2YVHA

Crystal structure of the operator-binding form of the multi-drug binding transcriptional repressor cgmr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
SKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription/dna
molecule keywords Transcriptional regulator
total genus 55
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yvhA00
4GFKA 2XGCA 3ON4A 1ORKA 3C07A 2XPWA 3LWJA 3ZQLA 3BR3A 4ICHA 3EUPA 1UI6A 3HTHA 3CRJA 3LJLA 5F0CA 1QVTA 3DPJA 3C2BA 1U9NA 3VW2A 4V2FA 3G1LA 4D7MA 1UI5A 3BRUA 3FIWA 3PM1A 5CXGA 3LSPA 3O8GA 2NS7A 3CJDA 4NELA 3T6NA 5GPCA 1JT6A 3BT9A 5K7FA 3G7RA 3NPIA 3QBMA 5HAWA 3PASA 3GEUA 1JTXA 3VP5A 2ZCNA 4MXMA 3ANGA 2QKOA 3G1MA 2TCTA 3IUVA 4W97A 4I6ZA 5IOYA 3LSJA 2VKEA 3SFIA 2HXIA 3DCFA 5FMPA 2V57A 3BR2A 3ANPA 2OPTA 2VPRA 4AF5A 4GCLA 3GZIA 2NS8A 2YVHA 3VOKA 5F0FA 3NI7A 2ID6A 3QPLA 3BTIA 2PBXA 2ZB9A 5J3LA 1JUMA 5K7ZA 4ABZA 2ZOYA 2OERA 3QPSA 3NNRA 3MNLA 2UXUA 3JSJA 5EYRA 5CXIA 2UXIA 5F27A 2HQ5A 2YVEA 3BHQA 5D19A 2XGDA 3G56A 3V78A 1A6IA 2D6YA 3IH2A 5F1JA 1QVUA 2ID3A 3BR5A 5D18A 5HSZA 2QWTA 2JK3A 4I76A 2WGBA 4GCKA 3HTAA 1JT0A 2GFNA 5F04A 3QQAA 4JYKA 2X9DA 3FRQA 3KKCA 5IPAA 4D5CA 5HBUA 5F08A 1Z0XA 5H9TA 3PPBA 2IAIA 3COLA 2Y31A 3BR1A 3HGGA 2ZCMA 3F0CA 3LSRA 3VVXA 2NX4A 3V6GA 2RAEA 5J1YA 2VKVA 2G3BA 5F0HA 3CCYA 3BNIA 2GUHA 3VIBA 3NRGA 3E7QA 2GENA 3ZQIA 1JUSA 4M3EA 4ME9A 3VUQA 3EGQA 3G1OA 2OF7A 3SDGA 3QKXA 2RASA 4M3DA 2FBQA 3HTJA 2XB5A 5FKNA 2O7OA 3B81A 5FKMA 4CGRA 1RPWA 1T56A 3BQZA 2FJ1A 1T33A 3RD3A 5IP6A 4PXIA 2Q24A 2XPUA 4L62A 2UXOA 3BTCA 3ON2A 4B1RA 3VVZA 3RH2A 3ZQGA 3BCGA 5CW8A 2F07A 3BR6A 4V2GA 2REKA 1ZK8A 2UXHA 2XRLA 4HKUA 3TP3A 2G0EA 5K7HA 4JNNA 2QCOA 1SGMA 1U9OA 2XDNA 2GBYA 5FGLA 3Q0UA 2G7LA 4D7NA 2DTZA 2O7TA 3BTJA 3F1BA 4MK6A 2IEKA 3S5RA 5K58A 2QIBA 3VOXA 4NN1A 5FKKA 4W1UA 3HIMA 3Q0VA 2Y30A 4UDSA 1Z77A 4AC0A 3ZQFA 2OI8A 3VW0A 2EH3A 4JL3A 4D5FA 3O60A 2ZCXA 3VW1A 1JUPA 3BJBA 3VPRA 5J1RA 4YZEA 3HGYA 3MVPA 2Y2ZA 1VI0A 3WHBA 3DEWA 4DW6A 5J1UA 3ZQHA 4M3BA 2HXOA 3WHCA 4ACIA 4KWAA 2FD5A 1BJZA 3Q0WA 2RHAA 2NP3A 3FK7A 4B3AA 2DG8A 3O8HA 2IU5A 4MO7A 4JKZA 2PZ9A 2QOPA 2UXPA 3CWRA 3KKDA 3BTLA 3B6AA 2TRTA 3AQTA 2IBDA 5D1RA 1JTYA 2FX0A 2QTQA 3BQYA 5EZHA 3LOCA 2JJ7A 2G7GA 