2YUXA

Solution structure of 3rd fibronectin type three domain of slow type myosin-binding protein c
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
120
structure length
120
Chain Sequence
GSSGSSGASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, slow-type
publication title Solution Structure of 3rd Fibronectin type three Domain of slow type Myosin-Binding Protein C
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 7
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yuxA01
4ZUUA 3DSFL 3EO9H 4YDLC 1CG9B 5DFVC 2ADJA 1EBPA 1T83C 2AQ3A 1F6AB 5L8JB 1NLDH 2X70B 1YZZA 5F8QC 2FWOA 2GT9A 4R2GC 3WEXB 1T7XA 3QDAA 3QXWA 2DTMH 1R5WB 2Z93B 3HAEG 3WBDA 2I9LA 1SY6H 2WANA 1UXSA 1PG7X 3T4YA 5IMMB 1AGDB 3RI5F 1IEAB 4G8GB 1G7LB 4PJBE 1H3UA 2DKMA 3OKDB 4U05A 5HHVL 2A9NH 1LK3H 3ZDYF 4PRBB 5ITFA 3IF1B 5F97E 3SE4A 5FYJE 1RK1A 2FLRT 3TNNB 4MJ5B 2KDGA 3LKOA 2Q3ZA 4PP1D 5L8LB 2ZUTA 4PGCB 5I1HL 2FYYA 3KPOA 1OB1B 4GXVH 2Q6WA 1CFVH 4ELMF 2DTSA 4Q0XH 1UWXK 3UPCA 2QSCL 4F80A 3UTSA 3GKWH 1JGEA 1ZT1B 2HYMA 2NY5C 3FN0L 3ELAT 4X7SL 4ODHL 2HKFH 1S7UA 3ZLQC 3QEQB 3HN3A 3GBML 3VA2C 4HZAA 1YY8B 5C0AE 4TUKL 1G0YR 1R3KA 1B0GA 2H26A 3O6KL 1BHGA 1ZS8B 4Q6IA 1DBJH 3VXQB 5JNYB 1GZQB 4PJ8D 2F15A 3FO9B 1UWGL 1DLFL 1ETZB 2P4AB 3FQTB 5HHXH 1NFKA 2F53B 4I5BB 2ZUWA 2VKWA 5I15H 4WHTA 3VFOB 4NQVA 1RMFH 5IMLB 2Q87A 1NCWL 4JPVL 1IMHC 4H20H 5KOMC 1AGCA 3VFMA 1ZA3A 4QXGH 2CO6B 5D1XB 4QNPF 3T65B 5DO2D 4NM4L 2I9TA 1EMTL 1F6FB 2XNAB 1VADB 3TIDB 2F54D 3E3QE 1RUKL 3DECA 3H9SE 5SWSE 3VFNB 3S4SB 4MNHB 1I4FB 4L9LA 3RWCA 2RGSA 4EOWH 4BH7A 3S37X 2NY5H 1MCWW 3Q5OA 1ONQA 1XEDA 2DYPA 3D6GA 5DJ8B 3U83A 4M62L 2XKNB 3WO3B 4OCSL 1E4JA 1HH9B 1P7QA 5FOBA 5ETUA 1T1WB 1F4HA 2WV3A 4HQQL 3CXHJ 3P9MA 3OKMA 1LQSR 2X4QB 2FEEL 1IGMH 3INUL 3MACH 5DUML 3ALXA 1UM4H 1MWAH 4S2SB 2CKBH 4FXKB 1MFNA 5B3NA 1BGXH 4G5ZL 4Y4KB 1HKFA 1ZWIA 4XP4L 5FCUL 5HI3C 4NHCH 3VXMB 1TQBC 5IB5A 1R3JA 3OWEA 3MV7E 4OM0H 5D5MA 4F3FB 2PKDA 4DZ8A 4M5ZH 2G9HB 4D0CA 1DDHA 2XQYG 3WDHA 4Y0GA 1CD8A 2OYPA 3DGGB 4N8VA 2W0FB 5D8JL 4C54A 5BVJB 4KZDL 4FFWC 1N26A 4NYLB 5FM5M 2YOCA 4OAWB 5EIIB 3L3JB 4NJAH 3CXHK 5DJ2B 1ZA6A 4IIQA 4KK9C 4NFBA 3MA9H 3NCJL 3W39B 5DYOA 4EI5D 4ODUA 4ESKA 3ARGC 4BZ2H 2CD0A 1XCQB 2YSSB 3VFVA 2X4TA 4MJ4A 4YHOH 4FQHB 1Z5LB 1UA6H 5LQBL 1HYSD 1KBGL 4PLKD 5E6IA 1QFWI 2Y9RT 3MFGB 1T6VN 3LRSB 5D7IE 4JB9L 1EO8H 3IFLL 2XIDA 3DMMC 3QUXB 1EJOL 1RZFL 1S7SB 4HWNA 2QSQA 3QRGL 1CFQB 1T7VA 3RVXC 2X41A 3K2UL 4YXKH 3GJFB 1S7QB 1UENA 2JJSA 3LMJH 4XPAH 4NO3A 2QQKL 3ECBA 3WXVL 4J23A 1G84A 1RHHA 1SM3H 1A22B 1J0JA 5AZ2L 1A5FL 3IJSA 2A6IB 5F96L 2P42B 2R69H 2BRRL 2OL3H 4PJDF 5AUMB 1KLUB 3P4OB 2OP4L 5IKCB 3NIFF 1Q0XH 1WCQA 2EDYA 2NW2B 3EOTH 4DEPC 1P7HL 4ALAL 3V7AG 3BN9C 3EGSB 2EC9T 2CDFA 4XHJD 4U1KA 4JZJB 1UB5A 2DDQL 3QXAA 4HT1L 1CDUA 1IGYB 4K8RD 2PO6C 1T1ZB 4HJGA 5D71H 4PGJA 3HR5A 4M03A 4PY7B 1RJZB 1F4XL 2E7CA 1ZLUK 2EDEA 1PY9A 2VRAA 3QCVH 1UKQA 3B2UC 4QHKJ 5ENWB 4CVXA 1Q0YH 5EC2A 3MUZ1 4NKDB 4LLUA 5KANG 5JXEC 4Y5XA 2H45A 3VGBA 3LKRA 5I1KH 4BQ8A 3D3VB 5FHBH 2BY0A 2ITCA 4NQEB 4YDLB 1Z0NA 4NPYB 4OZ4A 4YPGB 2A6JA 3VXRE 3W9EB 2APVA 3NVQA 2DM7A 2Y7QB 4IOSD 4AL8L 1HIMH 1AY1L 5CZXD 5B38G 1OF2B 4KKAC 4G8GE 1WBXB 2FO4A 3VW3H 2Z92B 5FB8A 5IB2A 4F33B 4X80L 1UWEH 1K9TA 2H32A 4EUPG 1UC6A 3QNZB 2HRPH 2PN5A 3VH8G 4LVHC 4KVNH 2P45B 2GTWB 3LKNB 3ZKND 5D1ZC 3PWVB 1FNGA 3G6AB 2CRYA 2YMXL 4RFOL 1E6OL 4JFQB 3SE8L 1MSPA 5E94A 5F1KC 4XI5D 1KEML 1ITCA 2DJUA 4RAVB 4HXAL 4M1CC 5JPMB 2VR5A 3BAEH 1CLYL 4AG4L 5C0CB 2BVQB 5IT2L 3FZUC 4HWBH 3T2QA 1MRFH 2OXGA 3QEQE 3TFKC 1BOGB 3O8XC 1NSNH 3BYYA 3JTTB 4P5TD 1K3IA 2W60B 2MPAH 4U1NA 1CI5A 3BP4B 4KV5E 1MLBA 2NTFB 1V3MA 5TPWH 5HYSB 4HULB 5FUZH 1PKQB 3KPPA 1CQYA 3IDUA 5E08L 5DRZB 4OD1L 5FUCE 2DLHA 4TSCH 4LAQH 4F7EA 4A2LA 2VLKD 4QXUH 3O3EA 1W8OA 1BVZA 2IBZY 3SOBL 1BJ8A 2XA8L 3C60C 3GRWH 4O9HH 4A2MA 2AABL 3QZWA 3MRIA 1BVLA 1KPVA 1MWAB 1URLA 3X12B 1KT2A 2CKBB 4LLQB 4I3SL 1CGVA 3JTSB 4DKFL 1IAII 4YDIH 4OI8A 1YECL 4JVWA 3STLB 4QRRD 5GGVH 1CDGA 1NGQH 3HLAB 4QRPE 1FLRH 1S8DA 5BZWA 5LGHH 4O51B 5HGHB 1MAKA 4H5SB 3SY0A 3U79A 4UIKH 5FKAB 1LEKB 3GEWB 1NFIB 3BW9A 4K7PY 3LQZB 4H1LA 1GGTA 5FYLH 1VGEH 2GFBB 4OM1L 2B2XL 1MCJA 3TWCH 4NWTH 3QBTB 1Z9LA 1JRHL 5C86A 3QI9C 2IGFL 3OZ9L 4PJ7B 1LO0L 4F7MA 1B6UA 3PV7A 4I9WE 4HGWB 2H3NB 4Z7QE 1GHFL 2VTFA 3EYFB 3P4MA 4FQ2H 4UBDD 1FZKB 1V3LA 5JIIA 3WFZA 1FFPB 3BX7C 1DBKH 2KQMA 4QOKB 2GIYA 3IAPA 2Z31D 3BKCH 5ITBH 3QQ9C 4DTGL 2BDNH 1SEQH 3VXME 5B4MC 2K9UA 3TZVD 2EYTB 3IT8D 3V4UL 1PY4A 5CBAB 5DA0B 2RCSL 3GHBL 1CE6B 5GJSH 1YNKH 3VFWA 5B8CC 1AD0A 1QYGL 1S9WA 3PGCB 3RGVC 4TOYL 3C5JB 4K3GA 5ESAB 3A67H 4NQXB 2O61B 2VO5A 3W2DH 3WUWA 2QHLA 3IU3A 3WXWH 3NZHL 2OK0H 2F19H 3L3OB 4N9GA 4TVPD 1ZHBB 2PXYD 3VXTB 1LHZA 1MJ8L 5DLMH 3MRJB 2OL3B 3M8OH 1G9MH 2GTZB 2C4FU 3EFFA 4FZEH 4OLXL 5HVWA 3AREA 3T0BA 2ZG3A 1J1XL 2ESVB 5IFHL 3ARYA 4Q9QL 1QUNA 2NY4B 4KKNA 3CH1A 1U8JA 2FX7L 5SV4A 1T2QL 3BUTA 3ARGB 1B3JA 3VRLF 4A6YL 1KCVH 5FUOH 1NFDA 1JN6A 4OJFH 5D7LB 5C9JB 1A4JB 4DQOH 3JV6B 4H8WH 5DVMA 3ROOA 4NRZA 4X8JB 3PWUB 3SKOB 