2YVHA

Crystal structure of the operator-binding form of the multi-drug binding transcriptional repressor cgmr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
b'SKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
molecule tags Transcription/dna
source organism Corynebacterium glutamicum
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
total genus 55
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yvhA00
3VW0A 3BJBA 3BNIA 3F0CA 2IAIA 1T56A 1BJZA 4ABZA 2G7GA 3IH3A 2OF7A 4MXMA 3E7QA 3ZQGA 1ORKA 3B6AA 3CWRA 4ME9A 4GFKA 2Y2ZA 2VPRA 4AUXA 2Y30A 3IH2A 5K58A 4JYKA 3BQYA 4AF5A 1JTYA 4M3FA 2TRTA 3PM1A 4B3AA 2GFNA 2PBXA 1JUMA 4JNNA 5IPAA 2HYJA 3HGGA 2VKVA 4D7NA 1JUSA 3ON4A 2YVEA 5EFYA 3VPRA 3QPLA 2FQ4A 3O60A 1RKWA 2OI8A 2YVHA 1Z77A 3KKDA 3NPIA 4MO7A 4G12A 3SDGA 5IP6A 3LJLA 1UI6A 5CW8A 2HKUA 3VUQA 3NXCA 3IH4A 3HTJA 2IU5A 1Z0XA 2HXIA 2Y31A 2UXUA 5F0FA 1A6IA 3HTAA 5GPCA 4I6ZA 2RASA 3DCFA 4MK6A 5J1UA 3FK6A 3V78A 2UXIA 1UI5A 2IBDA 1JT0A 4M3DA 5K7ZA 2QKOA 2XPVA 5K7HA 2FD5A 2ZB9A 2XDNA 2W53A 3BR3A 3ZQFA 5H9TA 3PPBA 2D6YA 2UXOA 3EUPA 5EYRA 2WGBA 4GFLA 4AC6A 3NNRA 5FHPA 2IEKA 3G56A 5F08A 4DW6A 2G7SA 3B6CA 2ZCMA 4YZEA 2XGDA 3QPSA 3RD3A 3HTIA 3BT9A 4JL3A 2GBYA 2O7TA 4V2GA 3VP5A 3JSJA 3BCGA 4M3GA 5FKMA 5F27A 3BTIA 3HIMA 5J1RA 3CJDA 5FKNA 3CCYA 4CGRA 5IOZA 4KWAA 5J1YA 3GZIA 5HBUA 3LSRA 3AQTA 2ZOZA 3Q0VA 3FIWA 3HTHA 2WUIA 3G1MA 3VVZA 4ACIA 3Q3SA 3BTJA 3C07A 2QTQA 3Q0WA 4GCTA 3RH2A 2XRLA 3VIBA 3LOCA 5HSZA 3WHBA 1SGMA 3V6GA 3P9TA 3F1BA 3HGYA 3PASA 3LSJA 2ZCNA 3VW2A 3VVYA 5FKLA 3LWJA 4JKZA 3ANPA 2HXOA 3B81A 1JUPA 3NI7A 5FGLA 5FMPA 2HYTA 3HE0A 2X9DA 2XGEA 3KZ9A 3BHQA 4V2FA 5D1RA 2Q24A 5FKOA 1VI0A 4L62A 5J3LA 2G0EA 5D18A 3KNWA 4D7MA 5F0CA 2DG7A 3GEUA 3ZQLA 1ZKGA 3ANGA 2NS8A 3ON2A 3MVPA 3QBMA 4X1EA 4AC0A 5F04A 1RKTA 3BQZA 2TCTA 4NN1A 4M3BA 3NRGA 3SFIA 2PZ9A 2DTZA 2XPUA 4GCKA 3BTCA 3VOXA 3VVXA 5AQCA 2REKA 2ZOYA 4NELA 5FKKA 2UXHA 4W1UA 4PXIA 2UXPA 2XB5A 2HQ5A 5CXGA 4UDSA 5F1JA 2QOPA 2NX4A 2QWTA 4W97A 3O8HA 2QCOA 4D5CA 2VKEA 3BR1A 5EZGA 3LSPA 3BR0A 2GENA 2EH3A 3O8GA 2DG8A 4B1RA 1T33A 2NP3A 2QIBA 3BR5A 3DEWA 2WV1A 3IUVA 4XK4A 2G3BA 2JK3A 2X6OA 3VW1A 4D5FA 2I10A 3BTLA 2FX0A 1U9NA 1RPWA 3CDLA 5DAJA 3ZQHA 3MNLA 