3BR0A 5GP9A 5FHPA 5FKLA 1RKTA 2HYTA 3P9TA 2X6OA 3KNWA 2I10A 5FKOA 1RKWA 3HE0A 5AQCA 2XGEA 2DG7A 3HTIA 4AC6A 2W53A 3Q3SA 2FQ4A 4XK4A 3CDLA 2HYJA 2WV1A 5EZGA 3IH4A 3AQSA 3B6CA 4M3FA 4G12A 2WUIA 4AUXA 2HKUA 2NP5A 5GPAA 3VVYA 5EFYA 3NXCA 4X1EA 3TP0A 1ZKGA 4GCTA 4M3GA 5IOZA 2G7SA 5DAJA 3LHQA 3IH3A 2ZOZA 4GFLA 2XPVA 3FK6A 1QPIA 5C4YA 3KZ9A
chains in the Genus database with same CATH superfamily
4GFKA 2XGCA 3ON4A 1ORKA 3C07A 2XPWA 3LWJA 3ZQLA 3BR3A 4ICHA 3EUPA 1UI6A 3HTHA 3CRJA 3LJLA 5F0CA 1QVTA 3DPJA 3C2BA 1U9NA 3VW2A 4V2FA 3G1LA 4D7MA 1UI5A 3BRUA 3FIWA 3PM1A 5CXGA 3LSPA 3O8GA 2NS7A 3CJDA 2ZY9A 4NELA 3T6NA 5GPCA 1JT6A 4WIBA 3BT9A 5K7FA 3G7RA 3NPIA 3DU6A 3QBMA 5HAWA 3PASA 3GEUA 1JTXA 3VP5A 2ZCNA 4MXMA 3ANGA 2QKOA 3G1MA 4U9LA 2TCTA 3IUVA 4W97A 4I6ZA 5IOYA 3LSJA 2VKEA 3SFIA 2HXIA 3DCFA 5FMPA 2V57A 3BR2A 3ANPA 2OPTA 2VPRA 4AF5A 4GCLA 3GZIA 2NS8A 2YVHA 3VOKA 5F0FA 3NI7A 2ID6A 3QPLA 3BTIA 2PBXA 2ZB9A 5J3LA 1JUMA 5K7ZA 4ABZA 2R7OA 2OERA 2ZOYA 3QPSA 3NNRA 3MNLA 2UXUA 3JSJA 3VTIA 5EYRA 2R7SA 5CXIA 2UXIA 5F27A 2HQ5A 5CQGA 2YVEA 3BHQA 5D19A 2XGDA 3G56A 3V78A 1A6IA 2D6YA 3IH2A 5F1JA 1QVUA 2ID3A 3BR5A 5D18A 5HSZA 2JK3A 2QWTA 4I76A 2WGBA 4GCKA 3HTAA 1JT0A 2GFNA 5F04A 3QQAA 4JYKA 2X9DA 3FRQA 3KKCA 4OD4A 5IPAA 4D5CA 5HBUA 5F08A 4IRVA 1Z0XA 5H9TA 3PPBA 2IAIA 3COLA 2Y31A 3BR1A 3HGGA 2ZCMA 3F0CA 3LSRA 3VVXA 2NX4A 3V6GA 2RAEA 5J1YA 3DU5A 2VKVA 2G3BA 5F0HA 3CCYA 3BNIA 2GUHA 3VIBA 3NRGA 3E7QA 2GENA 2R7RA 3ZQIA 1JUSA 4M3EA 4ME9A 3VUQA 3EGQA 3G1OA 2B1EA 2OF7A 3SDGA 3QKXA 2RASA 4M3DA 2FBQA 3HTJA 2XB5A 5FKNA 2O7OA 5FKMA 2YVXA 3B81A 4CGRA 1RPWA 1T56A 2R7TA 3BQZA 2FJ1A 1T33A 3RD3A 5IP6A 4PXIA 2Q24A 2XPUA 4L62A 2UXOA 3BTCA 3ON2A 4B1RA 3VVZA 3RH2A 3ZQGA 3BCGA 5CW8A 2F07A 3BR6A 4V2GA 2REKA 1ZK8A 2UXHA 3KYLA 2XRLA 4HKUA 3TP3A 2G0EA 5K7HA 4JNNA 2QCOA 1SGMA 1U9OA 2XDNA 2GBYA 5FGLA 3Q0UA 2G7LA 4D7NA 2DTZA 2O7TA 3BTJA 3F1BA 4MK6A 2IEKA 3S5RA 5K58A 2QIBA 3VOXA 4NN1A 5FKKA 4OD5A 4W1UA 3HIMA 3Q0VA 2Y30A 4UDSA 1Z77A 4AC0A 3ZQFA 2OI8A 3VW0A 2EH3A 4JL3A 4D5FA 3O60A 2ZCXA 3VW1A 1JUPA 3BJBA 3VPRA 5J1RA 4YZEA 3HGYA 3MVPA 2Y2ZA 1VI0A 3WHBA 3DEWA 4DW6A 2PFVA 5J1UA 3ZQHA 4M3BA 2HXOA 3WHCA 4ACIA 4KWAA 2FD5A 1BJZA 3Q0WA 2RHAA 3NS4A 2NP3A 