2YVHA

Crystal structure of the operator-binding form of the multi-drug binding transcriptional repressor cgmr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
SKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription/dna
molecule keywords Transcriptional regulator
total genus 55
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yvhA00
3NNRA 1UI6A 2DG7A 3VW1A 2XPUA 2ZOYA 5F0FA 2QTQA 3C2BA 3G56A 4NN1A 3O60A 5IP6A 2QOPA 2G7LA 2ZCXA 3B6CA 3HGGA 3BR1A 2HQ5A 3S5RA 2NP5A 1A6IA 5EZGA 3GEUA 5H9TA 4M3DA 3JSJA 2O7OA 5J3LA 2Y30A 3ZQHA 3BR2A 2NS7A 4JYKA 4B3AA 3HTJA 1T33A 3RH2A 3VUQA 1QVTA 2Y2ZA 3VP5A 2V57A 3HGYA 4GCKA 2QWTA 4ICHA 2GBYA 2ZCNA 2ZOZA 3Q3SA 4I76A 2UXHA 4MXMA 3RD3A 3VW2A 3HE0A 2IU5A 2PBXA 5EFYA 3NRGA 2FX0A 2ID3A 3O8GA 5F0HA 3NI7A 2NS8A 1ZK8A 1Z0XA 4L62A 3NPIA 4GCTA 5FHPA 1JTXA 3BQYA 3LHQA 2VKVA 4W1UA 3VVYA 5HAWA 3VVZA 2G7GA 2HYJA 3IH2A 3T6NA 1JT6A 5DAJA 2DTZA 5HBUA 4AUXA 5K7FA 3G1OA 3LWJA 3BCGA 2DG8A 3BRUA 2ZB9A 3BR5A 3LOCA 3V6GA 3HTAA 3GZIA 4GCLA 1ZKGA 5K7ZA 4ME9A 3PM1A 2QIBA 1JTYA 3G1LA 3VVXA 2GENA 3KNWA 2HKUA 4ABZA 2JJ7A 4M3BA 3BTJA 4NELA 3ANGA 4YZEA 2WV1A 3VW0A 5K58A 5IOYA 3BQZA 3LJLA 5FGLA 5GPAA 3P9TA 3VPRA 5D19A 1U9NA 4JKZA 4PXIA 2G7SA 3CJDA 5FKMA 2F07A 3B6AA 2G3BA 2JK3A 1JUMA 2OF7A 2XGCA 3BJBA 3NXCA 3DEWA 3FIWA 3ON2A 3CRJA 2REKA 5FKNA 5AQCA 3ANPA 3MVPA 4B1RA 4KWAA 4CGRA 4D7NA 5EZHA 3LSRA 3CDLA 3QPLA 2GUHA 2NX4A 4DW6A 3BTLA 2FJ1A 3EUPA 2X9DA 3E7QA 5CW8A 3ZQLA 1RKWA 1JUPA 3DPJA 3MNLA 3VIBA 3QKXA 2OPTA 4M3FA 5F1JA 2UXPA 2UXOA 3IUVA 4AC0A 2D6YA 4MK6A 3SDGA 3ZQIA 3FK6A 3KKCA 3WHCA 2IBDA 4GFLA 3QBMA 2X6OA 2IAIA 1RPWA 2G0EA 3BTIA 3QPSA 2GFNA 3BR0A 5HSZA 2W53A 2RASA 3TP0A 2QCOA 4M3EA 3HTHA 2YVHA 1T56A 3SFIA 2WUIA 2QKOA 2VPRA 5FKKA 3B81A 1QPIA 3C07A 2YVEA 4G12A 3Q0UA 2O7TA 3CCYA 2VKEA 5FKOA 1UI5A 3VOKA 3FK7A 1Z77A 3BNIA 2PZ9A 1SGMA 3V78A 5CXIA 1U9OA 3BT9A 4HKUA 3VOXA 3KKDA 1RKTA 5J1YA 3LSJA 3TP3A 3PPBA 5IOZA 3WHBA 2NP3A 1JUSA 2XGDA 4D7MA 3IH3A 4X1EA 1BJZA 2TRTA 2XRLA 2UXIA 3O8HA 4JNNA 2XPWA 3BHQA 4ACIA 3AQTA 3LSPA 4MO7A 2EH3A 2TCTA 5J1RA 3Q0WA 3FRQA 1JT0A 2HXOA 5EYRA 2WGBA 2XDNA 3G1MA 5F0CA 5D1RA 3Q0VA 3ZQFA 2UXUA 4D5CA 2RHAA 2XGEA 2XPVA 3BR6A 1QVUA 4W97A 5FMPA 4D5FA 5D18A 