2YVJB

Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
b'TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin reductase
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase/electron transport
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yvjB00
1G8KB 1SQXE 4NBDD 4AAYB 2HMKA 4QCKA 2HMJA 1NTZE 2QPZA 2D2CD 1JM1A 1O7MA 3CWBE 1FQTA 2NVFA 3L70E 1O7WA 2BMQA 2ZT9D 4U3FE 4NBFD 1Q90C 1WQLA 2NWFA 4NBBD 4QDFA 3GCEA 4HM8A 2YVJB 4HM4A 1SJGA 2DE6D 5BOKA 1BCCE 1ULJA 4NB9D 3H1IE 3L74E 4HKVA 3VMID 2A06E 2XSOA 2E74D 4QUQA 2B1XA 3VMHD 4NB8D 2NVEA 2XRXA 2Q3WA 1EG9A 3GTSA 2JO6A 1PP9E 3DQYA 2B24A 1UUVA 1G8JB 3TGUE 2E4PA 2BMRA 1SQVE 3GZYA 4P1CH 1SQPE 2QJYC 1UUWA 1SQBE 4PD4E 3GZXA 2DE7D 4QURA 4AIVA 2YFJA 1NTME 4HM7A 3CX5E 2QJKC 3H1LE 3L71E 2E76D 4OGQD 3BCCE 4HM5A 2FYNC 5KKZC 2YFIA 3AZCA 1RFSA 3GOBA 4NBHD 4QDDA 2NUMA 1PPJE 2QJPC 1SQQE 1ZRTE 2E75D 1BE3E 2GBXA 1EZVE 3L72E 2YFLA 5AEWA 3GTEA 2YIUC 3VCAA 4QDCA 2GBWA 2XR8A 4PV1D 5HL4A 3VMGD 2XSHA 4H0LD 3D89A 4HM6A 2E4QA 4NBED 3GB4A 4H44D 2HMLA 1KYOE 3H1JE 4NBGD 3N0QA 3CXHE 5AEUA 1O7PA 1VCKA 3L73E 1O7NA 2BMOA 1ULIA 1NYKA 1RIEA 3H1HE 3L75E 2ZYLA 2HMMA 4HM2A 2I7FA 4HM0A 1P84E 2HMOA 4QUPA 2NUKA 4H13D 2JZAA 5KLVE 3GL0A 3GL2A 3VCPA 1NDOA 4QDFB 4P1BH 3EN1A 2NVGA 2FYUE 2BCCE 1VM9A 1NTKE 2IBZE 1NU1E 1O7HA 3FOUA 4EMJB 1VF5D 5KLIC 1O7GA 1L0LE 4HM1A 2DE5D 2CKFA 4HM3A 1KB9E 4NBAD 3H1KE 1L0NE 3EQQA 2HMNA 4NBCD 3C0DA 5CXMA 3GKEA 4HJLA
chains in the Genus database with same CATH superfamily
1G8KB 1SQXE 4NBDD 4AAYB 2HMKA 4QCKA 2HMJA 1NTZE 2QPZA 2D2CD 1JM1A 1O7MA 3CWBE 1FQTA 2NVFA 3L70E 1O7WA 2BMQA 2ZT9D 4U3FE 4NBFD 1Q90C 1WQLA 2NWFA 4NBBD 4QDFA 3GCEA 4HM8A 2YVJB 4HM4A 1SJGA 2DE6D 5BOKA 1BCCE 1ULJA 4NB9D 3H1IE 3L74E 4HKVA 3VMID 2A06E 2XSOA 2E74D 4QUQA 2B1XA 3VMHD 4NB8D 2NVEA 2XRXA 2Q3WA 1EG9A 3GTSA 2JO6A 1PP9E 3DQYA 2B24A 1UUVA 1G8JB 3TGUE 2E4PA 2BMRA 1SQVE 3GZYA 4P1CH 1SQPE 2QJYC 1UUWA 1SQBE 4PD4E 3GZXA 2DE7D 4QURA 4AIVA 2YFJA 1NTME 4HM7A 3CX5E 2QJKC 3H1LE 3L71E 2E76D 4OGQD 3BCCE 4HM5A 2FYNC 5KKZC 2YFIA 3AZCA 1RFSA 3GOBA 4NBHD 4QDDA 2NUMA 1PPJE 2QJPC 1SQQE 1ZRTE 2E75D 1BE3E 2GBXA 1EZVE 3L72E 2YFLA 5AEWA 3GTEA 2YIUC 3VCAA 4QDCA 2GBWA 2XR8A 4PV1D 5HL4A 3VMGD 2XSHA 4H0LD 3D89A 4HM6A 2E4QA 4NBED 3GB4A 4H44D 2HMLA 1KYOE 3H1JE 4NBGD 3N0QA 3CXHE 5AEUA 1O7PA 1VCKA 3L73E 1O7NA 2BMOA 1ULIA 1NYKA 1RIEA 3H1HE 3L75E 2ZYLA 2HMMA 4HM2A 2I7FA 4HM0A 1P84E 2HMOA 4QUPA 2NUKA 4H13D 2JZAA 5KLVE 3GL0A 3GL2A 3VCPA 1NDOA 4QDFB 4P1BH 3EN1A 2NVGA 2FYUE 2BCCE 1VM9A 1NTKE 2IBZE 1NU1E 1O7HA 3FOUA 4EMJB 1VF5D 5KLIC 1O7GA 1L0LE 4HM1A 2DE5D 2CKFA 4HM3A 1KB9E 4NBAD 3H1KE 1L0NE 3EQQA 2HMNA 4NBCD 3C0DA 5CXMA 3GKEA 4HJLA