2FBQA 2GUHA 2JJ7A 3AQSA 3KKCA 2O7OA 5EZHA 1ZK8A 2ID6A 2NS7A 2V57A 4GCLA 2G7LA 3G1LA 3LHQA 4I76A 3BR6A 3CRJA 2ZCXA 2RAEA 1QPIA 4HKUA 3G1OA 3DPJA 1JT6A 5HAWA 3FRQA 2OPTA 3COLA 3WHCA 2ID3A 2F07A 3T6NA 3S5RA 3ZQIA 2XGCA 3TP3A 4M3EA 5F0HA 3QQAA 3Q0UA 5IOYA 2FJ1A 2XPWA 5K7FA 3TP0A 5CXIA 1U9OA 3EGQA 2RHAA 2OERA 5GP9A 3BRUA 3C2BA 3FK7A 5C4YA 3VOKA 1JTXA 3BR2A 5D19A 3QKXA 5GPAA 4ICHA 1QVTA 2NP5A 3G7RA 1QVUA
chains in the Genus database with same CATH superfamily
3VW0A 3BJBA 3BNIA 3F0CA 2IAIA 1T56A 1BJZA 4ABZA 2G7GA 3SWHA 3IH3A 2OF7A 4MXMA 3E7QA 3ZQGA 1ORKA 3B6AA 3CWRA 4ME9A 4GFKA 2Y2ZA 2VPRA 4AUXA 2Y30A 3IH2A 5K58A 4JYKA 3BQYA 4AF5A 1JTYA 4M3FA 2TRTA 3PM1A 4B3AA 2GFNA 2PBXA 1JUMA 4JNNA 5IPAA 2HYJA 3HGGA 2VKVA 4D7NA 1JUSA 3ON4A 2YVEA 2ZY9A 4IRVA 5EFYA 3VPRA 3QPLA 2FQ4A 3O60A 1RKWA 2OI8A 2YVHA 1Z77A 3DU5A 3KKDA 3NPIA 4MO7A 4G12A 3SDGA 5IP6A 3LJLA 1UI6A 5CW8A 2HKUA 3VUQA 3NXCA 3IH4A 3HTJA 2IU5A 1Z0XA 2R7RA 2HXIA 2Y31A 2UXUA 5F0FA 1A6IA 3HTAA 5GPCA 4I6ZA 2RASA 3DCFA 4MK6A 5J1UA 3FK6A 4WIBA 3V78A 2UXIA 1UI5A 2IBDA 1JT0A 4M3DA 5K7ZA 2QKOA 2XPVA 5K7HA 2FD5A 2ZB9A 2XDNA 2W53A 2R7OA 3BR3A 3ZQFA 5H9TA 2R7VA 3PPBA 2D6YA 4C2MA 2A2FX 2UXOA 3EUPA 5EYRA 3KYLA 2WGBA 2R7QA 4GFLA 4AC6A 3NNRA 5FHPA 2IEKA 3G56A 5F08A 4DW6A 2G7SA 3B6CA 2ZCMA 4YZEA 2XGDA 3QPSA 3RD3A 3HTIA 3BT9A 4JL3A 2GBYA 2O7TA 4V2GA 3VP5A 2R7SA 5CQGA 3JSJA 3BCGA 4M3GA 5FKMA 5F27A 3BTIA 3HIMA 5J1RA 3CJDA 4OD5A 5FKNA 3CCYA 4CGRA 5IOZA 4KWAA 5J1YA 3GZIA 5HBUA 3LSRA 3AQTA 2ZOZA 3Q0VA 3FIWA 3HTHA 2WUIA 3G1MA 3VVZA 4ACIA 3Q3SA 3BTJA 3C07A 4U9NA 2QTQA 3Q0WA 4GCTA 3RH2A 2XRLA 3VIBA 3LOCA 5HSZA 3WHBA 1SGMA 3V6GA 3P9TA 3F1BA 3HGYA 3PASA 3LSJA 2FJI1 2ZCNA 3VW2A 3VVYA 5FKLA 3LWJA 4JKZA 3ANPA 2HXOA 3B81A 1JUPA 3NI7A 5FGLA 5FMPA 2HYTA 3HE0A 2X9DA 2XGEA 3KZ9A 3BHQA 4V2FA 5D1RA 2Q24A 5FKOA 4U9LA 1VI0A 2R7TA 4L62A 5J3LA 2G0EA 5D18A 3KNWA 4D7MA 5F0CA 2DG7A 3GEUA 3ZQLA 2R7XA 1ZKGA 3ANGA 2NS8A 2B1EA 3ON2A 3MVPA 3QBMA 4X1EA 4AC0A 5F04A 1RKTA 3BQZA 2TCTA 4NN1A 4M3BA 2R7UA 3NRGA 4OD4A 3SFIA 2PZ9A 2DTZA 2XPUA 4GCKA 3BTCA 3VOXA 3VVXA 5AQCA 3K8PC 2REKA 2ZOYA 4NELA 5FKKA 2UXHA 4W1UA 4PXIA 2UXPA 2XB5A 2HQ5A 5CXGA 4UDSA 5F1JA 3FHNA 2QOPA 2NX4A 2QWTA 4W97A 3O8HA 2QCOA 4D5CA 2VKEA 