5K7HA 5CXGA 2FD5A 3COLA 3PASA 3CWRA 4V2GA 4V2FA 2FQ4A 3EGQA 3ZQGA 2RAEA 5GPCA 5F08A 2Y31A 2Q24A 3BR3A 2OERA 3AQSA 2IEKA 3F1BA 5F04A 3IH4A 4AC6A 5C4YA 1ORKA 3F0CA 4AF5A 3DCFA 3HIMA 5GP9A 2HXIA 2XB5A 5FKLA 3G7RA 3BTCA 4M3GA 2HYTA 5IPAA 2OI8A 4GFKA 4JL3A 2I10A 2ZCMA 3HTIA 5F27A 4I6ZA 2FBQA 4XK4A 4UDSA 2ID6A 1VI0A 3QQAA 5J1UA 3KZ9A 3ON4A
chains in the Genus database with same CATH superfamily
3NNRA 1UI6A 2DG7A 2R7UA 3VW1A 2XPUA 2ZOYA 5F0FA 2QTQA 3C2BA 3G56A 4NN1A 2R7XA 3O60A 5IP6A 2R7VA 2QOPA 2G7LA 2ZCXA 2YVXA 3B6CA 3HGGA 3BR1A 2HQ5A 3S5RA 2NP5A 1A6IA 4OD4A 5EZGA 3GEUA 5H9TA 4M3DA 3JSJA 2O7OA 5J3LA 2Y30A 3ZQHA 3BR2A 2NS7A 4JYKA 4OD5A 4B3AA 3HTJA 2FJI1 1T33A 3RH2A 3VUQA 1QVTA 2Y2ZA 3VP5A 2V57A 3HGYA 2R7WA 4GCKA 2QWTA 4ICHA 2GBYA 2ZCNA 2ZOZA 3Q3SA 4I76A 2UXHA 4MXMA 3RD3A 3VW2A 3HE0A 2IU5A 2PBXA 5EFYA 3NRGA 2FX0A 2ID3A 3O8GA 5F0HA 3NI7A 2NS8A 1ZK8A 1Z0XA 4L62A 3NPIA 4GCTA 5FHPA 1JTXA 3BQYA 3LHQA 2VKVA 3DU5A 4W1UA 3VVYA 5HAWA 3VVZA 2G7GA 2HYJA 3IH2A 3T6NA 1JT6A 4WIBA 5DAJA 2DTZA 5HBUA 4AUXA 5K7FA 3G1OA 3LWJA 3BCGA 2DG8A 3BRUA 2ZB9A 3BR5A 3LOCA 3V6GA 3HTAA 3GZIA 4GCLA 1ZKGA 5K7ZA 4ME9A 3PM1A 4U9LA 5CQGA 2QIBA 1JTYA 4C2MA 3G1LA 3VVXA 2GENA 3KNWA 2HKUA 4ABZA 2JJ7A 4M3BA 3BTJA 4NELA 3ANGA 4YZEA 2WV1A 3VW0A 5K58A 5IOYA 3BQZA 4DVYP 3LJLA 5FGLA 5GPAA 3P9TA 3VPRA 2ZY9A 5D19A 1U9NA 4JKZA 4PXIA 2G7SA 3CJDA 5FKMA 2F07A 3B6AA 2G3BA 2JK3A 1JUMA 2OF7A 2XGCA 3BJBA 3NXCA 2R7TA 3DEWA 3FIWA 3ON2A 3CRJA 2REKA 2R7SA 5FKNA 5AQCA 3ANPA 3MVPA 4B1RA 4KWAA 4CGRA 4D7NA 5EZHA 3LSRA 3CDLA 3QPLA 2GUHA 2NX4A 4DW6A 3BTLA 2FJ1A 3EUPA 2X9DA 3E7QA 5CW8A 3ZQLA 1RKWA 1JUPA 3DPJA 3MNLA 3VIBA 3QKXA 2OPTA 2B1EA 4M3FA 5F1JA 2UXPA 2UXOA 3IUVA 4AC0A 3DU6A 2D6YA 4MK6A 3SWHA 3SDGA 3ZQIA 3FK6A 3KKCA 3WHCA 2IBDA 2B3WA 4GFLA 3QBMA 2PFVA 2X6OA 2IAIA 1RPWA 2G0EA 3BTIA 3QPSA 2GFNA 3BR0A 5HSZA 2W53A 2RASA 3TP0A 2QCOA 4M3EA 3FHNA 3HTHA 2YVHA 1T56A 3SFIA 2WUIA 2QKOA 2VPRA 5FKKA 3B81A 1QPIA 3C07A 2YVEA 3KYLA 4G12A 3Q0UA 2O7TA 3CCYA 2VKEA 5FKOA 1UI5A 3VOKA 2R7OA 3FK7A 1Z77A 3BNIA 3NS4A 2PZ9A 1SGMA 3V78A 5CXIA 1U9OA 2A2FX 3BT9A 4HKUA 3VOXA 3KKDA 1RKTA 5J1YA 3LSJA 3TP3A 3PPBA 5IOZA 3WHBA 2NP3A 1JUSA 2XGDA 4D7MA 3IH3A 4X1EA 1BJZA 2TRTA 2R7QA 2XRLA 