3FK7A 4B3AA 2DG8A 3O8HA 2IU5A 4MO7A 2FJI1 4JKZA 2PZ9A 2QOPA 2UXPA 3CWRA 3KKDA 3BTLA 4DVYP 3B6AA 2TRTA 3AQTA 2IBDA 5D1RA 1JTYA 2FX0A 2QTQA 2R7UA 3BQYA 5EZHA 3LOCA 2JJ7A 2G7GA 4C2MA 3BR0A 5GP9A 5FHPA 5FKLA 1RKTA 4U9NA 2HYTA 3P9TA 2X6OA 3KNWA 2I10A 5FKOA 1RKWA 3HE0A 5AQCA 2XGEA 2DG7A 3HTIA 4AC6A 2R7VA 3K8PC 2W53A 2R7QA 3Q3SA 2FQ4A 3SWHA 4XK4A 3CDLA 2HYJA 2WV1A 5EZGA 2B3WA 2A2FX 3IH4A 2R7XA 3AQSA 3B6CA 4M3FA 4G12A 2WUIA 4AUXA 2HKUA 2NP5A 5GPAA 3VVYA 5EFYA 3NXCA 4X1EA 3TP0A 1ZKGA 4GCTA 4M3GA 5IOZA 2G7SA 2R7WA 3FHNA 5DAJA 3LHQA 3IH3A 2ZOZA 4GFLA 2XPVA 3FK6A 1QPIA 5C4YA 3KZ9A
chains in the Genus database with same CATH topology
4GFKA 2XGCA 3ON4A 1ORKA 3C07A 2XPWA 3LWJA 3ZQLA 3BR3A 4ICHA 3EUPA 1UI6A 3HTHA 3CRJA 3LJLA 5F0CA 1QVTA 3DPJA 3C2BA 1U9NA 3VW2A 4V2FA 3G1LA 4D7MA 1UI5A 3BRUA 3FIWA 3PM1A 5CXGA 3LSPA 3O8GA 2NS7A 3CJDA 4NELA 3T6NA 5GPCA 1JT6A 3BT9A 5K7FA 3G7RA 3NPIA 3QBMA 5HAWA 3PASA 3GEUA 1JTXA 3VP5A 2ZCNA 4MXMA 3ANGA 2QKOA 3G1MA 2TCTA 3IUVA 4W97A 4I6ZA 5IOYA 3LSJA 2VKEA 3SFIA 2HXIA 3DCFA 5FMPA 2V57A 3BR2A 3ANPA 2OPTA 2VPRA 4AF5A 4GCLA 3GZIA 2NS8A 2YVHA 3VOKA 5F0FA 3NI7A 2ID6A 3QPLA 3BTIA 2PBXA 2ZB9A 5J3LA 1JUMA 5K7ZA 4ABZA 2ZOYA 2OERA 3QPSA 3NNRA 3MNLA 2UXUA 3JSJA 5EYRA 5CXIA 2UXIA 5F27A 2HQ5A 2YVEA 3BHQA 5D19A 2XGDA 3G56A 3V78A 1A6IA 2D6YA 3IH2A 5F1JA 1QVUA 2ID3A 3BR5A 5D18A 5HSZA 2QWTA 2JK3A 4I76A 2WGBA 4GCKA 3HTAA 1JT0A 2GFNA 5F04A 3QQAA 4JYKA 2X9DA 3FRQA 3KKCA 5IPAA 4D5CA 5HBUA 5F08A 1Z0XA 5H9TA 3PPBA 2IAIA 3COLA 2Y31A 3BR1A 3HGGA 2ZCMA 3F0CA 3LSRA 3VVXA 2NX4A 3V6GA 2RAEA 5J1YA 2VKVA 2G3BA 5F0HA 3CCYA 3BNIA 2GUHA 3VIBA 3NRGA 3E7QA 2GENA 3ZQIA 1JUSA 4M3EA 4ME9A 3VUQA 3EGQA 3G1OA 2OF7A 3SDGA 3QKXA 2RASA 4M3DA 2FBQA 3HTJA 2XB5A 5FKNA 2O7OA 3B81A 5FKMA 4CGRA 1RPWA 1T56A 3BQZA 2FJ1A 1T33A 3RD3A 5IP6A 4PXIA 2Q24A 2XPUA 4L62A 2UXOA 3BTCA 3ON2A 4B1RA 3VVZA 3RH2A 3ZQGA 3BCGA 5CW8A 2F07A 3BR6A 4V2GA 2REKA 1ZK8A 2UXHA 2XRLA 4HKUA 3TP3A 2G0EA 5K7HA 4JNNA 2QCOA 1SGMA 1U9OA 2XDNA 2GBYA 5FGLA 3Q0UA 2G7LA 4D7NA 2DTZA 2O7TA 3BTJA 3F1BA 4MK6A 2IEKA 3S5RA 5K58A 2QIBA 3VOXA 4NN1A 5FKKA 4W1UA 3HIMA 3Q0VA 2Y30A 4UDSA 1Z77A 4AC0A 3ZQFA 2OI8A 3VW0A 2EH3A 4JL3A 4D5FA 3O60A 2ZCXA 3VW1A 1JUPA 3BJBA 3VPRA 