3BR1A 5EZGA 3LSPA 3BR0A 2GENA 2EH3A 3O8GA 2DG8A 4B1RA 1T33A 2NP3A 2QIBA 3BR5A 3DEWA 2WV1A 3IUVA 4XK4A 2G3BA 2JK3A 2X6OA 3VW1A 4D5FA 2I10A 3BTLA 2FX0A 1U9NA 1RPWA 3CDLA 5DAJA 3ZQHA 2B3WA 3MNLA 2FBQA 2GUHA 2JJ7A 3AQSA 3KKCA 2O7OA 5EZHA 1ZK8A 2ID6A 2NS7A 2V57A 4GCLA 2G7LA 2YVXA 3G1LA 3LHQA 4I76A 3BR6A 3CRJA 2ZCXA 2RAEA 1QPIA 4DVYP 4HKUA 3G1OA 3DPJA 1JT6A 5HAWA 3FRQA 2OPTA 3COLA 3WHCA 2ID3A 2F07A 3T6NA 3S5RA 3VTIA 2PFVA 3ZQIA 2XGCA 3TP3A 4M3EA 5F0HA 3QQAA 3Q0UA 5IOYA 2FJ1A 2XPWA 5K7FA 3TP0A 5CXIA 1U9OA 3EGQA 2RHAA 2OERA 5GP9A 3BRUA 3C2BA 3FK7A 5C4YA 3VOKA 1JTXA 3NS4A 3BR2A 2R7WA 5D19A 3QKXA 5GPAA 4ICHA 1QVTA 2NP5A 3G7RA 3DU6A 1QVUA
chains in the Genus database with same CATH topology
3VW0A 3BJBA 3BNIA 3F0CA 2IAIA 1T56A 1BJZA 4ABZA 2G7GA 3IH3A 2OF7A 4MXMA 3E7QA 3ZQGA 1ORKA 3B6AA 3CWRA 4ME9A 4GFKA 2Y2ZA 2VPRA 4AUXA 2Y30A 3IH2A 5K58A 4JYKA 3BQYA 4AF5A 1JTYA 4M3FA 2TRTA 3PM1A 4B3AA 2GFNA 2PBXA 1JUMA 4JNNA 5IPAA 2HYJA 3HGGA 2VKVA 4D7NA 1JUSA 3ON4A 2YVEA 5EFYA 3VPRA 3QPLA 2FQ4A 3O60A 1RKWA 2OI8A 2YVHA 1Z77A 3KKDA 3NPIA 4MO7A 4G12A 3SDGA 5IP6A 3LJLA 1UI6A 5CW8A 2HKUA 3VUQA 3NXCA 3IH4A 3HTJA 2IU5A 1Z0XA 2HXIA 2Y31A 2UXUA 5F0FA 1A6IA 3HTAA 5GPCA 4I6ZA 2RASA 3DCFA 4MK6A 5J1UA 3FK6A 3V78A 2UXIA 1UI5A 2IBDA 1JT0A 4M3DA 5K7ZA 2QKOA 2XPVA 5K7HA 2FD5A 2ZB9A 2XDNA 2W53A 3BR3A 3ZQFA 5H9TA 3PPBA 2D6YA 2UXOA 3EUPA 5EYRA 2WGBA 4GFLA 4AC6A 3NNRA 5FHPA 2IEKA 3G56A 5F08A 4DW6A 2G7SA 3B6CA 2ZCMA 4YZEA 2XGDA 3QPSA 3RD3A 3HTIA 3BT9A 4JL3A 2GBYA 2O7TA 4V2GA 3VP5A 3JSJA 3BCGA 4M3GA 5FKMA 5F27A 3BTIA 3HIMA 5J1RA 3CJDA 5FKNA 3CCYA 4CGRA 5IOZA 4KWAA 5J1YA 3GZIA 5HBUA 3LSRA 3AQTA 2ZOZA 3Q0VA 3FIWA 3HTHA 2WUIA 3G1MA 3VVZA 4ACIA 3Q3SA 3BTJA 3C07A 2QTQA 3Q0WA 4GCTA 3RH2A 2XRLA 3VIBA 3LOCA 5HSZA 3WHBA 1SGMA 3V6GA 3P9TA 3F1BA 3HGYA 3PASA 3LSJA 2ZCNA 3VW2A 3VVYA 5FKLA 3LWJA 4JKZA 3ANPA 2HXOA 3B81A 1JUPA 3NI7A 5FGLA 5FMPA 2HYTA 3HE0A 2X9DA 2XGEA 3KZ9A 3BHQA 4V2FA 5D1RA 2Q24A 5FKOA 1VI0A 4L62A 5J3LA 2G0EA 5D18A 3KNWA 4D7MA 5F0CA 2DG7A 3GEUA 3ZQLA 1ZKGA 3ANGA 2NS8A 3ON2A 3MVPA 3QBMA 4X1EA 4AC0A 5F04A 1RKTA 3BQZA 2TCTA 4NN1A 4M3BA 3NRGA 3SFIA 2PZ9A 2DTZA 2XPUA 4GCKA 3BTCA 3VOXA 3VVXA 5AQCA 2REKA 2ZOYA 4NELA 5FKKA 2UXHA 4W1UA 4PXIA 2UXPA 