2YVKA

Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from bacillus subtilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
349
Chain Sequence
MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioribose-1-phosphate isomerase
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 129
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yvkA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yvkA02
4LDQA 4ZEOA 1T9KA 3ECSA 3A9CA 4ZEMA 3VM6A 4LDRA 1VB5A 2YRFA 3A11A 1W2WB 2YVKA 5DBOA 1T5OA 2A0UA
chains in the Genus database with same CATH superfamily
2BLNA 2H3EA 2R5WA 2Q1UA 4EJSB 2YNMC 2EQ5A 3GHHA 4N4WA 4R4JA 4URVR 3WK5A 1ZD2P 2BN4A 2H1IA 1MJ5A 2I6GA 4H7PA 2V1XA 1L5HB 4FTWA 3POVA 1CCWA 4DMCA 5IH7A 4QELA 5ANRB 4K46A 4J7UA 3P4XA 4DLNA 3FPSA 1YRLA 2LE0A 4Q00A 3CZ6A 3ZGXA 1G8SA 2IPNA 2W6CX 3QOYA 2QN2A 3TLCA 3B1XA 4CJGA 3H13A 3I4UA 1FSGA 4PIMA 5I7AA 4G0PA 2PSFA 1PDWA 3KZKA 3DKPA 5AJXA 3FROA 2JGDB 2QV7A 3MQ4A 2D2FA 2C2HA 2RI6A 2ATCA 1HZJA 1M73E 1MMFB 2X0EA 4TN5A 4EA7A 1TCAA 5DBIA 2HFKA 2RHWA 3RK0A 4DYDA 1R5OA 2ZU6A 3PNYA 1N2HA 4EPYA 1Z88A 1GQOA 5JFTA 4X1KB 3QELB 3D8RA 1CS0A 1TVCA 2WWTA 5IAOA 1AZSC 4I1RA 2J4CA 2PGXA 1ZD3A 1S05A 1TCCA 4OEHA 4FFVA 1L1FA 4QTUB 1GGQA 1KXJA 3EK2A 3G79A 4YDQA 5JQGB 4YUXA 3GCWA 4KQ9A 3QFFA 3VPXA 1E58A 4A0FA 3NFRA 2OC9A 2P3SA 2JEZA 1F2VA 1F9EA 3D1VA 3GUZA 4FW9A 3GLSA 2I34A 5JS2A 4UTNA 2H54A 4F2PA 5DMXA 5AIAA 3ANNA 3JT1A 2FQ1A 2JD0A 1CR4A 2FLVA 2XMCA 4DA8A 3GGPA 2QROA 2AJTA 5DNYB 1A0BA 1HM5A 1XK7A 3UG7A 1I2DA 2HT1A 1NJSA 3K0SA 2ZJ4A 3ATPA 3ZTZA 4U5XA 3IXMA 2XVMA 2DF8A 2Q4EA 1YONA 1Y1KE 3QEAZ 4KK4A 3BD7A 1HDIA 4L5AA 1X1QA 1ZOLA 1MBZA 3Q7GA 3HNPA 3QUBA 5FUBA 5GY7A 2I8BA 3P7MA 4J2HA 5AW2A 2WHPB 4Z51A 1SU4A 2HTEA 3LVRE 1E9FA 5T8KC 3I1IA 3LXRA 1T6ZA 1BXZA 4DOZA 2ZWVA 1G291 4X44A 4EVSA 5DJ5A 5BMVB 3RC2A 4LWZA 3OCCA 3W8RA 3GRCA 2Z30A 3EFOA 1TFUA 3WLHA 4EO7A 3DKKA 5L6MB 2YWEA 4FD3A 1WPRA 5CM2Z 4MLCA 3IGFA 4QLBA 3VRCA 2C9DA 1MH1A 2PMFA 4BNMA 5JO0A 3TTXA 1NPYA 2HW8A 1HZZC 3NEJA 1I94B 3THRA 2VTBB 2PZAA 4WZZA 2ZTHA 3ADPA 4IIVA 1U8UA 4LSZA 3HU1A 2G04A 1XTBA 1E3SA 1E1NA 1P9NA 3IPMO 3BH7A 2A4KA 4AD8A 3PDIB 3X1YA 3DFMA 4AJEA 3ULKA 1BU5A 4JUCA 2ZXUA 2W2TA 3OQNA 4R16A 3Q8XB 3BORA 5BVGB 3ZIAA 4AY4A 2ZXWC 1N33B 1L4EA 5FQOA 1RZUA 4OX9B 5F5HA 2R8RA 1SPBS 4XXHA 4FEEA 3VISA 1K7EB 2AGVA 4XJTA 2BKLA 2YQYA 4F3CA 4ODIA 1VE6A 3TTUA 4GSLA 3LLUA 5D84A 4QGHA 4B8ZA 2A69F 3R7NA 4HLNA 5BW5A 3RWMB 1BJTA 5B4UA 1N2SA 3ABMC 6REQA 5C8YB 2MINB 3ED5A 1M5TA 3PGXA 3ORHA 1MT0A 4KMRA 2CMDA 3LZCA 2MSWA 3BCRA 3TEMA 2WZQA 1R9MA 4ZOCA 1PX0A 1PQUA 4O33A 1XFAA 1LQUA 3RQFA 4C01A 3C1AA 4N12A 2DTDA 2QM3A 1YRWA 1V9LA 1ID8A 3HJBA 2GHTA 1PS9A 3RBZA 2ZJBA 3K96A 5IASA 4IOMA 1XLTC 1YNOA 1N5MA 3C8DA 3S5JA 4X64B 3WLTA 4QJBA 5JAIA 3NBKA 1KIFA 3LUFA 2TMGA 1I3KA 2GD0A 2XDWA 5C7IO 5C5CA 1G3IA 3F8TA 1EZ1A 1DTWB 3PP8A 5F3DA 2W6ZA 3ASZA 1KI4A 1C03A 2ZJFA 4KGVA 4WCDA 3KFVA 3N74A 1GEGA 1R6DA 1BWRA 3N0WA 3AHEA 3MUFA 2AKEA 3V6MA 1TU3A 1AQNA 3H2YA 3MILA 4JLUA 1UJ5A 4XARA 3NALA 4GP9A 4YFYA 4BN5A 3RSGA 2ASRA 4II3A 2XVXA 1I30A 1SHUX 1EINA 3CWQA 3HB7A 2PH1A 2BELA 2Q2WA 4EH1A 1BDJA 4ZT7A 5J4YA 5K3BA 3LKBA 3M1AA 2IYPA 5T5QA 3EGVA 4YDSA 1U9IA 4RZ3A 2Q4DA 3JQEA 4X7PA 4K03A 1RBQA 4MR9B 3ZYZA 4DNPA 4BCCA 1Q7GA 3V7OA 4BFSA 1QHHA 4HDSA 4BEBA 1MX9A 5E4FA 2JRCA 3RRNA 1N34B 4MUAA 5FD8A 2E4UA 3VTAA 4IRUA 1Y3DE 5GADl 2ZBEA 5DW3A 1XCGB 2PQMA 4L2IA 4RD3A 4GICA 1HI9A 5GPGB 3OZSA 3NS7A 4PZ0A 3T9DA 2WY2D 2XQJA 4CPDA 4V0LA 2IA5A 1H9CA 3QPAA 5DTMA 2X8JB 4LK2A 4QRDA 2PYDA 3C6YA 1OWPA 1UM9A 2GTHA 1R16A 1U7XA 1RWVA 2DFKB 1KZ6A 3HJCA 4G2NA 1D1SA 1LE4A 1PJQA 1NVMB 2YRXA 1BCRB 1BW9A 3ZCUA 4TRNA 4YA6A 5AHKA 2OZPA 4D57A 2VJBA 3ZV4A 2SBTA 5F33A 2VTDA 3L0ZA 2QUZA 3ZJVA 1K8QA 1ZM3A 1L4UA 2RAFA 3T3NA 4N5DA 2EPNA 5L4NA 4FKBA 2AOUB 2ZRQA 3T3MB 5G0VA 1WGWA 1EDDA 1YDHA 2QA5A 4JS0A 2NTVA 4LRTB 3IAS6 3MJTA 4IJUA 4H0FA 4CF7A 5CPBA 3G5AA 3QUAA 3G1TA 3N76A 3DZHA 3ANYB 2HO5A 2RONA 1I33A 2R9VA 3QMPA 3RH3A 4A8JA 2QHXA 4WVFA 3C2QA 3P9YA 3GLFB 5ALPA 3QKIA 3DMFA 5ELMA 1HFJA 2R1VA 1MNAA 3K6KA 2GSWA 1POXA 3X44A 1F5SA 1EFAA 2NPUA 4Y98A 5LKRA 1TZCA 4E1AA 4DSOA 2X5OA 3TI9A 2QZZA 2WBLC 3PLRA 3G7UA 1IATA 1QQAA 4G41A 2Y1KA 1WO8A 4BRUA 2VHVA 3WICA 4CM7A 5BUSA 1KMIY 2AH5A 2OKGA 2AX4A 2Y3GA 1EH5A 2MMCA 2VTKA 3JX9A 5K3AA 2BMFA 1V7CA 1T91A 5JLAA 4AZ0B 1D09A 3T9EA 4BBAA 1BX3A 3AHFA 1KMQA 4NE9A 4D97A 1Z4OA 2P7IA 4QPPA 3VGPA 1Q3TA 3V1MA 5KOIA 3G17A 2Z4RA 4D02A 5F76A 1P6XA 3O75A 4O4HA 4X97A 4MVJP 3TLZA 2WUVA 2X0CA 4CM5A 5CXQA 4LRYA 3AI1A 1PEKE 4TV9F 2WKQA 1GG2A 4BO7A 4MJLA 4FW8A 2FR0A 3FFXA 2BZ0A 3V7UA 3JALB 3JD4A 2BFFB 4XLTA 2VYFA 4G4JA 1KEEB 1IXKA 3VC2A 3GJ6A 2D5CA 3CZAA 3EVBA 4DR3B 2Q62A 4RQAA 1SXHA 3U8VA 2VDLB 5A9SA 1JFFB 4HDMA 2LNDA 3HNOA 2ZXRA 4JT2A 4WNCA 1TC1A 3VKHA 1K75A 5B2FA 3DQQA 5JJIA 3DOIA 4Q4CA 4BG0A 2PKEA 4B32A 2WYVA 2CCKA 1GYRA 3DLBA 1ICEA 3E2PA 3U3FA 1YI8A 1T6IA 5IH3A 3HVJA 4IHJF 4XVCA 1GAJA 3O4JA 1J25A 3DQZA 4BV3A 1SC1A 3Q87B 3KJFA 1LBQA 2QNIA 1RLJA 3BMQA 3LE8A 1ODLA 1RE0A 2FUG1 4IDNA 1L5RA 4O2BF 4XIJA 