2UXIA 3O8HA 4JNNA 2XPWA 3BHQA 4ACIA 3AQTA 3VTIA 3LSPA 3K8PC 4MO7A 2EH3A 2TCTA 5J1RA 3Q0WA 3FRQA 1JT0A 2HXOA 5EYRA 2WGBA 2XDNA 3G1MA 5F0CA 5D1RA 2R7RA 3Q0VA 3ZQFA 4U9NA 2UXUA 4D5CA 2RHAA 2XGEA 2XPVA 3BR6A 1QVUA 4W97A 5FMPA 4D5FA 5D18A 5K7HA 5CXGA 2FD5A 3COLA 3PASA 3CWRA 4V2GA 4V2FA 2FQ4A 3EGQA 3ZQGA 2RAEA 5GPCA 5F08A 2Y31A 2Q24A 3BR3A 2OERA 3AQSA 2IEKA 3F1BA 5F04A 3IH4A 4AC6A 5C4YA 4IRVA 1ORKA 3F0CA 4AF5A 3DCFA 3HIMA 5GP9A 2HXIA 2XB5A 5FKLA 3G7RA 3BTCA 4M3GA 2HYTA 5IPAA 2OI8A 4GFKA 4JL3A 2I10A 2ZCMA 3HTIA 5F27A 2FBQA 4I6ZA 4XK4A 4UDSA 2ID6A 1VI0A 3QQAA 5J1UA 3KZ9A 3ON4A
chains in the Genus database with same CATH topology
3NNRA 1UI6A 2DG7A 3VW1A 2XPUA 2ZOYA 5F0FA 2QTQA 3C2BA 3G56A 4NN1A 3O60A 5IP6A 2QOPA 2G7LA 2ZCXA 3B6CA 3HGGA 3BR1A 2HQ5A 3S5RA 2NP5A 1A6IA 5EZGA 3GEUA 5H9TA 4M3DA 3JSJA 2O7OA 5J3LA 2Y30A 3ZQHA 3BR2A 2NS7A 4JYKA 4B3AA 3HTJA 1T33A 3RH2A 3VUQA 1QVTA 2Y2ZA 3VP5A 2V57A 3HGYA 4GCKA 2QWTA 4ICHA 2GBYA 2ZCNA 2ZOZA 3Q3SA 4I76A 2UXHA 4MXMA 3RD3A 3VW2A 3HE0A 2IU5A 2PBXA 5EFYA 3NRGA 2FX0A 2ID3A 3O8GA 5F0HA 3NI7A 2NS8A 1ZK8A 1Z0XA 4L62A 3NPIA 4GCTA 5FHPA 1JTXA 3BQYA 3LHQA 2VKVA 4W1UA 3VVYA 5HAWA 3VVZA 2G7GA 2HYJA 3IH2A 3T6NA 1JT6A 5DAJA 2DTZA 5HBUA 4AUXA 5K7FA 3G1OA 3LWJA 3BCGA 2DG8A 3BRUA 2ZB9A 3BR5A 3LOCA 3V6GA 3HTAA 3GZIA 4GCLA 1ZKGA 5K7ZA 4ME9A 3PM1A 2QIBA 1JTYA 3G1LA 3VVXA 2GENA 3KNWA 2HKUA 4ABZA 2JJ7A 4M3BA 3BTJA 4NELA 3ANGA 4YZEA 2WV1A 3VW0A 5K58A 5IOYA 3BQZA 3LJLA 5FGLA 5GPAA 3P9TA 3VPRA 5D19A 1U9NA 4JKZA 4PXIA 2G7SA 3CJDA 5FKMA 2F07A 3B6AA 2G3BA 2JK3A 1JUMA 2OF7A 2XGCA 3BJBA 3NXCA 3DEWA 3FIWA 3ON2A 3CRJA 2REKA 5FKNA 5AQCA 3ANPA 3MVPA 4B1RA 4KWAA 4CGRA 4D7NA 5EZHA 3LSRA 3CDLA 3QPLA 2GUHA 2NX4A 4DW6A 3BTLA 2FJ1A 3EUPA 2X9DA 3E7QA 5CW8A 3ZQLA 1RKWA 1JUPA 3DPJA 3MNLA 3VIBA 3QKXA 2OPTA 4M3FA 5F1JA 2UXPA 2UXOA 3IUVA 4AC0A 2D6YA 4MK6A 3SDGA 3ZQIA 3FK6A 3KKCA 3WHCA 2IBDA 4GFLA 3QBMA 2X6OA 2IAIA 1RPWA 2G0EA 3BTIA 3QPSA 2GFNA 3BR0A 5HSZA 2W53A 2RASA 3TP0A 2QCOA 4M3EA 3HTHA 2YVHA 1T56A 3SFIA 2WUIA 2QKOA 2VPRA 5FKKA 3B81A 1QPIA 3C07A 2YVEA 4G12A 3Q0UA 2O7TA 3CCYA 2VKEA 5FKOA 1UI5A 3VOKA 3FK7A 1Z77A 3BNIA 2PZ9A 1SGMA 3V78A 5CXIA 1U9OA 3BT9A 4HKUA 3VOXA 3KKDA 1RKTA 5J1YA 3LSJA 3TP3A 