2XB5A 2HQ5A 5CXGA 4UDSA 5F1JA 2QOPA 2NX4A 2QWTA 4W97A 3O8HA 2QCOA 4D5CA 2VKEA 3BR1A 5EZGA 3LSPA 3BR0A 2GENA 2EH3A 3O8GA 2DG8A 4B1RA 1T33A 2NP3A 2QIBA 3BR5A 3DEWA 2WV1A 3IUVA 4XK4A 2G3BA 2JK3A 2X6OA 3VW1A 4D5FA 2I10A 3BTLA 2FX0A 1U9NA 1RPWA 3CDLA 5DAJA 3ZQHA 3MNLA 2FBQA 2GUHA 2JJ7A 3AQSA 3KKCA 2O7OA 5EZHA 1ZK8A 2ID6A 2NS7A 2V57A 4GCLA 2G7LA 3G1LA 3LHQA 4I76A 3BR6A 3CRJA 2ZCXA 2RAEA 1QPIA 4HKUA 3G1OA 3DPJA 1JT6A 5HAWA 3FRQA 2OPTA 3COLA 3WHCA 2ID3A 2F07A 3T6NA 3S5RA 3ZQIA 2XGCA 3TP3A 4M3EA 5F0HA 3QQAA 3Q0UA 5IOYA 2FJ1A 2XPWA 5K7FA 3TP0A 5CXIA 1U9OA 3EGQA 2RHAA 2OERA 5GP9A 3BRUA 3C2BA 3FK7A 5C4YA 3VOKA 1JTXA 3BR2A 5D19A 3QKXA 5GPAA 4ICHA 1QVTA 2NP5A 3G7RA 1QVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VW0 A;  3BJB A;  3BNI A;  3F0C A;  2IAI A;  1T56 A;  1BJZ A;  4ABZ A;  2G7G A;  3IH3 A;  2OF7 A;  4MXM A;  3E7Q A;  3ZQG A;  1ORK A;  3B6A A;  3CWR A;  4ME9 A;  4GFK A;  2Y2Z A;  2VPR A;  4AUX A;  2Y30 A;  3IH2 A;  5K58 A;  4JYK A;  3BQY A;  4AF5 A;  1JTY A;  4M3F A;  2TRT A;  3PM1 A;  4B3A A;  2GFN A;  2PBX A;  1JUM A;  4JNN A;  5IPA A;  2HYJ A;  3HGG A;  2VKV A;  4D7N A;  1JUS A;  3ON4 A;  2YVE A;  5EFY A;  3VPR A;  3QPL A;  2FQ4 A;  3O60 A;  1RKW A;  2OI8 A;  2YVH A;  1Z77 A;  3KKD A;  3NPI A;  4MO7 A;  4G12 A;  3SDG A;  5IP6 A;  3LJL A;  1UI6 A;  5CW8 A;  2HKU A;  3VUQ A;  3NXC A;  3IH4 A;  3HTJ A;  2IU5 A;  1Z0X A;  2HXI A;  2Y31 A;  2UXU A;  5F0F A;  1A6I A;  3HTA A;  5GPC A;  4I6Z A;  2RAS A;  3DCF A;  4MK6 A;  5J1U A;  3FK6 A;  3V78 A;  2UXI A;  1UI5 A;  2IBD A;  1JT0 A;  4M3D A;  5K7Z A;  2QKO A;  2XPV A;  5K7H A;  2FD5 A;  2ZB9 A;  2XDN A;  2W53 A;  3BR3 A;  3ZQF A;  5H9T A;  3PPB A;  2D6Y A;  2UXO A;  3EUP A;  5EYR A;  2WGB A;  4GFL A;  4AC6 A;  3NNR A;  5FHP A;  2IEK A;  3G56 A;  5F08 A;  4DW6 A;  2G7S A;  3B6C A;  2ZCM A;  4YZE A;  2XGD A;  3QPS A;  3RD3 A;  3HTI A;  3BT9 A;  4JL3 A;  2GBY A;  2O7T A;  4V2G A;  3VP5 A;  3JSJ A;  3BCG A;  4M3G A;  5FKM A;  5F27 A;  3BTI A;  3HIM A;  5J1R A;  3CJD A;  5FKN A;  3CCY A;  4CGR A;  5IOZ A;  4KWA A;  5J1Y A;  3GZI A;  5HBU A;  3LSR A;  3AQT A;  2ZOZ A;  3Q0V A;  3FIW A;  3HTH A;  2WUI A;  3G1M A;  3VVZ A;  4ACI A;  3Q3S A;  3BTJ A;  3C07 