2YVHA

Crystal structure of the operator-binding form of the multi-drug binding transcriptional repressor cgmr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
b'SKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription/dna
total genus 55
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yvhA00
3ANGA 1QPIA 5CW8A 3TP0A 5K7ZA 3ZQGA 3F1BA 4X1EA 3KNWA 5FKOA 4MXMA 5F0HA 5J1RA 3QBMA 3O60A 2VPRA 5FHPA 3PM1A 1Z0XA 2G3BA 3G1MA 3HGYA 3V78A 2IAIA 3ZQFA 3G1LA 2XPVA 3BTIA 5DAJA 3LHQA 2GENA 5CXIA 4V2FA 5IOYA 3CCYA 5IOZA 4ABZA 3FK6A 5F27A 3AQTA 3ZQIA 1QVUA 2XPUA 3BHQA 3Q3SA 3B81A 2ZCMA 5F1JA 2NP3A 2QTQA 3BQYA 4CGRA 3VP5A 3EGQA 5H9TA 2XGDA 2O7OA 3VW1A 2X6OA 2G7GA 2UXIA 3HGGA 3G7RA 3RH2A 2F07A 2JJ7A 2ZCXA 5IPAA 3LWJA 3QPSA 3BR6A 3HTIA 4D5FA 1A6IA 5EZHA 4PXIA 3C2BA 4ME9A 3VVXA 5HSZA 3ON2A 3SFIA 3Q0WA 3MVPA 4B3AA 4M3BA 1JT6A 3JSJA 3VW2A 3HTAA 2RHAA 4MK6A 5GP9A 4B1RA 3VW0A 1UI5A 2YVEA 2REKA 5F08A 2QWTA 2PBXA 1ZKGA 2GBYA 3E7QA 3IH3A 1JTYA 4UDSA 1JTXA 2Y31A 2FBQA 4GCKA 3BR1A 3BTCA 3NRGA 2OERA 4M3FA 3WHCA 3VUQA 1BJZA 5K58A 3IH2A 2PZ9A 5D19A 1JUMA 1SGMA 3V6GA 4GCTA 3BR3A 3QKXA 2HYTA 3P9TA 4MO7A 2HKUA 2G7SA 3MNLA 5F0CA 3DCFA 1JUPA 2I10A 3C07A 2QCOA 2XGEA 3VPRA 2TRTA 3HE0A 3VOKA 3LSRA 3NXCA 2ZOYA 3IUVA 2WUIA 5IP6A 2Y30A 1T56A 2X9DA 3BJBA 2IEKA 4D7NA 5F0FA 3GZIA 3BR0A 3LSPA 5HAWA 1Z77A 2EH3A 4NN1A 3ZQLA 1JT0A 5CXGA 3CJDA 4DW6A 2IBDA 3ZQHA 3HTJA 5EZGA 3QPLA 5FKKA 5FKMA 2QKOA 3G56A 3KKDA 4AUXA 2RASA 3ON4A 4M3DA 3TP3A 4GFKA 2QIBA 4GCLA 3BR5A 2WV1A 3G1OA 2O7TA 2D6YA 2XPWA 4AC0A 4ICHA 2FJ1A 3Q0VA 2XB5A 4M3GA 2DTZA 2XDNA 3LSJA 2TCTA 2XGCA 4NELA 2UXOA 4ACIA 5D1RA 2Y2ZA 5EYRA 5FGLA 4M3EA 2V57A 3F0CA 1UI6A 2DG7A 3S5RA 2VKEA 3T6NA 2OI8A 4V2GA 5F04A 5EFYA 1RKWA 2HYJA 4W97A 2ID6A 4GFLA 5FKNA 1ORKA 3BTLA 3CDLA 2ZOZA 2ZB9A 2YVHA 3FRQA 3EUPA 4JNNA 2VKVA 3Q0UA 2OPTA 4G12A 3PASA 5J1UA 5FMPA 2RAEA 2G0EA 2Q24A 2W53A 3NI7A 3BQZA 1JUSA 4JYKA 2UXPA 2XRLA 3DPJA 5AQCA 3BCGA 3SDGA 5HBUA 2GUHA 3O8HA 4D7MA 5D18A 2ZCNA 2QOPA 4JKZA 3KZ9A 2DG8A 4I6ZA 4YZEA 1ZK8A 2HXOA 2HQ5A 2UXHA 3BTJA 3CRJA 3B6AA 4AC6A 3AQSA 3PPBA 5J3LA 3DEWA 5C4YA 2NX4A 2NP5A 5FKLA 1RPWA 2NS7A 3BR2A 3CWRA 1RKTA 2FD5A 4D5CA 5GPCA 4JL3A 4XK4A 2GFNA 3LJLA 3B6CA 2UXUA 1VI0A 2IU5A 5K7HA 1U9OA 3NPIA 3O8GA 3VIBA 3ANPA 2ID3A 3HIMA 3IH4A 2WGBA 5K7FA 3BNIA 4AF5A 3QQAA 1U9NA 3BRUA 3RD3A 3VVZA 2FX0A 3BT9A 3HTHA 5J1YA 2G7LA 2OF7A 3KKCA 2FQ4A 4HKUA 5GPAA 3LOCA 3FIWA 3GEUA 2NS8A 4W1UA 4L62A 3VVYA 3NNRA 1T33A 4KWAA 3WHBA 3VOXA 4I76A 3COLA 1QVTA 2JK3A 3FK7A 2HXIA