3PPBA 5IOZA 3WHBA 2NP3A 1JUSA 2XGDA 4D7MA 3IH3A 4X1EA 1BJZA 2TRTA 2XRLA 2UXIA 3O8HA 4JNNA 2XPWA 3BHQA 4ACIA 3AQTA 3LSPA 4MO7A 2EH3A 2TCTA 5J1RA 3Q0WA 3FRQA 1JT0A 2HXOA 5EYRA 2WGBA 2XDNA 3G1MA 5F0CA 5D1RA 3Q0VA 3ZQFA 2UXUA 4D5CA 2RHAA 2XGEA 2XPVA 3BR6A 1QVUA 4W97A 5FMPA 4D5FA 5D18A 5K7HA 5CXGA 2FD5A 3COLA 3PASA 3CWRA 4V2GA 4V2FA 2FQ4A 3EGQA 3ZQGA 2RAEA 5GPCA 5F08A 2Y31A 2Q24A 3BR3A 2OERA 3AQSA 2IEKA 3F1BA 5F04A 3IH4A 4AC6A 5C4YA 1ORKA 3F0CA 4AF5A 3DCFA 3HIMA 5GP9A 2HXIA 2XB5A 5FKLA 3G7RA 3BTCA 4M3GA 2HYTA 5IPAA 2OI8A 4GFKA 4JL3A 2I10A 2ZCMA 3HTIA 5F27A 4I6ZA 2FBQA 4XK4A 4UDSA 2ID6A 1VI0A 3QQAA 5J1UA 3KZ9A 3ON4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNR A;  1UI6 A;  2DG7 A;  3VW1 A;  2XPU A;  2ZOY A;  5F0F A;  2QTQ A;  3C2B A;  3G56 A;  4NN1 A;  3O60 A;  5IP6 A;  2QOP A;  2G7L A;  2ZCX A;  3B6C A;  3HGG A;  3BR1 A;  2HQ5 A;  3S5R A;  2NP5 A;  1A6I A;  5EZG A;  3GEU A;  5H9T A;  4M3D A;  3JSJ A;  2O7O A;  5J3L A;  2Y30 A;  3ZQH A;  3BR2 A;  2NS7 A;  4JYK A;  4B3A A;  3HTJ A;  1T33 A;  3RH2 A;  3VUQ A;  1QVT A;  2Y2Z A;  3VP5 A;  2V57 A;  3HGY A;  4GCK A;  2QWT A;  4ICH A;  2GBY A;  2ZCN A;  2ZOZ A;  3Q3S A;  4I76 A;  2UXH A;  4MXM A;  3RD3 A;  3VW2 A;  3HE0 A;  2IU5 A;  2PBX A;  5EFY A;  3NRG A;  2FX0 A;  2ID3 A;  3O8G A;  5F0H A;  3NI7 A;  2NS8 A;  1ZK8 A;  1Z0X A;  4L62 A;  3NPI A;  4GCT A;  5FHP A;  1JTX A;  3BQY A;  3LHQ A;  2VKV A;  4W1U A;  3VVY A;  5HAW A;  3VVZ A;  2G7G A;  2HYJ A;  3IH2 A;  3T6N A;  1JT6 A;  5DAJ A;  2DTZ A;  5HBU A;  4AUX A;  5K7F A;  3G1O A;  3LWJ A;  3BCG A;  2DG8 A;  3BRU A;  2ZB9 A;  3BR5 A;  3LOC A;  3V6G A;  3HTA A;  3GZI A;  4GCL A;  1ZKG A;  5K7Z A;  4ME9 A;  3PM1 A;  2QIB A;  1JTY A;  3G1L A;  3VVX A;  2GEN A;  3KNW A;  2HKU A;  4ABZ A;  2JJ7 A;  4M3B A;  3BTJ A;  4NEL A;  3ANG A;  4YZE A;  2WV1 A;  3VW0 A;  5K58 A;  5IOY A;  3BQZ A;  3LJL A;  5FGL A;  5GPA A;  3P9T A;  3VPR A;  5D19 A;  1U9N A;  4JKZ A;  4PXI A;  2G7S A;  3CJD A;  5FKM A;  2F07 A;  3B6A A;  2G3B A;  2JK3 A;  1JUM A;  2OF7 A;  2XGC A;  3BJB A;  3NXC A;  3DEW A;  3FIW A;  3ON2 A;  3CRJ A;  2REK A;  5FKN A;  5AQC A;  3ANP A;  3MVP A;  4B1R A;  4KWA A;  4CGR A;  4D7N A;  5EZH