A;  2QTQ A;  3Q0W A;  4GCT A;  3RH2 A;  2XRL A;  3VIB A;  3LOC A;  5HSZ A;  3WHB A;  1SGM A;  3V6G A;  3P9T A;  3F1B A;  3HGY A;  3PAS A;  3LSJ A;  2ZCN A;  3VW2 A;  3VVY A;  5FKL A;  3LWJ A;  4JKZ A;  3ANP A;  2HXO A;  3B81 A;  1JUP A;  3NI7 A;  5FGL A;  5FMP A;  2HYT A;  3HE0 A;  2X9D A;  2XGE A;  3KZ9 A;  3BHQ A;  4V2F A;  5D1R A;  2Q24 A;  5FKO A;  1VI0 A;  4L62 A;  5J3L A;  2G0E A;  5D18 A;  3KNW A;  4D7M A;  5F0C A;  2DG7 A;  3GEU A;  3ZQL A;  1ZKG A;  3ANG A;  2NS8 A;  3ON2 A;  3MVP A;  3QBM A;  4X1E A;  4AC0 A;  5F04 A;  1RKT A;  3BQZ A;  2TCT A;  4NN1 A;  4M3B A;  3NRG A;  3SFI A;  2PZ9 A;  2DTZ A;  2XPU A;  4GCK A;  3BTC A;  3VOX A;  3VVX A;  5AQC A;  2REK A;  2ZOY A;  4NEL A;  5FKK A;  2UXH A;  4W1U A;  4PXI A;  2UXP A;  2XB5 A;  2HQ5 A;  5CXG A;  4UDS A;  5F1J A;  2QOP A;  2NX4 A;  2QWT A;  4W97 A;  3O8H A;  2QCO A;  4D5C A;  2VKE A;  3BR1 A;  5EZG A;  3LSP A;  3BR0 A;  2GEN A;  2EH3 A;  3O8G A;  2DG8 A;  4B1R A;  1T33 A;  2NP3 A;  2QIB A;  3BR5 A;  3DEW A;  2WV1 A;  3IUV A;  4XK4 A;  2G3B A;  2JK3 A;  2X6O A;  3VW1 A;  4D5F A;  2I10 A;  3BTL A;  2FX0 A;  1U9N A;  1RPW A;  3CDL A;  5DAJ A;  3ZQH A;  3MNL A;  2FBQ A;  2GUH A;  2JJ7 A;  3AQS A;  3KKC A;  2O7O A;  5EZH A;  1ZK8 A;  2ID6 A;  2NS7 A;  2V57 A;  4GCL A;  2G7L A;  3G1L A;  3LHQ A;  4I76 A;  3BR6 A;  3CRJ A;  2ZCX A;  2RAE A;  1QPI A;  4HKU A;  3G1O A;  3DPJ A;  1JT6 A;  5HAW A;  3FRQ A;  2OPT A;  3COL A;  3WHC A;  2ID3 A;  2F07 A;  3T6N A;  3S5R A;  3ZQI A;  2XGC A;  3TP3 A;  4M3E A;  5F0H A;  3QQA A;  3Q0U A;  5IOY A;  2FJ1 A;  2XPW A;  5K7F A;  3TP0 A;  5CXI A;  1U9O A;  3EGQ A;  2RHA A;  2OER A;  5GP9 A;  3BRU A;  3C2B A;  3FK7 A;  5C4Y A;  3VOK A;  1JTX A;  3BR2 A;  5D19 A;  3QKX A;  5GPA A;  4ICH A;  1QVT A;  2NP5 A;  3G7R A;  1QVU A; 
#chains in the Genus database with same CATH topology
 3VW0 A;  3BJB A;  3BNI A;  3F0C A;  2IAI A;  1T56 A;  1BJZ A;  4ABZ A;  2G7G A;  3SWH A;  3IH3 A;  2OF7 A;  4MXM A;  3E7Q A;  3ZQG A;  1ORK A;  3B6A A;  3CWR A;  4ME9 A;  4GFK A;  2Y2Z A;  2VPR A;  4AUX A;  2Y30 A;  3IH2 A;  5K58 A;  4JYK A;  3BQY A;  4AF5 A;  1JTY A;  4M3F A;  2TRT A;  3PM1 A;  4B3A A;  2GFN A;  2PBX A;  1JUM A;  