3B5GA 4QEGA 2P5ED 2FIKA 4XPTH 4XVSH 1FGVL 1RZ8B 4D9QD 5I1IH 2WIMA 3OKOA 3DSNA 4FFYH 4K3JH 4M61B 1JZ7A 4Y16C 3U46A 3W5NA 2ZCHL 5SX5K 4MD5A 2E9IA 1LE5A 2VC2H 1AE6L 2Q20A 4O5LL 1DTUA 3ZYIA 4EJ1C 4LARL 3CUPB 1DVFD 4GQ9L 2JJUA 1D6EB 4Y1AE 3PL6D 1NCAH 3MUY1 1ACZA 2BVOA 2DQHH 1QSED 2OZ4L 2DWEA 5J9PA 2J5LB 5DJYB 1MELA 4IDJL 5IBLD 5F8RC 4YHLH 3MRMB 4UU9A 3MXVL 4F7CB 1CL7L 4UUJB 3QEGL 1OPGH 3FFDA 4DEPB 1V7NL 1IC5L 2AJSL 4PJHF 3GI8L 4UTAL 4G8FB 4XVUD 4FTVA 1FZMA 1XR9B 4PTTB 3ZTJG 5IK3A 5FYKH 1PEZA 2PO6B 1PG7H 3QQ3B 1HQ4A 5EUOB 4Z0XB 2YXFA 3VFRB 5J13C 2B20A 3W82A 4DWHA 3GZKA 5I16A 3W5MA 3U7WH 1JP5A 1AO7E 1QO3B 2AJUH 3V6OA 3SDAA 4JGJA 1OW0A 3FQNA 1I9IL 5I30L 2GSIA 3BUYB 3CSYA 2MMXA 4D0BB 2P7TB 3BIKA 2Y6SC 4J1UB 5HDLA 5ID0A 3D3VE 1LD9A 5DK0B 4NQEE 2P47B 4RDQF 1AGFA 3B2VL 5BOZG 3T3PE 1XGPB 5BO1H 4TSAL 5F9JA 5IHUL 5A3ID 4LMQI 2CK0L 2BVTA 1FFOA 4KK8D 3GSRB 3U7YH 4L4TD 4X7FC 1AP2B 5GJTH 1DL7L 2BJMH 2EKSB 4IOIB 3QB7C 3BD5A 1EHLH 3LEVH 2XWBB 3WFCH 2R2EA 3CFIC 4NO0D 3VGGA 5DHYB 4XBEL 3S96B 2NLJB 1FC1A 4JRYB 1TITA 4JPWH 1X5LA 4PJXA 4LVHB 3U36A 4JDTL 5DFWH 1CT8A 1A7BA 3AUVA 3SDXF 2BMKA 3PWPB 5ID1B 3QEHB 3QWOA 4POYA 2W9LA 2EC8A 3K8KA 2HH0L 4ZUWB 3HZVA 4L9LC 1NGYA 1KELL 3TEUA 1HHJA 5CJ8A 4AK1A 5C0CE 1A9BB 5I18L 5CGYC 4YXHH 2DQGL 4N8VG 4DVRH 1T04B 4QTHB 1XF3B 4WTWA 4X6DB 1AFVL 3DI3B 4FNLL 3IU4L 1PKQE 2MCPL 4KRPD 3TLRA 4JY5L 4ORZC 4PD4K 4O00A 4OF6A 4EN3A 1F00I 2D7OA 5K9JH 5FO8B 3B9DA 5D96C 4ZTPL 4FXGB 2ICEA 4YHZL 1KIQB 4P0DA 3E8UL 1JNLL 5D1QD 4JQVC 2FZ3B 5CWSB 3WDJA 5F1NA 3NBNA 3BN3B 1MCLA 3C60B 5C0GA 3RZCA 4J7RA 1DLHA 2FX8H 2H2SC 2W65B 4M1DL 3F58H 1XGTB 4QXTB 1MY7A 1TVBA 2OTUB 1FAIL 2BNQB 3RL2B 3F7VA 4LCCB 4U0RB 1WF5A 5KSBB 3DV4B 3SKJH 5IF0B 3SGKA 4DUXA 4K07A 2PW2A 3L7FB 4PP2A 4LPYA 4PYHA 2ARWA 4EVNB 1N5AA 3ZKSD 3GIVB 3O3DA 5MEQB 5DR5L 4IIQC 4UT9H 1RK0B 3FQUB 3ZDXE 2EH8H 1YEJH 4Q7DA 4JFFB 2EKJA 4PJ7E 2UV3A 1RZKL 4ONGH 1DQLL 2BSED 3CXDL 2DKSA 1A7OH 3WS3B 1UFUA 2BOBB 4HBCH 4TVPL 2P24A 5I6XB 5CJQL 1S7WB 2Y23A 2R1XA 4QOKE 3LS5L 2A6KB 1UACH 4XRCA 4ZTOL 4XWOC 4GO6B 4HJ0D 4NNYB 2DMBA 3S5LA 2YEZA 3D9AH 2VLRA 4ZFGH 2KQNA 5CJ5A 4KKCC 2ZJSL 3VFPB 2JJSC 1NAKL 1MJUL 3EOYG 3FO0L 4S10A 4YAQB 1MQ8A 1FNAA 3VDAA 1M6OA 2LVEA 3MLXH 4LOUC 1XCTA 1T80A 5L6YH 3ABZA 3ET9F 1E27A 1P9MC 2UUDH 2HLAA 2AJXL 4Y19B 1YA5A 4JRXA 5EDXA 4U6HB 4LSPH 2X4UA 1EO5A 4AENA 3K4ZA 2IPTL 1N2RA 1LP9B 1FNFA 1ZLWK 4FQ1H 1R3IH 3BISA 3MO1A 4HFUL 1BJ1H 4TN9A 4N0RA 2GITA 4NQSA 2O5XL 3REVA 3SPVA 3T4AA 4K23L 1MFBH 5JHDB 3MRKA 4XC3L 5D7LE 1RD6A 1BBJB 3T2NH 2BOCA 2HVKB 4PREB 3VXNA 4PGBA 3BP7A 1A7PL 5F3BA 1F13A 1NUFA 5TH2B 3QXTA 3MRGB 1GRWA 2VXTL 4Y5XC 4OF0A 1UCBL 1MI5B 1UXWA 2VQ1A 1NEUA 4HDIA 3NFSH 5DJCB 1MUJA 4K3EL 5EZJB 3LEYH 2YUXA 1QVOA 4ZUUB 4MB5A 4U1IA 4Y16B 4CN1A 2XWJB 5GRUH 4Y2DA 1UM6H 4S1QL 1ZTXL 2ATKA 1GOHA 1JTOA 3IFNL 5DS8A 1WTLA 2FWOB 3NIDE 3MROB 1JL8A 1CXKA 3O6ML 4JQIH 1RZIB 1SBSL 4M43H 3RVVD 5BS0A 4Z7WA 5H35A 1I8IA 1KCSL 3SGDI 1WLHA 1WAAE 5FO9A 1D5IL 3FOLA 2IFFH 4A6YA 5IFAL 5ISZA 4LLVA 5DK2B 3CK0L 3BPCA 1JTTA 1RK1B 2IJ0C 3QZWG 3GSQB 3MV8E 4S0TD 5K9OA 5E99L 1H15A 4PBXA 5EUOE 2X5PA 4G8IA 4JFEA 1P6AB 3DVIA 1EH9A 2FYYB 3OKEB 3BEWA 3G9AB 1JYXA 4XNMB 1ZLSH 5DWUL 3L9RA 3TJHC 2IAND 3ZMRA 3CMOH 4WUUA 3M45A 1OGAA 1JGEB 2F5AL 4N0CC 2A73B 1CGUA 5E95B 3V52H 1AQKL 1S7UB 1EFQA 4H1LG 1T4KA 3VD7A 2J8HA 2W0LA 3QG6A 2OZ4A 1FCGA 5F21B 2DLIA 3WS6A 2HT2D 2KBGA 3WLWD 4V1DE 2F58H 1B0GB 2YRLA 2H26B 3OB0K 5CEXA 1ADQA 4ELMB 1B4JH 4R4ND 2VN7A 4X83A 5LAXA 2QKIA 1YEFL 3CSGA 5DGRA 2AJVL 5JUEH 3BZFB 1QBLL 3CX2A 6FABH 5E2WL 4JRYE 3UTPE 4WHTB 4WU5B 3RX8A 3QXVA 2BXZA 3U0TA 3LB6D 3HZKA 4NZRL 3PWPE 1EEUA 1OHQA 3TBWA 1AGCB 4GKZB 3VFMB 4E5XA 4YJZL 4LSVL 4YHIA 5C09D 2FHFA 1HQRA 1PLGL 3LOWA 4B7LA 5C07D 4JKPL 5TGBA 3ARUA 5GGSB 3EDEA 5E2VH 3S35L 3S7GA 4AEHL 4PJEF 4BH7B 1WC7B 1YEEL 5CSZA 1PZUB 2VLME 1RZ7H 3WUWG 2JLLA 4X6DE 4I1NB 1MAJA 3MNVA 3OG4B 2H2PC 4MSWA 2DS4A 2IH1A 1D5XB 2X4PB 1WWBX 2CIKA 3OKMB 1BD2A 2K3TA 4LSUH 4H25B 5T1DL 2P8MB 3MFFB 5IW3A 1GXEA 5GGRA 4Z0BH 5D96B 2AXJA 4UQ3A 4LIQL 3HPJA 1CGXA 2DM3A 4K9EH 2HVJA 5CMAB 2DOCA 2CQVA 1YEHL 4FQXD 4R4FL 1S5IH 4JDVA 5JDJA 5IB5B 3HMWL 2FNBA 1JWUB 2G60L 4HS3A 4X6EB 3D0LA 2BNQE 3PDOB 4DZ8B 3KLDA 3BXNA 4D0CB 1NC4D 4DCQB 5KSBE 4HIXH 1BF8A 2PETA 1N0XH 3O45B 4WWKB 4HIEB 3VWJD 2PYEE 1M71B 1TCRA 3TPUA 1U8LB 3SBWC 4NQUA 2FJFA 3LS4L 1QP1A 1W72A 3E1F1 3B5TA 4XCCH 4LRNH 3TYFA 3EKCA 3O6LL 5JO5A 3WCYA 3VMNA 2GY7B 2NY1B 4JFFE 1A3LL 2BY2A 3AREC 4RBPK 1AKJD 4IIQB 1Q72H 1UADC 4AEFA 3HS0B 5DYOB 4QGYA 4AH2A 4OCWH 4PJCF 3MRDA 3HE7A 43C9A 1OGTA 3LZFL 2M26A 1FBIL 3REWB 4P2RB 5HHMD 1ZKAA 1NAMA 4DKAA 3TO4A 1OM3L 5DMKA 1GGIH 4G9DA 1MCEA 4J6RL 2AI0H 2NW3A 1SJHB 1UVQA 1DQJA 1A6AB 1TVHB 3FQXA 1F3DJ 4M3JA 2EDBA 5C0BB 3RZWA 3X3GL 1AXSA 1NCTA 1IGFH 1ZEAL 3DETD 4NRXB 4F8QA 1DBBL 3K8LA 3I9GL 1P4IL 4BKLA 5IJVA 1EFXB 4LNRB 4DFHA 4MQ7A 3GMLA 5HHQA 4Y19E 2FBJL 1OP3K 4Z7VA 4JFZL 4D94A 4WEBL 3VD3A 3EYVA 5KN5A 1FNLA 3TV3L 4I18B 1VSCA 2P46B 3KPQA 4KZEH 1OTUC 1H9VA 3L3IA 3B9EA 1KN2H 3DYPA 1NGXB 3HE6D 2CDFB 2XN9D 4U1KB 3GNMH 3GSXB 