5J1RA 4YZEA 3HGYA 3MVPA 2Y2ZA 1VI0A 3WHBA 3DEWA 4DW6A 5J1UA 3ZQHA 4M3BA 2HXOA 3WHCA 4ACIA 4KWAA 2FD5A 1BJZA 3Q0WA 2RHAA 2NP3A 3FK7A 4B3AA 2DG8A 3O8HA 2IU5A 4MO7A 4JKZA 2PZ9A 2QOPA 2UXPA 3CWRA 3KKDA 3BTLA 3B6AA 2TRTA 3AQTA 2IBDA 5D1RA 1JTYA 2FX0A 2QTQA 3BQYA 5EZHA 3LOCA 2JJ7A 2G7GA 3BR0A 5GP9A 5FHPA 5FKLA 1RKTA 2HYTA 3P9TA 2X6OA 3KNWA 2I10A 5FKOA 1RKWA 3HE0A 5AQCA 2XGEA 2DG7A 3HTIA 4AC6A 2W53A 3Q3SA 2FQ4A 4XK4A 3CDLA 2HYJA 2WV1A 5EZGA 3IH4A 3AQSA 3B6CA 4M3FA 4G12A 2WUIA 4AUXA 2HKUA 2NP5A 5GPAA 3VVYA 5EFYA 3NXCA 4X1EA 3TP0A 1ZKGA 4GCTA 4M3GA 5IOZA 2G7SA 5DAJA 3LHQA 3IH3A 2ZOZA 4GFLA 2XPVA 3FK6A 1QPIA 5C4YA 3KZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFK A;  2XGC A;  3ON4 A;  1ORK A;  3C07 A;  2XPW A;  3LWJ A;  3ZQL A;  3BR3 A;  4ICH A;  3EUP A;  1UI6 A;  3HTH A;  3CRJ A;  3LJL A;  5F0C A;  1QVT A;  3DPJ A;  3C2B A;  1U9N A;  3VW2 A;  4V2F A;  3G1L A;  4D7M A;  1UI5 A;  3BRU A;  3FIW A;  3PM1 A;  5CXG A;  3LSP A;  3O8G A;  2NS7 A;  3CJD A;  4NEL A;  3T6N A;  5GPC A;  1JT6 A;  3BT9 A;  5K7F A;  3G7R A;  3NPI A;  3QBM A;  5HAW A;  3PAS A;  3GEU A;  1JTX A;  3VP5 A;  2ZCN A;  4MXM A;  3ANG A;  2QKO A;  3G1M A;  2TCT A;  3IUV A;  4W97 A;  4I6Z A;  5IOY A;  3LSJ A;  2VKE A;  3SFI A;  2HXI A;  3DCF A;  5FMP A;  2V57 A;  3BR2 A;  3ANP A;  2OPT A;  2VPR A;  4AF5 A;  4GCL A;  3GZI A;  2NS8 A;  2YVH A;  3VOK A;  5F0F A;  3NI7 A;  2ID6 A;  3QPL A;  3BTI A;  2PBX A;  2ZB9 A;  5J3L A;  1JUM A;  5K7Z A;  4ABZ A;  2ZOY A;  2OER A;  3QPS A;  3NNR A;  3MNL A;  2UXU A;  3JSJ A;  5EYR A;  5CXI A;  2UXI A;  5F27 A;  2HQ5 A;  2YVE A;  3BHQ A;  5D19 A;  2XGD A;  3G56 A;  3V78 A;  1A6I A;  2D6Y A;  3IH2 A;  5F1J A;  1QVU A;  2ID3 A;  3BR5 A;  5D18 A;  5HSZ A;  2QWT A;  2JK3 A;  4I76 A;  2WGB A;  4GCK A;  3HTA A;  1JT0 A;  2GFN A;  5F04 A;  3QQA A;  4JYK A;  2X9D A;  3FRQ A;  3KKC A;  5IPA A;  4D5C A;  5HBU A;  5F08 A;  1Z0X A;  5H9T A;  3PPB A;  2IAI A;  3COL A;  2Y31 A;  3BR1 A;  3HGG A;  2ZCM A;  3F0C A;  3LSR A;  3VVX A;  2NX4 A;  3V6G A;  2RAE A;  5J1Y A;  2VKV A;  2G3B A;  5F0H A;  3CCY A;  3BNI A;  2GUH A;  3VIB A;  3NRG A;  3E7Q A;  2GEN A;  3ZQI A;  1JUS A;  4M3E A;  4ME9 A;  3VUQ A;  3EGQ A;  3G1O A;  2OF7 A;  3SDG A;  3QKX A;  2RAS A;  4M3D A;  2FBQ A;  3HTJ A;  2XB5 A;  5FKN A;  2O7O A;  3B81 A;  5FKM A;  4CGR A;  1RPW A;  1T56 A;  3BQZ A;  2FJ1 A;  1T33 A;  3RD3 A;  5IP6 A;  4PXI A;  2Q24 A;  2XPU A;  4L62 A;  2UXO A;  3BTC A;  3ON2 A;  4B1R A;  3VVZ A;  3RH2 A;  3ZQG A;  3BCG A;  5CW8 A;  2F07 A;  3BR6 A;  4V2G A;  2REK A;  1ZK8 A;  2UXH A;  2XRL A;  4HKU A;  3TP3 A;  2G0E A;  5K7H A;  4JNN A;  2QCO A;  1SGM A;  1U9O A;  2XDN A;  2GBY A;  5FGL A;  3Q0U A;  2G7L A;  4D7N A;  2DTZ A;  2O7T A;  3BTJ A;  3F1B A;  4MK6 A;  2IEK A;  3S5R A;  5K58 A;  2QIB A;  3VOX A;  4NN1 A;  5FKK A;  4W1U A;  3HIM A;  3Q0V A;  2Y30 A;  4UDS A;  1Z77 A;  4AC0 A;  3ZQF A;  2OI8 A;  3VW0 A;  2EH3 A;  4JL3 A;  4D5F A;  3O60 A;  2ZCX A;  3VW1 A;  1JUP A;  3BJB A;  3VPR A;  5J1R A;  4YZE A;  3HGY A;  3MVP A;  2Y2Z A;  1VI0 A;  3WHB A;  3DEW A;  4DW6 A;  5J1U A;  3ZQH A;  4M3B A;  2HXO A;  3WHC A;  4ACI A;  4KWA A;  2FD5 A;  1BJZ A;  3Q0W A;  2RHA A;  2NP3 A;  3FK7 A;  4B3A A;  2DG8 A;  3O8H A;  2IU5 A;  4MO7 A;  4JKZ A;  2PZ9 A;  2QOP A;  2UXP A;  3CWR A;  3KKD A;  3BTL A;  3B6A A;  2TRT A;  3AQT A;  2IBD A;  5D1R A;  1JTY A;  2FX0 A;  2QTQ A;  3BQY A;  5EZH A;  3LOC A;  2JJ7 A;  2G7G A;  3BR0 A;  5GP9 A;  5FHP A;  5FKL A;  1RKT A;  2HYT A;  3P9T A;  2X6O A;  3KNW A;  2I10 A;  5FKO A;  1RKW A;  3HE0 A;  5AQC A;  2XGE A;  2DG7 A;  3HTI A;  4AC6 A;  2W53 A;  3Q3S A;  2FQ4 A;  4XK4 A;  3CDL A;  2HYJ A;  2WV1 A;  5EZG A;  3IH4 A;  3AQS A;  3B6C A;  4M3F A;  4G12 A;  2WUI A;  4AUX A;  2HKU A;  2NP5 A;  5GPA A;  3VVY A;  5EFY A;  3NXC A;  4X1E A;  3TP0 A;  1ZKG A;  4GCT A;  4M3G A;  5IOZ A;  2G7S A;  5DAJ A;  3LHQ A;  3IH3 A;  2ZOZ A;  4GFL A;  2XPV A;  3FK6 A;  1QPI A;  5C4Y A;  3KZ9 A; 
#chains in the Genus database with same CATH topology
 4GFK A;  2XGC A;  3ON4 A;  1ORK A;  3C07 A;  2XPW A;  3LWJ A;  3ZQL A;  3BR3 A;  4ICH A;  3EUP A;  1UI6 A;  3HTH A;  3CRJ A;  3LJL A;  5F0C A;  1QVT A;  3DPJ A;  3C2B A;  1U9N A;  3VW2 A;  4V2F A;  3G1L A;  4D7M A;  1UI5 A;  3BRU A;  3FIW A;  3PM1 A;  5CXG A;  3LSP A;  3O8G A;  2NS7 A;  3CJD A;  2ZY9 A;  4NEL A;  3T6N A;  5GPC A;  1JT6 A;  4WIB A;  3BT9 A;  