4JNN A;  5IPA A;  2HYJ A;  3HGG A;  2VKV A;  4D7N A;  1JUS A;  3ON4 A;  2YVE A;  2ZY9 A;  4IRV A;  5EFY A;  3VPR A;  3QPL A;  2FQ4 A;  3O60 A;  1RKW A;  2OI8 A;  2YVH A;  1Z77 A;  3DU5 A;  3KKD A;  3NPI A;  4MO7 A;  4G12 A;  3SDG A;  5IP6 A;  3LJL A;  1UI6 A;  5CW8 A;  2HKU A;  3VUQ A;  3NXC A;  3IH4 A;  3HTJ A;  2IU5 A;  1Z0X A;  2R7R A;  2HXI A;  2Y31 A;  2UXU A;  5F0F A;  1A6I A;  3HTA A;  5GPC A;  4I6Z A;  2RAS A;  3DCF A;  4MK6 A;  5J1U A;  3FK6 A;  4WIB A;  3V78 A;  2UXI A;  1UI5 A;  2IBD A;  1JT0 A;  4M3D A;  5K7Z A;  2QKO A;  2XPV A;  5K7H A;  2FD5 A;  2ZB9 A;  2XDN A;  2W53 A;  2R7O A;  3BR3 A;  3ZQF A;  5H9T A;  2R7V A;  3PPB A;  2D6Y A;  4C2M A;  2A2F X;  2UXO A;  3EUP A;  5EYR A;  3KYL A;  2WGB A;  2R7Q A;  4GFL A;  4AC6 A;  3NNR A;  5FHP A;  2IEK A;  3G56 A;  5F08 A;  4DW6 A;  2G7S A;  3B6C A;  2ZCM A;  4YZE A;  2XGD A;  3QPS A;  3RD3 A;  3HTI A;  3BT9 A;  4JL3 A;  2GBY A;  2O7T A;  4V2G A;  3VP5 A;  2R7S A;  5CQG A;  3JSJ A;  3BCG A;  4M3G A;  5FKM A;  5F27 A;  3BTI A;  3HIM A;  5J1R A;  3CJD A;  4OD5 A;  5FKN A;  3CCY A;  4CGR A;  5IOZ A;  4KWA A;  5J1Y A;  3GZI A;  5HBU A;  3LSR A;  3AQT A;  2ZOZ A;  3Q0V A;  3FIW A;  3HTH A;  2WUI A;  3G1M A;  3VVZ A;  4ACI A;  3Q3S A;  3BTJ A;  3C07 A;  4U9N A;  2QTQ A;  3Q0W A;  4GCT A;  3RH2 A;  2XRL A;  3VIB A;  3LOC A;  5HSZ A;  3WHB A;  1SGM A;  3V6G A;  3P9T A;  3F1B A;  3HGY A;  3PAS A;  3LSJ A;  2FJI 1;  2ZCN A;  3VW2 A;  3VVY A;  5FKL A;  3LWJ A;  4JKZ A;  3ANP A;  2HXO A;  3B81 A;  1JUP A;  3NI7 A;  5FGL A;  5FMP A;  2HYT A;  3HE0 A;  2X9D A;  2XGE A;  3KZ9 A;  3BHQ A;  4V2F A;  5D1R A;  2Q24 A;  5FKO A;  4U9L A;  1VI0 A;  2R7T A;  4L62 A;  5J3L A;  2G0E A;  5D18 A;  3KNW A;  4D7M A;  5F0C A;  2DG7 A;  3GEU A;  3ZQL A;  2R7X A;  1ZKG A;  3ANG A;  2NS8 A;  2B1E A;  3ON2 A;  3MVP A;  3QBM A;  4X1E A;  4AC0 A;  5F04 A;  1RKT A;  3BQZ A;  2TCT A;  4NN1 A;  4M3B A;  2R7U A;  3NRG A;  4OD4 A;  3SFI A;  2PZ9 A;  2DTZ A;  2XPU A;  4GCK A;  3BTC A;  3VOX A;  3VVX A;  5AQC A;  3K8P C;  2REK A;  2ZOY A;  4NEL A;  5FKK A;  2UXH A;  4W1U A;  4PXI A;  2UXP A;  2XB5 A;  2HQ5 A;  5CXG A;  4UDS A;  5F1J A;  3FHN A;  2QOP A;  2NX4 A;  2QWT A;  4W97 