5BY2A 5CB6A 3CB4A 5DO9A 2WINI 4B6IA 2ZUUA 5L6LB 4Z9YA 1XQ9A 3PJEA 4KEAA 3QVJA 4MQUA 2XMZA 3IJEB 4NL4H 4DNQA 1D0SA 2Y4OA 5DEIA 2JFXA 2MTBA 4KOEC 4D4XA 4YRZA 1E92A 3COJA 1V3TA 4GS5A 2GBCA 3NRBA 3CB2A 1U2SA 1H2BA 1GUYA 2RH5A 4OIRF 7ADHA 1SIUA 2BSXA 3WQRA 1BOOA 2BM9A 5ECGC 5ICSA 3AUXA 3E05A 5HQ3B 3JWPA 2BFOA 3GXOA 2X5NA 5DM1A 1W9MA 1YA6A 5CFZA 5ILOA 3TNDA 1SUAA 3O3CA 2QRZA 4EUSA 3MCTA 3DZGA 1U2GC 4U3JB 3HXTA 4DG5A 3U3BA 3HHPA 1GRRA 1OAKA 1UANA 2ZATA 5H9WA 1XTIA 5EIXA 1VIYA 2R8BA 4QARA 1KQPA 2QN8A 4IMIB 4AG6A 4XGRA 1CP2A 2UUHA 3DZIA 2YQ4A 2H51A 4IZHA 1OLXA 4OM8A 1R8JA 3GEBA 4D3ZA 4KU4A 4G1UC 1PKEA 2CFSA 2QR2A 1YJ8A 3DR3A 1R0BA 3QVMA 4PYIA 1QHYA 2PK3A 1ML4A 4PIPA 5IFKA 1NR1A 3NHFA 2XM0A 5K0CA 2X4DA 4FBMA 1PJAA 3T9BA 1E7RA 2P8JA 1QP7A 1NX9A 3A06A 1YV9A 2CJPA 1OY1A 4IMPA 3D7SA 1E20A 3R6GA 4EGFA 4S3MA 1XZLA 1CJTC 4M8IA 1LPBB 4KFCA 1VZ3A 3GPIA 1XZKA 2QW1A 3GLUA 4JC0A 2Q99A 2JANA 3ZCXA 3GG2A 1WLYA 5HUQA 3EYWA 2Q4BA 2XMGA 1AB6A 3KXDA 4O1MA 2NACA 3AHGA 4TVSA 3L0CA 2DGJA 2C1XA 1GNVA 3VRHA 4N6NA 3L4BA 3UAGA 1QVZA 4PYJA 4NK4A 3MBOA 4ETWA 2YHIB 4J4TA 5LBIA 4EYGA 4LDJA 2SCUA 3MMNA 2HHAA 2P0EA 3DFFA 1K3FA 2WYHA 1T5HX 3T7IA 5K0FA 2ZIVB 3TOMA 1UMKA 2YQZA 3BEHA 3QKUA 4AWAA 3SZRA 1M1YE 1W59A 3KSRA 4QDZA 4JLWA 4JLAA 1JYEA 2C9YA 1IBLB 2AUTA 3HJGA 3LLVA 3E7XA 1KI1A 1E6WA 4F3TA 4AMYA 1J8QA 3R5KA 4LECA 4DWJA 1MU0A 3TQFA 5F9MA 2E5LB 5LBUA 1XCPA 2X8WA 5B58C 1GL7A 4QQFA 3PPWA 1O9HA 1C9DB 2FOLA 1JHXA 2AC7A 1C17M 3Q3IA 3SYRA 4O6MA 4X93A 3VOAA 2AIRA 3LIIA 1XNJA 3P71T 4E70A 3MMZA 1OILA 2O57A 1VYHA 1GM5A 4KODA 1QTRA 3O39A 4R1UA 5DBOA 2EW1A 3ND8A 4JURI 4TM8A 4C0XA 2AU5A 3FCSB 4U7FA 1XSEA 2RCYA 4KWEA 2J87A 4YRRA 1BRMA 4HZIA 1GA6A 4AJ4A 4U8GA 3EW9A 3OJOA 1KOGA 1ZHWA 4XW2A 4A03A 1T2VA 3DVRX 4J16C 4XD7D 3EXEA 3WLOA 2GF0A 2ILTA 2J5XA 2ORED 5JYCA 5KNBA 4U2EA 3DAHA 3K2BA 4UVDA 2WF7A 4AS2A 1TZJA 5IJ0B 1DIHA 3H5RA 4IMJB 4IF4A 4Y1GA 3I9V6 2Z5VA 4PG8A 5CDYA 5F3WB 2H2WA 2FETA 5B3LA 3KCQA 4R40A 3VYUB 3VYWA 5B2ZA 1JJBA 1AS0A 4HZUB 4LE0A 3G7SA 1HNXB 2XZLA 3KB8A 2HNKA 2VDOB 1RQLA 1VHLA 3PQ7A 3EVFA 4ON9A 3PLAE 5IXSA 3LT2A 4OHKA 1YTUA 4KTTE 1KFCB 4BE9A 5KYKA 2EIXA 2JGNA 2R4UA 1J8VA 1MZVA 2DH5A 5K0SA 4YPVA 5LUBA 4AURA 1NQ5A 1CERA 1K6IA 3NAZA 2G4CA 2D00A 1HDOA 1N5RA 1WNTA 3IEUA 1WXIA 4JX9A 3WMRA 1PHRA 3QZUA 1C30B 3Q5DA 3WHIA 3KJIA 1KZ7B 1YMQA 2D1TA 4UM7A 4JIMA 1N92A 4YV7A 1NRJB 3LLSA 3STYA 5G02A 3D6TB 1UKYA 1PT9A 4FB5A 3TLJA 1JMWA 2Q2QA 3OUTA 1DC4A 4DM7A 4BXOA 3SYLA 5B6PA 4JIOA 2N9UA 3MCVA 2OY0A 4G9EA 3JWEA 5ARDA 4B7UA 1Y98A 1UT6A 2VT7A 2X2FA 2FSFA 1CULC 2IPOA 1W5BA 4X45A 3F78A 1V74B 1RRCA 5EXDA 1BX1A 1TXGA 3OF2A 1D2NA 1I14A 4DUGA 5DB4A 1OASA 2JH3A 2OEVA 2O2ZA 4CI0B 4OQXA 3PWTA 2ASVA 3VPAA 2WTXA 1F2UA 2C9MA 5BV8A 3E7FA 4QSMA 4N40A 2NQTA 4RK7A 1ES9A 3O82A 13PKA 4RKRA 1CQXA 1FMJA 1N2OA 1USWA 1AXGA 4LI0A 4BKUA 3QE0A 4TTJA 3HP7A 1WUJS 2IUFA 1FMFA 4QEZA 1HMYA 4DYVA 1LUAA 4XPIA 1YK0A 3OD1A 2BJWA 2ACVA 2CFRA 4G1EB 3LEVA 2WA1A 2FU5C 2XDQA 4D1YA 1ZESA 1X7YB 3Q2OA 4RXTA 1L8LA 1GCAA 3J7AC 1FRNA 1NW9B 3GP8A 2VRNA 4E2XA 4RHEA 2QLFA 3BL6A 1ZJ5A 5I8WA 3M5PA 3KZMA 2QJTA 3A37A 4RHXA 4TOIA 2O2EA 2W0MA 4PHCA 4QWWA 4D42A 2FAXA 3HFGA 1OA0A 1DC7A 5JRDS 2VLIA 2OB2A 1L7CA 3SKYA 3H05A 4J94A 3FM9A 2DYSC 1OWOA 3OHPA 4QUGA 3T4PA 3ZK7A 1D6MA 4NZPA 4OLAA 1UC9A 2KB0A 2RCNA 1E4YA 4RM2A 4RMJA 3DZ8A 1F17A 1W75A 3HQ4O 3SYMA 5C1BA 1R18A 3T0FA 1BKDR 3BK2A 3IEEA 4OGWA 4RF3A 2F9FA 2H59A 3U4QA 5DI3B 3SS9X 2LKCA 3U1VA 4RHCA 1E0SA 4FMDF 4CS8C 4C08A 4UPDA 1I80A 5AVYA 2G4VA 3QQPA 4GXTA 3D4BA 1V39A 4EJFA 4MZXA 4F4UA 3UJ3X 1SXPA 3UW1A 2FK7A 3BIXA 4P7FA 5HRCA 4CN9A 1KWKA 4EMTA 3TL6A 1NV8A 2PZBA 3TLGB 3G2JA 2O7QA 4JGIA 4K6GA 5DYYA 1B3BA 2GN1A 2H1FA 5AJUA 1NY6A 3S2UA 1PWEA 4HMOA 4RTJA 5C8YF 1RQRA 5E2BA 3V1YA 2JZOA 4E6EA 3VHXB 3TJRA 5BYJA 3VYTB 3N8NA 3VU3A 1PJ2A 2ZANA 5ADHA 3ZC3A 3RF6A 1GKUB 3IUSA 1KEVA 2J3MA 1KDYA 4MS3B 4PHTA 1YIAA 5IJ9B 3EY9A 3CVUA 2ZQ5A 3PWZA 2QK4A 3BXPA 4YCSA 3FKQA 3AVPA 3C5EA 4CV3A 1P1CA 4NYJQ 5ALWA 2RBKA 3OQVA 2J5QA 3MJFA 4IL5A 3NYLA 3DTNA 1IZ0A 1J21A 3FWHA 1EM8B 3DCYA 3C8ZA 1PV1A 2GYWA 4X6LA 5CITA 4ANJA 1R88A 1P0FA 1U5BA 1R8YA 4TKVA 2XX3A 5F2KA 3TZCA 3ZE9A 1JAHA 3AHJA 1YVDA 4BVJA 4WFJA 1XCJA 2DZDA 4YHBA 3OQ1A 2VPZA 5IT4A 5KYYA 2QLNA 2Z9DA 4PR3A 5C0OE 3B1VA 4DAOA 4P5DA 2XUPA 4W8KA 1II8A 1QO7A 4OXNA 1A9TA 5CB8A 5I9NA 4YRFA 2Q2OA 2Y93A 3BJIC 3LLCA 4RVFA 5FOXA 3JD3A 4A0HA 4K9NA 3TI7A 5BN3B 4B6OA 2C88A 4L51A 4RE5A 3KPUA 4B5LA 2W2OA 3HYSA 2G3KA 3MBGA 2C3YA 3IHTA 4K9QA 4MHSA 1VHDA 2GM5A 4WCFB 4NYMR 2ZU0C 1Z38A 1SVUA 1Q0LA 3AP1A 5C32A 4TZ0A 1INLA 1E3JA 1RQ7A 3K6SB 1VLSA 1VI6A 4EG6A 2R65A 5FF9A 2W93A 2IXEA 3WRXA 2F9LA 3O21A 4QBFA 1DV2A 1JUDA 4I19A 3FXAA 1Q2XA 4XWTA 2C8JA 4CIVA 4DCUA 3TXXA 4YEDA 3EPKA 3UMVA 3IBGA 3L0BA 1U8ZA 3U9MA 2R3SA 2I2BA 1WBJB 3H86A 3ITDA 2E7ZA 1H4VB 4FE3A 2IBMA 2W2PA 1SWWA 4NCNA 3SGLA 2OD2A 2PD3A 1YYJA 3RYTC 1EB8A 3GLVA 4C4AA 5E2QA 4BEJA 1H2XA 2YLDA 3JVUA 2YHBA 1ENOA 1UFVA 3IAEA 2QGFA 3ORYA 1L5LA 1NLUA 3NOOA 5AVZA 3BMOB 4MQLA 4D8XA 2O5EA 2FB9A 3OM0A 1USGA 1E3TA 2QG9A 4EA6A 3NB0A 