1NGWB 4B7IA 5JHDE 4HJGB 3MV11 3LPWA 1IKFH 1BZ9B 3MJ7A 5TDNB 1H8NA 3IDIA 4PJDB 5FYKE 4L1HA 1J7VR 1GIGH 4NZTL 3V6OC 1DBAL 1OAKL 1G6RL 1G7HA 3QIBA 3K46A 1JYVA 2WUCH 4OCRL 4LLUB 4M1GH 1U8MA 1KN4H 3KWWA 3H42H 2HN7A 3LKRB 1EAPB 5GGQL 4MCYA 1DSFH 5H2BA 2ITCB 4U31A 3S36H 5JQ6L 4NSKB 1MEXH 2A6JB 3ILQC 4WDIB 4XP9H 5I1LA 3PHSA 1LGVA 4FQJH 4XCEB 1FYTA 4KUZL 2WQRA 4J4PA 3DX9B 4O4YH 4XNXL 3KPRB 1YNTA 4Z95L 5CGTA 2R29L 4UAOB 1NC2D 1T22A 3IDNB 2W1NA 1NCNA 1A21A 2GUOA 3ETBF 1RURH 1LMKA 5E94B 3RWIA 4U6YB 2ZUYA 3ZDYE 4XBGA 1I7TA 4OCYH 4W68A 2QADB 5J12C 3OL2A 1JPTH 5CEYB 3N1FC 4OLWL 1F2XK 4HUXB 1G7QA 3D5OF 4JM4H 4PB9L 1EO7A 4CMHC 2GKIA 5LGJA 1HINL 4IRSA 3I2CH 3T0ED 5DD6A 4PV9A 1TVDA 1MLBB 4EN3C 5JORB 2VOTA 5E0QA 3SE3C 1YMHA 1RUAL 3UZQA 1JVKA 4ELME 2EEAA 3ULVD 4XPFH 1AGBA 5LGKA 3H3PL 2EXWD 2NY3D 1J5OH 1PYWB 4M48H 4F7EB 2DQTH 5ADOL 1A6WL 1SVCP 3VWKD 3UTQA 2C1OB 2R0WL 1YEIL 3H9ZA 3MRIB 4MJIA 4WU7A 3S5LG 3ESVF 1KPVB 4F58H 2B5IB 2ZKHH 2B1HL 4HFWB 2DQEH 5F7DB 4HUKB 1A3RL 1CIUA 5FDWA 3QUKA 3TN0B 2KUTA 5CD3A 2ORBL 3HNTH 3IFOA 5JQHC 3QQNA 5BZWB 3SGKC 4K94C 3ZT7A 1T66C 1IGTB 3SE9H 1JZ6A 3S88H 2MKWA 3EJYD 4OZIA 1LO4L 3SHSA 4GRLD 2HG5A 1ZVSA 3BW9B 1X5JA 3C5SA 2R1WA 2VR9A 2YPVL 3HKFA 4KK6C 4KRLB 1RUPL 2ICES 5I1AA 3CLFH 4NN5B 2C26A 1T7WA 2AEQL 1H3VA 3RY6C 3CLEL 1K4DB 3P4MB 1S9XA 4LHUD 2P5WB 3M1BB 2YC1A 4JPKL 4MDIB 4LBEB 1LWRA 4HUNB 1Z3GH 5FHAH 4NN7B 5IM7A 2IBGA 4Y8AA 4OIBA 5EU5A 4M7KH 2XRAL 3ME0A 3S34L 4PGEA 4HH9B 4G43A 2O5ZL 4AJ0A 1FNHA 2IG2H 2V17H 1S9WB 1H8OA 3A6CH 4G9FA 2YPLD 4F8TA 5CCKH 4ZXBD 3EHBD 4K94H 4L8SB 4HLZH 5FYJD 1XGRA 4I48A 3OPZH 1FGNL 4F9LA 2Q8BL 4MXQC 3QO0B 4WO4D 5F1OB 4HJJL 3RNQB 2LAGB 3HPLB 1KNOA 5GSRB 5JXAH 2EDOA 2VAAA 4M8QB 1CWVA 2VL5A 3UTTB 5FA4A 2NNAA 1MCBA 5CP3A 1VFAA 5TJWK 4JHBA 5J6HA 5E5RB 4JAMB 2I07A 1TZGH 4MD4A 3PUCA 5CLTA 5T33H 5JLZB 2DQUL 3P4LA 2ADGA 3MNWA 5IFJB 4NJ9H 4DFIA 1I3UA 4JFHE 3RFZC 2Q1EA 4HPYL 1NFDB 3UX9B 1JN6B 2NY7H 5I9QC 3B9VA 3I6GA 5JPNA 1HHGB 4HWEH 1BX2A 1F11A 5T3ZD 1C12A 5C0BE 3D0VB 3BPNB 1KCUH 1MJ7L 3V4VH 1OAZL 3QFJD 2FIKB 3OAYK 4UOW1 1VEPA 3VJ6A 2HA1A 5GIRB 5ILTL 5T5NG 4NRYB 3U46B 1MCPL 3I84A 3QPQC 1CGWA 1Y18B 2BNUA 1FL3A 1IL1A 4MD5B 4OLUL 2AK1L 1AD9B 4PJ9D 4YHPB 3DV6B 3I02B 2WUBL 1SJEB 2YK1L 4PR5B 3VGAC 3GMMA 4BQ6A 4M6OL 1EIBA 2BVOB 1A6TB 3BH8A 2V7HA 2FECL 1YMMD 3H9SD 1GGBH 5SWSD 4UU9B 4O2EA 4RSVA 1JNNH 5AAMA 4PRNA 1G0XA 4Z8FL 4XPGL 4LKCA 1FPTL 1MOEA 5I1EH 1V7ML 2YZ1A 1EUTA 3RL1A 4KDTA 5IK3B 1IKNA 3STZA 3DX8B 1UJTA 2LFGA 4P4KB 5AD0A 4MQXD 2IF7A 3SDCD 3ROLB 1OCWH 1DANU 2UVEA 1W0VB 4JLRA 4MJ6A 2YN5A 4NQDA 3IFPA 4H88L 5FGBA 4PJHB 1XZ0A 3KXFA 4AT6B 2IPUG 3IJHB 4S1RL 2NZIA 4LLYA 2V2TA 3QHZH 5IVZA 2XTJD 5E7BA 3LEXA 3O6FB 4XCNA 1ZT7A 4K3DH 2I60H 2D3VA 4PJIA 3X3FH 4KXZH 5GS1A 1FFOB 1SJVA 1FO0L 4GG6A 2F8VA 1UQSA 3KPRE 3LRGA 4YWGL 2UY6A 5T1KD 2JELL 5D4QA 4P57A 3LH2H 3AU1B 3ZYOA 1EGJL 5E8PA 1PD6A 2YRZA 1V3JA 4BFEA 3MGOB 4PJXB 1G6RA 5C6WH 4I2XA 2BMKB 1HI6B 3RIAF 4P9HL 3BFOA 1QSFA 2JB6A 2P49B 1HHJB 2R2BA 3GHEH 1G9EA 3VXPA 1XAUA 2H9GA 3IDXL 4Z7OF 4YXLL 5J12B 1A0QL 5EZLA 5E1AB 4R90H 1NPUA 4HKJA 1F97A 3O2DL 4M7LH 3O81A 2NY6C 5TE7H 1N8ZA 3P0YH 4CMHB 2CLVB 3SDXB 4FFVD 1QOKA 1CLCA 1W0WB 2EDQA 2YKLH 2ICWI 5E2TL 1BFVH 3D2UD 4BH8A 1WCBB 4G8EA 1ADQH 3BGFB 2FJGA 3AB0C 4X4YB 2VLLA 1ZANL 3RVTD 4PPTA 2HT3D 3RY4A 2J3SA 5IP4A 4BK4A 5GGTH 3V6FB 4YHKL 1E4KA 1IAMA 5DD1L 4I0PC 1RQ5A 2OR9H 4NKMA 3OX8A 3QDGA 5KS9A 4JM2D 3U0WH 3CAFA 3U30C 2FSEA 1WWWX 1L7IL 1BBDL 2C7UA 5DD3L 1TVBB 2VR4A 5JDSA 2J7LA 1JNHA 2WBJD 1N6QH 3F7VB 3CFEB 1IRAY 1CGSL 5CAYB 3UAJD 3AXLB 5EN2B 1N5AB 4OCXL 1PKOA 3GMQA 3K3QA 4GRMB 1XF5B 1KB5A 5FYJL 1XMWA 2MKLC 5C6TL 32C2B 5MI0B 2J8UF 5C3TA 2I5YH 1OTSD 4DW2H 3QO1A 3EDKA 4OGAD 3CCHB 3TO4C 4ZFOL 2MQCA 4ETQA 2Y4SA 5E8EA 4X6CF 3K80A 3LIZL 2P5WE 2BK8A 3KNBA 4KROC 4XC1L 3QIUA 3VXRD 2GYSA 4KQ4L 4NM8L 4Y88A 1MLCA 4PJFF 3KR3H 1MRDL 3TH3T 3U1SH 5JOFA 4E41B 5EOTB 4YFLF 3OJVC 1CVRA 2XFXB 2RFXB 4G8GD 4QHNA 5CBEA 4RMVA 3I85A 4HD9A 15C8H 1LK2B 4M4RA 1FL6A 2ZOKA 3L3GA 4YUEL 1BWWA 4NOBA 4QXWA 3G04B 1E27B 4Z76B 2MFNA 1W72H 4UV7H 4X7DC 2X4UB 1W0YT 1PDKA 2YZ8A 4KJWC 2BVEA 2AKRB 1TJIH 4MZ3A 3BKJH 4HUMB 1ZE3C 1FNSH 3ALPA 1TTGA 2PYFB 5EO9B 4ODVL 2PTTB 2EXYC 3MYJA 5DJZA 1NAMH 4QRUA 3IKCA 5EORL 4R4BB 4OB5H 1V5JA 1NFDE 4IDLA 3X11A 1AIFB 3SDDD 2GJ6A 4U3XA 1KJVB 1ZHLB 1MFEH 5F70A 3G08A 2BOCB 1HHIA 4JFXA 4Y5VC 1QHPA 4JY4A 4TUJA 5T1MA 4GLRI 2DD8H 4PGBB 3IDJA 3BP7B 5I9QB 2VZ3A 5DJXB 5F3BB 3OR6B 3QIBC 3VD4A 3RDTB 5JMRA 4G7YL 3D85A 3KYOB 3QUMH 3WKNA 4HUVA 5EZIH 4YK4C 2G75B 3VRLE 3L5XL 3MCLH 5KVGH 3BKYL 4M6NH 2IFGA 4KVCL 5MEND 1IT9L 2CDGB 4G6MH 1KIUA 4YDKL 5HYJB 2ATKB 1BFSA 4GXUN 4WI3A 5IW6A 4GFTB 1KOAA 1IC4H 3AS1A 5CFHA 5H35B 4U6VL 4QRPD 4CMMA 3QJFA 5ICYA 4J4PC 1G1YA 2C9AA 4Q9RH 4TVSa 3WLBA 1EHNA 3G5XB 3MV9A 5BW7A 4HIIB 1QEWA 2EE6A 4JG1L 3MNZA 2Q86B 1WT5A 1G7JB 4FTVE 2NXZD 4CNIA 5J1AA 1DQDH 1H3PH 4PRDB 1MFCH 5DVNA 3BEWB 3V6OE 1S9YB 4HSQA 4RGND 5EUKB 1RFDL 3NFPA 1QG3A 1FVCA 4XCFH 4NKIL 1G7PB 4U3CA 3L9RB 1U91A 1GGCH 4R96A 3NA9L 1T3FB 2AXFB 4WI6A 4XWGL 4JDZA 