chains in the Genus database with same CATH superfamily
3ANGA 1QPIA 2R7SA 5CW8A 3TP0A 4WIBA 5K7ZA 2R7VA 3ZQGA 3DU5A 3F1BA 4X1EA 3KNWA 5FKOA 4MXMA 5F0HA 2ZY9A 5J1RA 3QBMA 3O60A 2VPRA 5FHPA 3PM1A 1Z0XA 2G3BA 3G1MA 3HGYA 3V78A 2IAIA 3ZQFA 3G1LA 2XPVA 3BTIA 5DAJA 3LHQA 2GENA 5CXIA 4V2FA 5IOYA 3CCYA 5IOZA 4ABZA 3FK6A 5F27A 3AQTA 3ZQIA 1QVUA 2XPUA 3BHQA 3Q3SA 3B81A 2ZCMA 5F1JA 2NP3A 2QTQA 3BQYA 3FHNA 4CGRA 3VP5A 3EGQA 5H9TA 2XGDA 2O7OA 3VW1A 2X6OA 2G7GA 2UXIA 3HGGA 3G7RA 3RH2A 2F07A 2JJ7A 2ZCXA 5IPAA 2R7XA 3LWJA 3QPSA 3BR6A 3HTIA 4D5FA 1A6IA 5EZHA 4PXIA 4IRVA 3C2BA 4ME9A 3VVXA 5HSZA 3ON2A 3SFIA 3Q0WA 3MVPA 4B3AA 4M3BA 1JT6A 3JSJA 3VW2A 3HTAA 2RHAA 4MK6A 5GP9A 4B1RA 3VW0A 1UI5A 2FJI1 2YVEA 2REKA 5F08A 2QWTA 2PBXA 1ZKGA 2GBYA 3E7QA 3IH3A 1JTYA 4UDSA 1JTXA 2Y31A 2FBQA 4OD4A 4GCKA 3BR1A 3BTCA 3NRGA 2OERA 4M3FA 3WHCA 3VUQA 1BJZA 5K58A 3IH2A 2PZ9A 5D19A 1JUMA 1SGMA 3V6GA 4GCTA 3BR3A 3QKXA 2HYTA 3P9TA 4MO7A 2HKUA 2G7SA 3MNLA 5F0CA 3DCFA 1JUPA 2I10A 3C07A 2QCOA 2XGEA 3VPRA 2TRTA 3HE0A 3VOKA 3LSRA 3NXCA 2ZOYA 3IUVA 2WUIA 5IP6A 2Y30A 1T56A 2X9DA 3BJBA 2IEKA 4D7NA 5F0FA 3GZIA 4C2MA 3BR0A 3LSPA 5HAWA 2R7QA 1Z77A 2EH3A 4NN1A 3ZQLA 1JT0A 5CXGA 3CJDA 4DW6A 2IBDA 3ZQHA 3HTJA 5EZGA 3QPLA 5FKKA 5FKMA 2QKOA 3G56A 3KKDA 4AUXA 2RASA 3ON4A 4M3DA 3TP3A 4GFKA 2QIBA 4GCLA 3BR5A 2WV1A 3G1OA 3NS4A 2O7TA 2D6YA 2XPWA 4AC0A 4ICHA 2FJ1A 3Q0VA 2XB5A 3SWHA 4M3GA 2DTZA 2XDNA 3LSJA 2TCTA 2XGCA 4NELA 2UXOA 4ACIA 5D1RA 2Y2ZA 5EYRA 5FGLA 4M3EA 2V57A 3F0CA 1UI6A 3VTIA 2DG7A 3S5RA 2VKEA 3T6NA 2OI8A 4V2GA 5F04A 5EFYA 1RKWA 2HYJA 4W97A 2ID6A 4GFLA 5FKNA 1ORKA 3BTLA 3CDLA 2ZOZA 2ZB9A 3KYLA 2YVHA 3FRQA 3EUPA 4JNNA 2VKVA 3Q0UA 2OPTA 4G12A 3PASA 5J1UA 5FMPA 2RAEA 2G0EA 2Q24A 2W53A 3NI7A 2R7OA 3BQZA 1JUSA 4OD5A 4JYKA 2UXPA 2XRLA 3DPJA 4U9NA 5AQCA 3BCGA 3SDGA 5HBUA 2YVXA 2GUHA 3O8HA 4D7MA 4DVYP 5D18A 2R7UA 2R7TA 2B1EA 2ZCNA 2QOPA 4JKZA 