3CMCO 2E9SA 3G23A 1YVUA 4O4LF 2FXVA 1SG9A 2HA2A 1UZUA 2HD4A 2BFBB 2Z9BA 2VZEA 3EARA 4NU0A 4WGFA 4TS9A 4BMCA 1N2ZA 4GLOA 4YK7A 3GGDA 3G9TA 1DTSA 1TRKA 1O87A 1OFVA 3K4QA 4RGYA 4FYWA 1YE5A 4JT4A 4B7ZA 2GERA 4EY7A 3VVMA 5KBYA 2IEDA 1XYYA 3AKZA 4BC0A 4MS4A 4GPBA 4GG1A 3V1UA 1WUTA 3UMCA 4P4SA 3WADA 1ZJWA 3GZNB 3WC4A 2LIVA 1NATA 3N8KA 2QRKA 4UFOA 4PJLA 2JJ2A 5IKMA 5IM4A 5I9TA 1KNXA 1QG6A 5COGA 4EVIA 4MVJA 3I2GA 2IKSA 1BCSA 1KMMA 4QJ3A 4J0DA 1NULA 3G50A 4QQ8A 1FDIA 1T9HA 3GPLA 1ZJ4A 3FTDA 5T67A 1NA5A 2HTFA 4FMCF 4WADA 4AWBA 2JDID 5DGIA 3RRXA 5IJZA 1I01A 4I1UA 3EE6A 2H2AA 1J2EA 3E7WA 2Q00A 3CUKA 2LFDA 5DX1A 1EAYA 4H1HA 4MYUA 2H1CA 4R2WA 1IY1A 1XXHB 2GB4A 3OICA 3CISA 1TVKA 3TR0A 2O23A 3OQBA 3A27A 3UJBA 2XXJA 4R0VA 3FPFA 3A1UA 2I6XA 3Q0TA 4DCMA 3OQJA 4ZVNA 5H0IA 4FGZA 3UWDA 2JL1A 4QBTA 5C4GB 2ZE8A 3PE4A 1GAXA 2IZ5A 3NTUA 2W8ZA 5JLJA 1ND6A 5DNVA 2YVAA 2GM4A 2WHEA 1SQFA 3AJ8A 2Q28A 5FBQB 4FX2A 4DPMA 4EW3A 4HN2A 1ZOSA 1AB5A 1LPNA 2YV1A 1QIHA 1XMVA 3QSGA 2ZKIA 4KYUA 3WB9A 4J7AA 5FO1A 4P38A 1YI1A 2Y39A 3UHOA 5THXA 3EXHB 4JITA 2OFXA 5E1MA 3AJEA 3I4CA 1GAWA 4M86A 2VNJA 3AEQA 4TV9B 3WLJA 1TJNA 4PFJA 4FEAA 2VJYA 3ZJ4A 2ZR7A 4BJ1A 5CA1A 3C3KA 2HQ1A 2XOKA 5LJLA 2EU8A 1JHDA 2ZYGA 2NV0A 2FPGA 1G20E 5B4TA 1JPUA 3QU5A 3OJ0A 3P96A 3KYIA 4K9LA 1FFSA 1A4RA 4B17A 3UGJA 3O47A 1EIZA 3NMUF 2V6JA 1Z7WA 5JYBA 3L84A 1VPVA 2IU0A 5D6OA 3SXUA 1TD9A 2OCLA 1R6BX 4FYKA 5E7QA 1NVVR 5EXEA 4B2YA 2ODAA 1EJ0A 1Z7EA 4WZBB 1JG6A 1U81A 2VC9A 3AGUA 1DIBA 1A9ZA 5HTOA 1IULA 3ROQA 2WAMA 1NP6A 4NMMA 2WIBA 3P5SA 1NVAA 4IHJB 3ZDDA 2XB2A 4Y6GB 3TJMA 4A2WA 4KMOA 4B84A 5CHEA 2YWGA 2PH3A 3H3XA 1G9XA 3V34A 4O2BB 3IO5A 5GVSA 2RH4A 2IHYA 1KWGA 4ZQFA 1GFWA 3SHOA 3FOZA 1E2UA 1BMFA 4H3SA 4AUEA 3GT4A 2EIKC 3QI7A 1Y1LA 2XUJA 1DKOA 1W30A 2ZZNA 3LDUA 1TT5A 1YKSA 4RZQA 4HBGA 1SEPA 1QCZA 1ZMOA 5D8DA 2VNSA 4EJMA 4HAXA 3JTLO 2BGWA 5REQB 1Q91A 1YE8A 3FPHA 2CT8A 3C87A 1N6NA 4FE7A 2HREA 5MN6A 4F96A 4ZLDA 1T25A 3HU3A 1PHPA 2YV4A 1HA3A 4XYBA 2BHNA 4BNFA 3TMAA 1CUSA 4F45A 3WSWA 3A6DA 3H84A 4Z9XA 2IYFA 3FSEA 3UR3C 4HVCA 2H8GA 4CMHA 4HUQA 2QAGA 4TZ6A 2C58A 3DZKA 1YDGA 1X9GA 3IAM1 4ZPJA 3U56A 5FEMA 1U4SA 1CNFA 1M6VB 4NNOA 2DBRA 4IG9A 2PRJA 4KV9A 4PNEA 3KR0A 5TMDA 2NO6A 2IYVA 2OM6A 1WQ1R 2IHVA 4C4RA 3GOQA 2O4CA 2PEYA 5H3HA 3R3JA 4XDYA 4AXBA 2CZQA 4HGZA 2OENG 3LWBA 4Y2JA 1T8WA 2EXXA 2HADA 5JBQA 3DFZA 2VJLA 1DHRA 3TG8A 4JI8B 2Y68A 4FVTA 2VDQB 3FTQA 4KQKA 3V9PA 2G9NA 1U0OC 4P32A 2R8OA 5DM0A 4WDRA 1ORTA 1DPGA 5JH7F 2R6HA 2Q5LA 5BVHA 1R8XA 3GDOA 2VQ6A 1P7PA 4RV5A 4OQQA 1IUPA 4GOOD 3K3PA 1OR3A 4IO0A 2DC1A 3BA1A 2NZWA 2AD5A 3W34A 3UJ6A 1YQ9A 3DEKA 4HSGA 3DGFC 4NJMB 4DY4A 5E9WA 3HVHA 3K5PA 4TYYA 5T3UA 3VPBA 4AF8A 5JAMA 4ALKA 1I2CA 1JHPA 1SC3A 1W4BA 4OMDA 2PR7A 3KT6A 3WNQA 2WQ6A 2SNIE 3KFLA 4OHPA 3PUIA 2YWJA 3W2EA 5IKOA 3AG5A 3HV0A 4HLQB 2V0GA 4FGSA 1VJDA 4NOMA 1PZGA 3KXLA 1GTG1 3I6IA 5TGTA 5LZ7A 2YDYA 3UGPA 3JSXA 3G2PA 4F84A 2I2FA 3BJRA 1VB3A 3C45A 3LWDA 5CCBA 2EARA 1WW3A 3N2LA 2RFLA 1E8MA 2VYNA 3NVKI 3U1BA 1R5NA 2WWHA 4K9RA 4M0FA 5L3SA 1Q92A 3OTOB 1QXSA 2ZAYA 2VUIB 3F6CA 3OFND 3CCCA 4QG7A 1GG5A 1ZUIA 2X6TA 1PJRA 1XK6A 3EZIA 3CF0A 1Y7PA 1N2CA 4IY1A 2QRVA 2I4NA 2YOHA 2YIJA 5KJEA 4FZJA 4YMLA 5DLEA 1KVRA 1AHNA 4FCWA 3DNPA 3BXZA 3W06A 1EKYA 2JJ1D 3F7TA 1N78A 2B9EA 1UWCA 4GF5A 3TVTA 3EEFA 3ITNA 4A91A 3ZU5A 5E9QA 3BXEA 1UBMS 4OAOA 4D5GA 3CZCA 4HTFB 4MUNA 1FYVA 2C92A 5BNFA 3J81A 3ZV7A 3B9PA 2VCYA 4TXNA 2FW9A 1RLMA 1Z82A 4WXPA 5AHWA 3FWYA 3JZMA 1OF1A 4IEIA 1HOTA 4EB8A 5GM2A 1J0BA 4DEXA 1CLUA 1DWPA 1Z26A 1ZWKA 2OAEA 3EZ9A 3OT5A 2XWPA 2OQIA 2AOWA 1E2BA 3R3WA 1Z4KA 4ZV7A 1RC0A 1KQFA 4EZEA 4HDAA 3PNBA 4V39A 3RBAA 2CBZA 1EUDB 2XB9A 2XUHA 3VA7A 5HXAA 4K88A 4K3VA 1RYZA 2FCRA 1Z17A 1HE1A 1C7ZA 1UK8A 5JD5A 4PRZA 4PEVA 1Z5ZA 2O2JA 5JSZA 3M4CA 4WEOA 1XA4A 2FPKA 1O94A 1QPGA 3N2YA 2FJPA 3P0FA 3BM5A 2ZYAA 3AF2A 3LNCA 3ILYA 3FTNA 1HKUA 3ZJTA 1HMOA 3DE8A 3FDXA 1SA0B 1J39A 3T52A 4CDAA 4IDAA 2Y0DA 2D8AA 3U5TA 3L0OA 1EVZA 2F64A 3J80A 5DTQA 3DBIA 3E9RA 1TZKA 2VA9A 3WRWA 1MMGA 1B43A 3CSDA 3T1TA 4AMGA 2HDNB 2RAUA 2VT6A 1BR4A 3EEYA 3P5BA 3LT4A 4GE3A 1J2UA 3GT3A 2HCTA 4JB2A 5DIFA 1L5SA 1NV9A 1E3WB 2WZLA 1J00A 2BMDA 3RI3A 3OWTA 4N6GA 3C7DB 4K2AA 4ZV4A 3DDNA 4GDFA 4NZ9A 3RASA 1O95D 2PA0A 3UAWA 1TWCA 2PKRA 2X5XA 2XHZA 3TZQA 3BRWD 4L07A 3PXBA 2ADOA 2I7VA 5JECA 4HHEA 1SOUA 4EG1A 1KVUA 3O74A 1IM5A 3OWHA 1KQGA 2Y1GA 1RJWA 3ZDFA 4UCQA 4LFCB 4U39A 4N4AA 4TXMA 6YASA 1EVQA 2PSSA 1FTQA 2LXNA 3C63A 3AUTA 3OIWA 1FOEB 5BSTA 1BVYF 1YB5A 5HRUA 3JU3A 5JZVA 1E86A 4FS3A 3T34A 3EA4A 4HEAJ 3MINA 3E2IA 4JFAA 1RMYA 2BL2A 1KOLA 2OBXA 1F3LA 3FYUB 3VZQA 3ZWCA 3S81A 3DXFA 4B5KA 1P17A 4PAWA 2AWNA 1J8FA 3PYLA 4JVMA 2PX4A 4HVAA 4JLMA 1ZO8A 1AS3A 2V9ZA 3HDVA 3EGDA 4YMGA 1ESCA 5FWXB 1OVGA 3FUTA 1QRDA 1Z73A 2R00A 5JVEA 3QEMB 4YMHA 5CTJA 1GU1A 2AUMA 1EVYA 1DXHA 3SE7A 1FPQA 4GQAA 3UUGA 5HK9A 1Y0BA 3HLKA 1CUJA 3WAJA 2OSVA 2IU3A 2IYRA 2ZSHA 4ZCIA 1GNRA 1MOSA 2GAOA 3U9LA 3C8GB 1LNZA 1PQPA 4WK2B 2WSYB 4RKYA 3TCNA 4R41A 4FAPB 2QUHA 4IIYA 4HE8D 2OO7A 2R48A 3ZI7A 1C3LA 