A;  3LSR A;  3CDL A;  3QPL A;  2GUH A;  2NX4 A;  4DW6 A;  3BTL A;  2FJ1 A;  3EUP A;  2X9D A;  3E7Q A;  5CW8 A;  3ZQL A;  1RKW A;  1JUP A;  3DPJ A;  3MNL A;  3VIB A;  3QKX A;  2OPT A;  4M3F A;  5F1J A;  2UXP A;  2UXO A;  3IUV A;  4AC0 A;  2D6Y A;  4MK6 A;  3SDG A;  3ZQI A;  3FK6 A;  3KKC A;  3WHC A;  2IBD A;  4GFL A;  3QBM A;  2X6O A;  2IAI A;  1RPW A;  2G0E A;  3BTI A;  3QPS A;  2GFN A;  3BR0 A;  5HSZ A;  2W53 A;  2RAS A;  3TP0 A;  2QCO A;  4M3E A;  3HTH A;  2YVH A;  1T56 A;  3SFI A;  2WUI A;  2QKO A;  2VPR A;  5FKK A;  3B81 A;  1QPI A;  3C07 A;  2YVE A;  4G12 A;  3Q0U A;  2O7T A;  3CCY A;  2VKE A;  5FKO A;  1UI5 A;  3VOK A;  3FK7 A;  1Z77 A;  3BNI A;  2PZ9 A;  1SGM A;  3V78 A;  5CXI A;  1U9O A;  3BT9 A;  4HKU A;  3VOX A;  3KKD A;  1RKT A;  5J1Y A;  3LSJ A;  3TP3 A;  3PPB A;  5IOZ A;  3WHB A;  2NP3 A;  1JUS A;  2XGD A;  4D7M A;  3IH3 A;  4X1E A;  1BJZ A;  2TRT A;  2XRL A;  2UXI A;  3O8H A;  4JNN A;  2XPW A;  3BHQ A;  4ACI A;  3AQT A;  3LSP A;  4MO7 A;  2EH3 A;  2TCT A;  5J1R A;  3Q0W A;  3FRQ A;  1JT0 A;  2HXO A;  5EYR A;  2WGB A;  2XDN A;  3G1M A;  5F0C A;  5D1R A;  3Q0V A;  3ZQF A;  2UXU A;  4D5C A;  2RHA A;  2XGE A;  2XPV A;  3BR6 A;  1QVU A;  4W97 A;  5FMP A;  4D5F A;  5D18 A;  5K7H A;  5CXG A;  2FD5 A;  3COL A;  3PAS A;  3CWR A;  4V2G A;  4V2F A;  2FQ4 A;  3EGQ A;  3ZQG A;  2RAE A;  5GPC A;  5F08 A;  2Y31 A;  2Q24 A;  3BR3 A;  2OER A;  3AQS A;  2IEK A;  3F1B A;  5F04 A;  3IH4 A;  4AC6 A;  5C4Y A;  1ORK A;  3F0C A;  4AF5 A;  3DCF A;  3HIM A;  5GP9 A;  2HXI A;  2XB5 A;  5FKL A;  3G7R A;  3BTC A;  4M3G A;  2HYT A;  5IPA A;  2OI8 A;  4GFK A;  4JL3 A;  2I10 A;  2ZCM A;  3HTI A;  5F27 A;  4I6Z A;  2FBQ A;  4XK4 A;  4UDS A;  2ID6 A;  1VI0 A;  3QQA A;  5J1U A;  3KZ9 A;  3ON4 A; 
#chains in the Genus database with same CATH topology
 3NNR A;  1UI6 A;  2DG7 A;  2R7U A;  3VW1 A;  2XPU A;  2ZOY A;  5F0F A;  2QTQ A;  3C2B A;  3G56 A;  4NN1 A;  2R7X A;  3O60 A;  5IP6 A;  2R7V A;  2QOP A;  2G7L A;  2ZCX A;  2YVX A;  3B6C A;  3HGG A;  3BR1 A;  2HQ5 A;  3S5R A;  2NP5 A;  1A6I A;  4OD4 A;  5EZG A;  3GEU A;  5H9T A;  4M3D A;  3JSJ A;  2O7O A;  5J3L A;  2Y30 A;  3ZQH A;  3BR2 A;  2NS7 A;  4JYK A;  