chains in the Genus database with same CATH topology
1G8KB 1SQXE 4NBDD 4AAYB 2HMKA 4QCKA 2HMJA 1NTZE 2QPZA 2D2CD 1JM1A 1O7MA 3CWBE 1FQTA 2NVFA 3L70E 1O7WA 2BMQA 2ZT9D 4U3FE 4NBFD 1Q90C 1WQLA 2NWFA 4NBBD 4QDFA 3GCEA 4HM8A 2YVJB 4HM4A 1SJGA 2DE6D 5BOKA 1BCCE 1ULJA 4NB9D 3H1IE 3L74E 4HKVA 3VMID 2A06E 2XSOA 2E74D 4QUQA 2B1XA 3VMHD 4NB8D 2NVEA 2XRXA 2Q3WA 1EG9A 3GTSA 2JO6A 1PP9E 3DQYA 2B24A 1UUVA 1G8JB 3TGUE 2E4PA 2BMRA 1SQVE 3GZYA 4P1CH 1SQPE 2QJYC 1UUWA 1SQBE 4PD4E 3GZXA 2DE7D 4QURA 4AIVA 2YFJA 1NTME 4HM7A 3CX5E 2QJKC 3H1LE 3L71E 2E76D 4OGQD 3BCCE 4HM5A 2FYNC 5KKZC 2YFIA 3AZCA 1RFSA 3GOBA 4NBHD 4QDDA 2NUMA 1PPJE 2QJPC 1SQQE 1ZRTE 2E75D 1BE3E 2GBXA 1EZVE 3L72E 2YFLA 5AEWA 3GTEA 2YIUC 3VCAA 4QDCA 2GBWA 2XR8A 4PV1D 5HL4A 3VMGD 2XSHA 4H0LD 3D89A 4HM6A 2E4QA 4NBED 3GB4A 4H44D 2HMLA 1KYOE 3H1JE 4NBGD 3N0QA 3CXHE 5AEUA 1O7PA 1VCKA 3L73E 1O7NA 2BMOA 1ULIA 1NYKA 1RIEA 3H1HE 3L75E 2ZYLA 2HMMA 4HM2A 2I7FA 4HM0A 1P84E 2HMOA 4QUPA 2NUKA 4H13D 2JZAA 5KLVE 3GL0A 3GL2A 3VCPA 1NDOA 4QDFB 4P1BH 3EN1A 2NVGA 2FYUE 2BCCE 1VM9A 1NTKE 2IBZE 1NU1E 1O7HA 3FOUA 4EMJB 1VF5D 5KLIC 1O7GA 1L0LE 4HM1A 2DE5D 2CKFA 4HM3A 1KB9E 4NBAD 3H1KE 1L0NE 3EQQA 2HMNA 4NBCD 3C0DA 5CXMA 3GKEA 4HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8K B;  1SQX E;  4NBD D;  4AAY B;  2HMK A;  4QCK A;  2HMJ A;  1NTZ E;  2QPZ A;  2D2C D;  1JM1 A;  1O7M A;  3CWB E;  1FQT A;  2NVF A;  3L70 E;  1O7W A;  2BMQ A;  2ZT9 D;  4U3F E;  4NBF D;  1Q90 C;  1WQL A;  2NWF A;  4NBB D;  4QDF A;  3GCE A;  4HM8 A;  2YVJ B;  4HM4 A;  1SJG A;  2DE6 D;  5BOK A;  1BCC E;  1ULJ A;  4NB9 D;  3H1I E;  3L74 E;  4HKV A;  3VMI D;  2A06 E;  2XSO A;  2E74 D;  4QUQ A;  2B1X A;  3VMH D;  4NB8 D;  2NVE A;  2XRX A;  2Q3W A;  1EG9 A;  3GTS A;  2JO6 A;  1PP9 E;  3DQY A;  2B24 A;  1UUV A;  1G8J B;  3TGU E;  2E4P A;  2BMR A;  1SQV E;  3GZY A;  4P1C H;  1SQP E;  2QJY C;  1UUW A;  1SQB E;  4PD4 E;  3GZX A;  2DE7 D;  4QUR A;  4AIV A;  2YFJ A;  1NTM E;  4HM7 A;  3CX5 E;  2QJK C;  3H1L