5DJ6B 2IWGA 3V4PL 4X0KA 3GBNH 4XPHL 4MAYD 4NO5A 1PX3A 1Q9WB 2DRUA 3QCUL 1G7IB 4XH2B 4YGVA 1IEBA 1T03H 3IDYB 4N5EC 1ZHKA 5DUPL 4R7DA 4DGIH 2ED9A 1IM9A 3ZL4H 8FABB 2C3HA 4G3YH 1N7ML 5KVFH 1ROWA 1IQWL 2IADB 4HXBH 4P2QA 3FAWA 3UZEA 1NCCH 3HRZB 1BM3L 4JJHA 5LXGL 3BVNB 4Q9CA 3ZTNH 1YEGH 3VXUB 3O2VL 3C2AL 1R3LB 4GMSL 5TQ0L 1J05A 1Z9SA 2GK0A 2GY5A 3GIZH 1V3KA 4WV1C 4PJXE 2VXQL 4FQIL 3N1QC 2EE9A 3U0TB 2LU7A 5CIPA 3TBWB 4E5XB 1X5AA 2DQJH 2EDNA 1HQRB 2AK4A 2V2XA 2J1KA 3CFDA 5F44A 4HS8L 1U93B 1LNUB 4U3HA 2KKQA 3W0WA 4F37K 4NZDA 4WNQB 5TGBB 3QA3A 1G6VK 2A9ML 2W91A 5H37H 3U48A 2EICA 3CVIL 2OS7A 3I3DA 3N0PB 1BQSA 2AJYH 2D2OA 4K7FA 5CSZB 5DJAA 3MREB 2C5DC 4HGMA 2NXYC 4PG2A 1T0NA 1YPZA 5I1CL 3L3KB 4MAUH 5F7MC 1M05B 1R24B 2D7QA 4XBPA 5JA8B 5TFSH 2NY6B 3QUYA 4PGDB 5J57B 1FO0A 4YE4L 1A6PA 2COQA 1J1OH 5DMIL 4GAGH 3AB0B 1HE7A 4I3GA 4MA8L 3C5ZA 3ILPA 2IALA 3L7EB 2XA3A 3JZ7A 4KTDH 1QFUL 2CRMA 3HPJB 3BKML 4Y1AD 4CU8A 3KPMB 1D9KB 1J10A 2ZNWA 3OXSB 5EBWB 1I8KB 4I0PB 5DHVA 5DMGC 4BZYA 4WCYH 5C2UB 1YUHB 3IDGA 2XICA 3LKQB 4KU1A 1NMCB 3ARFA 3U30B 3D0LB 3RP1A 3PJSA 4UINL 5GRWA 5T1LD 5EU6B 2NY0C 3RWHA 1CLOH 5HPMB 2WINB 3I6LE 3P9WB 4YO0A 1D5ZA 4XNYH 2PCPA 4DN4L 4F9LC 3P73B 1UYWL 3IGAA 3LD8C 3TF7C 1B2WH 1CTNA 3V0VB 3O2DA 1AHWA 1W72B 4KTEL 3DLQR 1OAYL 1R3HB 1BF2A 5IJKA 4F7TB 2RAMA 5JO5B 4QF1A 1AO7D 1KLGA 5E8OB 2VLJA 1MQKH 2Y5TB 3RTQA 1AJ7L 4JFDA 3FB8A 5KVDH 3MJGX 3BQUA 2J2ZA 5D6CA 2X40A 4C58B 1CDCA 43C9B 4ZNEA 3EZJB 3MLYL 3O2WH 4NQED 1NAMB 5DFVD 1UZ8A 1CD9B 5DMKB 5JTWA 5HDBF 3ARBD 4PUBH 4OQTA 5TE4L 1TJGH 4E41E 4QHUA 4R2GD 5ALBL 3FQXB 1A6ZA 5IEHB 4FMKA 1H3WM 2AEPH 2ED7A 5D7SH 1JFQH 3KJ4B 2BSRA 4UDTA 4GG8A 3EO1B 3DUUA 4X9FA 4YDJB 5IJVB 3QUMB 1Q1JL 4MQ7B 4X6BA 3UBXA 2ZG1A 4JHAL 4JRXE 1A14L 2NMSA 1CS6A 3O9WD 5E5MB 3EYVB 5BRZB 1ORSA 4W6YB 3OAZH 1P5UA 1U3HD 1NBZB 3U4BH 3TGXA 3IXTA 4LHJB 4ONFL 4BUHA 1MFAL 1F02I 4LQFH 4D3CH 3UXFA 1TZHA 3PWLA 3B3IB 3HG1B 4UV4H 5C0CD 1H0DA 2DBLL 3Q6GL 1BLNB 1IKNC 4JJ5A 3U9PH 5L9DL 1T5XA 2BVPA 3PGFH 3P11H 4OZFH 1I3RA 3SJVA 1WWAX 3CVHH 1FN4B 4M7ZB 4PJAF 3IDIB 2QJDA 3D39D 3RWGB 5FKPB 4LCYB 5JW5B 2D31B 1C16A 4Y5VB 4ZAKA 2NX5B 2C3WA 4IHOA 3QWRD 1UH2A 5C0AA 5IB3A 5ACZA 4GT7A 1U8MB 1MIEL 1DUYA 4X6FA 4N0YH 3RGHA 5L2JB 1I85A 4Q58C 3KWWB 3NTCL 5JHLH 5IB1A 1N6VA 3VFTB 2JE8A 3CZJA 3GSOB 4YK4B 4MNGB 3EOBA 4JO2H 4JO4H 5HYJE 4WRLA 1FH5H 3KPLB 1QRNA 1R5IB 2EH7L 1T0MB 2AVGA 5GRXG 1OSPL 4PRIB 5GS1C 3ZKXC 3O11B 4ZUVA 4CUCA 4RWYH 4Z7WE 4TQEL 5HHPB 3RU8L 4OF8A 2E27L 1UEYA 3QUZA 3O0RL 5E9DA 3HZMB 2W9DL 3QHTC 4OUUB 1T7ZA 3MOQA 4HUUB 4QRTB 1CFTB 1I3GL 5D7JD 1NJ9B 1KB9J 4MMXC 1E4XI 4YHMH 1P4BH 1E28B 4AIOA 3L5JA 3B6SA 3MBXH 5INCB 5FF6B 1RUQL 1T22B 4JFEE 5AZEH 3DGCR 4MB4A 3B83A 5IBUG 4L3EB 4HCRH 5LWYL 5CEZH 4O2FA 2G5BA 5I8CA 2DWDA 4EDXA 1OWWA 2AJZA 2BZDA 3EYUL 3HFMH 5ABDE 2DLFL 3B9KD 1JZ3A 3T8XB 1ZGLA 3O3UN 5C0EB 2CXGA 1G7MA 5HI3D 4B53A 2WAHA 1FSKC 5DD6B 3AY4A 1GPOH 3GMNB 4FP8H 3G5VA 3U9UA 3S8WA 1F3RB 3R1GH 1U8KB 5BVPH 1B0RA 2CIIA 1MRCH 5CZVL 3MV7A 3IDMB 3VXUE 2ZCLL 3HI5H 2NY2D 3H7BB 1UH4A 4XX1E 2FATL 3CPLB 5I1GL 2BNRA 5DSCA 1E4WH 4FFWD 1RY7B 4OBRA 4O02H 2CDEB 1MHPL 3EO9L 5DZNA 4MNQB 4ZUTB 4WV1B 3MGTB 2ICWJ 3RWJA 3QULA 4LGSB 3K74B 4OT1L 1NLDL 4P3DA 4XMLH 1PZ5B 4J3OC 3DYOA 3IFOB 3ARGD 5EZOH 3Q0HA 1HSBA 5HVHB 4GSDH 1SY6L 3C9NA 3GSNA 3PQYD 1HOCB 5I17A 1YJDC 2VDKH 4TTGA 1PQZA 4Y4FA 3DMMD 1LK3L 5C0IA 4GS7C 1QLFA 5HHOB 2KPNA 4H26A 5EBLA 3RWDB 1T89A 4QHLB 3Q1SH 3RKDD 3VI3E 2ZOLB 1I8LA 1R6VA 1WFTA 1N3NA 2W59A 3RVXD 1CICC 5D70L 4W4NA 3OKNA 3UCRA 5J3HC 1S9XB 2X09A 3QIUC 5BCAA 4WI7A 3BDXA 2JCCF 4MS8C 5E2UH 4L3AA 3W9DB 1BMGA 4JN2B 4Q0XL 1RJYB 4CJ0A 1KYOK 1OAXH 2OMNA 1NGZA 3GKWL 1X5IA 5EU6E 3DIFB 2EDTA 4NQCD 1EXUB 4DKEH 2A6DA 3TP4A 4S1DC 3BN9D 2NY0B 4P23C 1JPST 2FR4A 1VKXA 2XKUA 3MV8D 3CZFA 1YJDH 3MTRA 3QXDA 1DBJL 2QQNL 7FABH 2E8YA 3LD8B 3GSWA 2BCKB 4KRMB 1XFPA 1K6QH 2VAAB 3B2UD 3T1WA 5FA4B 5SX4I 2FJHA 5SWZD 2N56A 5HHXL 1U42A 4LCWB 4Z9KB 1HCFX 5I15L 5JXED 5KBNC 4D0DB 4R26H 4IRJD 5MERA 3UMTA 1JF1B 4H20L 2ADGB 4U1LB 3VFSB 3TC9A 4LGRB 4QXGL 4HIHB 5I1HH 1LDPL 1UJ3A 2ZPKH 2VLKA 1ZHNB 1CG9A 1U8HB 4OZFB 5I66B 1GC1C 1F11B 3CVHB 4PJGF 3K4AA 5EO0B 43CAB 4ZOBA 1F4WH 4V1DD 4EOWL 2X70A 2NY5L 1JGUH 2FD6H 4K2UH 3WEXA 3GO1H 4KKAD 2XI9A 1R5WA 2Z93A 3L95B 5FECB 2E9JA 3FN0H 4ODBD 4ODHH 2FX9L 4Z7VE 4MQSB 5IMMA 1A7RH 2E9WA 3LRHA 1IEAA 1G7LA 5BRZE 3OKDA 4TUKH 4ISVB 3UTPD 5IW1A 2FB4H 1IGML 1CFNA 4IMLB 1NGPH 3O6KH 3TNNA 1CR9H 2D03H 2QLVB 5D1ZD 1MWAL 4TRPH 4PGCA 4NT6B 1BGXL 4GBXA 3HG1E 5BW7C 1WIOA 3LQMA 4APQB 2CKNA 1OB1A 4NHCL 1EZVX 3BP6A 4OM0L 1KJMA 5IHLB 4JPVH 1MFDH 5HYFA 3RL1B 3TFKD 1OP5H 2AV1B 3O8XD 1ZT1A 1GC1H 2RJMA 1EMTH 3TBTA 1EDQA 4P2OD 2NX5E 3QEQA 2DIBA 4PJ5B 4XT1C 1MCHA 1AH1A 2ENYA 5CJBA 3DBXB 3QIWB 3MLSH 3MRNB 5DQDH 5F72S 4NO2B 3KXFB 4NJAL 1FE8H 1ZS8A 4KHTH 4MNGE 3VXQA 1QFHA 3MA9L 5JNYA 1Y0LB 4G6AC 3WIHA 5D2NB 3FO9A 1C7TA 1ETZA 1INQB 1SYVA 3FQTA 1EEQA 1HHKB 4PRIE 4YHOL 1C5BH 2F53A 1UA6L 4I5BA 4XCNB 3VG9C 1MNUL 1U0QA 2A0LC 4LRIA 3UTZA 3VFOA 3C6LD 5IMLA 5GS1B 1EO8L 2IAMB 4JREC 4LPWA 4PS4H 