4U9LA 3KZ9A 2DG8A 4I6ZA 4YZEA 1ZK8A 2B3WA 2HXOA 2HQ5A 2UXHA 3BTJA 3CRJA 3B6AA 4AC6A 3AQSA 3PPBA 2R7WA 5J3LA 3DEWA 5C4YA 2NX4A 2NP5A 5FKLA 1RPWA 2NS7A 3BR2A 3CWRA 1RKTA 2FD5A 4D5CA 5GPCA 4JL3A 4XK4A 2GFNA 3LJLA 3B6CA 2UXUA 1VI0A 2PFVA 2IU5A 5K7HA 1U9OA 3NPIA 3O8GA 3VIBA 3DU6A 3ANPA 2ID3A 3HIMA 3IH4A 2WGBA 5K7FA 3BNIA 4AF5A 3QQAA 1U9NA 3BRUA 3RD3A 5CQGA 3VVZA 2FX0A 2A2FX 3BT9A 3HTHA 3K8PC 5J1YA 2R7RA 2G7LA 4HKUA 2OF7A 2FQ4A 3KKCA 5GPAA 3LOCA 3FIWA 3GEUA 2NS8A 4W1UA 4L62A 3VVYA 3NNRA 1T33A 4KWAA 3WHBA 3VOXA 4I76A 3COLA 1QVTA 2JK3A 3FK7A 2HXIA
chains in the Genus database with same CATH topology
3ANGA 1QPIA 5CW8A 3TP0A 5K7ZA 3ZQGA 3F1BA 4X1EA 3KNWA 5FKOA 4MXMA 5F0HA 5J1RA 3QBMA 3O60A 2VPRA 5FHPA 3PM1A 1Z0XA 2G3BA 3G1MA 3HGYA 3V78A 2IAIA 3ZQFA 3G1LA 2XPVA 3BTIA 5DAJA 3LHQA 2GENA 5CXIA 4V2FA 5IOYA 3CCYA 5IOZA 4ABZA 3FK6A 5F27A 3AQTA 3ZQIA 1QVUA 2XPUA 3BHQA 3Q3SA 3B81A 2ZCMA 5F1JA 2NP3A 2QTQA 3BQYA 4CGRA 3VP5A 3EGQA 5H9TA 2XGDA 2O7OA 3VW1A 2X6OA 2G7GA 2UXIA 3HGGA 3G7RA 3RH2A 2F07A 2JJ7A 2ZCXA 5IPAA 3LWJA 3QPSA 3BR6A 3HTIA 4D5FA 1A6IA 5EZHA 4PXIA 3C2BA 4ME9A 3VVXA 5HSZA 3ON2A 3SFIA 3Q0WA 3MVPA 4B3AA 4M3BA 1JT6A 3JSJA 3VW2A 3HTAA 2RHAA 4MK6A 5GP9A 4B1RA 3VW0A 1UI5A 2YVEA 2REKA 5F08A 2QWTA 2PBXA 1ZKGA 2GBYA 3E7QA 3IH3A 1JTYA 4UDSA 1JTXA 2Y31A 2FBQA 4GCKA 3BR1A 3BTCA 3NRGA 2OERA 4M3FA 3WHCA 3VUQA 1BJZA 5K58A 3IH2A 2PZ9A 5D19A 1JUMA 1SGMA 3V6GA 4GCTA 3BR3A 3QKXA 2HYTA 3P9TA 4MO7A 2HKUA 2G7SA 3MNLA 5F0CA 3DCFA 1JUPA 2I10A 3C07A 2QCOA 2XGEA 3VPRA 2TRTA 3HE0A 3VOKA 3LSRA 3NXCA 2ZOYA 3IUVA 2WUIA 5IP6A 2Y30A 1T56A 2X9DA 3BJBA 2IEKA 4D7NA 5F0FA 3GZIA 3BR0A 3LSPA 5HAWA 1Z77A 2EH3A 4NN1A 3ZQLA 1JT0A 5CXGA 3CJDA 4DW6A 2IBDA 3ZQHA 3HTJA 5EZGA 3QPLA 5FKKA 5FKMA 2QKOA 3G56A 3KKDA 4AUXA 2RASA 3ON4A 4M3DA 3TP3A 4GFKA 2QIBA 4GCLA 3BR5A 2WV1A 3G1OA 2O7TA 2D6YA 2XPWA 4AC0A 4ICHA 2FJ1A 3Q0VA 2XB5A 4M3GA 2DTZA 2XDNA 3LSJA 2TCTA 2XGCA 4NELA 2UXOA 4ACIA 5D1RA 2Y2ZA 5EYRA 5FGLA 4M3EA 2V57A 3F0CA 1UI6A 2DG7A 3S5RA 2VKEA 3T6NA 2OI8A 4V2GA 5F04A 5EFYA 1RKWA 2HYJA 4W97A 2ID6A 4GFLA 5FKNA 1ORKA 3BTLA 3CDLA 2ZOZA 2ZB9A 2YVHA 3FRQA 3EUPA 4JNNA 2VKVA 3Q0UA 2OPTA 4G12A 3PASA 5J1UA 5FMPA 2RAEA 2G0EA 2Q24A 2W53A 3NI7A 3BQZA 