4ZEVA 3D5EA 1RJDA 5E2IA 3OTQA 3EXIB 3DPUA 4C4PA 3GD7A 5ITVA 1G1AA 1G3QA 1L7MA 3GJ4A 3IQGX 2ZIZA 4BJ6C 3UC5A 4YYEA 4RPLA 3WAQA 4FOSA 1ADYA 5G0WA 2A5LA 5JD3A 4KAAA 1XROA 4I1MA 4LV5B 5DHFA 1E99A 4FMDB 2HCJB 1CW2B 1ISFA 1Z83A 1CNMA 1I1NA 1QPUA 1YZQA 5L0DA 1EXNA 2VF4X 1XEXA 3ECSA 1EBUA 4IEEA 3A2NA 1Y4DE 5I4IA 4CT5A 1UDBA 1XTUA 3HI6A 4HDKA 2Q3BA 1A77A 3NEPX 3VPSA 2XPCA 3EBOA 1P4GA 5D5HA 2QDKA 4RF4A 3RARA 4TTTS 3U7QA 2PFGA 3RC7A 2FOIA 3RTDA 1WPXA 2NVUA 1O96B 1DQYA 2RHMA 1NQXA 1Y7TA 3E03A 2YWFA 3NYQA 4GU5A 1CJBA 3JWIA 4HRVA 3H0EA 3SBEA 4MQEB 1KBZA 4RFVA 4RY0A 4CQNA 2X0JA 1H3NA 3F5FA 3NVDA 2J7KA 3GV0A 3N07A 1E94E 4M46A 5GINE 5HS4A 1W4LA 1OLOA 2RIPA 4JC5A 4TMXA 3EQ8A 1QQ7A 2MWQA 1E2JA 5AMXA 4IWNA 3E61A 2QORA 3R7CA 3N7TA 2QP9X 4BHTA 1Y4ZA 4L4UA 2W6JA 3A6HA 3C8HA 2BMEA 1IY2A 3HCFA 4L22A 1B6TA 3AHDA 1JG1A 3UHPA 4MVMA 2Q27A 1YZHA 3RR2A 5IF3A 1MCZA 3U48A 3S2YA 1FXSA 1DBQA 3IMFA 4S05A 4AKIA 2X1VA 3U16A 2GXUA 1NLYA 3NU1A 4E21A 1UMDA 2K87A 4HLCA 2PVCA 4ZQHA 5ALSA 1OJLA 1R9NA 2HJVA 1JDBB 4KP7A 4ZKDA 2VB6A 1ZOPA 5K3EA 4YP1A 1I24A 4LAFA 4JOCA 1RCPA 3O0DA 3R7LA 1JI3A 3H6GA 4YBZA 3ZVNA 5IW8A 1W1IA 3PQ6A 1UKZA 3JQ8B 2CJXA 3FOPA 1ZNZA 4JV5B 2WJPA 4YAKA 5FWYA 2FQWA 1DCKA 4RAOA 5EKUA 4GXQA 4HYQA 1N7JA 3RVRA 4HQKA 3FVYA 1UBRS 3E81A 3LCVB 3GL9A 3CLTD 3PEWA 3L46A 4AY6A 3OQIB 3HCCA 1J5EB 4DZZA 4HNQA 2ZVQX 4EMSA 4CM6A 4KFUA 2JHPA 4DG9A 5EQDA 2BP7A 3VU9A 3O7MA 4WSOA 2FP3A 4M8NE 1LDGA 2IZ0A 3I9FA 2C54A 3MS2A 3D4LA 1HMDA 3LP5A 2J9GA 3BERA 1SUFA 2E1PA 1BN7A 1ZK4A 2G67A 4C7JA 4IQFA 3G8CA 3QE9Y 2Z8YA 2WZGA 4JYAB 1ZPDA 1ESMA 2QMQA 3ZE8A 2HHJA 3KT0A 3AKDA 3HXQA 4LRWA 1YS4A 1V8DA 4Q4HB 1UKCA 2Z3VA 2ZBQA 2BGLA 4U5QA 3E9QA 2OEXA 5CAEB 1JLRA 4UNNA 1P6QA 2G5TA 4TYQA 2P9FA 2P1DA 4O4LB 5A0FA 1QGUA 4CCYB 1H2EA 1FVOA 2IQ5A 1TA4A 4IP0A 1CXZA 2WT4A 4E88A 1TTTA 2KC3A 1G5ZA 5CCDA 5CDUA 4IHKA 2ZUVA 4HX5A 2DU8A 1XAGA 1YQXA 4WESA 4KDRA 4YUWA 1P0CA 4JAVC 4ALNA 3TKYA 4IUBS 4BX2A 2IIBA 4DR1B 1KHHA 3WGZA 3CZ5A 2VQSA 3KP1A 3MFYA 4QT4A 3V8QA 4I6GA 3NH9A 3AY3A 3A9WA 1RZRD 4ITUA 1R4AA 4YT8A 4NS1A 3KTFA 2BLLA 1U5CA 3C1TA 2ZGVA 4LF4B 3PKJA 4Y2UA 4C6TB 3LH5A 5LD2B 1PFKA 2WPDD 1A7JA 3EAFA 2KHZA 3HS3A 1VLTA 1XMJA 5IZCC 3JD0A 3HU2A 4FMCB 2D06A 4KB5A 2ZR8A 4HL6A 3AOEC 4GNKA 2I3BA 2YZ2A 3C3XA 1V48A 5EMJA 2W2LA 3TW6A 1V43A 3ETLA 4PJNA 3LDGA 4D3XA 2P9YA 6PFKA 4C07A 4GOND 2ZBVA 2DRIA 1UBCA 2ZSBA 3B6JA 4DUZB 4OJYA 1TFRA 4U02A 2QD5A 4C9BA 3IT1A 1MDBA 4B73A 2FPPB 1OAOC 3E18A 2I4TA 5FLXA 4LHZA 3LCCA 4OGFA 1TU0A 4A23A 1JI0A 2OBFA 2VAXA 1D0IA 2IYQA 4X3CA 3EQLF 1XZEA 3NXSA 5KJ1A 3JZ0A 2WJIA 3COSA 3HVIA 3TOXA 2FN4A 4ENSA 3K70D 3PWKA 4CGYA 3DOHA 2VQ3A 3BWVA 3I9NA 4KR2A 4KR6A 1VRCA 5I7FA 2G72A 1TF5A 5GMOA 1XLWA 1Z0UA 4XASA 1YB1A 3CA8A 2BT4A 4KIFA 3EZ6A 2OQMA 3IUEA 1U6HA 3SDBA 5I7HA 5AKYA 2Y1FA 1GZHB 5JT1A 3CVYA 3CLUC 3B8EA 2NU6B 3Q8KA 4AE4B 1KS2A 2GX6A 2Q5JA 1HXHA 5LR6A 3DEJA 3NORA 1ILWA 1EXMA 3OKAA 1MQ9A 4Q02A 3DBLB 3R74A 3FUWA 3HYNA 3KEOA 4ZT6A 2DH6A 1UJ2A 1AKWA 2GFHA 2IXPA 1PCXA 1V45E 3WYCA 4KQFA 5BQPA 4JL6A 2FW8A 2JFNA 1QTIA 4XI9A 4MS1A 4TLMB 3UMGA 1LLFA 2W2VA 2FWPA 4AL1A 4FFWA 1I6MA 4JDUA 2FUKA 5EXTA 2OUIA 1NX6A 3MPUA 4Y1RB 1PV2A 5DTEA 1JL3A 3A4MA 1JMYA 1ZEMA 2R84A 4L15A 3BOSA 4NG4A 3VBEA 3FAJA 3DSRA 4LBYA 4OK3A 3EGEA 2G4LA 3DR5A 1JAYA 1B00A 1SK8A 2VBIA 3B1YA 1XCOA 3GBSA 1PUXA 2DUWA 3U3OA 4Z2AA 1LTHR 1E6CA 5FOWA 2A59A 5IDYA 4BDSA 1M8KA 2FGJA 4I2NA 3V4VB 3EH1A 3UN1A 3U5SA 4KI2A 1UP4A 3FMVA 3S1SA 1Y7LA 4Z7OB 1XTPA 1MD9A 2JI6A 3INTA 5FX2A 1YCDA 1H1LB 2B34A 3BN3A 3B70A 1MORA 4CR6A 1AMOA 1J56A 2V45A 3ADBA 2Z09A 1V9SA 4I50F 4P7BA 4C2AA 1PNTA 4C22A 3WNCA 4AWXA 2GEUA 1ETUA 3OHSX 1H8HA 2BUBA 3GARA 4D3SA 4TKMA 1JVSA 3R3UA 1RVV1 3D2CA 1FX0B 4OGLA 2Q6TA 4BPMA 1T8YA 2A1UB 2W83A 2FSVA 1G9SA 4X6YA 4JJ7A 3WSTA 3NT2A 5IDXA 1IBSA 3N8DA 4L3WA 5DOVA 3VDQA 3FDIA 4C0WA 5BUQA 1CGOA 1IHUA 1VYUA 5A6SA 2BDEA 4IGFA 2V3WA 1Z74A 1FBTA 4JJGA 3Q0EA 4LOKA 1B23P 3P2EA 3ZG1A 4R2JA 1TO6A 2IBSA 4L8WB 4QG3A 4EBBA 2J33A 2PE5A 1YL5A 1Z5UA 4ZEWA 1UBOS 1B0AA 4EPXA 1SC9A 1V16A 1JW9B 4XIFA 4G5SA 3C74A 4H9GA 4K0RA 5DT9A 4NZOA 1GGJA 4D4MA 1JFTA 4R6XA 3RU9A 3P2IA 1EUYA 1Q50A 2JI9A 3MK31 4OIPF 3N1UA 1UJ4A 1FA9A 1BVUA 4MDHA 4MEBA 2JRLA 2QRMA 3UAVA 3FTFA 4UVIA 5CTAA 4F1JA 3OWOA 5E38A 3EOAI 4REOA 2HLDD 1RE1A 3LECA 4OJQA 3T5GA 2VXCA 4G24A 3AW8A 2B4QA 2V6MA 1BH2A 5JH7B 2D7DA 5D3MB 4TYMA 2X19A 3T9AA 4HLDA 2VCAA 4DV2B 4NAUA 1T0BA 2QD2A 1F14A 1XJ0A 3GCDA 4JY7A 3RFCA 1M2JA 3A4VA 2J31A 3NGMA 5FORA 2VYQA 1RKUA 1QQTA 2ZAGA 5J23A 3KC2A 1X7DA 3EASA 3I1JA 5KYVA 1SQ0A 2IXMA 5CEFA 4MQFB 1VJ0A 2ODWA 1XP5A 1I9GA 3AEYA 4N0EA 1FNDA 5D1NA 2PT7A 2FKAA 3O8QA 4O2AF 5AKHA 2XD9A 4DLVA 5HP4A 3HDJA 2QX8A 4MO2A 3B85A 3HNLA 4W1QA 1C0LA 5ERXA 3TXAA 2C95A 1KAHA 1W88B 4MGIR 2GN2A 4OSPA 1KEPA 1T2EA 2WSSA 1RWPA 3P0EA 3OLWA 4WUVA 3C5HA 3ROFA 4JBLA 4GX2A 4D0NA 4EUKB 3GXBA 5ILGA 1A1VA 4ENWA 4JYBA 3FWNA 5ICEA 2XIQA 5T64A 1CR6A 3G0GA 4OBEA 2X86A 3DUFB 4QM6A 5LMNB 1QU3A 4DJ9A 1Y1RA 2ZP1A 4JEUA 3THYB 3WQSB 4J1TA 1E98A 2ZB2A 1Z2DA 2EQBA 3WJ1A 5KSYA 4AMZA 4NLLA 2W71A 3BC1A 1YA4A 5B53A 3F6SA 3SMQA 4M6WA 2R8YA 1U3FA 3CNQS 4DRYA 3VI4B 3HJAA 2EFDB 3KLBA 3RFTA 1BU8A 5EE3A 2FR8C 4G78A 4EI2A 1QO0D 4CDYA 2XUIA 1F1JA 4URHA 3WL4A 3A1TA 1DWQA 4WTOA 1UK9A 4U2KA 2VBFA 2AK2A 1IPFA 5E0KB 5EINA 4YCAA 1V3QE 2DUJA 3HR4A 2P6VA 3H3FA 1RKCA 3NTVA 2FPMA 3TUJC 3H75A 4K9PA 5CVJA 2EYUA 7REQA 3KMIA 4C20A 4L27A 4ZP1A 1G3UA 3MGBA 3A58B 1ISGA 4EW1A 4QYWA 1EWQA 4IARA 5IJXA 3EG9A 3RC1A 4F3KA 2FX3A 3JQ6A 3QPCA 2H08A 3C6QA 2IBFA 2D5RB 2DTXA 2QVLA 3NCTA 4ENVA 3BCHA 3L1KA 4NF2A 2ETVA 4YRJA 3HKBB 4Q5IA 4HN4B 4WZAE 2Z15A 1JE1A 1PNQA 4IJ6A 1L1EA 3CLVA 1N5OX 4WW0A 3ZX4A 1I4ZA 2NU8A 1WS6A 1QTNA 2R6AA 2QLBA 2D1SA 3QXCA 3LY8A 3T8YA 5KTYA 3L18A 5T57A 1JQ3A 1P29A 3RQSA 4KLZA 5DBHX 3IX7A 3EZGA 4OV6B 4QFBA 4G4SO 3ETHA 4JJEA 1NLFA 1JKJA 1G8JA 3S1AB 1THZA 4F9GA 3JAWA 4P0PB 3QE2A 4II2A 4LVUA 2VWQA 4WBNF 3AJRA 3RSOA 2VQDA 1J2YA 3ZWAA 4DZTA 4YRKA 4LWPA 3OFVA 4ND8B 4UJ3A 3RTGA 3LNTA 1QR6A 5JFOA 1G3RA 3PENA 1AQIA 3AR3A 2CMKA 4W5WA 2PF4E 2J8ZA 5KOYA 3DZFA 1KQOA 4ZZ2A 2ZB7A 3PQ8A 1DEKA 3H2JA 4WH0A 2YUTA 2HU5A 4IDDA 5LMCA 2KK1A 5KOHA 2RHJA 2E4ZA 3OE7A 3I01A 3ZDEA 1SXQA 1DAHA 4XUEA 5CH5A 3HCWA 2JBHA 4GP7A 5IXYA 1JDZA 1XVLA 5IBQA 3GRAA 3ZY4A 2J9ZB 4JN6B 1QP4A 4ENUA 3RVKA 4B2IA 4RAQA 3LUDA 1DAOA 3W5JA 3HKEA 2EYQA 3ZZUA 1T1GA 2WE8A 1QK3A 5AR1A 5B6IA 1ZUWA 3NMIA 3D1JA 4H4CA 4LSWA 2B0JA 4YXWA 3T41A 2H4ZA 1OI4A 5IVDA 1R4NB 3W9SA 4FGUA 5TV2A 5DN9A 4XPYA 1JEYA 4DJDC 4G0VA 3GZTB 4D4GA 3PF9A 1YB6A 2R7NA 2OAP1 3A04A 2XJ4A 1Q21A 3A1NA 4Y30A 2ZRCA 4JLKA 3NTQA 1UJMA 3GWLA 1DFHA 1SCKA 3K1IA 5EJ6A 3OPXA 3FHTA 4QUDA 4ZRNA 1I5EA 5T6BA 1RFLA 1KO5A 1U80A 3PXDA 3E1SA 5DYNA 1C4OA 1T9CA 4J9VA 4O63O 1UZMA 3UMMA 3GQVA 4QWMA 2DQSA 4IRMA 3MWYW 1RYDA 3TLKA 5DHQA 3ZWQA 5SY4A 2NQ8A 3NETA 2CLIB 2A0KA 4MIOA 1GY8A 2OGZA 4WKBA 4Y2HA 4Q18A 3T0IA 3S9OA 3V4SA 1NYLA 1USVA 3CZ9A 1ZL2A 1EGMB 2W42A 2O3TA 1ZRNA 2FEOA 2EGUA 4XVHA 1YWGO 2O3UA 3QZCA 4J07A 3ID6C 4LOHA 4D5EA 2VA8A 5K6AC 2J6HA 2QN7A 3UK2A 4MEAA 1M0SA 4BV9A 3I58A 2C29D 4I1PA 3M6UA 4I55F 4KO8A 1KO1A 3A7EA 4FDAA 1TADA 2HDWA 4L72A 3V48A 2W48A 1O5HA 5D92A 4TLBA 2M4EA 1JSLA 4GBMA 4O1IA 4DAEA 3OEED 2CLEB 3D3EA 2LK4A 3T61A 2OO5A 4IG4A 3TSWA 4PZLA 3EPVA 3IVRA 4QI0A 3RAFC 3GT7A 5DCWA 4TQ9A 4EQ6A 1FP1D 1TM3E 1RABA 3REQB 5LQSA 1S7CA 4DZRA 2J85A 1E84A 2FPSA 2XJ9A 1PLJA 4HY3A 2D0DA 3N2GA 5AW8A 4CEJA 1CE8A 2NO9A 4FHZA 3I0ZA 5C7OO 1CJCA 4NVRA 5E6UB 2HUJA 3IILA 4Q9JA 2EERA 4Q34A 3LOQA 4ZDKA 4WBSA 2W6MA 5IYZA 1CWUA 1YQEA 3MBIA 1OR8A 4OGGA 1DT3A 3JYQA 5EE9A 4QPJC 2FMIA 2IODA 3FMFA 4HEQA 5EQTA 2WNIA 3QEOA 4UQPA 4JLNA 5JXJA 2WU4A 4LHSA 3QNUA 2ZXEA 2AOTB 3ENVA 2I76A 1Q0SA 4LJKA 3IKVA 4IIDA 4LYFA 2VHCA 2ZIXA 2YLGA 1N5KA 3RVMA 4OXKA 2A9PA 1TFOB 2XLOA 4FINA 3V4ZA 1SYQA 2VH5R 1PJTA 2WYOA 1R66A 4HEA6 4DMHA 4CF5A 2OCXA 3R1IA 4AJ9A 2NNLD 3VJLA 2QG6A 2JAUA 2C9ZA 1UMBB 3C70A 1J07A 1V7ZA 1MMDA 3M5DA 1C7JA 1CUDA 1SQ5A 4Y6LA 2CVHA 4DV1B 1P0QA 1DRJA 1KVQA 3R23A 1X80B 2IDZA 4ZT3A 4DRXB 3DT9A 1PLKA 3RSFA 4QEKA 1L1QA 4D8YA 1BS9A 3HFRA 1CZUA 1I4TD 3L93A 1XZQA 5BN1A 1Y4UA 3QG1A 2WD7B 3O2SB 1SU7A 2G62A 3KQMA 2CKMA 4MUHA 4JMPA 2BTEA 4YHHB 3ZHTA 1SZDA 4UBIA 5AVJA 2Z57A 3DMGA 8ADHA 2HMQA 4EX7A 4ZIRA 4PNPA 4TWRA 2Q7OE 2H4YA 1XTZA 5KCMA 5HFAA 3ADDA 3ZY3A 4E2WA 2EIJC 2EAUA 5BR8B 4TT3D 2QTHA 4AP5A 3H16A 4PPGA 2MCFA 5LQKA 4LS3A 4E5UA 5GIPE 4RJTA 3T3IA 2BKEA 3RVPA 1AUQA 2I22A 4BYGA 4DDWA 4TZKA 3BVPA 1OU0A 1CQIB 1O6BA 1UBHS 4HYYA 1VYIA 3F74A 1J1UA 5J2UF 4NBNA 1GPLA 1XQXA 1IQPA 1XCBA 2B20A 1JXAA 2E37A 4US0R 4BCBA 5KNCH 3LUPA 1US8B 1W0KD 4GC5A 1VCHA 4EIWA 1UKAA 1NN0A 2PS3A 2LDXA 4LHWA 3PL1A 1PSDA 4QUBA 1A5SB 1ANKA 1B8NA 3ZGOA 1HK7A 5AW5A 3AI7A 2ZE5A 1HURA 1VBNA 1OB5A 5J58A 1LTQA 2Z0MA 3QU4A 4EHJA 3NKLA 1RWXA 1XTKA 2C2BA 2GA8A 2IE8A 1I4OA 4UD2A 2ZULA 2ZRFA 3UCFA 1YBFA 4JCOA 1N1MA 2QLLA 4YQEA 3RSQA 1I2AA 1BA3A 4DR4B 3WAGA 4NECA 5B1SA 3DV0B 3HKKA 1C81A 2K5UA 1C3JA 2W6PA 1R15A 5JBNA 2X5JO 1C3EA 2FRVA 3BZUA 5TDHA 1OIWA 1E3LA 2DSNA 2L81A 1RYEA 3CLTC 2P0YA 2XY4A 1FPMA 4HNSA 1JX6A 1ZA1A 4P3OA 2CLDX 1VRWA 5ES3A 3O3NB 2C7OA 1DCMA 1EK6A 4WABA 4FMPA 3DL4A 1ZHHA 3LWZA 3C8MA 1WUKS 2X1LA 9MHTA 2AOVA 1F0PA 1EZZA 4LRUA 3HCNA 2YW2A 5A03A 3M33A 2I67A 3MTIA 5KTPA 4L85A 2PBZA 1NJGA 1RD4A 4EHFA 5DT2A 5AK4A 4HQRA 5I4CA 1OROA 2JAPA 4XQ1A 5EXPA 1CNEA 1RSZA 4Y7CA 2H9YA 3REOA 2C2GA 3ZDRA 1OXMA 4WKNA 2IIVA 5B4VA 1K27A 3S8YA 4EB6A 4HMQA 1RMVA 4ZK2A 3JAKA 4XX1A 1Z7YA 3OE5A 3WGIA 2OHIA 3R5XA 1WU7A 2GBLA 1DJPA 4X84A 4C0HA 4RPCA 2FPOA 4PZUA 2WMOB 1MH9A 3ZS8A 3V7YA 3ND9A 3TECE 3QKSB 3MX3A 1NU7D 3SSNA 5EJEA 4GVPA 2ORWA 1RM0A 2CE2X 4M88A 2UV8A 1DIGA 3S2GA 1J9ZA 2HC9A 1L5GB 3RQEA 1UBKS 5CXUA 1AK2A 1YR1A 4MKIA 4YL3A 3ZV6A 3U13A 5CFLA 5AOVA 4G4GA 2J7PD 4GX1A 3F7NA 1DZ3A 1HDZA 5A7GA 1N2BA 5LP6F 1YCGA 3E8SA 2OVBA 4PXYA 1QWOA 3GUCA 5TQ0B 3RYHB 1D2EA 2FSIA 1YULA 1Y5LA 3O84A 1OXTA 2PT9A 2Q50A 1DQSA 1CB7A 3ABOB 5K0NA 2IIPA 2VXOA 2PYIA 4GLJA 5TR9A 1U1GA 3ZGNA 2XXAB 3GNQA 3U0VA 3QVYA 3AR9A 2BMVA 3AVTA 1EG7A 4AZ3B 1ORHA 3ACCA 3IT3A 4G0NA 1E66A 2ATVA 2PT5A 3D54D 3OLYA 2IEBA 2SECE 4IGEA 4DJFC 3A1EA 4ULVA 3DT8A 1CZHA 