A;  3O8H A;  2QCO A;  4D5C A;  2VKE A;  3BR1 A;  5EZG A;  3LSP A;  3BR0 A;  2GEN A;  2EH3 A;  3O8G A;  2DG8 A;  4B1R A;  1T33 A;  2NP3 A;  2QIB A;  3BR5 A;  3DEW A;  2WV1 A;  3IUV A;  4XK4 A;  2G3B A;  2JK3 A;  2X6O A;  3VW1 A;  4D5F A;  2I10 A;  3BTL A;  2FX0 A;  1U9N A;  1RPW A;  3CDL A;  5DAJ A;  3ZQH A;  2B3W A;  3MNL A;  2FBQ A;  2GUH A;  2JJ7 A;  3AQS A;  3KKC A;  2O7O A;  5EZH A;  1ZK8 A;  2ID6 A;  2NS7 A;  2V57 A;  4GCL A;  2G7L A;  2YVX A;  3G1L A;  3LHQ A;  4I76 A;  3BR6 A;  3CRJ A;  2ZCX A;  2RAE A;  1QPI A;  4DVY P;  4HKU A;  3G1O A;  3DPJ A;  1JT6 A;  5HAW A;  3FRQ A;  2OPT A;  3COL A;  3WHC A;  2ID3 A;  2F07 A;  3T6N A;  3S5R A;  3VTI A;  2PFV A;  3ZQI A;  2XGC A;  3TP3 A;  4M3E A;  5F0H A;  3QQA A;  3Q0U A;  5IOY A;  2FJ1 A;  2XPW A;  5K7F A;  3TP0 A;  5CXI A;  1U9O A;  3EGQ A;  2RHA A;  2OER A;  5GP9 A;  3BRU A;  3C2B A;  3FK7 A;  5C4Y A;  3VOK A;  1JTX A;  3NS4 A;  3BR2 A;  2R7W A;  5D19 A;  3QKX A;  5GPA A;  4ICH A;  1QVT A;  2NP5 A;  3G7R A;  3DU6 A;  1QVU A; 
#chains in the Genus database with same CATH homology
 3VW0 A;  3BJB A;  3BNI A;  3F0C A;  2IAI A;  1T56 A;  1BJZ A;  4ABZ A;  2G7G A;  3IH3 A;  2OF7 A;  4MXM A;  3E7Q A;  3ZQG A;  1ORK A;  3B6A A;  3CWR A;  4ME9 A;  4GFK A;  2Y2Z A;  2VPR A;  4AUX A;  2Y30 A;  3IH2 A;  5K58 A;  4JYK A;  3BQY A;  4AF5 A;  1JTY A;  4M3F A;  2TRT A;  3PM1 A;  4B3A A;  2GFN A;  2PBX A;  1JUM A;  4JNN A;  5IPA A;  2HYJ A;  3HGG A;  2VKV A;  4D7N A;  1JUS A;  3ON4 A;  2YVE A;  5EFY A;  3VPR A;  3QPL A;  2FQ4 A;  3O60 A;  1RKW A;  2OI8 A;  2YVH A;  1Z77 A;  3KKD A;  3NPI A;  4MO7 A;  4G12 A;  3SDG A;  5IP6 A;  3LJL A;  1UI6 A;  5CW8 A;  2HKU A;  3VUQ A;  3NXC A;  3IH4 A;  3HTJ A;  2IU5 A;  1Z0X A;  2HXI A;  2Y31 A;  2UXU A;  5F0F A;  1A6I A;  3HTA A;  5GPC A;  4I6Z A;  2RAS A;  3DCF A;  4MK6 A;  5J1U A;  3FK6 A;  3V78 A;  2UXI A;  1UI5 A;  2IBD A;  1JT0 A;  4M3D A;  5K7Z A;  2QKO A;  2XPV A;  5K7H A;  2FD5 A;  2ZB9 A;  2XDN A;  2W53 A;  3BR3 A;  3ZQF A;  5H9T A;  3PPB A;  2D6Y A;  2UXO A;  3EUP A;  5EYR A;  2WGB A;  4GFL A;  4AC6 A;  3NNR A;  5FHP A;  2IEK A;  3G56 A;  5F08 A;  4DW6 A;  2G7S A;  3B6C A;  2ZCM A;  4YZE A;  2XGD A;  3QPS A;  