E;  3L71 E;  2E76 D;  4OGQ D;  3BCC E;  4HM5 A;  2FYN C;  5KKZ C;  2YFI A;  3AZC A;  1RFS A;  3GOB A;  4NBH D;  4QDD A;  2NUM A;  1PPJ E;  2QJP C;  1SQQ E;  1ZRT E;  2E75 D;  1BE3 E;  2GBX A;  1EZV E;  3L72 E;  2YFL A;  5AEW A;  3GTE A;  2YIU C;  3VCA A;  4QDC A;  2GBW A;  2XR8 A;  4PV1 D;  5HL4 A;  3VMG D;  2XSH A;  4H0L D;  3D89 A;  4HM6 A;  2E4Q A;  4NBE D;  3GB4 A;  4H44 D;  2HML A;  1KYO E;  3H1J E;  4NBG D;  3N0Q A;  3CXH E;  5AEU A;  1O7P A;  1VCK A;  3L73 E;  1O7N A;  2BMO A;  1ULI A;  1NYK A;  1RIE A;  3H1H E;  3L75 E;  2ZYL A;  2HMM A;  4HM2 A;  2I7F A;  4HM0 A;  1P84 E;  2HMO A;  4QUP A;  2NUK A;  4H13 D;  2JZA A;  5KLV E;  3GL0 A;  3GL2 A;  3VCP A;  1NDO A;  4QDF B;  4P1B H;  3EN1 A;  2NVG A;  2FYU E;  2BCC E;  1VM9 A;  1NTK E;  2IBZ E;  1NU1 E;  1O7H A;  3FOU A;  4EMJ B;  1VF5 D;  5KLI C;  1O7G A;  1L0L E;  4HM1 A;  2DE5 D;  2CKF A;  4HM3 A;  1KB9 E;  4NBA D;  3H1K E;  1L0N E;  3EQQ A;  2HMN A;  4NBC D;  3C0D A;  5CXM A;  3GKE A;  4HJL A; 
#chains in the Genus database with same CATH topology
 1G8K B;  1SQX E;  4NBD D;  4AAY B;  2HMK A;  4QCK A;  2HMJ A;  1NTZ E;  2QPZ A;  2D2C D;  1JM1 A;  1O7M A;  3CWB E;  1FQT A;  2NVF A;  3L70 E;  1O7W A;  2BMQ A;  2ZT9 D;  4U3F E;  4NBF D;  1Q90 C;  1WQL A;  2NWF A;  4NBB D;  4QDF A;  3GCE A;  4HM8 A;  2YVJ B;  4HM4 A;  1SJG A;  2DE6 D;  5BOK A;  1BCC E;  1ULJ A;  4NB9 D;  3H1I E;  3L74 E;  4HKV A;  3VMI D;  2A06 E;  2XSO A;  2E74 D;  4QUQ A;  2B1X A;  3VMH D;  4NB8 D;  2NVE A;  2XRX A;  2Q3W A;  1EG9 A;  3GTS A;  2JO6 A;  1PP9 E;  3DQY A;  2B24 A;  1UUV A;  1G8J B;  3TGU E;  2E4P A;  2BMR A;  1SQV E;  3GZY A;  4P1C H;  1SQP E;  2QJY C;  1UUW A;  1SQB E;  4PD4 E;  3GZX A;  2DE7 D;  4QUR A;  4AIV A;  2YFJ A;  1NTM E;  4HM7 A;  3CX5 E;  2QJK C;  3H1L E;  3L71 E;  2E76 D;  4OGQ D;  3BCC E;  4HM5 A;  2FYN C;  5KKZ C;  2YFI A;  3AZC A;  1RFS A;  3GOB A;  4NBH D;  4QDD A;  2NUM A;  1PPJ E;  2QJP C;  1SQQ E;  1ZRT E;  2E75 D;  1BE3 E;  2GBX A;  1EZV E;  3L72 E;  2YFL A;  5AEW A;  3GTE A;  2YIU C;  3VCA A;  4QDC A;  2GBW A;  2XR8 A;  4PV1 D;  5HL4 A;  3VMG D;  2XSH A;  4H0L D;  3D89 A;  4HM6 A;  2E4Q A;  4NBE D;  3GB4 A;  4H44 D;  2HML A;  1KYO E;  3H1J E;  4NBG D;  3N0Q A;  3CXH E;  5AEU A;  1O7P A;  1VCK A;  3L73 E;  1O7N A;  2BMO A;  1ULI A;  1NYK A;  