4OD5 A;  4B3A A;  3HTJ A;  2FJI 1;  1T33 A;  3RH2 A;  3VUQ A;  1QVT A;  2Y2Z A;  3VP5 A;  2V57 A;  3HGY A;  2R7W A;  4GCK A;  2QWT A;  4ICH A;  2GBY A;  2ZCN A;  2ZOZ A;  3Q3S A;  4I76 A;  2UXH A;  4MXM A;  3RD3 A;  3VW2 A;  3HE0 A;  2IU5 A;  2PBX A;  5EFY A;  3NRG A;  2FX0 A;  2ID3 A;  3O8G A;  5F0H A;  3NI7 A;  2NS8 A;  1ZK8 A;  1Z0X A;  4L62 A;  3NPI A;  4GCT A;  5FHP A;  1JTX A;  3BQY A;  3LHQ A;  2VKV A;  3DU5 A;  4W1U A;  3VVY A;  5HAW A;  3VVZ A;  2G7G A;  2HYJ A;  3IH2 A;  3T6N A;  1JT6 A;  4WIB A;  5DAJ A;  2DTZ A;  5HBU A;  4AUX A;  5K7F A;  3G1O A;  3LWJ A;  3BCG A;  2DG8 A;  3BRU A;  2ZB9 A;  3BR5 A;  3LOC A;  3V6G A;  3HTA A;  3GZI A;  4GCL A;  1ZKG A;  5K7Z A;  4ME9 A;  3PM1 A;  4U9L A;  5CQG A;  2QIB A;  1JTY A;  4C2M A;  3G1L A;  3VVX A;  2GEN A;  3KNW A;  2HKU A;  4ABZ A;  2JJ7 A;  4M3B A;  3BTJ A;  4NEL A;  3ANG A;  4YZE A;  2WV1 A;  3VW0 A;  5K58 A;  5IOY A;  3BQZ A;  4DVY P;  3LJL A;  5FGL A;  5GPA A;  3P9T A;  3VPR A;  2ZY9 A;  5D19 A;  1U9N A;  4JKZ A;  4PXI A;  2G7S A;  3CJD A;  5FKM A;  2F07 A;  3B6A A;  2G3B A;  2JK3 A;  1JUM A;  2OF7 A;  2XGC A;  3BJB A;  3NXC A;  2R7T A;  3DEW A;  3FIW A;  3ON2 A;  3CRJ A;  2REK A;  2R7S A;  5FKN A;  5AQC A;  3ANP A;  3MVP A;  4B1R A;  4KWA A;  4CGR A;  4D7N A;  5EZH A;  3LSR A;  3CDL A;  3QPL A;  2GUH A;  2NX4 A;  4DW6 A;  3BTL A;  2FJ1 A;  3EUP A;  2X9D A;  3E7Q A;  5CW8 A;  3ZQL A;  1RKW A;  1JUP A;  3DPJ A;  3MNL A;  3VIB A;  3QKX A;  2OPT A;  2B1E A;  4M3F A;  5F1J A;  2UXP A;  2UXO A;  3IUV A;  4AC0 A;  3DU6 A;  2D6Y A;  4MK6 A;  3SWH A;  3SDG A;  3ZQI A;  3FK6 A;  3KKC A;  3WHC A;  2IBD A;  2B3W A;  4GFL A;  3QBM A;  2PFV A;  2X6O A;  2IAI A;  1RPW A;  2G0E A;  3BTI A;  3QPS A;  2GFN A;  3BR0 A;  5HSZ A;  2W53 A;  2RAS A;  3TP0 A;  2QCO A;  4M3E A;  3FHN A;  3HTH A;  2YVH A;  1T56 A;  3SFI A;  2WUI A;  2QKO A;  2VPR A;  5FKK A;  3B81 A;  1QPI A;  3C07 A;  2YVE A;  3KYL A;  4G12 A;  3Q0U A;  2O7T A;  3CCY A;  2VKE A;  5FKO A;  1UI5 A;  3VOK A;  2R7O A;  3FK7 A;  1Z77 A;  3BNI A;  3NS4 A;  2PZ9 A;  1SGM A;  3V78 A;  5CXI A;  1U9O A;  2A2F X;  3BT9 A;  4HKU A;  3VOX A;  3KKD A;  1RKT A;  5J1Y A;  3LSJ A;  3TP3 A;  3PPB