3HHRB 3C87A 5D1XA 5IUSA 2PYED 3T65A 2D0GA 3TIDA 2XNAA 1VADA 3VFNA 3S4SA 4RRPA 5DJDB 4MNHA 1I4FA 4WUKH 1I9EA 4YXKL 2FEEI 5BOPA 5HYEA 4KTYA 4XPAL 3RVWC 5E8PB 4JFFD 2OTWB 1EK3A 4KJYB 4L3EE 1SM3L 5DJ8A 3C09C 5C0FB 2XKNA 2DQDH 3QI9D 1KJ3H 1NL0H 3T0XA 2BVYA 4XXDB 2L4OA 1QSFB 3GK8H 3QDJA 5KG9B 2OL3L 1T1WA 4KZDH 4Y2OA 3QPXH 1CDJA 1F4AA 1Q0XL 1NUDA 2H9GB 2X4QA 4PG2C 1H5BB 3HNVH 2XT1B 3VCLA 3QQ9D 3NCJH 3QUYC 2HJKB 4FXKA 5B4MD 4P3WA 5D71L 4Y4KA 3QHFH 3VXMA 2EZ0C 3ZYJA 5I71B 3C5ZC 3NCYS 3QCVL 3QG7L 4HC1L 3RGVD 1J87A 3SCMD 4F3FA 4XCYB 3IFLH 1ZSDB 2G9HA 3F62A 5F6IC 4L4VB 2XXMB 4MJIE 3ZE2E 3PGDA 3FHAA 1QQDB 3DGGA 3QNXA 2EYRB 5FIEA 4MNQE 2W0FA 2FSEB 3K2UH 4RX4A 5I1KL 5BVJA 4NYLA 2C7UB 1A64A 5FHBL 2E7LA 3WXVH 4R6UA 5EIIA 5JDSB 1A2YA 4ZFZA 1WIPA 5AZ2H 5DJ2A 4YFEA 3RA7H 1OSZB 1A6UH 1HIML 3UBXG 1HXYB 1AHWC 4OV6F 2BY3A 2EDLA 2YSSA 5IJKC 4JN1H 3O4LD 1F4YH 4FQHA 3VW3L 1Z5LA 1QBAA 1NMAH 2HFEA 5HHOE 3LRSA 1UWEL 4Y7MA 4S0SD 4Z7UF 3BQUC 4EQ2A 3QUXA 4M3KB 4YNYA 2HRPL 3GI9H 4HT1H 1FIGH 1S7SA 4XMKH 4KVNL 4X4XA 1X44A 4F57H 3CDFA 4E9LA 2DM4A 4ETQB 1CFQA 1CICB 3GJFA 1NMBH 1S7QA 1WV7T 5LBSH 3F6IA 5DHVH 1BQLH 5HGBB 3BAEL 4LLDB 5JOFB 2A6IA 2Y06H 2JIXA 1UWXH 1FG2A 4HWBL 1MRFL 1KLUA 3P4OA 1J8HA 5IKCA 4G9FE 1NSNL 4M00A 5DO2C 5B3JE 2NW2A 2MPAL 4LCIH 4PRAB 4X6CB 2V6HA 4OZGF 5FUZL 3EGSA 4P23B 4JZJA 1GJIA 1M7IA 2R0KL 4TSCL 1T1ZA 4QXUL 4PY7A 1RJZA 5I2IA 2DF3A 3GRWL 5K9KB 4O9HL 4LCWE 4X80H 1JWSB 4R0LB 4N68A 3DARA 3W81A 2Z8SA 3UTSD 4NKDA 4U1HB 4WHYH 2Y6SD 1A1OB 2Q8AH 5I8KH 4HW6A 3X11B 4OQTH 4MDJA 2GJ6B 5GGVL 1FLRL 2YMXH 3G08B 3DXAB 4XVTL 4JFXB 2DICA 1FHGA 5D1QA 4JY4B 4ZAKC 3D3VA 5T1MB 4NPYA 4AG4H 3W9EA 5FA3B 3VD9A 5EFIA 4UIKL 2Y7QA 3D85B 3MRLA 4UNVA 1I85C 3TWCL 1LVEA 1OF2A 4ZUSA 4NWTL 1C5DB 4MA7L 4UT6L 2Z92A 4F33A 3IVKA 5A43C 3Q3GB 4FQ2L 5E08H 4NUGH 3QNZA 4KI5C 4D9LH 2GTWA 3LKNA 1U58B 3VRIB 4DOHE 4ZNCD 4CMMB 1YEKH 3PWVA 3SOBH 3BKCL 5ITBL 3G6AA 2BDNL 1SEQL 5GHWH 2MOVA 5IVXF 4JFQA 4JZOB 1BQHB 5CGYD 5GJSL 2DYPD 1YNKL 4UMGA 5C08A 4DKFH 5JPMA 1CLZL 1IQDB 3PP4H 4CVUA 4GKSB 2X9WA 4CNIB 1HYSC 4PLKC 4L8BB 2J12B 2LABA 1KENH 1P7QD 3A67L 2V5RA 3ARDB 1CYGA 3BD4A 1VFUA 5IIEB 1QACA 4JO3H 4PJ5E 2SEBB 4MZ2A 1BOGA 3T08A 3NGBC 1TZIB 3W2DL 3JTTA 3NFNB 3NFPB 1FVCB 2OK0L 3BP4A 3EO0A 2F19L 1GL4B 2NTFA 5LKNA 5HYSA 1PKQA 3KXFE 2UWEF 5DRZA 3BHBB 3M8OL 4JDZB 4X0KB 3ULUC 1ZAGA 4P46B 4FZEL 5D2NE 3UPAA 1VEOA 4NNXA 3KLSA 4RAHA 2IGFH 3OZ9H 3AY4C 2OI9B 2H2SD 4PJIE 1KCVL 3MR9B 4LDOB 2CKBA 2VDQH 1IM9B 3UYPA 1FFNA 4IOFC 2YD4A 3JTSA 4OJFL 4H8WL 4HZLB 1WITA 3TBSB 4GRWH 2HTKC 4JCMA 3STLA 5FAAA 4JREB 1LO2H 1JRHI 3HLAA 3WIIL 4KAQH 4P59H 3BSZL 5F88A 4XVSL 4O51A 3ARXA 5I1IL 4FFYL 4K3JL 4H5SA 1RSFA 2UYLB 4E0RB 2EDFA 3WHXB 4I2XE 1QYGH 5FKAA 1LEKA 1NFIA 2VC2L 2R0LH 4RGOH 2GFBA 1DE4B 1QSFE 2AK4B 3JUZA 1JHLH 3KPSB 4M02A 2DQHL 4JFHD 5E6ID 3G6JF 2H3NA 2XPGA 1XGYH 4Y4FC 5KSUA 1MJ8H 3EYFA 3DX6B 4K7FB 5DJAB 1KSRA 1FZKA 2YHGA 1FFPA 1OPGL 3GGWB 1T89C 4QOKA 4EQ3A 1I9RH 4P5MA 4BYHA 4PLOB 5IFHH 4KKCD 1R5VB 2EDKA 3QUYB 1I8LC 4OF5A 5HGAB 5FYKL 1WQVT 2EYTA 1PG7L 4LOUD 1AXIB 2I24N 1ZLUH 3J8F7 3U7WL 4Z7OE 3WE6A 1DEEA 4NZUL 2ADFH 2AJUL 3PGCA 3C5JA 2CRZA 3ZKQD 4K8RH 1ED3B 5F6IB 1ORQB 3JV0A 4GQPH 5KS9E 5DHVB 2O61A 5FYJU 3CFJB 3ZKNC 3E6HB 1FGVH 1I7RB 1JI2A 1UKSA 3IDGB 2YD2A 3L3OA 5DF0A 1ZHBA 3VXTA 5A2FA 1T1YB 3NCEB 1CBVH 3BI9X 4X7TB 1QD0A 1AE6H 1TTFA 5HVGB 2GTZA 5BO1L 4LARH 1QLEH 3LPGA 1UEMA 3GSNH 2KH2B 1CDIA 2D7PA 2ESVA 1MHCB 4NKQB 3LHPL 1I1FA 5D9SB 3U7YL 3QR2A 2NYYC 1NANH 4JR9H 5GJTL 2BJML 2VLJB 5D7LA 5C9JA 1A4JA 1XGQB 3JV6A 3LEVL 3WFCL 1V7NH 2VWEC 2AJSH 3PWUA 1WEJL 3SO3C 5D6CB 3WJJC 4JPWL 1YQ2A 4G7VL 4EIGB 5KAQG 3K8MA 1PGRB 3KLAB 1UJ3C 2ZZUT 2C4FT 5F9OH 1RZ8A 1NANI 2FDBP 4M61A 1UZ8B 1GAFL 2YPKA 4ZS7H 3VFGH 4X9BA 4PJ8B 1CL7I 3NABL 2Z0BA 2BERA 4ZG1A 4PFEA 1I1YB 4P5KB 5CKGA 2ICCA 4YXHL 1A6ZB 1D6EA 2BC4B 2VDML 4NNPL 4DVRL 1MIMH 4HX1B 2WBKA 2BSRB 1FP5A 5CS7A 4UDTB 4XXCA 1RAMA 1M1SA 2C3VB 4NBXB 4X6CE 5DJYA 3B2VH 3MRMA 4WVRA 4F7CA 4UUJA 1MCNA 2F54B 4FG6D 5KSAA 1ORSB 4QO1A 1VFOA 5EO1B 1IC7H 4N0FB 2ZNXA 3Q5TA 4X5XB 5EU4B 4G8FA 1XR9A 4WWID 2PO6A 3QQ3A 4GBXC 3U7AA 5EUOA 5EOQL 4PBVC 3HB3C 1X3DA 3UEZA 4LKXB 4Z0XA 3VFRA 1KJ2A 1TZHB 3PWLB 4QLRA 3S97C 4PGZA 4HG4K 3FB7B 1INEH 1QO3A 2FX8L 3E6FB 1UM5H 1TJHH 3F58L 4HKXB 1D6VL 2VL4A 3TJHD 3BUYA 4UBDC 3FTGB 3HUJF 4ODTL 2GJ6E 4N0CD 3S4SG 4JDTH 4RRPG 4D0BA 5JOPE 1I3RB 4J1UA 3DXAE 1WZLA 1YC8A 2QQLH 1MJJA 2HH0H 3Q6FB 5DK0A 2Z9TA 3SKJL 1HZHH 2QHRH 2V9TA 3TZVC 4HWBA 3RWEB 1XGPA 4WFGE 1P1ZB 4X7EC 2B1AH 1DUYB 5IQ7H 4UT9L 5B39B 4YDVB 4UNTA 3SDYH 3GSRA 1IAOB 4WFFE 1QBML 1CFSB 4ONGL 1U92A 4BM7A 1A7OL 4FNLH 2EKSA 3NAAH 4HBCL 4IOIA 1QRNB 4N0UB 4PJAB 4R3SA 3L6FB 2ZSWB 2H6PA 3ULSA 4LRIC 5CZKA 2PXYC 3GRWA 1UACL 5DHYA 1C5CH 3S96A 4MD0B 4ZTPH 1ES0B 4JRYA 3MMEA 1QA9B 5D1XC 1YN6A 4X5WB 3BGAA 3PWPA 4O58H 5ID1A 3QEHA 5I8EB 3PWNB 4ZUWA 3THMH 4XMPH 3UJIH 3G6DL 4EI5B 3CX5J 2VITB 2OSLB 1HN1A 3MLXL 3B6SB 1A9BA 5L6YL 3PIQB 4OLYH 5C1MB 4XNUL 3RUGF 4DK6A 2VDPL 1HKLH 3TYGH 1T04A 4QTHA 5CUSH 1XF3A 3MLPA 4X6DA 4LSPL 2N7AA 1N6UA 3GMOA 