5K7F A;  3G7R A;  3NPI A;  3DU6 A;  3QBM A;  5HAW A;  3PAS A;  3GEU A;  1JTX A;  3VP5 A;  2ZCN A;  4MXM A;  3ANG A;  2QKO A;  3G1M A;  4U9L A;  2TCT A;  3IUV A;  4W97 A;  4I6Z A;  5IOY A;  3LSJ A;  2VKE A;  3SFI A;  2HXI A;  3DCF A;  5FMP A;  2V57 A;  3BR2 A;  3ANP A;  2OPT A;  2VPR A;  4AF5 A;  4GCL A;  3GZI A;  2NS8 A;  2YVH A;  3VOK A;  5F0F A;  3NI7 A;  2ID6 A;  3QPL A;  3BTI A;  2PBX A;  2ZB9 A;  5J3L A;  1JUM A;  5K7Z A;  4ABZ A;  2R7O A;  2OER A;  2ZOY A;  3QPS A;  3NNR A;  3MNL A;  2UXU A;  3JSJ A;  3VTI A;  5EYR A;  2R7S A;  5CXI A;  2UXI A;  5F27 A;  2HQ5 A;  5CQG A;  2YVE A;  3BHQ A;  5D19 A;  2XGD A;  3G56 A;  3V78 A;  1A6I A;  2D6Y A;  3IH2 A;  5F1J A;  1QVU A;  2ID3 A;  3BR5 A;  5D18 A;  5HSZ A;  2JK3 A;  2QWT A;  4I76 A;  2WGB A;  4GCK A;  3HTA A;  1JT0 A;  2GFN A;  5F04 A;  3QQA A;  4JYK A;  2X9D A;  3FRQ A;  3KKC A;  4OD4 A;  5IPA A;  4D5C A;  5HBU A;  5F08 A;  4IRV A;  1Z0X A;  5H9T A;  3PPB A;  2IAI A;  3COL A;  2Y31 A;  3BR1 A;  3HGG A;  2ZCM A;  3F0C A;  3LSR A;  3VVX A;  2NX4 A;  3V6G A;  2RAE A;  5J1Y A;  3DU5 A;  2VKV A;  2G3B A;  5F0H A;  3CCY A;  3BNI A;  2GUH A;  3VIB A;  3NRG A;  3E7Q A;  2GEN A;  2R7R A;  3ZQI A;  1JUS A;  4M3E A;  4ME9 A;  3VUQ A;  3EGQ A;  3G1O A;  2B1E A;  2OF7 A;  3SDG A;  3QKX A;  2RAS A;  4M3D A;  2FBQ A;  3HTJ A;  2XB5 A;  5FKN A;  2O7O A;  5FKM A;  2YVX A;  3B81 A;  4CGR A;  1RPW A;  1T56 A;  2R7T A;  3BQZ A;  2FJ1 A;  1T33 A;  3RD3 A;  5IP6 A;  4PXI A;  2Q24 A;  2XPU A;  4L62 A;  2UXO A;  3BTC A;  3ON2 A;  4B1R A;  3VVZ A;  3RH2 A;  3ZQG A;  3BCG A;  5CW8 A;  2F07 A;  3BR6 A;  4V2G A;  2REK A;  1ZK8 A;  2UXH A;  3KYL A;  2XRL A;  4HKU A;  3TP3 A;  2G0E A;  5K7H A;  4JNN A;  2QCO A;  1SGM A;  1U9O A;  2XDN A;  2GBY A;  5FGL A;  3Q0U A;  2G7L A;  4D7N A;  2DTZ A;  2O7T A;  3BTJ A;  3F1B A;  4MK6 A;  2IEK A;  3S5R A;  5K58 A;  2QIB A;  3VOX A;  4NN1 A;  5FKK A;  4OD5 A;  4W1U A;  3HIM A;  3Q0V A;  2Y30 A;  4UDS A;  1Z77 A;  4AC0 A;  3ZQF A;  2OI8 A;  3VW0 A;  2EH3 A;  4JL3 A;  4D5F A;  3O60 A;  2ZCX A;  3VW1 A;  1JUP A;  3BJB A;  3VPR A;  5J1R A;  4YZE A;  3HGY A;  3MVP A;  2Y2Z A;  1VI0 A;  3WHB A;  3DEW A;  4DW6 A;  2PFV A;  5J1U