A;  5IOZ A;  3WHB A;  2NP3 A;  1JUS A;  2XGD A;  4D7M A;  3IH3 A;  4X1E A;  1BJZ A;  2TRT A;  2R7Q A;  2XRL A;  2UXI A;  3O8H A;  4JNN A;  2XPW A;  3BHQ A;  4ACI A;  3AQT A;  3VTI A;  3LSP A;  3K8P C;  4MO7 A;  2EH3 A;  2TCT A;  5J1R A;  3Q0W A;  3FRQ A;  1JT0 A;  2HXO A;  5EYR A;  2WGB A;  2XDN A;  3G1M A;  5F0C A;  5D1R A;  2R7R A;  3Q0V A;  3ZQF A;  4U9N A;  2UXU A;  4D5C A;  2RHA A;  2XGE A;  2XPV A;  3BR6 A;  1QVU A;  4W97 A;  5FMP A;  4D5F A;  5D18 A;  5K7H A;  5CXG A;  2FD5 A;  3COL A;  3PAS A;  3CWR A;  4V2G A;  4V2F A;  2FQ4 A;  3EGQ A;  3ZQG A;  2RAE A;  5GPC A;  5F08 A;  2Y31 A;  2Q24 A;  3BR3 A;  2OER A;  3AQS A;  2IEK A;  3F1B A;  5F04 A;  3IH4 A;  4AC6 A;  5C4Y A;  4IRV A;  1ORK A;  3F0C A;  4AF5 A;  3DCF A;  3HIM A;  5GP9 A;  2HXI A;  2XB5 A;  5FKL A;  3G7R A;  3BTC A;  4M3G A;  2HYT A;  5IPA A;  2OI8 A;  4GFK A;  4JL3 A;  2I10 A;  2ZCM A;  3HTI A;  5F27 A;  2FBQ A;  4I6Z A;  4XK4 A;  4UDS A;  2ID6 A;  1VI0 A;  3QQA A;  5J1U A;  3KZ9 A;  3ON4 A; 
#chains in the Genus database with same CATH homology
 3NNR A;  1UI6 A;  2DG7 A;  3VW1 A;  2XPU A;  2ZOY A;  5F0F A;  2QTQ A;  3C2B A;  3G56 A;  4NN1 A;  3O60 A;  5IP6 A;  2QOP A;  2G7L A;  2ZCX A;  3B6C A;  3HGG A;  3BR1 A;  2HQ5 A;  3S5R A;  2NP5 A;  1A6I A;  5EZG A;  3GEU A;  5H9T A;  4M3D A;  3JSJ A;  2O7O A;  5J3L A;  2Y30 A;  3ZQH A;  3BR2 A;  2NS7 A;  4JYK A;  4B3A A;  3HTJ A;  1T33 A;  3RH2 A;  3VUQ A;  1QVT A;  2Y2Z A;  3VP5 A;  2V57 A;  3HGY A;  4GCK A;  2QWT A;  4ICH A;  2GBY A;  2ZCN A;  2ZOZ A;  3Q3S A;  4I76 A;  2UXH A;  4MXM A;  3RD3 A;  3VW2 A;  3HE0 A;  2IU5 A;  2PBX A;  5EFY A;  3NRG A;  2FX0 A;  2ID3 A;  3O8G A;  5F0H A;  3NI7 A;  2NS8 A;  1ZK8 A;  1Z0X A;  4L62 A;  3NPI A;  4GCT A;  5FHP A;  1JTX A;  3BQY A;  3LHQ A;  2VKV A;  4W1U A;  3VVY A;  5HAW A;  3VVZ A;  2G7G A;  2HYJ A;  3IH2 A;  3T6N A;  1JT6 A;  5DAJ A;  2DTZ A;  5HBU A;  4AUX A;  5K7F A;  3G1O A;  3LWJ A;  3BCG A;  2DG8 A;  3BRU A;  2ZB9 A;  3BR5 A;  3LOC A;  3V6G A;  3HTA A;  3GZI A;  4GCL A;  1ZKG A;  5K7Z A;  4ME9 A;  3PM1 A;  2QIB A;  1JTY A;  3G1L A;  3VVX A;  2GEN A;  3KNW A;  2HKU A;  4ABZ A;  2JJ7 A;  4M3B A;  3BTJ A;  4NEL A;  3ANG A;  