1RIE A;  3H1H E;  3L75 E;  2ZYL A;  2HMM A;  4HM2 A;  2I7F A;  4HM0 A;  1P84 E;  2HMO A;  4QUP A;  2NUK A;  4H13 D;  2JZA A;  5KLV E;  3GL0 A;  3GL2 A;  3VCP A;  1NDO A;  4QDF B;  4P1B H;  3EN1 A;  2NVG A;  2FYU E;  2BCC E;  1VM9 A;  1NTK E;  2IBZ E;  1NU1 E;  1O7H A;  3FOU A;  4EMJ B;  1VF5 D;  5KLI C;  1O7G A;  1L0L E;  4HM1 A;  2DE5 D;  2CKF A;  4HM3 A;  1KB9 E;  4NBA D;  3H1K E;  1L0N E;  3EQQ A;  2HMN A;  4NBC D;  3C0D A;  5CXM A;  3GKE A;  4HJL A; 
#chains in the Genus database with same CATH homology
 1G8K B;  1SQX E;  4NBD D;  4AAY B;  2HMK A;  4QCK A;  2HMJ A;  1NTZ E;  2QPZ A;  2D2C D;  1JM1 A;  1O7M A;  3CWB E;  1FQT A;  2NVF A;  3L70 E;  1O7W A;  2BMQ A;  2ZT9 D;  4U3F E;  4NBF D;  1Q90 C;  1WQL A;  2NWF A;  4NBB D;  4QDF A;  3GCE A;  4HM8 A;  2YVJ B;  4HM4 A;  1SJG A;  2DE6 D;  5BOK A;  1BCC E;  1ULJ A;  4NB9 D;  3H1I E;  3L74 E;  4HKV A;  3VMI D;  2A06 E;  2XSO A;  2E74 D;  4QUQ A;  2B1X A;  3VMH D;  4NB8 D;  2NVE A;  2XRX A;  2Q3W A;  1EG9 A;  3GTS A;  2JO6 A;  1PP9 E;  3DQY A;  2B24 A;  1UUV A;  1G8J B;  3TGU E;  2E4P A;  2BMR A;  1SQV E;  3GZY A;  4P1C H;  1SQP E;  2QJY C;  1UUW A;  1SQB E;  4PD4 E;  3GZX A;  2DE7 D;  4QUR A;  4AIV A;  2YFJ A;  1NTM E;  4HM7 A;  3CX5 E;  2QJK C;  3H1L E;  3L71 E;  2E76 D;  4OGQ D;  3BCC E;  4HM5 A;  2FYN C;  5KKZ C;  2YFI A;  3AZC A;  1RFS A;  3GOB A;  4NBH D;  4QDD A;  2NUM A;  1PPJ E;  2QJP C;  1SQQ E;  1ZRT E;  2E75 D;  1BE3 E;  2GBX A;  1EZV E;  3L72 E;  2YFL A;  5AEW A;  3GTE A;  2YIU C;  3VCA A;  4QDC A;  2GBW A;  2XR8 A;  4PV1 D;  5HL4 A;  3VMG D;  2XSH A;  4H0L D;  3D89 A;  4HM6 A;  2E4Q A;  4NBE D;  3GB4 A;  4H44 D;  2HML A;  1KYO E;  3H1J E;  4NBG D;  3N0Q A;  3CXH E;  5AEU A;  1O7P A;  1VCK A;  3L73 E;  1O7N A;  2BMO A;  1ULI A;  1NYK A;  1RIE A;  3H1H E;  3L75 E;  2ZYL A;  2HMM A;  4HM2 A;  2I7F A;  4HM0 A;  1P84 E;  2HMO A;  4QUP A;  2NUK A;  4H13 D;  2JZA A;  5KLV E;  3GL0 A;  3GL2 A;  3VCP A;  1NDO A;  4QDF B;  4P1B H;  3EN1 A;  2NVG A;  2FYU E;  2BCC E;  1VM9 A;  1NTK E;  2IBZ E;  1NU1 E;  1O7H A;  3FOU A;  4EMJ B;  1VF5 D;  5KLI C;  1O7G A;  1L0L E;  4HM1 A;  2DE5 D;  2CKF A;  4HM3 A;  1KB9 E;  4NBA D;  3H1K E;  1L0N E;  3EQQ A;  2HMN A;  4NBC D;  3C0D A;  5CXM A;  3GKE A;  4HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...