1JUSA 4JYKA 2UXPA 2XRLA 3DPJA 5AQCA 3BCGA 3SDGA 5HBUA 2GUHA 3O8HA 4D7MA 5D18A 2ZCNA 2QOPA 4JKZA 3KZ9A 2DG8A 4I6ZA 4YZEA 1ZK8A 2HXOA 2HQ5A 2UXHA 3BTJA 3CRJA 3B6AA 4AC6A 3AQSA 3PPBA 5J3LA 3DEWA 5C4YA 2NX4A 2NP5A 5FKLA 1RPWA 2NS7A 3BR2A 3CWRA 1RKTA 2FD5A 4D5CA 5GPCA 4JL3A 4XK4A 2GFNA 3LJLA 3B6CA 2UXUA 1VI0A 2IU5A 5K7HA 1U9OA 3NPIA 3O8GA 3VIBA 3ANPA 2ID3A 3HIMA 3IH4A 2WGBA 5K7FA 3BNIA 4AF5A 3QQAA 1U9NA 3BRUA 3RD3A 3VVZA 2FX0A 3BT9A 3HTHA 5J1YA 2G7LA 2OF7A 3KKCA 2FQ4A 4HKUA 5GPAA 3LOCA 3FIWA 3GEUA 2NS8A 4W1UA 4L62A 3VVYA 3NNRA 1T33A 4KWAA 3WHBA 3VOXA 4I76A 3COLA 1QVTA 2JK3A 3FK7A 2HXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANG A;  1QPI A;  5CW8 A;  3TP0 A;  5K7Z A;  3ZQG A;  3F1B A;  4X1E A;  3KNW A;  5FKO A;  4MXM A;  5F0H A;  5J1R A;  3QBM A;  3O60 A;  2VPR A;  5FHP A;  3PM1 A;  1Z0X A;  2G3B A;  3G1M A;  3HGY A;  3V78 A;  2IAI A;  3ZQF A;  3G1L A;  2XPV A;  3BTI A;  5DAJ A;  3LHQ A;  2GEN A;  5CXI A;  4V2F A;  5IOY A;  3CCY A;  5IOZ A;  4ABZ A;  3FK6 A;  5F27 A;  3AQT A;  3ZQI A;  1QVU A;  2XPU A;  3BHQ A;  3Q3S A;  3B81 A;  2ZCM A;  5F1J A;  2NP3 A;  2QTQ A;  3BQY A;  4CGR A;  3VP5 A;  3EGQ A;  5H9T A;  2XGD A;  2O7O A;  3VW1 A;  2X6O A;  2G7G A;  2UXI A;  3HGG A;  3G7R A;  3RH2 A;  2F07 A;  2JJ7 A;  2ZCX A;  5IPA A;  3LWJ A;  3QPS A;  3BR6 A;  3HTI A;  4D5F A;  1A6I A;  5EZH A;  4PXI A;  3C2B A;  4ME9 A;  3VVX A;  5HSZ A;  3ON2 A;  3SFI A;  3Q0W A;  3MVP A;  4B3A A;  4M3B A;  1JT6 A;  3JSJ A;  3VW2 A;  3HTA A;  2RHA A;  4MK6 A;  5GP9 A;  4B1R A;  3VW0 A;  1UI5 A;  2YVE A;  2REK A;  5F08 A;  2QWT A;  2PBX A;  1ZKG A;  2GBY A;  3E7Q A;  3IH3 A;  1JTY A;  4UDS A;  1JTX A;  2Y31 A;  2FBQ A;  4GCK A;  3BR1 A;  3BTC A;  3NRG A;  2OER A;  4M3F A;  3WHC A;  3VUQ A;  1BJZ A;  5K58 A;  3IH2 A;  2PZ9 A;  5D19 A;  1JUM A;  1SGM A;  3V6G A;  4GCT A;  3BR3 A;  3QKX A;  2HYT A;  3P9T A;  4MO7 A;  2HKU A;  2G7S A;  3MNL A;  5F0C A;  3DCF A;  1JUP A;  2I10 A;  3C07 A;  2QCO A;  2XGE A;  3VPR A;  2TRT A;  3HE0 A;  3VOK A;  3LSR A;  3NXC A;  2ZOY A;  3IUV A;  2WUI A;  5IP6 A;  2Y30 A;  1T56 A;  2X9D A;  3BJB A;  2IEK A;  4D7N A;  5F0F A;  3GZI A;  3BR0 A;  3LSP A;  5HAW A;  1Z77 A;  