4QXQA 3EULA 3UMFA 1WZNA 3EQ2A 1W85A 1ST6A 1EVIA 2CF6A 1M34A 3CO0S 3DEZA 1Y9EA 2BFPA 1JFSA 1F2DA 5FDFA 3G9XA 3PJGA 3K70C 1SCUA 3CQ9A 5DBEX 4ID3A 2G9VA 2YKGA 3UICA 3ZY5A 3Q15C 3LCUA 4OI0A 1PWHA 2DFNA 2W90A 5EPOA 3AYZB 2CLCX 2QUAA 4ZVRA 3E1KA 3CEMA 4D9NA 5BSUA 3NWJA 4TVBA 4BJ5A 3MM4A 1NZEA 4KYTA 5CT6A 2CDRA 3ZWDA 4MRAA 3O8BA 3LC7O 8ABPA 1MT3A 3FDZA 3LOPA 2QP3A 1QAQA 2GAIA 2PGAA 2AXEA 3CUYA 1X42A 3DMHA 3VR4A 1M1UA 1XR3A 1UC4B 4M21A 2OE2A 4BP3A 4K9SA 5AGFA 2PBFA 3K2EA 3COPA 4IH1A 4I50B 3NXKA 4JE9A 1G21B 2JFUA 2R1ZA 4KGXA 3UMYA 1JH9A 1XRQA 2P79A 1U2PA 3EDOA 1W36D 1JKFA 3QOWA 4M9ZA 3UGQA 5EUQB 4GNRA 2Q5EA 4F4BA 1YZAA 1UF9A 2GVZC 4QYXA 3THXA 4NFYA 2AJBA 3UMHA 3QXHA 4QFMA 4O4IF 2YV5A 4UFNA 5KTSA 1CEEA 3UA4A 4CL0A 4NCXA 3H17A 3HK2A 1NN5A 1U4NA 5IM5A 3IOBA 4MIEA 1AKUA 2J0UB 4M1TA 1WWKA 3RVZA 1XKTA 3X43A 5L0HA 4UUQA 1FS6A 1UZLA 2F1JA 5AW7A 2IY9A 4RADA 5JDCA 2O2GA 3F46A 2K2QB 3K9WA 3MJDA 4EKYA 2PZKA 3EC2A 1PFYA 3TLAA 4DLBA 5LOVF 1C1DA 4AP6A 5HOEA 5BUOA 1TYBE 1WXWA 1GGMA 1JIIA 1PQYA 1IN4A 1NNI1 3PXCX 2X4IA 4OJNA 4NOKA 2WSLA 5LQCA 1WETA 1A41A 1GQYA 4K1XA 3BMCB 2C4TA 4JC7A 4U7DA 5K3FA 1H2HA 1EMDA 2JIZA 4Q6WA 4CDGA 2R7QA 4TLDA 1Q7CA 3HNJA 1RTKA 2CKDA 5JAZA 3AG3C 4C1NA 4P9NA 1H0RA 2CYDA 3NDRA 1D2GA 5ICGA 4DRZA 2BR4A 5L4LA 2VEDA 3RW0A 2O3JA 2A5FA 2A5YB 3DPSA 4M7RA 4BGDA 2GJ4A 1W25A 1H9GA 2B4RO 3AINA 4OOFA 1B42A 3OP4A 4DCPA 2QTTA 1CQJA 2JC3A 3IE0A 2VK8A 1DS6A 1BJRE 5DF1A 5C8VA 1SEVA 4TLAA 4BNYA 4O2AB 1GNLA 5K51A 3BMNB 2VT3A 4IIUA 3BAZA 1N5LA 4KYVA 4ERXA 1VYVA 2HIHA 5LZ4A 5LB4A 4KIJA 4LXHA 4RMNA 1NL3A 4OUKX 3I2IA 4QUIA 4CMJA 1JSCA 3H6HA 1WKVA 2FPIA 1YRYE 1Y8RB 5DYIA 2C31A 1SGWA 3VSBA 4OMUA 5ISMA 1J42A 4ENTA 5AK0A 4Q24A 3NWOA 1L5WA 4Y2SA 2BCJQ 4GQHA 3EWAA 4IQ0A 3OT4A 3U61B 2O0LA 4E17A 2INGX 5FLYA 2GF9A 3DE0X 2IYWA 3OPQA 4QODA 2VHJA 3SC6A 2XW6A 4LERA 4JL8A 2XLCA 3CPHA 1I3MA 5J59A 1QKKA 1IK4A 3PC6A 3L49A 5IFLA 4G5XA 1JXMA 1NBMA 4U1RA 3UHJA 2J9RA 4QAJA 3V5YA 5F5LA 1NNLA 2PT6A 1TJYA 4G26A 4OKNA 1QU2A 3TSCA 1W49A 4ITVA 2IK8A 4MSUA 1ORWA 2YCLA 3EIOA 1P2DA 4ZA2A 1XAHA 1EQAA 1Z15A 1DV1A 3IVAA 2QV0A 4AN4A 3VDMA 4C4XA 5HKKA 3SFZA 2E4VA 2UAGA 3K9QO 3H2HA 2BBSA 1VP3A 4GOLD 3GEEA 4QC2A 3CVXA 3SC2A 3JQ9C 1N8SA 3RJ5A 1XQ6A 3SLRA 5KQMA 1GZUA 2P7VA 4EHLA 3ENQA 2GZDA 2JCBA 1Q6ZA 4O2RA 3NFYA 3B5IA 4G8CA 3SCZA 4GI2A 3TCXB 3HVKA 5DV9A 4E09A 2IYYA 5IY5C 4US2R 2CJFA 4IF6A 1HFKA 4ARUA 3LTEA 1ADBA 4I6EA 4NENB 3LTNC 3FNEA 2UYHA 2OYCA 2GCOA 4F93B 4I3MA 2UXBB 4U0JA 1UQUA 4TV8A 4HAIA 2ST1A 3T1QA 2V4UA 1Z0ZA 5FAXA 3IR5A 4KWHA 4WN9B 5JY1A 1EUCA 5F3RA 1CVIA 5HBRA 2HOQA 3HRIA 1OI7A 4WBNB 1CY1A 2OZLB 3R5JA 1I7LA 3ABRB 2C5AA 2KYHA 1XCLA 1W44A 4O8CA 1TE2A 2RGUA 3TLMA 1V1JA 3LWNA 1ST2A 1T6YA 2B36A 2H17A 4JYZA 1WHSA 3FCYA 4XR9A 2XA9A 1IVSA 1UDRA 4ZI2A 4I66A 1IM2A 1EFRD 3MLBA 1YT5A 3W5CA 2X1HA 3NIFB 3PEUA 2Q8PA 2YZGA 4RWZA 1CQZA 5JU6A 1XRSB 5LCXA 1T0UA 1KI6B 2PRIA 3BB4A 2WKWA 2BEVA 1IBKB 3D02A 2DPLA 5CA0A 1HNWB 5DS6A 4QBIA 3KJZA 1NIPA 2GVNA 1IQRA 2G5PA 3EOBI 1MABB 1NQWA 4PY2A 2PUDA 4KQGA 4RQBA 2ZTLA 3SX2A 3CLKA 4W5QA 1SUDA 4RH1A 1T1IA 4MMYB 3SZ3A 4WNYA 4R1LA 1Y81A 3TE7A 4P6VF 3WHKA 3EA0A 2C1EA 2Y3BA 2R6CA 2WB7A 1VL1A 1D0XA 3F0TA 4E1BA 1WOYA 1OBFO 1HNZB 3QTBA 1ISMA 2EX0A 1Q19A 3HBLA 2J4FA 3IIMA 4R1PA 1BFUA 2FZEA 3VKGA 5AJZA 2F1IA 1V95A 2F1OA 2QQGA 2KWIA 4ZI7A 3LL4A 4JT9A 3QX3A 2AZXA 3WBFA 2Q0HA 2Y3DA 2ZSFA 4G5YA 1RRVA 2YFKA 4QYIA 2G1PA 1M2FA 1TWGA 2ZFUA 2LD4A 1G5FA 2VLBA 3FUXA 1OXKB 2VHEA 5IK2A 4FFLA 2H5IA 3A3YA 4OF4A 4YT2A 2HPHA 5FWAA 4FOLA 4RJIA 3TPZA 4L75A 2WQ7A 3AKCA 1P2FA 1GLGA 3VKWA 3M34A 2B4YA 2X76A 2WP8J 2ZAMA 4B4WA 4OLHA 3RFXA 4I55B 3IVGA 2EKDA 1L4HA 3QW0A 3EBLA 1DO0A 4Q1AA 4LVCA 4AIIA 1YB2A 3I0NA 3FZNA 1ZK3A 3ZTMA 3DD7A 2IX9A 3IQ6A 2NUPB 2LCIA 2IHUA 3AV3A 4FN4A 2RD9A 3G5UA 1TT7A 5ALDA 4R8VA 1JZQA 1V7QA 1GYQA 4Q0MA 4XTKA 3JQAD 4DTIA 1SHLA 2FPRA 3VSAA 5E6SB 1TTHA 3BRSA 4GOJA 3O83A 3KAKA 1OFHA 1FFBA 4KG7A 3T94A 1P75A 3IOEA 2TECE 3L0PA 3L4JA 4LQLA 3HM9A 4HYEA 4C6SA 5D3ZA 4MCHA 1R0LA 3RUEA 1VL6A 3KEFA 3OPVA 3TQRA 1F4VA 3GIWA 5BN4B 4M76B 2VDWB 3F2VA 2X0KA 3L8ZA 4RSHA 4QM7A 3T6KA 1GTMA 4NAVA 3C41J 1E79A 1MIOB 2V6FA 4FFBA 1HH4A 2B8TA 3EEOA 1DAGA 2PZ8A 2A0YA 5JPCA 1UBNA 2YYZA 3I4LA 2RKOA 4E46A 2N75A 1OFIA 4CS9C 2VJQA 5EMMA 2GPAA 1FNBA 3RIGA 2ECPA 4XD2A 1DOWA 4PK4A 4CTNA 4QNNA 5CT4A 3TSOA 2X7XA 1T43A 5COBA 3RWBA 2H7OA 1KBOA 4D9HA 1JIKA 3B6MA 4B33A 4JI2B 1Q6YA 4I81A 1OTXA 2B3TA 2TMVP 1TYZA 1U7OA 2OQRA 3Q7SA 4F6RB 2FE1A 5TC4A 4BKMA 3A10A 3DEHA 1J06A 1RWOA 5HJ2A 2CHEA 1L3PA 1OHHA 4JLSA 2H11A 4I5DA 5I51A 1N9GB 2EVWX 1S4QA 4NEHB 4LYEA 4J76A 1JFVA 1X70A 4AKEA 1XYGA 3CX3A 1MPTA 3NHWA 3N0RA 3N2NA 3Q8LA 5JTUA 2W5UA 1U3TA 3WHLA 1OKKD 2HXYA 4DM4A 2I7CA 2H7VA 5DRYA 3MBKA 2JGIA 1KO7A 2EG5A 1W5EA 1M54A 5G0UA 2IYEA 3R7SA 3IURA 2F3RA 1MGOA 1R4MB 3TJZA 2PLAA 5TPZA 5TVKA 2QT0A 4DQDA 1LGYA 2OWEA 2WIJA 1WUIS 4LDAA 1CRLA 4OP3A 1PEAA 2HQBA 3ND5A 1RRGA 1OTYA 1YTLA 4HNAB 2I7TA 1DBVO 5BQIA 4ISCA 4V1CA 1DOZA 4IS2A 2XCQA 3K16A 1RHRA 4RZXA 1A71A 2OBMA 1TJ4A 3E8MA 5C7YA 1D4FA 3R3YA 1ADJA 4QSHA 