4YZE A;  2WV1 A;  3VW0 A;  5K58 A;  5IOY A;  3BQZ A;  3LJL A;  5FGL A;  5GPA A;  3P9T A;  3VPR A;  5D19 A;  1U9N A;  4JKZ A;  4PXI A;  2G7S A;  3CJD A;  5FKM A;  2F07 A;  3B6A A;  2G3B A;  2JK3 A;  1JUM A;  2OF7 A;  2XGC A;  3BJB A;  3NXC A;  3DEW A;  3FIW A;  3ON2 A;  3CRJ A;  2REK A;  5FKN A;  5AQC A;  3ANP A;  3MVP A;  4B1R A;  4KWA A;  4CGR A;  4D7N A;  5EZH A;  3LSR A;  3CDL A;  3QPL A;  2GUH A;  2NX4 A;  4DW6 A;  3BTL A;  2FJ1 A;  3EUP A;  2X9D A;  3E7Q A;  5CW8 A;  3ZQL A;  1RKW A;  1JUP A;  3DPJ A;  3MNL A;  3VIB A;  3QKX A;  2OPT A;  4M3F A;  5F1J A;  2UXP A;  2UXO A;  3IUV A;  4AC0 A;  2D6Y A;  4MK6 A;  3SDG A;  3ZQI A;  3FK6 A;  3KKC A;  3WHC A;  2IBD A;  4GFL A;  3QBM A;  2X6O A;  2IAI A;  1RPW A;  2G0E A;  3BTI A;  3QPS A;  2GFN A;  3BR0 A;  5HSZ A;  2W53 A;  2RAS A;  3TP0 A;  2QCO A;  4M3E A;  3HTH A;  2YVH A;  1T56 A;  3SFI A;  2WUI A;  2QKO A;  2VPR A;  5FKK A;  3B81 A;  1QPI A;  3C07 A;  2YVE A;  4G12 A;  3Q0U A;  2O7T A;  3CCY A;  2VKE A;  5FKO A;  1UI5 A;  3VOK A;  3FK7 A;  1Z77 A;  3BNI A;  2PZ9 A;  1SGM A;  3V78 A;  5CXI A;  1U9O A;  3BT9 A;  4HKU A;  3VOX A;  3KKD A;  1RKT A;  5J1Y A;  3LSJ A;  3TP3 A;  3PPB A;  5IOZ A;  3WHB A;  2NP3 A;  1JUS A;  2XGD A;  4D7M A;  3IH3 A;  4X1E A;  1BJZ A;  2TRT A;  2XRL A;  2UXI A;  3O8H A;  4JNN A;  2XPW A;  3BHQ A;  4ACI A;  3AQT A;  3LSP A;  4MO7 A;  2EH3 A;  2TCT A;  5J1R A;  3Q0W A;  3FRQ A;  1JT0 A;  2HXO A;  5EYR A;  2WGB A;  2XDN A;  3G1M A;  5F0C A;  5D1R A;  3Q0V A;  3ZQF A;  2UXU A;  4D5C A;  2RHA A;  2XGE A;  2XPV A;  3BR6 A;  1QVU A;  4W97 A;  5FMP A;  4D5F A;  5D18 A;  5K7H A;  5CXG A;  2FD5 A;  3COL A;  3PAS A;  3CWR A;  4V2G A;  4V2F A;  2FQ4 A;  3EGQ A;  3ZQG A;  2RAE A;  5GPC A;  5F08 A;  2Y31 A;  2Q24 A;  3BR3 A;  2OER A;  3AQS A;  2IEK A;  3F1B A;  5F04 A;  3IH4 A;  4AC6 A;  5C4Y A;  1ORK A;  3F0C A;  4AF5 A;  3DCF A;  3HIM A;  5GP9 A;  2HXI A;  2XB5 A;  5FKL A;  3G7R A;  3BTC A;  4M3G A;  2HYT A;  5IPA A;  2OI8 A;  4GFK A;  4JL3 A;  2I10 A;  2ZCM A;  3HTI A;  5F27 A;  4I6Z A;  2FBQ A;  4XK4 A;  4UDS A;  2ID6 A;  1VI0 A;  3QQA A;  5J1U A;  3KZ9 A;  3ON4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...