2EH3 A;  4NN1 A;  3ZQL A;  1JT0 A;  5CXG A;  3CJD A;  4DW6 A;  2IBD A;  3ZQH A;  3HTJ A;  5EZG A;  3QPL A;  5FKK A;  5FKM A;  2QKO A;  3G56 A;  3KKD A;  4AUX A;  2RAS A;  3ON4 A;  4M3D A;  3TP3 A;  4GFK A;  2QIB A;  4GCL A;  3BR5 A;  2WV1 A;  3G1O A;  2O7T A;  2D6Y A;  2XPW A;  4AC0 A;  4ICH A;  2FJ1 A;  3Q0V A;  2XB5 A;  4M3G A;  2DTZ A;  2XDN A;  3LSJ A;  2TCT A;  2XGC A;  4NEL A;  2UXO A;  4ACI A;  5D1R A;  2Y2Z A;  5EYR A;  5FGL A;  4M3E A;  2V57 A;  3F0C A;  1UI6 A;  2DG7 A;  3S5R A;  2VKE A;  3T6N A;  2OI8 A;  4V2G A;  5F04 A;  5EFY A;  1RKW A;  2HYJ A;  4W97 A;  2ID6 A;  4GFL A;  5FKN A;  1ORK A;  3BTL A;  3CDL A;  2ZOZ A;  2ZB9 A;  2YVH A;  3FRQ A;  3EUP A;  4JNN A;  2VKV A;  3Q0U A;  2OPT A;  4G12 A;  3PAS A;  5J1U A;  5FMP A;  2RAE A;  2G0E A;  2Q24 A;  2W53 A;  3NI7 A;  3BQZ A;  1JUS A;  4JYK A;  2UXP A;  2XRL A;  3DPJ A;  5AQC A;  3BCG A;  3SDG A;  5HBU A;  2GUH A;  3O8H A;  4D7M A;  5D18 A;  2ZCN A;  2QOP A;  4JKZ A;  3KZ9 A;  2DG8 A;  4I6Z A;  4YZE A;  1ZK8 A;  2HXO A;  2HQ5 A;  2UXH A;  3BTJ A;  3CRJ A;  3B6A A;  4AC6 A;  3AQS A;  3PPB A;  5J3L A;  3DEW A;  5C4Y A;  2NX4 A;  2NP5 A;  5FKL A;  1RPW A;  2NS7 A;  3BR2 A;  3CWR A;  1RKT A;  2FD5 A;  4D5C A;  5GPC A;  4JL3 A;  4XK4 A;  2GFN A;  3LJL A;  3B6C A;  2UXU A;  1VI0 A;  2IU5 A;  5K7H A;  1U9O A;  3NPI A;  3O8G A;  3VIB A;  3ANP A;  2ID3 A;  3HIM A;  3IH4 A;  2WGB A;  5K7F A;  3BNI A;  4AF5 A;  3QQA A;  1U9N A;  3BRU A;  3RD3 A;  3VVZ A;  2FX0 A;  3BT9 A;  3HTH A;  5J1Y A;  2G7L A;  2OF7 A;  3KKC A;  2FQ4 A;  4HKU A;  5GPA A;  3LOC A;  3FIW A;  3GEU A;  2NS8 A;  4W1U A;  4L62 A;  3VVY A;  3NNR A;  1T33 A;  4KWA A;  3WHB A;  3VOX A;  4I76 A;  3COL A;  1QVT A;  2JK3 A;  3FK7 A;  2HXI A; 
#chains in the Genus database with same CATH topology
 3ANG A;  1QPI A;  2R7S A;  5CW8 A;  3TP0 A;  4WIB A;  5K7Z A;  2R7V A;  3ZQG A;  3DU5 A;  3F1B A;  4X1E A;  3KNW A;  5FKO A;  4MXM A;  5F0H A;  2ZY9 A;  5J1R A;  3QBM A;  3O60 A;  2VPR A;  5FHP A;  3PM1 A;  1Z0X A;  2G3B A;  3G1M A;  3HGY A;  3V78 A;  2IAI A;  3ZQF A;  3G1L A;  2XPV A;  3BTI A;  5DAJ A;  3LHQ A;  2GEN A;  5CXI A;  4V2F A;  5IOY A;  3CCY A;  5IOZ A;  4ABZ A;  