3RD3 A;  3HTI A;  3BT9 A;  4JL3 A;  2GBY A;  2O7T A;  4V2G A;  3VP5 A;  3JSJ A;  3BCG A;  4M3G A;  5FKM A;  5F27 A;  3BTI A;  3HIM A;  5J1R A;  3CJD A;  5FKN A;  3CCY A;  4CGR A;  5IOZ A;  4KWA A;  5J1Y A;  3GZI A;  5HBU A;  3LSR A;  3AQT A;  2ZOZ A;  3Q0V A;  3FIW A;  3HTH A;  2WUI A;  3G1M A;  3VVZ A;  4ACI A;  3Q3S A;  3BTJ A;  3C07 A;  2QTQ A;  3Q0W A;  4GCT A;  3RH2 A;  2XRL A;  3VIB A;  3LOC A;  5HSZ A;  3WHB A;  1SGM A;  3V6G A;  3P9T A;  3F1B A;  3HGY A;  3PAS A;  3LSJ A;  2ZCN A;  3VW2 A;  3VVY A;  5FKL A;  3LWJ A;  4JKZ A;  3ANP A;  2HXO A;  3B81 A;  1JUP A;  3NI7 A;  5FGL A;  5FMP A;  2HYT A;  3HE0 A;  2X9D A;  2XGE A;  3KZ9 A;  3BHQ A;  4V2F A;  5D1R A;  2Q24 A;  5FKO A;  1VI0 A;  4L62 A;  5J3L A;  2G0E A;  5D18 A;  3KNW A;  4D7M A;  5F0C A;  2DG7 A;  3GEU A;  3ZQL A;  1ZKG A;  3ANG A;  2NS8 A;  3ON2 A;  3MVP A;  3QBM A;  4X1E A;  4AC0 A;  5F04 A;  1RKT A;  3BQZ A;  2TCT A;  4NN1 A;  4M3B A;  3NRG A;  3SFI A;  2PZ9 A;  2DTZ A;  2XPU A;  4GCK A;  3BTC A;  3VOX A;  3VVX A;  5AQC A;  2REK A;  2ZOY A;  4NEL A;  5FKK A;  2UXH A;  4W1U A;  4PXI A;  2UXP A;  2XB5 A;  2HQ5 A;  5CXG A;  4UDS A;  5F1J A;  2QOP A;  2NX4 A;  2QWT A;  4W97 A;  3O8H A;  2QCO A;  4D5C A;  2VKE A;  3BR1 A;  5EZG A;  3LSP A;  3BR0 A;  2GEN A;  2EH3 A;  3O8G A;  2DG8 A;  4B1R A;  1T33 A;  2NP3 A;  2QIB A;  3BR5 A;  3DEW A;  2WV1 A;  3IUV A;  4XK4 A;  2G3B A;  2JK3 A;  2X6O A;  3VW1 A;  4D5F A;  2I10 A;  3BTL A;  2FX0 A;  1U9N A;  1RPW A;  3CDL A;  5DAJ A;  3ZQH A;  3MNL A;  2FBQ A;  2GUH A;  2JJ7 A;  3AQS A;  3KKC A;  2O7O A;  5EZH A;  1ZK8 A;  2ID6 A;  2NS7 A;  2V57 A;  4GCL A;  2G7L A;  3G1L A;  3LHQ A;  4I76 A;  3BR6 A;  3CRJ A;  2ZCX A;  2RAE A;  1QPI A;  4HKU A;  3G1O A;  3DPJ A;  1JT6 A;  5HAW A;  3FRQ A;  2OPT A;  3COL A;  3WHC A;  2ID3 A;  2F07 A;  3T6N A;  3S5R A;  3ZQI A;  2XGC A;  3TP3 A;  4M3E A;  5F0H A;  3QQA A;  3Q0U A;  5IOY A;  2FJ1 A;  2XPW A;  5K7F A;  3TP0 A;  5CXI A;  1U9O A;  3EGQ A;  2RHA A;  2OER A;  5GP9 A;  3BRU A;  3C2B A;  3FK7 A;  5C4Y A;  3VOK A;  1JTX A;  3BR2 A;  5D19 A;  3QKX A;  5GPA A;  4ICH A;  1QVT A;  2NP5 A;  3G7R A;  1QVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...