A;  3ZQH A;  4M3B A;  2HXO A;  3WHC A;  4ACI A;  4KWA A;  2FD5 A;  1BJZ A;  3Q0W A;  2RHA A;  3NS4 A;  2NP3 A;  3FK7 A;  4B3A A;  2DG8 A;  3O8H A;  2IU5 A;  4MO7 A;  2FJI 1;  4JKZ A;  2PZ9 A;  2QOP A;  2UXP A;  3CWR A;  3KKD A;  3BTL A;  4DVY P;  3B6A A;  2TRT A;  3AQT A;  2IBD A;  5D1R A;  1JTY A;  2FX0 A;  2QTQ A;  2R7U A;  3BQY A;  5EZH A;  3LOC A;  2JJ7 A;  2G7G A;  4C2M A;  3BR0 A;  5GP9 A;  5FHP A;  5FKL A;  1RKT A;  4U9N A;  2HYT A;  3P9T A;  2X6O A;  3KNW A;  2I10 A;  5FKO A;  1RKW A;  3HE0 A;  5AQC A;  2XGE A;  2DG7 A;  3HTI A;  4AC6 A;  2R7V A;  3K8P C;  2W53 A;  2R7Q A;  3Q3S A;  2FQ4 A;  3SWH A;  4XK4 A;  3CDL A;  2HYJ A;  2WV1 A;  5EZG A;  2B3W A;  2A2F X;  3IH4 A;  2R7X A;  3AQS A;  3B6C A;  4M3F A;  4G12 A;  2WUI A;  4AUX A;  2HKU A;  2NP5 A;  5GPA A;  3VVY A;  5EFY A;  3NXC A;  4X1E A;  3TP0 A;  1ZKG A;  4GCT A;  4M3G A;  5IOZ A;  2G7S A;  2R7W A;  3FHN A;  5DAJ A;  3LHQ A;  3IH3 A;  2ZOZ A;  4GFL A;  2XPV A;  3FK6 A;  1QPI A;  5C4Y A;  3KZ9 A; 
#chains in the Genus database with same CATH homology
 4GFK A;  2XGC A;  3ON4 A;  1ORK A;  3C07 A;  2XPW A;  3LWJ A;  3ZQL A;  3BR3 A;  4ICH A;  3EUP A;  1UI6 A;  3HTH A;  3CRJ A;  3LJL A;  5F0C A;  1QVT A;  3DPJ A;  3C2B A;  1U9N A;  3VW2 A;  4V2F A;  3G1L A;  4D7M A;  1UI5 A;  3BRU A;  3FIW A;  3PM1 A;  5CXG A;  3LSP A;  3O8G A;  2NS7 A;  3CJD A;  4NEL A;  3T6N A;  5GPC A;  1JT6 A;  3BT9 A;  5K7F A;  3G7R A;  3NPI A;  3QBM A;  5HAW A;  3PAS A;  3GEU A;  1JTX A;  3VP5 A;  2ZCN A;  4MXM A;  3ANG A;  2QKO A;  3G1M A;  2TCT A;  3IUV A;  4W97 A;  4I6Z A;  5IOY A;  3LSJ A;  2VKE A;  3SFI A;  2HXI A;  3DCF A;  5FMP A;  2V57 A;  3BR2 A;  3ANP A;  2OPT A;  2VPR A;  4AF5 A;  4GCL A;  3GZI A;  2NS8 A;  2YVH A;  3VOK A;  5F0F A;  3NI7 A;  2ID6 A;  3QPL A;  3BTI A;  2PBX A;  2ZB9 A;  5J3L A;  1JUM A;  5K7Z A;  4ABZ A;  2ZOY A;  2OER A;  3QPS A;  3NNR A;  3MNL A;  2UXU A;  3JSJ A;  5EYR A;  5CXI A;  2UXI A;  5F27 A;  2HQ5 A;  2YVE A;  3BHQ A;  5D19 A;  2XGD A;  3G56 A;  3V78 A;  1A6I A;  2D6Y A;  3IH2 A;  5F1J A;  1QVU A;  2ID3 A;  3BR5 A;  5D18 A;  5HSZ A;  2QWT A;  2JK3 A;  4I76 A;  2WGB A;  4GCK A;  3HTA A;  1JT0 A;  2GFN A;  5F04 A;  