3P77B 3VFUB 1J0IA 2LQRA 3NGBB 4O2FB 3TBVB 3C8HA 2CPCA 5IGXH 1CD0A 1R3IL 5FO8A 5DD5H 2F5BH 2L0DA 3SQBA 1KIQA 3OKLB 1AI1H 5I19H 1RZKH 1DVFC 5CWSA 5C70A 4Y4KC 4TVPH 3C60A 2CR3A 1MCRA 4WY7L 4MGXA 1MFBL 5CJQH 4P2QE 2W65A 3T2NL 2CIIB 1BEYH 1XGTA 4QXTA 5I1JH 2OTUA 3CX5K 3RL2A 4WI5A 2DI8A 2IPKB 2ZJSH 1DQMH 3MYZA 1CXFA 4LCCA 3NFSL 5DSCB 5INDB 3FO0H 2HLFC 5IF0A 3LEYL 4GKOA 4DN3H 3L7FA 5GS2H 4EVNA 3ARED 5GRUL 5SX5H 1J86A 2AK4E 5GZNC 1RK0A 3FQUA 3NCBB 4P3DB 3W0WE 3P9LB 1Q9KA 4JQIL 5TE6H 1CK0H 4M43L 2BOBA 5FM4A 3GSNB 3WFHB 4KGLA 5I17B 5HXMA 1KTLA 1S7WA 2A6KA 5DEZA 3QUXC 1QLFB 4H26B 3LN5B 4HAFA 3GJEA 2R9HC 2O5XH 4MXVE 3VFPA 4KK8C 4OLEA 4OV5A 2OX5A 3AGVA 4YAQA 3OKNB 2AGJH 2XY2A 1KTKE 3OTTA 5EIVA 1ZLSL 1CZ8L 2VXTH 4QYOB 5KTEH 3CSBA 4Y19A 4U6HA 2VZTA 3CMOL 4AEEA 1OTUD 4F2MB 2R23A 3V52L 4U7KA 5GGVY 4P9MH 1LP9A 4FTVD 3IFNH 4JZJC 3LY6A 2JCCB 2F58L 3CZFB 3ULVF 1B6DA 4RFEB 1B4JL 3TT1L 4HKZB 3ZO0A 2VLJE 3LQAC 3SDAD 2EE2A 1KGCE 1BBJA 3CH8A 3CFCH 4JFDE 3TT3H 4YBHA 2HVKA 25C8H 4PREA 5JUEL 2J88H 4P5TB 4X7CC 6FABL 4KRPC 1IE5A 3QQ4B 2YUVA 3CK0H 4X98B 3DVFA 4NDMA 1MI5A 2IQAB 5DJCA 3CSPA 2LU4A 5EZJA 5D1QC 3NPSB 5CD5C 2R2HB 2VLKB 1A8JH 4Y16A 2XWJA 3ILQD 5CINH 5E2VL 3O41A 5DWUH 1QSVA 3MROA 3BZDA 1RZIA 2VE6B 5HYSG 3QDMA 4QRRB 3FRUA 3H8NA 4YBLB 2F54E 5HDBE 2D7MA 3BGMB 2VH5H 1U8IB 3ZSTA 5IW1B 4LSUL 3RRQA 1CFNB 4W4OA 4PJGB 5DK2A 3GSQA 4Z0BL 2XZCH 3LQAH 4R7NB 5C92A 1L4IA 3B4NA 4BJLA 4GBXB 1YEFH 3OKEA 4OF3A 4ERSH 4XNMA 1S5IL 3V0AC 4MA3B 3BP6B 1KJMB 2ATPB 4PJBF 2H8PB 3SJVE 4J12A 1PVHA 3RX7A 4TULH 1PLGH 2A73A 3ESUF 1F2QA 1N0XL 3TBTB 2Z31B 4GW4B 4EN3D 4NC1E 4CAGA 4FFZH 3S35H 3TZVB 1BFOB 4XCCL 4LRNL 1VFMA 1A7QL 2MWCA 4KK5C 1FORH 3D25B 2GCYB 3JV5A 1DP0A 2CO7B 4ELMA 3CDCA 4WFEE 3VRJB 1Q72L 3K1KC 4XVJL 1Q8MA 5J0BA 3RZCD 2YPLA 4GKNB 1QRNE 4OCWL 2GAZB 2YR3A 1SYVB 4LSRH 3BZFA 1K8IB 1OT1A 4CGTA 5F93C 4WO4A 3UTZB 4WU5A 4KI5E 1GGIL 5MEPB 5E9DE 2PXYB 3FFCA 2X6MA 3QCTH 2AI0L 2H1PL 1WBZB 4GKZA 5DD0L 1BIIB 4GRWE 1T66D 3DURB 1YEHH 3JWNC 5SV3A 5GGSA 1LO3H 1WGOA 4ZS6D 2VXUH 2L7UA 4X99B 5ACLA 1WC7A 2EO9A 3V7MA 3CFBB 4HK3J 4RIRB 4KK6D 4LVEA 3H2WA 2ADIA 4EEEA 5I1DB 1MREL 3V5KB 3PP3K 3QDJB 3WN5B 1D5XA 1ULVA 2X4PA 3LS4H 2P5EB 4KZEL 5IESH 4H25A 2VLRD 2VB5A 4L8DB 1KN2L 2P8MA 3MFFA 3ULUE 1IGCL 2KZWA 1IAKA 4HPOL 1ZLWH 3VCLB 4HMEA 1XF1A 5CJOH 3GNML 3W11C 5LCVH 4JQVA 1DVFB 4LASL 5CMAA 3LZFH 4RISH 1FBIH 3PL6B 5ACMA 1IKFL 5M7QA 3NCFB 5C0RL 5DEFB 5C71A 1QSEB 2MJWA 3C08L 1OM3H 1BAFH 1JWUA 1OAQH 3GM0A 4X6EA 1GIGL 3EYQC 4JRXD 5CSBA 4J6RH 2AQ1A 3PDOA 2O26U 4DCQA 4RAUA 5IR1B 2CLZB 2BNRE 5F7LB 4M1GL 3PGDB 3O45A 3EIFA 4WWKA 3QNXB 4HIEA 1M71A 1U8LA 4WW2F 1DBBH 3H42L 4FQLL 5K59F 1Z9MA 3M17B 3HI1B 1WBYB 1MAMH 3TBYB 1DSFL 3S36L 1QFWH 1A2YB 1MEXL 2DI7A 4ZFZB 5DTFA 1T1XB 5A2IH 1KEGL 1WZKA 4POUB 4XP9L 2NY4C 4FHBD 3HS0A 3K4DA 4BQBA 3RY5A 4FQJL 2Z91B 3KJ6H 3WMSA 3REWA 4P2RA 4U1MA 4D2NA 4G80B 2HFEB 5T3XH 5KVEH 4O4YL 3V6BR 4ZD3L 2QV2A 1SJHA 4YNYB 1A6AA 1TVHA 2X1XR 3WLWC 2V9QA 2NPLX 4X4XB 5C0BA 3T0AA 1NH6A 4NRXA 5C0ND 4Y2DD 3GUTA 1CFBA 2HTLC 4JHWH 4FS0A 4P48A 1RURL 1DBAH 3FT2A 5D72H 1EFXA 4LNRA 5ANMB 5DVKA 4CVWA 2LVCA 3T3ME 4OCYL 3HC0B 5HYIA 2XOTA 1JPTL 5BS0D 1P9MA 4Z7UB 5D7IF 2IMNA 2JIXB 5FXCH 4NO0B 3MBED 1X6NA 1FG2B 4I18A 4KY1H 3MZGB 1QFOA 4IJ3C 4JM4L 1C1EH 4XXCC 5CSGA 2J5LC 1J8HB 2JJTA 3SGEI 3PABB 2QSTA 3EJZC 5ISZD 3I2CL 1VPOH 1NGXA 5KSAC 4C56A 4QWWD 3RWFB 3GFUA 3MUJA 1VFBA 3GSXA 1M7IB 1NGWA 4JFED 4XPFL 2OR7A 4M48L 3OB0H 4S1SL 2DQTL 3GDBA 1QRKA 3BOVA 5I2IB 1BZ9A 5TDNA 4PJDA 2DQFB 2OMBA 1RJLB 4X4MA 1II4E 4KKBD 1L0YA 3IS1X 1SMAA 4JM2F 4Y4HD 4Z95H 2VWEE 4F58L 5GRVK 4WUUD 1OGAD 2PUQT 4OFPA 4KRPB 4I4WB 4OZGB 1QNZH 3MXWH 1IZJA 3T09A 3E0GA 4MDJB 5DVOA 2VLKE 3HNTL 1G9NC 4XTRD 1S9VB 1EAPA 2WLYA 5D1QB 3S88L 3ZHDA 4NSKA 3F7PC 5TDOA 4UI2A 5EFIB 4WDIA 3MRLB 4OLWH 1N64H 5JW3H 3VA6A 1RI8A 4NC0B 4QRRE 2D7TH 4ZUSB 3AAZB 3RBSA 3CLFL 3C6SA 4XCEA 1NEZB 5L2KA 2VNCA 3IVKB 3DX9A 1JK8B 2DI9A 2CLRB 3KPRA 1RUAH 4WTZA 1KJ2H 4HV8B 3AM8C 3IDNA 1U8OB 1Z3GL 5FHAL 4PRPD 1OWRM 2Q3AA 1YEIH 4WENB 4U6YA 4M7KL 2B1HH 5A1AA 3FONB 5C08B 4QTIH 2VXSL 3VXSA 5CEYA 2IPUK 1G9NH 3A6CL 2OJEB 5CCKL 3FB5B 4HUXA 4K94L 3FO2A 2C1PA 3TNMB 5DI8B 1KCLA 3OPZL 3WUZA 1BD2D 2X4RB 1AXTH 3EO0B 5EPMB 1T21B 5JORA 5JXAL 5DFTA 3H7LA 2R8SH 1S7VA 1T5WB 4RQQA 5KW9H 1IAIH 3D69B 3OR7B 3S9DB 1VCAA 1U8QB 2ZUSA 3MRQA 4W70A 1PYWA 2HAZA 4RBPH 4NNXB 1TZGL 2C1OA 1QSZA 3EYSH 5T33L 2F53E 4YBQC 3QJHB 3IS0X 4NJ9L 1J1PH 4HFWA 1FFNB 2NY7L 5F7DA 3MJ6A 3EDFA 4HWEL 4ZPVB 3WD5H 3C8DA 2UWEB 5FGCB 3TN0A 4LCCC 4U0RC 4NWUH 4U49A 1KCUL 2GQHA 3V4VL 4OLZH 1VDGA 5F88B 2HT4D 5FFLA 1IGTA 4OIAA 3LPFA 3OB8A 5DA4A 3TESA 4OKDA 5D2LF 1MVFA 4V2BA 3HE7D 1OP3H 3QDJE 1G9MC 3I50H 2P5EE 3QAZC 1IGJB 5I6XC 3TO4D 3EFDH 1MCFA 3F12B 2XPGB 3MRHB 4NQTA 5KSUB 4KROD 1K4DA 3SKNA 1GGBL 1IILE 4XGZB 2Q7YA 1MVUB 1AC0A 2P5WA 3M1BA 4OZHF 4MDIA 4P5MB 4JFPB 4LBEA 2NTSP 4H8WC 5DC4B 3R8BB 5I1EL 2EO1A 3RVUC 4MB3A 2R4RH 2JF1A 1OLLA 1QSEE 1FVEA 4HH9A 5HGGS 3G6JB 4N1EA 3V5HA 3WE6B 1F3DH 1DEEB 3HCVB 2BSSA 4Z7QF 1OCWL 3OHXB 2ZUUA 4KC3B 