3FK6 A;  5F27 A;  3AQT A;  3ZQI A;  1QVU A;  2XPU A;  3BHQ A;  3Q3S A;  3B81 A;  2ZCM A;  5F1J A;  2NP3 A;  2QTQ A;  3BQY A;  3FHN A;  4CGR A;  3VP5 A;  3EGQ A;  5H9T A;  2XGD A;  2O7O A;  3VW1 A;  2X6O A;  2G7G A;  2UXI A;  3HGG A;  3G7R A;  3RH2 A;  2F07 A;  2JJ7 A;  2ZCX A;  5IPA A;  2R7X A;  3LWJ A;  3QPS A;  3BR6 A;  3HTI A;  4D5F A;  1A6I A;  5EZH A;  4PXI A;  4IRV A;  3C2B A;  4ME9 A;  3VVX A;  5HSZ A;  3ON2 A;  3SFI A;  3Q0W A;  3MVP A;  4B3A A;  4M3B A;  1JT6 A;  3JSJ A;  3VW2 A;  3HTA A;  2RHA A;  4MK6 A;  5GP9 A;  4B1R A;  3VW0 A;  1UI5 A;  2FJI 1;  2YVE A;  2REK A;  5F08 A;  2QWT A;  2PBX A;  1ZKG A;  2GBY A;  3E7Q A;  3IH3 A;  1JTY A;  4UDS A;  1JTX A;  2Y31 A;  2FBQ A;  4OD4 A;  4GCK A;  3BR1 A;  3BTC A;  3NRG A;  2OER A;  4M3F A;  3WHC A;  3VUQ A;  1BJZ A;  5K58 A;  3IH2 A;  2PZ9 A;  5D19 A;  1JUM A;  1SGM A;  3V6G A;  4GCT A;  3BR3 A;  3QKX A;  2HYT A;  3P9T A;  4MO7 A;  2HKU A;  2G7S A;  3MNL A;  5F0C A;  3DCF A;  1JUP A;  2I10 A;  3C07 A;  2QCO A;  2XGE A;  3VPR A;  2TRT A;  3HE0 A;  3VOK A;  3LSR A;  3NXC A;  2ZOY A;  3IUV A;  2WUI A;  5IP6 A;  2Y30 A;  1T56 A;  2X9D A;  3BJB A;  2IEK A;  4D7N A;  5F0F A;  3GZI A;  4C2M A;  3BR0 A;  3LSP A;  5HAW A;  2R7Q A;  1Z77 A;  2EH3 A;  4NN1 A;  3ZQL A;  1JT0 A;  5CXG A;  3CJD A;  4DW6 A;  2IBD A;  3ZQH A;  3HTJ A;  5EZG A;  3QPL A;  5FKK A;  5FKM A;  2QKO A;  3G56 A;  3KKD A;  4AUX A;  2RAS A;  3ON4 A;  4M3D A;  3TP3 A;  4GFK A;  2QIB A;  4GCL A;  3BR5 A;  2WV1 A;  3G1O A;  3NS4 A;  2O7T A;  2D6Y A;  2XPW A;  4AC0 A;  4ICH A;  2FJ1 A;  3Q0V A;  2XB5 A;  3SWH A;  4M3G A;  2DTZ A;  2XDN A;  3LSJ A;  2TCT A;  2XGC A;  4NEL A;  2UXO A;  4ACI A;  5D1R A;  2Y2Z A;  5EYR A;  5FGL A;  4M3E A;  2V57 A;  3F0C A;  1UI6 A;  3VTI A;  2DG7 A;  3S5R A;  2VKE A;  3T6N A;  2OI8 A;  4V2G A;  5F04 A;  5EFY A;  1RKW A;  2HYJ A;  4W97 A;  2ID6 A;  4GFL A;  5FKN A;  1ORK A;  3BTL A;  3CDL A;  2ZOZ A;  2ZB9 A;  3KYL A;  2YVH A;  3FRQ A;  3EUP A;  4JNN A;  2VKV A;  3Q0U A;  2OPT A;  4G12 A;  3PAS A;  5J1U A;  5FMP A;  2RAE A;  2G0E A;  2Q24 A;  2W53 A;  3NI7 A;  2R7O A;  3BQZ A;  1JUS A;  4OD5 A;  4JYK A;  2UXP A;  2XRL A;  3DPJ A;  4U9N