3ELWA 3L7DA 5J2UB 1X7WA 1MJGA 1GKYA 2NYRA 3ZUPA 3OI7A 3DMPA 2F3TA 5DBGA 3GFBA 2XITA 4J6EA 1U98A 2OBBA 3GH1A 4I0WB 2ZR9A 3WFJA 3DM5A 1GGKA 2P1RA 4F12A 1AUEA 1QFSA 3OBIA 1NXSA 1YR6A 1TYEB 1USIA 2DR3A 2GCGA 5K0IA 2Y77A 2L42A 2O48X 3R9XA 1GPWB 5IZ4A 3QVGB 3FYSA 1OC2A 1P2UA 2OG2A 1O03A 2F3SA 2B82A 4ZVUA 1PKXA 1CQWA 1VI5A 4TMKA 3T38A 1PS0A 4KXXA 2A9OA 3H83A 3FMPB 3MWDA 3HBFA 1Z7GA 3PGMA 5HK8A 4E32A 4ZWNA 2LGJA 4L6CA 2BHLA 3G5MA 3AHIA 2GF2A 1WF3A 3WMEA 2VKQA 3JQGB 4XTRA 2REQA 2DYKA 1AHPA 3M6FA 3O8NA 1U6KA 3W2FA 4RK4A 3GVHA 3IELA 2GLTA 4LNUB 3BMXA 4B9EA 4AROA 3EZLA 2HPZA 1FUEA 4ZYVA 2R7WA 2PS0A 3BT7A 4HEJA 2XV1A 5DVZA 4D25A 4QRHA 3PVZA 5FA8A 3VDNB 2KPOA 3DLPX 3U4GA 4U4AA 1UBUS 4D44A 3CWCA 1JKXA 4IZ6A 5GV7A 1EHYA 3SLGA 4QGFA 1EJ2A 4EO9A 2X2EA 2OAQ1 2CMHA 4RHFA 3D7NA 3RROA 4HLUC 2RGRA 1H65A 3H1BA 5EWMB 3ROXA 2QTCA 1SBYA 1SU8A 4CU5A 4FSHA 1HRDA 2YICA 2WF8A 1ZH2A 4G9BA 2CDNA 2X0NA 4DM3A 3NGXA 10MHA 5KC9A 4C4YA 3PX3A 3I64A 3H9BA 3QFRA 2Q8NA 256BA 1JXQA 4OH7A 1JPVA 4A8TA 3FA2A 5KNCD 4BPBA 2YWRA 3MTDA 4Y2QA 1VE3A 3DMTA 2CXXA 5EUMA 3B78A 1SKQA 2CXQA 1CEYA 1BBHA 5K05A 3X2EA 1AUXA 4JODA 1Q7RA 2AT1A 1MMNA 2PNOA 5LP1A 1F38A 4LHXA 2J3DA 4GZ5A 5H8WA 1DWOA 3PUZA 1NNUA 2H6EA 1S0UA 1PWYE 3QFTA 2QM7A 2PD6A 4DCNA 2PZLA 3MW8A 4HQFA 1RCUA 1U0LA 3LPDA 2QTGA 4EG4A 3GLGA 4P8RA 3TLXA 1HETA 2BD0A 1Z4JA 3S90A 3LQ2A 3NBXX 4JU9A 2CVZA 1A3CA 3HJHA 5CYGA 1V6CA 7ABPA 1FZTA 3ZIAD 1B8UA 3QEKA 3LUGA 2WJJA 1MOPA 1W2WB 5AHRA 1EEHA 5AVKA 1P1FA 4H7FA 5LP6B 4ZAYA 4MDEA 2F7SA 2ZSEA 3IFSA 1Z8HA 3U26A 3T9FA 1EQUA 1C1HA 4DHEA 3EWIA 2DHDA 3Q7EA 3DMNA 5DASA 5EJ2A 2EDCA 2O3RA 5KTNA 3HCAA 3BQ9A 3LPCA 3KZOA 4YASA 1Y80A 2XLWA 3R7FA 4OGKA 4K6KA 3L7MA 2Q3CA 4JL5A 3AMVA 1YZFA 3ZIDA 2K7FA 2G76A 3UH1A 2GA0A 1EAMA 4REQA 2ZM6B 2FOXA 2G0TA 2X8BA 4B4VA 1G5HA 3TMKA 4HUJA 1EVJA 3D81A 3H65A 1U0RA 1J20A 1XVIA 1OT5A 4G8JA 1GDHA 2ZRKA 5BQOA 5BPHA 4D8WA 1KORA 3SIXA 3W9YA 3D8SA 1M2EA 2DCMA 1W34A 1DIRA 4PZYA 2ZWMA 5A06A 1LXCA 4NTZA 4F4HA 4DMFA 4DDKA 4FDVA 1DKQA 1Z5GA 4GH5A 5LA6F 5ALYA 3M4BA 1I10A 1WB4A 1G5IA 1FJ2A 2Q6OA 3RSCA 5IBPA 2XBUA 1Z5OA 4ZGBA 2J6CA 2P2SA 5HFNA 3RRBA 3DFIA 3OF3A 4JI0B 2DT5A 2V55B 3W5HA 4K40A 2BYTA 3D3WA 1IXSB 1VE1A 3D6JA 4FFNA 1VPTA 4N7MA 4J43A 4J0FA 3RAJA 4MS2A 3IAXA 621PA 5I7OA 5HKBA 5DGXA 2O0HA 3KNZA 5DHTA 3R0XA 4J90A 2CCGA 1BEUB 4F38A 4G25A 1HT2E 1ODSA 5DLDA 1UPTA 1L5ZA 4U5HA 2NSYA 5CBPA 3EQZA 3D4IA 5T3TA 3HBAA 5JNLA 4OK6A 4W5HA 2AXPA 4KWCA 3PUYA 2P4HX 3C3WA 1RHKA 2R7VA 4U5BE 4OUDB 4ZYXA 4MVXA 3DS8A 1U3UA 3NZEA 4XWJA 4JVSB 1KK3A 1WQ3A 1U0NA 4O4IB 1PL7A 3GX1A 3KTDA 2WV7A 1AIPA 1XWWA 3CRW1 5EZYF 3HN7A 1MVLA 4W1RA 1GCOA 2IGBA 4DGSA 2EZTA 4QAQA 4K9MA 2XLBA 4LEIA 3UV7A 8LDHA 1KFEB 1KYZA 1A5ZA 2GZ2A 4FR5A 4BVLA 3M3DA 1E0AA 4KQEA 5F2EA 3JQQA 5LOVB 3VOBA 5FH9A 4B3TB 2MSCB 4L9SA 1M1ZA 3JCUQ 2W2KA 2FMXA 2IDMA 1HY3A 2R97A 4N6OA 2WDPA 3U19A 3KE8A 4HH4A 2Z2IA 3I45A 1T3ZA 2X5KO 4W8HA 1GUBA 3LPMA 1W36C 5I8ZA 4J03A 4WGGA 3T6GB 2I3AA 2IXGA 3W5UA 4RV4A 2WSBA 3ANTA 4BUJA 3I2JA 3OZIA 2OILA 1TECE 3RREA 2YW9A 2JX0A 3W5IA 4WOBA 5F7ZA 4YC7A 2BM0A 3M83A 4CT0A 1LD3A 2AI3A 3MWEB 4CDRA 1YAUO 4PN7A 4Q3CA 3CURA 3WRYA 3O3MB 4Q4AB 2Z1NA 1FLNA 4HI0E 2HSGA 3IALA 3F5MA 2E89A 4X1YA 5CNIA 3V46A 4EG5A 2VCEA 2WU0A 1FUIA 4DKXA 4CM4B 3IVCA 4EBKA 4ZD6A 4FHDA 4KR9A 3ZWOA 5L3QB 4Z54A 2NSFA 1B6SA 3BFXA 2QBYB 2DBVO 1RRPA 1Y3AA 2O8NA 4DR7B 3M6VA 5CJJA 2ETXA 4EYOA 1ODFA 3R7DA 1KMHA 5DULA 3ZBTA 4GUAA 3LAYA 3QLEA 2FR1A 4CQMB 1NOJA 4GFDA 2I8LA 1D3AA 5CXXA 2GYYA 3N2KA 2FHPA 3ICWA 1NZJA 1IY9A 2X8AA 3OLCX 2JGJA 3HYTA 5LDDC 4QDJA 3K9CA 3KE9A 3ELUA 4EHAA 2WA2A 3HWSA 4XPZA 2F8SA 1TDJA 3DOCA 1LRLA 4IIHA 1VG1A 1NR7A 1QHEA 2BFEB 3SEZA 2IDJA 1Z0JA 2B0HA 5A4FS 3WL6A 4HPJB 4DLXA 5EHQA 2FP4A 3OQHA 2VI5A 5TF4A 5TARA 4BQEA 4EARA 3ET5A 2HA0A 4MTFA 4DFDA 3HM2A 1T4CA 2HF7A 2H85A 2DJ5A 3WWPA 1DAIA 3H6KA 4JQZA 2IYSA 4LWQA 5EIFA 1FNCA 1X1SA 5BV1A 5K8CA 1G2OA 3K0FA 3HCDA 2ZBRA 2V4ZA 4Y6SA 3O1LA 4R2LA 1HE5A 3U37A 3NVMB 3GRVA 4Q7MB 4F46A 5K01A 3U4AA 1PTKA 4LF9B 3PEEA 5AVOA 3E35A 2Z83A 4K8RB 5KC8A 4CIXA 4L5YA 4U5DE 3U0BA 3UKOA 1U8FO 2WAAA 2O07A 4NU6A 3KVVA 1JWAB 2OGTA 3OZTA 2IOHA 4OREX 1JHYA 4YP0A 1MPXA 1MXFA 3NAGA 3FPEA 3GFPA 3VAZA 1XKXA 5BWBA 4W6QA 4MH0R 1H6GA 3N53A 1HW2A 3I23A 1H6AA 3ZEIA 4DJTA 2AYZA 1FJGB 4ASUD 1Y3FE 2IYAA 1BQEA 3KJNA 1AVTA 2W22A 3V4RA 3AEKA 2MU1A 1ISJA 4IZOA 2UVDA 1PN3A 4BNZA 1EUZA 3Q0IA 3GH3A 3COWA 2HWKA 1MO4A 2SKCA 2CXUA 4DLPA 1Y3HA 4PFOA 2WD9A 2DHEA 4CLRB 4X94A 5KPJA 4Z9HA 3L0YA 5E7MA 4M0PA 3HBMA 3O3OB 3NASA 4J30B 2CWWA 5CFOA 2ZJYA 3ISTA 4RTNA 1Q0ZA 2EJTA 1Y37A 4XIGS 2FFJA 2CV2A 1KP2A 3M1IA 2BW0A 3NJ4A 1YVPA 4OG2A 5JVDB 2ES4A 4BLUA 4PSDA 3WYDA 4AVYA 3ZGLA 3VPDA 2HB6A 1M1XB 1O95C 4CG0A 2GFIA 3STTA 3OHMA 1Z63A 1DC6A 4J2TA 1T2AA 1O57A 4LZOA 3VSDA 3P94A 4Y7DA 1QYWA 3GFRA 4TMTA 3KQHA 1QJCA 1D1PA 1FUYB 4IKEA 1NIJA 2GJ8A 2I5PO 4HJRA 2JGKA 1BE1A 1F9AA 3N58A 3KUCA 2DY1A 2PVSA 4FT2A 4QXMA 2GPBA 4A4AA 5ECWA 3GNSA 2WQZA 5DNUA 4WX2B 4DIKA 3QVLA 2E5FA 3AESA 1DTEA 1KI9A 1NT4A 4MVJE 1FTWA 3RJTA 4W8OA 1HE3A 2CJWA 3I32A 