1HNFA 1XGUB 4L8SA 3LN4A 1T0PB 1KC5H 4ZPTB 5FK9A 1OL0A 3EBAA 5DZOA 4KJWD 5ILTH 3QO0A 3RNQA 3VMPA 4AIZB 4HK3N 3HPLA 3NA4A 5GSRA 3SBWA 3DX7B 3QHZL 4M8QA 3UTTA 1TMCB 1X5XA 1UZ6F 4FQCH 2EXYD 4KWUA 1JZ8A 2WUBH 4TSBH 4K3DL 2I60L 2W92A 3TH2T 4JAMA 4M6OH 5GRJH 3X3FL 4CVZA 1I1FB 8CGTA 5JLZA 3RJQB 2IANB 5IFJA 2AQ2A 1RIHH 1WISA 3L5HA 4MAYA 3D1MC 2FH6A 3QIBD 4Z8FH 2HJFB 1HHGA 3D87B 3LH2L 1FPTH 3DROB 3CC5B 4F37F 3D0VA 5IVOA 1V7MH 5GRVL 3BE1L 1JHTA 3ULVC 2CUMA 5I0ZA 2EXWC 2NY3C 2VDLL 5GIRA 4KRNA 2FECI 2MTPA 5JW4N 5ANME 3FQRB 4NRYA 2YPKB 3FRPA 5CILH 3VWKC 1H3GA 1Y18A 4KHXH 1AD9A 4YHPA 3NZ8B 3DV6A 4FZ8L 3I02A 2FIRT 5HI5C 1SJEA 4PR5A 3OKYA 4H88H 4EKXA 1BZ7B 1J8HE 4S1RH 1FYTD 3LCYA 4M7LL 1GH7A 2RIKA 2V5MA 5TE7L 3QWQB 4IJ3B 1A6TA 3P0YL 4PLJD 2DN7A 1BFVL 1RULH 1ADQL 5C07B 1WFUA 2V9RA 4W4OC 5KSAB 4LP4A 3F5WB 4GRLC 5SWQA 5J6GB 2VABB 1CF8L 1I1AA 4HK0B 3VXOA 1KFAH 4DGYL 3DX8A 3WDIA 4IS6B 2E8ZA 4P4KA 3MLZL 1KJ2B 5HPOA 2OR9L 3V2AR 1F58H 4WI4A 2JELH 1O5DT 1FZJB 3ROLA 3U0WL 4PG9A 3ULVH 4OZGE 3S36X 1HILA 1PSKH 1W0VA 2R56H 1A1NB 2CRIA 4GJTB 4AT6A 4PJHA 4HKBB 4IRSD 4I77H 3IJHA 1N6QL 1YY9C 4FQPA 3WHE1 1MJJB 2HWZH 3JUYA 5BQ7B 4N5ED 5T5FH 4XP1L 4BFIB 3O6FA 5DMYA 2B0SH 1GVIA 1P7KB 2CMRH 1ACYH 3P2TA 4FQXB 1MHEA 4YXLH 4ORGA 5DC0A 1TQCB 4FRWA 1XF2B 3HUJB 4MJID 1U92B 2LAAA 2I5YL 4PD4J 4ENEC 1DANT 1RU9H 4DW2L 5IQ9B 1OVZA 2VUOA 4R3SB 2H6PB 3ULSB 3VWJB 3DWTA 4WO4C 2IEPA 3AU1A 4JHZA 1JZ5A 3T3PF 3MMEB 3KYKH 1LEIB 3MGOA 4AMKL 1YN6B 4TNWF 1S7TB 1AKJB 3U1SL 1HI6A 2ZSVB 4TPRH 4K55A 3BPLB 3ARRA 5DRWB 5C08E 15C8L 1L7IH 1M7DB 1BBDH 4G6FD 1S3KL 1A9EB 2NXYD 5HHMB 3UJJH 4H0IA 5BZDB 3C8KB 1VHPA 5E1AA 4KJQC 4XPBH 3TA3A 1W72L 4UV7L 1L7TL 3GMOB 2CLVA 3SDXA 1W0WA 3O3BB 1WCBA 4X4YA 3BKJL 1TDQA 4YEFA 5I73C 1HNGA 2ZUQB 3SE3A 1BP3B 5FYJH 3RUGB 5C6TH 1JGLH 3V6FA 4PRHA 1NAML 3DRQA 4XB7A 4IRZH 1T2XA 3MZTA 1CDYA 3OMZA 5DMGD 3UBXI 5HYQB 4I8DA 4OB5L 2GJZB 4G9FD 2P48B 4K3HA 3FQWB 1I1RA 3PHQA 3BZ4A 1B88A 2UWEE 5FGCE 2DD8L 4Z18A 2OTPA 1L6ZA 1ZK9A 3ZZ1A 3CFEA 3HE6B 4WWKC 3QUML 4YX2L 2XN9B 3JXAA 2YBRA 5EZIL 4OD2B 3BD3A 3OAYH 3MCLL 3AXLA 5KVGL 1RZJH 4YUEH 2OQJB 3BH9B 4ZFFB 3L3DB 4M6NL 4MQXC 5EN2A 5T3ZH 2NY1C 4OCNC 4GRMA 2VISB 4NHUB 4G6ML 1XF5A 4ACPA 4DAGH 2N7BA 5C2BH 1Q9KB 3HMXH 32C2A 3V0WH 5F7HA 1JWMA 3F7YA 3MLRL 3WHE0 1IC4L 1MPAH 3QWRA 3QAZB 4WW2C 3CCHA 1DN0B 1WWCA 4UT7H 1KTLB 2DIAA 4Q9RL 1VACA 3RY6A 2XTJC 1WIUA 3U2SB 3EZ8A 3BDYL 5T3XE 3GJEB 3IXAB 5EORH 2DB8A 4E41A 1P2CA 4AQOA 5EOTA 3JWDC 2FEDD 5I76B 2XFXA 4OV5B 4PJ7F 2RFXA 1MFCL 1LK2A 5J1TC 4K71C 4UQ2B 2YS4A 5AG8A 1J0YA 2DLTA 3G04A 2VSCA 4Z76A 4LF3B 2LE9A 1GGCL 4HWZA 5D7JA 4I18C 3WKML 2RB8A 3GBNL 2JJTC 2V2WB 2EIZB 3LKSA 1CU4H 1NC2B 2Y07H 2R23B 1F90H 2AKRA 2ZG2A 2VXVL 5KJRH 4WIQA 2PYFA 4HF5H 1T03L 5EO9A 1YNLH 2ESVE 2PTTA 3ZL4L 4G3YL 5KVFL 4HXBL 3LDBB 1NCCL 6CGTA 3D18B 4R4BA 4U6VH 3B8SA 3ZTNL 1S7XB 3UJTH 3EOAB 1AIFA 4WTZG 1AQDA 1P6FA 1KJVA 1ZHLA 1WUNT 2R0ZH 3CFKA 1BZQK 4D9RD 3ISWA 2XWTB 4NQDD 4JG1H 3GIZL 5DJXA 3OR6A 5CP7A 2OJZH 3T0EB 2IH3B 3KXFD 3RDTA 2O93L 3JWDH 4NDMB 4IBLT 4CKVX 2HT3C 3KYOA 1BQUA 3UZVB 2Y1VA 2DQJL 3HR6A 3WFBL 3OKKB 2NY3B 2G75A 4ZOAA 3SGDH 3QH3B 4MLSA 3VWKB 1NDGA 3X13B 4NKIH 3O41B 2CDGA 5HYJA 2ZUVA 3UROR 2E6JA 4XWGH 4XNQA 4GUPB 4MWFB 5ESQA 2ID5A 3QDMB 3U0PB 4H0GA 5TFSL 3FRUB 3I6KB 3TCLB 5C07E 3VDCA 5FCSH 3G5XA 4HIIA 1J1OL 1UCTA 4GAGL 2A77H 2Q86A 1G7JA 4UAOC 4GRLB 5LXGH 4ONHA 1WFNA 2HKHH 4XAKE 5KZCD 4U6XB 4KTDL 1QSFD 3C2AH 4PRDA 1A1MB 1S9YA 5EUKA 4CW1B 4WCYL 5A2KH 2QADC 4QRQB 1G7PA 2ARJQ 3STBA 4JKKA 1ZGLM 4LPXA 1WAAF 2APXA 1T3FA 2AXFA 1CLOL 2DQIH 2ICWA 5DJ6A 1IZKA 2AXGA 4LHUB 4XNYL 1Q9WA 3P40A 4GAFB 1FJ1B 3RAJL 3WNLA 2PW1B 1B2WL 1G7IA 3EYOA 4XH2A 4Z78B 4M7JL 1X5KA 2UY7A 3CVIH 1I7UB 1N0LA 2IMMA 3PWJA 8FABA 3QFDB 4TNVF 3OBAA 2WWKT 2IADA 1MQKL 5JMOC 3MUGA 1OARH 3HRZA 3MCG1 4PJBB 3WV0A 3PXHA 3BVNA 2WIIB 5KVDL 4GAYA 3QDGD 2YPLB 5GXBB 3VXUA 1R3LA 2BSTA 4J3VA 2B5IC 2ERJB 1X5GA 5GGTA 4K9EC 4WO4B 4MA8H 3AC0A 1A02N 1MCOH 5BMFH 3TN0C 3FFCB 3LN9A 4PUBL 5I0DA 2K7QA 3CD4A 1TJGL 2YWZA 4Y5YB 3FT4B 3LKPA 4M6ML 4DJMA 5D7SL 1U93A 1LNUA 1JGVH 1NCBH 1JFQL 4WNQA 4LHQB 4UILH 4IRJA 3U4EB 5GSVB 5HHME 3SDDC 3NH7L 4HHAB 5IB4A 2EYSA 3MREA 1JPSH 1MCWM 1SVZA 2ADIB 1L9MA 2EDJA 3L3KA 4NN5C 1DUZA 5FYLE 1M05A 1R24A 2VDRH 3HI6L 5L0QC 4PGDA 1Q9LB 5J3HD 3QFJB 4LP5A 3UYRH 3QIUD 1CXEA 4LQFL 4HAGA 4D3CL 4MS8D 3I3BA 1FL5B 3RUGE 5I73B 4M4PA 1IAKB 5MHSE 1EEZB 3L7EA 4PJEA 4UV4L 4PJ9B 1K2DA 3TH4T 5M94B 1F3JB 4NN7C 4Q2ZB 3ARQA 1RPQA 3KPMA 5HJ3A 1D9KA 1JPFA 2DLGA 3PGFL 3OXSA 3P11L 5EBWA 1I8KA 4I0PA 4L29B 3MLYH 3V6ZB 1YUHA 1JI1A 3CVHL 2NZ9D 3LKQA 4S1DD 4YHNB 1YYLH 2F74B 5EU6A 1YMMB 3H9SB 4L8SC 5SWSB 5FEBA 5HPMA 2WINA 2ARJB 5ALBH 2XN9E 4RAUB 3FRPG 4GOSA 4FOMA 3P73A 3ZKMC 4N0YL 3T77B 3HZYB 5JHLL 3V0VA 3RIFK 1KIRB 1SEBA 1R3HA 1KPRB 4JO2L 2IC2A 4F7TA 1W2KT 4RGNC 5E8OA 2Y5TA 5DTFB 5MEOB 3SDCB 1LEGB 3FCTA 4NUJB 2XZQH 2GJ6D 4JPIB 5JOPD 3AMLA 2Y5EA 5KSBF 3AS3A 4JKWA 4MAYC 1DFBH 2HFGH 1MFAH 1OY3B 4WW2B 4U1MB 3AMKA 4ONOA 2FH8A 2WNGA 4OGYH 5F71A 3MJ8A 3D85D 2XTJB 3L5IA 1YDPB 3BPNC 1P4BL 