A;  5AQC A;  3BCG A;  3SDG A;  5HBU A;  2YVX A;  2GUH A;  3O8H A;  4D7M A;  4DVY P;  5D18 A;  2R7U A;  2R7T A;  2B1E A;  2ZCN A;  2QOP A;  4JKZ A;  4U9L A;  3KZ9 A;  2DG8 A;  4I6Z A;  4YZE A;  1ZK8 A;  2B3W A;  2HXO A;  2HQ5 A;  2UXH A;  3BTJ A;  3CRJ A;  3B6A A;  4AC6 A;  3AQS A;  3PPB A;  2R7W A;  5J3L A;  3DEW A;  5C4Y A;  2NX4 A;  2NP5 A;  5FKL A;  1RPW A;  2NS7 A;  3BR2 A;  3CWR A;  1RKT A;  2FD5 A;  4D5C A;  5GPC A;  4JL3 A;  4XK4 A;  2GFN A;  3LJL A;  3B6C A;  2UXU A;  1VI0 A;  2PFV A;  2IU5 A;  5K7H A;  1U9O A;  3NPI A;  3O8G A;  3VIB A;  3DU6 A;  3ANP A;  2ID3 A;  3HIM A;  3IH4 A;  2WGB A;  5K7F A;  3BNI A;  4AF5 A;  3QQA A;  1U9N A;  3BRU A;  3RD3 A;  5CQG A;  3VVZ A;  2FX0 A;  2A2F X;  3BT9 A;  3HTH A;  3K8P C;  5J1Y A;  2R7R A;  2G7L A;  4HKU A;  2OF7 A;  2FQ4 A;  3KKC A;  5GPA A;  3LOC A;  3FIW A;  3GEU A;  2NS8 A;  4W1U A;  4L62 A;  3VVY A;  3NNR A;  1T33 A;  4KWA A;  3WHB A;  3VOX A;  4I76 A;  3COL A;  1QVT A;  2JK3 A;  3FK7 A;  2HXI A; 
#chains in the Genus database with same CATH homology
 3ANG A;  1QPI A;  5CW8 A;  3TP0 A;  5K7Z A;  3ZQG A;  3F1B A;  4X1E A;  3KNW A;  5FKO A;  4MXM A;  5F0H A;  5J1R A;  3QBM A;  3O60 A;  2VPR A;  5FHP A;  3PM1 A;  1Z0X A;  2G3B A;  3G1M A;  3HGY A;  3V78 A;  2IAI A;  3ZQF A;  3G1L A;  2XPV A;  3BTI A;  5DAJ A;  3LHQ A;  2GEN A;  5CXI A;  4V2F A;  5IOY A;  3CCY A;  5IOZ A;  4ABZ A;  3FK6 A;  5F27 A;  3AQT A;  3ZQI A;  1QVU A;  2XPU A;  3BHQ A;  3Q3S A;  3B81 A;  2ZCM A;  5F1J A;  2NP3 A;  2QTQ A;  3BQY A;  4CGR A;  3VP5 A;  3EGQ A;  5H9T A;  2XGD A;  2O7O A;  3VW1 A;  2X6O A;  2G7G A;  2UXI A;  3HGG A;  3G7R A;  3RH2 A;  2F07 A;  2JJ7 A;  2ZCX A;  5IPA A;  3LWJ A;  3QPS A;  3BR6 A;  3HTI A;  4D5F A;  1A6I A;  5EZH A;  4PXI A;  3C2B A;  4ME9 A;  3VVX A;  5HSZ A;  3ON2 A;  3SFI A;  3Q0W A;  3MVP A;  4B3A A;  4M3B A;  1JT6 A;  3JSJ A;  3VW2 A;  3HTA A;  2RHA A;  4MK6 A;  5GP9 A;  4B1R A;  3VW0 A;  1UI5 A;  2YVE A;  2REK A;  5F08 A;  2QWT A;  2PBX A;  1ZKG A;  2GBY A;  3E7Q A;  3IH3 A;  1JTY A;  4UDS A;  1JTX A;  2Y31 A;  2FBQ A;  4GCK A;  3BR1 A;  3BTC A;  3NRG A;  2OER A;  4M3F A;  3WHC A;  3VUQ A;  1BJZ A;  5K58 A;  3IH2 A;  2PZ9 