2PBRA 2NXEA 2RSEB 3TZKA 1SHZA 5KYUA 2HSBA 2DQKA 2ERXA 3JATA 4WJLA 4CV2A 3PD0A 4HWTA 2XMQA 4QREA 1RKQA 2ODQA 1L9KA 2ZPTX 1A8HA 4ALMA 3A3KA 4F85A 5CIQA 3GFSA 3Q7LA 4JTAB 2ZB8A 1F8YA 4YP6A 2CL7X 1N8KA 3LA6A 4ZOLF 2R47A 1Y33E 1K3TA 3AVXA 2FFRA 4ESOA 2ZYTX 3UT5B 3FB1A 2R66A 2F3UA 1MAUA 3SXJA 4LY6A 3BRCA 5EXSA 4NG5A 4J0EA 3AU8A 2WAOA 3VPCA 3AGQA 3IR6A 1YVIA 5DKFA 1JILA 1GADO 1DADA 2F8MA 4QXRA 4E2ZA 5AJVB 5CNJA 3KYDB 2ZYVX 2NTNA 3NW9A 3Q3VA 4NWIA 5EC8A 2QZPA 3WAKA 2KBEA 3PQEA 2IP1A 3MPOA 3OMWA 3LJBA 2Z58A 3DWEX 3RYCA 2IE0A 3EPLA 1B0PA 1XDSA 5I7EA 5AT1A 1W0CA 2C9OA 4H7HA 1VOTA 16PKA 2WZFA 4KPUB 1Q7TA 3K1AA 3C98A 3NHSA 3NX4A 3W8HA 1C7IA 5AJHA 1AUOA 4OL9A 5B3JC 4E18A 3NUGA 2WM3A 1FP7A 4I46A 3KYBA 4KFTA 2G07A 5IN5A 4BFZA 1T9KA 5K4AA 5G4KA 4N48A 1A1SA 2R7RA 5IMBA 3UB4A 3ZWPA 5KVVA 2V3CC 3Q7QA 1W0JA 3VZCA 1EESA 2GN4A 3G6WA 1XPJA 1NW5A 1VDZA 2A68F 2OMEA 2YVLA 1ZI9A 2P61A 4U6NA 1QZUA 1TWHA 4QO7A 1B41A 2WB4A 4PSCA 2HIAA 2OORC 4BNHA 2GPWA 1PEYA 4C7XA 1X2BA 1O6FA 5I9LA 3B3GA 1WV0A 2IEIA 4LZLA 3ASYA 1MRZA 1RT9A 2QXYA 3KJHA 3KSMA 4J0HA 5C1OA 3U2QA 1Y6GA 2PKQP 3HP4A 1RLIA 5EESA 4R5HA 5DP1A 3T15A 3PZBA 2J09A 1SOVA 1HL3A 1Z75A 2OFPA 4J0QA 2H65A 3W2TA 4IVPA 2R6GA 3V7FA 1PR0A 3FKSD 2HQOA 3VH3A 1RAGA 3ZNQA 2AXQA 2V3VA 2A14A 2MYSA 1DEOA 3K8OE 2J30A 5LXTA 1EWVA 2VHUA 3RODA 2HFJA 2RHHA 1IEXA 3DEIA 1Z06A 2ECFA 2QTNA 2XCSB 1UEIA 2E48A 2O2XA 1J7KA 3FDJA 4IJKA 1WZCA 2P75A 4S0ZA 3ZKWB 1M34E 2GAFA 1GU7A 4MV7A 1Z5VA 2HJ3A 1VXOA 4Z4GA 1Z8FA 5BW4A 1H6DA 1P5ZB 5D51S 3H1EA 1PVVA 3PKZA 2CHQA 4W6ZA 1Q11A 2DX7A 3BQMB 5BQHA 1K05A 4LOAA 2FZLA 1B6GA 4PLGA 2A9KA 3CMMA 3SX4A 3O8CA 4H1TA 1UWKA 1P2SA 3KJEA 4PQEA 5EHHA 4GVLA 2Z1DA 3E5MA 3Q9LA 4TTIA 2E5WA 3PQ5A 2J41A 4DUGD 1UMCA 3IQFA 1NT2A 1UKEA 1U7DA 2AMVA 3O26A 5DIZA 2KW3C 3NT4A 2PDAA 3WYBA 2OLEA 4K05A 4HNTA 1Z62A 3MELA 2YC2C 3RHTA 3CKYA 1ZMTA 3U7JA 2JA2A 3GJ0A 4FR2A 2X0IA 4ZREA 4ZHQF 4V0MA 1JJIA 1LBTA 3MAAC 2FWIA 4M36A 1MEOA 4KX3A 3HBJA 4NK5A 2B61A 2D4UA 3IKJA 5L0FA 5IS2A 1SXJA 3TN7A 4E4TA 1U28A 1T2CA 2NVOA 1VM6A 3RYFB 5LVAA 1K4KA 2P7HA 1UPCA 1WP9A 1XVUA 1XD2B 3KQYA 4JSYA 2CWDA 4CNQA 1U7WA 3EJWA 1RI3A 2EFHB 2PUJA 3GWZA 3IAAA 1OCRC 3BFVA 1NQVA 1PE0A 4MWTA 4ZVQA 5AOBA 3FYHA 3FKJA 3FOAA 1FW6A 4ARIA 4EA9A 2HK9A 5AQEA 3HGMA 2JKYA 1IOVA 2W2QA 2JLRA 1YJGA 4ABTA 3NHRA 4ZO8A 3AT1A 1E9BA 3M3PA 3IR7A 2FMTA 3L02A 2DP4E 3FI0A 3S99A 3T5DA 4I9FA 4CMEA 4ARBA 3GJ8A 2WYUA 5KDOA 4W8GA 5AVXA 2X3FA 4ND5A 1L5VA 3U3KA 3EZHA 5FBRB 3RHSA 1R74A 3HJFA 6LDHA 4UHKA 4XSVA 4E2YA 4ZT5A 3CS3A 4HDRA 1K9VF 1IC6A 4CCWA 1FQOA 3IO3A 1KYWA 4QUAA 2F3PA 4F0JA 1UQRA 3I5QA 1DX6A 3OIGA 4E15A 3RIEA 3VR5A 3RAEC 3KH2A 3CUVA 4UUOA 1X7XB 2GZSA 4B3MB 4CIHA 4DSNA 2X23A 4WLFA 2Q5CA 2QYOA 1QGED 2JLZA 4K6FA 1S6YA 2PWPA 1V2HE 2I8CA 4M53A 1RHQA 2IIQA 3GEPA 2AEMA 3WGHA 3N2IA 5JC8A 5LU9A 4K6MA 2Y2VA 1N2CE 4NEGA 4GM1A 3L77A 3TW8B 5L3RA 1GN8A 2WU3A 2NQ2C 3OY7A 2Q2VA 2QM8A 3L6OO 2RGWA 3FZGA 3QJGA 2W8BA 2VWGA 2VATA 2RMKA 1OBOA 5F9HA 2FE4A 2E4AA 2JI8A 3DULA 1OX5A 4NULA 3WK8A 2X77A 1OLSA 3QLVC 5FYQA 3ZXXA 4BZZA 4MUGA 3WKAA 2QWXA 4IJVA 4UE2A 2AZMA 4BCDA 4LXYA 3L8IA 1X8KA 4IJMA 1AE1A 2JD1A 4CKWB 1PDVA 2VNAA 1CHDA 1PFQA 1FSSA 3LKZA 4DLYA 5D1HA 2WRZA 1U0HC 3JYLA 5A2QA 1O4WA 2J6IA 4YCLA 1TW2A 4LRSB 2CL6X 1JYFA 2OFFA 5KKNB 4P93A 3A11A 3H9CA 2FZCA 4E94A 4BMSA 4OXIA 1WV1A 3QEJA 3Q11A 3HNRA 4PC3A 1CLEA 3PE6A 2VDUE 5J5CA 4UFPA 1FYXA 2QRGA 4RFSB 3RTAA 4NCJA 3U44A 1VHWA 3DVLA 2I7DA 3FGZA 3EVTA 3QENA 5G2OA 2QM0A 3PQFA 3FZEA 4XSGA 2NG1A 1YCHA 3PNVA 2O8EB 1J0DA 3AJ9A 3HC7A 3E3NA 2Q1TA 4QTYA 4RVGA 3SVTA 1KGDA 1IN5A 2C2KA 4EJSA 4M1YA 1OW8A 1UJBA 1ZD9A 4U0KA 1U89A 2XNJA 1HLGA 3HBNA 1TGYA 2R25A 3JARB 5LA6B 3VJMA 1L5HA 1WOMA 4ZZ3A 2APJA 5U4XA 3DC2A 1IU9A 1LB1B 5BRNA 5CYOA 1DCTA 5B7GA 2ADFA 2QU8A 2R6JA 3OEOA 4LBZA 3H5NA 3P2MA 2FQXA 4P4UA 2WTEA 4PC6A 4M8LA 3FHOA 2FV8A 1M2OA 2RK3A 3OIUA 1UJCA 2JGDA 4FS8A 1JKIA 2HA5A 1GU0A 5CD9A 4L16A 1W5TA 2BDUA 4MWSA 4UCFA 2CDAA 2HRBA 1VE9A 1RPZA 3G9ZA 4TYWA 1M2VB 1XDGA 3QBDA 1HYQA 4M99A 4X1KA 3QELA 3T4UA 1EP2B 5C8XA 1QE0A 5JI3E 3GPDG 1Q2UA 3JQBA 3UAZA 4E4YA 3LRTA 2QN1A 3WLLA 2IPLA 2QMZA 4IDPA 5A0TA 5A6KA 1DO8A 3I9JA 3HCBA 5EZYB 1QLJA 3EWNA 1NYTA 3QTHA 1GFIA 1Y8CA 3JRMO 1T29A 3VVBA 1QHXA 1UBLS 2Q3JA 3AQBA 5LLTA 3PA8A 5HM6A 4OK5A 3D2BA 8AT1A 4K0KB 4GLLA 1ONNA 2N42A 2I62A 1CRPA 4Y67A 1XCMA 1I51A 1VGVA 1O7JA 1XZCA 1YA8A 2DQ4A 3K20A 1J5XA 2AR7A 1NVTA 1IVNA 1AY0A 1E0DA 3QMVA 2UYGA 4YCBA 1WMDA 5A5VA 1VTKA 2VHTA 1RI4A 4DCJA 5CNMA 2JJ2D 4I6JA 3RVSA 2WHPA 4GO1A 3UOAB 4NFHA 4H6PA 1HYHA 2JCSA 4KN9S 4EWLA 3K0AA 1VOMA 3OKCA 3FGOA 4FC7A 2ZTVA 3EEQA 4DIMA 1NXPA 4CLDA 1V35A 4BN0A 2ARKA 1W87A 3F97A 3ONDA 5BMVA 1GFZA 4QOJA 3OE4A 2FCAA 4D6YA 1PEDA 4NE7A 2AHRA 1M5RA 1CUAA 1PNOA 3L9XA 5ALUA 3RC3A 3FG9A 4ZVSA 3KSAC 3T54A 4WGZA 2NP7A 3HV2A 5ENVA 2VTBA 4EWCA 3NOXA 5IANA 1D0ZA 1O08A 3SYNA 2VF8A 4KITB 2Y6UA 3AZOA 1T3TA 4OHXA 3E84A 2DQZA 2ZWIA 3L8DA 4BTLA 4YDHB 2NLOA 3PDIA 1QO9A 1WP4A 2PD4A 4HH0A 4MV3A 3LJKA 4N5IX 5BVGA 3ODPA 1KR5A 1LPOA 4BYMA 2O2HA 2FDXA 1WMFA 1YBMA 1GPH1 2OQVA 1KYXA