1R0AL 5E8DL 3Q6GH 5IEHA 1EPFA 5AZEL 3PDGA 5EG6C 4PJCA 1P4LB 4HCRL 3MQIA 3EO1A 3GUTB 2I27N 4YDJA 3QUMA 3OJ2C 3FT2B 5GS3A 4K71B 3KVQA 3ZT6A 4LSQL 4OIIH 5HHNB 4Z7NE 5E5MA 5BRZA 1DBML 4JKLA 2C3GA 1S7RB 1NBZA 2FRGP 5DUBB 3DTXB 4XNZB 3MV9D 1JYNA 1JMZA 1LP9E 3HNSH 4L9DA 3NN8B 2A1WL 1QKZH 2EH7H 2APBA 4C56B 3B3IA 3HG1A 1GPOL 1I1AC 4I3RH 5BVPL 1VFBB 1BLNA 1MRCL 4MLIA 2XYCA 4NOFA 5D7IB 4RDQG 3HI5L 4P4KC 1PAMA 2B39A 4L3CB 1FN4A 3F6LA 3KLHD 3JV4B 5IHBA 3RWGA 1E4WL 4TTDC 4LCYA 5FKPA 3T0EE 5JW5A 2D31A 4O02L 4Y5VA 1GSMA 2NX5A 3D2UB 1ZOXA 2VDNH 5GGRY 1MI5E 4AM0B 5MP6H 4LDLB 4OD3L 1RUQH 5DQJB 3ULVE 4RMWA 2OBGA 3MOBH 5L2JA 3WNNA 4G6AD 4LMQE 1F8TH 5DURD 3SCMA 1P69B 1F5WA 3A6BH 3DHMA 3GSOA 3VFTA 1DR9A 4MNGA 3GMRB 5EZOL 2GW5A 3R8QA 1IM9D 3O6FC 4GSDL 3KPLA 1R5IA 4P2QD 4J3UA 4OTXH 2A0LD 3G5ZB 1T0MA 5TDOB 4X9HA 2VDKL 3OGCB 4KPHH 4JM2B 3RNKB 4PRIA 5EA0H 3O11A 5GZOC 2OLDA 5HHPA 3QDME 4OCLC 4HH8A 3HZMA 5AYQA 2WBJB 3C6SB 2CGRH 3Q1SL 4KMTH 4OUUA 1U95A 2VERN 5L2KB 4HUUA 4QRTA 1CFTA 3JWOC 4J3SA 3RVWD 1NJ9A 1K5NB 1E28A 5INCA 5FF6A 2AK4D 1ZLVK 4JFOB 3BWAB 5E2UL 3KYAA 3W0WD 1Q9OB 4L3EA 4OI7A 35C8H 5F7EH 2FATH 5I1GH 1BIHA 5ICXA 3SGJA 1ZT4B 1MHPH 2QEJA 5I74C 2X89A 3VXSB 4DKEL 3TA3C 4PTUA 4EDWL 3ARBC 3KS0J 3QUYD 4H0HB 4HLZG 4W6WB 4OT1H 3FO2B 2C1PB 3VXRB 3IETB 5E7FA 3T8XA 1YJDL 5C0EA 3BGFC 7FABL 1KB5L 2EZ0D 2CUHA 3C5ZD 3IAGC 1K8DB 1K6QL 3GMNA 1S7VB 4CDHA 4RQQB 1U8KA 2YPLE 3MRQB 2HMIC 4OLVL 3IDMA 1ERNA 2WLZA 4UTBL 3O9WC 3E2HC 3H7BA 3JWOH 4R26L 3CPLA 3ARFD 1U3HC 5D70H 2VDOH 1FVDB 2CDEA 3FFCE 1EERB 3OF6A 2ZPKL 4MNQA 3F7RA 4WI8A 4ZUTA 1L0QA 4WV1A 3MGTA 3PHOB 5K33A 4GW1A 1F4WL 2NR6C 1PZ5A 1JGUL 5DDHB 2FD6L 4K2UL 3GO1L 4U6TA 3ZSSA 3RKPA 2YUWA 4CBPA 5F1SA 5C6PB 2VLJD 1HOCA 1KGCD 3RTQD 4JFDD 5IOPB 2BX5A 1A7RL 3SDDB 1JHKH 3BQUD 1BREA 2FLBT 3FAXA 4YR6A 5T3ZE 4CADB 5MI0C 5HHOA 4KKLC 3RWDA 2FB4L 4KH2A 3H9HB 1NGPL 4QNPE 3WFDH 4QHLA 1CR9L 2D03L 3QFJE 3R06A 2ZOLA 2QQNH 5L0QB 3JBG7 4TRPL 2J6EA 1WFOA 1NBYB 3SKNB 5F7NC 2VJXA 2WK2A 1T7YA 2Q7YB 4L8CB 4DUWA 5MENB 1CGTA 1AR1D 3H0TA 3W9DA 5D2LB 4MXWH 1MFDL 4JN2A 2X1OA 1RJYA 4X5LA 1N5YH 1BECA 3CDGB 4HUWB 1LDPH 1FVEB 5EWIL 1GC1L 3DIFA 1YMME 4L5FH 1EXUA 1N59B 2KL6A 4QRPB 5EOCL 3V5HB 1EVTC 2BSSB 4WJ5A 5D7JC 3LN4B 3MLSL 5TF1H 5FK9B 4JG0H 4ZO7A 4NP4H 5DQDL 1EHXA 4OZHB 2NXZB 1FE8L 4XZUB 4KHTL 3HAEH 4MCZA 2BCKA 2FX9H 4JANA 2AW2A 2HFFB 1JUFB 2V5TA 5D5MF 3QEUA 4LCWA 4RGNB 1C5BL 3N1MC 1I9JH 3SJVD 4FABH 3MRBB 4CVZB 4D0DA 5CHNB 3WL9A 4P2RE 1FDLH 4PS4L 1L6XA 3HC3L 1JF1A 4U1LA 3MLVH 3VFSA 5F89B 5K59E 4HIHA 3B9KC 4MAYB 4ZAKD 4RCAA 2XTJE 1QLRA 5F9WB 3OSKA 1ZHNA 1U8HA 4OZFA 1NDMB 5C0AD 3RDTC 5I66A 1JMXA 1C08B 3V79C 4WUKL 4P2CG 2O5YH 3CVHA 5EO0A 5LG1A 43CAA 4ELKB 2BXYA 1XIWA 5C3LD 1JHTB 4U1GC 4WFED 3H3BC 1RZGB 3T1FA 3G5YB 3B9AA 5FECA 3L95A 2DQDL 1KJ3L 1NL0L 1QRND 2ZCKH 2NY2C 4NKOB 4LSSH 3GK8L 1U8PB 1DZBA 3QPXL 4LSTH 4ISVA 1VESA 2L7JA 4KI5D 3QUZD 5E9DD 4IMLA 3HNVL 1NLBL 3BP5B 5IHZB 4OKVB 1UKTA 4XP5L 1RUMH 4NFDA 3ZT5A 4NT6A 1H8SA 3IRPX 1PJ9A 4C56E 3BJLA 4FQQB 3L3HB 3OGOE 4APQA 1M7XA 1JGDB 3QHFL 5SWQB 2D9CA 1MNUH 3IAQA 1I1AB 1QR1B 5EH1A 3L1OH 3MRRB 4XX1G 3VXOB 5JZ7C 2HP4A 4PJDE 2AV1A 4WTXA 4X4ME 4DGVH 3NIFE 2VN4A 5JIPA 2BP3A 3RKDC 2J4WL 5EC1A 2DJSA 4PJ5A 1X4ZA 1U3YA 4PG9B 1HILB 4HCRA 3DBXA 3QIWA 5GGUB 4RZCB 3MRNA 3ULUD 4JFYA 4WEUD 4NO2A 4N9OB 3RA7L 1Y0LA 1A6UL 3MOAH 3K2MC 5D2NA 4Y1AB 1INQA 5IBTH 3IDYC 3V5DB 4BZ1H 5IMOB 1HHKA 4JN1L 2FO1A 4IOFD 1F4YL 3MV7D 4M9OA 2X4OA 1HXMA 1MHEB 2GJJA 1U8NB 3KYMA 4ORGB 1NMAL 3ORJA 5FM8A 1PFCA 2HTKD 1NBVH 2AERT 2IAMA 5DHXB 5T1LB 1NBQA 2BNRD 1KCRH 3GI9L 5L2KE 1FIGL 4XMKL 1NCUA 1YQVH 2WWKO 4F57L 1REIA 3K81A 4LLMB 4ZOEA 5DJDA 3QG7H 5F1IB 4HC1H 1NMBL 4RMSA 5LBSL 1QFWM 1BQLL 2OTWA 4KJYA 1AO7B 2IBZX 2D0FA 5C0FA 5BV7C 2Y06L 4XXDA 4IRJC 3T04D 1KCKA 4UDUB 5KG9A 3VXSE 4Y4FD 1QFPA 3UC0L 3VGFA 5C0DB 5I74B 2WSKA 3KYNA 1H5BA 4LCIL 2QR0A 5IWLA 3TA3B 3ARBB 3UYOD 2D9QB 2HJKA 4OFYA 4JCLA 4R2GB 1YN7B 4HLJA 4GMTL 4XHQA 2A74B 3GKZA 1IGIH 4K7PX 3DJ9A 4XCYA 1ZSDA 5F7KC 1D9KC 2DAVA 4PRHB 1KTRL 4L4VA 3DRQB 5F3HB 3U6RB 1LE9B 3O9WB 4C57C 5AYUH 3E2HB 2Q8AL 5I8KL 3WNKA 1QQDA 4QY8B 5AWNH 4OQTL 5L88H 2EYRA 5DMJB 1U3HB 5ESVB 2UZYB 1NMCC 1QPPA 3PHQB 3BZ4B 1KTDB 4MQTB 3FO1A 4U0QB 5BV7H 4F7PB 2E5EA 4QHMA 1N4XH 3RPIB 2Z4QA 4G6JH 1OSZA 1OTTC 5E00B 1HXYA 2YBRB 2NYYD 3P30H 1AR2A 3S3PA 2DMKA 5ALCL 4P2OC 3D39B 3HAEB 5E03A 3Q2CA 4NUGL 1JWMB 3F7YB 4D9LL 2QTEA 2R0KH 1SYSA 2P8PB 4OSUH 4P3CH 1HK6A 1NUGA 1YEKL 5ADPH 1CICA 1U36A 1VACB 5GHWL 5MENE 3BJ91 1K4CB 4Y89A 3MRPB 3ARTA 5D2LE 1RVFH 5HGBA 4LCUB 1A47A 3BMVA 3PP4L 4LLDA 1P2CB 4HS6A 3C6LC 3KJ4C 3FT3B 4LFHG 1KENL 2J8UA 1EV2E 2N1KA 4JO3L 4XVTH 1RIVH 2LTQC 1DQQB 2XZAH 3FN9A 4PRAA 4X6CA 4LEXH 3EDJA 4OZHE 3N85H 4HWZB 5D7JB 4P23A 5KANI 2DJ4A 1G1CA 2DLEA 3R4DA 4PJFA 3LKSB 4GBXD 2DQCH 3HB3D 4MA7H 3UTTE 4UT6H 2F9BT 4DVBA 1LO5B 4HIJA 4MVBC 5K9KA 4RGNE 1OQOA 3CU1A 4KQ3H 4UZGA 1KXQE 4GLRH 1JWSA 4R0LA 3MLUH 2A83B 2VDQL 1I8MB 2Y36H 1FNEB 1QR4A 5DT1L 1JYWA 4EUPH 2AV7B 4U1HA 3O3AB 2AJ3B 4GAJH 1VGKB 1A1OA 1F6LL 4M7ZC 3QEQD 1LO2L 1AQDB