A;  5D19 A;  1JUM A;  1SGM A;  3V6G A;  4GCT A;  3BR3 A;  3QKX A;  2HYT A;  3P9T A;  4MO7 A;  2HKU A;  2G7S A;  3MNL A;  5F0C A;  3DCF A;  1JUP A;  2I10 A;  3C07 A;  2QCO A;  2XGE A;  3VPR A;  2TRT A;  3HE0 A;  3VOK A;  3LSR A;  3NXC A;  2ZOY A;  3IUV A;  2WUI A;  5IP6 A;  2Y30 A;  1T56 A;  2X9D A;  3BJB A;  2IEK A;  4D7N A;  5F0F A;  3GZI A;  3BR0 A;  3LSP A;  5HAW A;  1Z77 A;  2EH3 A;  4NN1 A;  3ZQL A;  1JT0 A;  5CXG A;  3CJD A;  4DW6 A;  2IBD A;  3ZQH A;  3HTJ A;  5EZG A;  3QPL A;  5FKK A;  5FKM A;  2QKO A;  3G56 A;  3KKD A;  4AUX A;  2RAS A;  3ON4 A;  4M3D A;  3TP3 A;  4GFK A;  2QIB A;  4GCL A;  3BR5 A;  2WV1 A;  3G1O A;  2O7T A;  2D6Y A;  2XPW A;  4AC0 A;  4ICH A;  2FJ1 A;  3Q0V A;  2XB5 A;  4M3G A;  2DTZ A;  2XDN A;  3LSJ A;  2TCT A;  2XGC A;  4NEL A;  2UXO A;  4ACI A;  5D1R A;  2Y2Z A;  5EYR A;  5FGL A;  4M3E A;  2V57 A;  3F0C A;  1UI6 A;  2DG7 A;  3S5R A;  2VKE A;  3T6N A;  2OI8 A;  4V2G A;  5F04 A;  5EFY A;  1RKW A;  2HYJ A;  4W97 A;  2ID6 A;  4GFL A;  5FKN A;  1ORK A;  3BTL A;  3CDL A;  2ZOZ A;  2ZB9 A;  2YVH A;  3FRQ A;  3EUP A;  4JNN A;  2VKV A;  3Q0U A;  2OPT A;  4G12 A;  3PAS A;  5J1U A;  5FMP A;  2RAE A;  2G0E A;  2Q24 A;  2W53 A;  3NI7 A;  3BQZ A;  1JUS A;  4JYK A;  2UXP A;  2XRL A;  3DPJ A;  5AQC A;  3BCG A;  3SDG A;  5HBU A;  2GUH A;  3O8H A;  4D7M A;  5D18 A;  2ZCN A;  2QOP A;  4JKZ A;  3KZ9 A;  2DG8 A;  4I6Z A;  4YZE A;  1ZK8 A;  2HXO A;  2HQ5 A;  2UXH A;  3BTJ A;  3CRJ A;  3B6A A;  4AC6 A;  3AQS A;  3PPB A;  5J3L A;  3DEW A;  5C4Y A;  2NX4 A;  2NP5 A;  5FKL A;  1RPW A;  2NS7 A;  3BR2 A;  3CWR A;  1RKT A;  2FD5 A;  4D5C A;  5GPC A;  4JL3 A;  4XK4 A;  2GFN A;  3LJL A;  3B6C A;  2UXU A;  1VI0 A;  2IU5 A;  5K7H A;  1U9O A;  3NPI A;  3O8G A;  3VIB A;  3ANP A;  2ID3 A;  3HIM A;  3IH4 A;  2WGB A;  5K7F A;  3BNI A;  4AF5 A;  3QQA A;  1U9N A;  3BRU A;  3RD3 A;  3VVZ A;  2FX0 A;  3BT9 A;  3HTH A;  5J1Y A;  2G7L A;  2OF7 A;  3KKC A;  2FQ4 A;  4HKU A;  5GPA A;  3LOC A;  3FIW A;  3GEU A;  2NS8 A;  4W1U A;  4L62 A;  3VVY A;  3NNR A;  1T33 A;  4KWA A;  3WHB A;  3VOX A;  4I76 A;  3COL A;  1QVT A;  2JK3 A;  3FK7 A;  2HXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...