3QQA A;  4JYK A;  2X9D A;  3FRQ A;  3KKC A;  5IPA A;  4D5C A;  5HBU A;  5F08 A;  1Z0X A;  5H9T A;  3PPB A;  2IAI A;  3COL A;  2Y31 A;  3BR1 A;  3HGG A;  2ZCM A;  3F0C A;  3LSR A;  3VVX A;  2NX4 A;  3V6G A;  2RAE A;  5J1Y A;  2VKV A;  2G3B A;  5F0H A;  3CCY A;  3BNI A;  2GUH A;  3VIB A;  3NRG A;  3E7Q A;  2GEN A;  3ZQI A;  1JUS A;  4M3E A;  4ME9 A;  3VUQ A;  3EGQ A;  3G1O A;  2OF7 A;  3SDG A;  3QKX A;  2RAS A;  4M3D A;  2FBQ A;  3HTJ A;  2XB5 A;  5FKN A;  2O7O A;  3B81 A;  5FKM A;  4CGR A;  1RPW A;  1T56 A;  3BQZ A;  2FJ1 A;  1T33 A;  3RD3 A;  5IP6 A;  4PXI A;  2Q24 A;  2XPU A;  4L62 A;  2UXO A;  3BTC A;  3ON2 A;  4B1R A;  3VVZ A;  3RH2 A;  3ZQG A;  3BCG A;  5CW8 A;  2F07 A;  3BR6 A;  4V2G A;  2REK A;  1ZK8 A;  2UXH A;  2XRL A;  4HKU A;  3TP3 A;  2G0E A;  5K7H A;  4JNN A;  2QCO A;  1SGM A;  1U9O A;  2XDN A;  2GBY A;  5FGL A;  3Q0U A;  2G7L A;  4D7N A;  2DTZ A;  2O7T A;  3BTJ A;  3F1B A;  4MK6 A;  2IEK A;  3S5R A;  5K58 A;  2QIB A;  3VOX A;  4NN1 A;  5FKK A;  4W1U A;  3HIM A;  3Q0V A;  2Y30 A;  4UDS A;  1Z77 A;  4AC0 A;  3ZQF A;  2OI8 A;  3VW0 A;  2EH3 A;  4JL3 A;  4D5F A;  3O60 A;  2ZCX A;  3VW1 A;  1JUP A;  3BJB A;  3VPR A;  5J1R A;  4YZE A;  3HGY A;  3MVP A;  2Y2Z A;  1VI0 A;  3WHB A;  3DEW A;  4DW6 A;  5J1U A;  3ZQH A;  4M3B A;  2HXO A;  3WHC A;  4ACI A;  4KWA A;  2FD5 A;  1BJZ A;  3Q0W A;  2RHA A;  2NP3 A;  3FK7 A;  4B3A A;  2DG8 A;  3O8H A;  2IU5 A;  4MO7 A;  4JKZ A;  2PZ9 A;  2QOP A;  2UXP A;  3CWR A;  3KKD A;  3BTL A;  3B6A A;  2TRT A;  3AQT A;  2IBD A;  5D1R A;  1JTY A;  2FX0 A;  2QTQ A;  3BQY A;  5EZH A;  3LOC A;  2JJ7 A;  2G7G A;  3BR0 A;  5GP9 A;  5FHP A;  5FKL A;  1RKT A;  2HYT A;  3P9T A;  2X6O A;  3KNW A;  2I10 A;  5FKO A;  1RKW A;  3HE0 A;  5AQC A;  2XGE A;  2DG7 A;  3HTI A;  4AC6 A;  2W53 A;  3Q3S A;  2FQ4 A;  4XK4 A;  3CDL A;  2HYJ A;  2WV1 A;  5EZG A;  3IH4 A;  3AQS A;  3B6C A;  4M3F A;  4G12 A;  2WUI A;  4AUX A;  2HKU A;  2NP5 A;  5GPA A;  3VVY A;  5EFY A;  3NXC A;  4X1E A;  3TP0 A;  1ZKG A;  4GCT A;  4M3G A;  5IOZ A;  2G7S A;  5DAJ A;  3LHQ A;  3IH3 A;  2ZOZ A;  4GFL A;  2XPV A;  3FK6 A;  1QPI A;  5C4Y A;  3KZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...