A;  3PVL A;  1T0J A;  1ZX6 A;  2BZ8 A;  4Z88 A;  4AFZ C;  2JS2 A;  2RQW A;  4F14 A;  1KFZ A;  2J6K A;  1GCQ A;  1GRI A;  1YWO A;  1WX6 A;  1PWT A;  3A98 A;  1YNZ A;  2J6F A;  2FO0 A;  2J7I A;  1UUE A;  3SEM A;  3QWX X;  1CKB A;  3RNJ A;  2F2W A;  1N5Z A;  2DNU A;  1I07 A;  1W1F A;  1CSK A;  5HCK A;  2A08 A;  2O31 A;  2CH4 A;  2K6D A;  1WI7 A;  5IHN A;  3VS1 A;  3H0I A;  2DM1 A;  2DJQ A;  3VRY A;  3EG3 A;  1BK2 A;  4JJD A;  2HDA A;  1ABQ A;  2ENM A;  2P4R A;  1VYV A;  2EBP A;  2KXC A;  1H8K A;  4CC7 A;  3FJ5 A;  3VS0 A;  2VVK A;  3I9Q A;  2O88 A;  1RI9 A;  1MV3 A;  1X43 A;  2KT8 A;  2A36 A;  1SPK A;  1LCK A;  1ZBJ A;  1JU5 C;  3H0F A;  1M30 A;  1NEB A;  1PKS A;  2RQU A;  2DBM A;  2SEM A;  2F2X A;  3M0S A;  4J9I A;  1Y0M A;  1FYN A;  3GBQ A;  5FW9 A;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...