2YVKA

Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from bacillus subtilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
349
Chain Sequence
MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioribose-1-phosphate isomerase
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 129
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yvkA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yvkA02
2YVKA 5DBOA 4ZEOA 1VB5A 3ECSA 2A0UA 4LDQA 3VM6A 1T9KA 4ZEMA 2YRFA 1T5OA 3A9CA 3A11A 4LDRA 1W2WB
chains in the Genus database with same CATH superfamily
3HJNA 4GPIB 2CCKA 3EG5A 3BHNA 1KY5A 5COMA 1U5CA 1D07A 4DBZA 3F6SA 3WYBA 3RYLA 5JNSA 3BRJA 2X0CA 4R7TA 4NY3A 5KS2A 5B1IA 1TFOB 2WYOA 1XJQA 3EZ2A 5L0CA 2IUTA 3WZMA 2I3GA 3FMGA 5EJ6A 3EHMA 4AWBA 1EVKA 5IYZB 3PP8A 5TF0A 1C1DB 1P0PA 1NLZA 3IUMA 2QRZA 2GK7A 3D4OA 3GB9A 4DLPA 3L01A 1N3LA 5LCXA 3TM4A 4BU0A 4IUYA 4HTAA 4XX1A 1CUEA 4FDAA 3L4BA 2YIVX 1ZO8A 4DV3B 1L5QA 2LCIA 2J9VA 3KD3A 1E8MA 2ACEA 3OZUA 4PJNA 1QH1A 3JU3A 1I24A 3EBOA 3UMKA 4X71A 5E6RB 2J7KA 2JAPA 3HU3A 1FSFA 4DC0A 5C3UA 5KIAA 1W5AA 4G0UA 4XPYA 3T9FA 3HXOA 3E15A 3ET4A 4QUBA 5E6UA 2YFQA 4MS4A 1EUCA 4US0R 2ZPAA 2QRGA 3WGVA 3CCBA 4GLOA 1UP4A 3OHPA 4CKCB 4NONA 4WLVA 2OV6A 5LQAA 4Z4QA 5F5NA 5CB4A 1FRNA 2BMFA 4BCCA 4ZCPA 3ROGA 3MB5A 1HE1A 4MQ6A 3UF0A 3SXJA 1Q15A 4UEOA 4NYIR 3TRFA 1L4KA 3ZIBA 4J7AA 1VGRA 1U9JA 4I66A 5JMOA 3INGA 3IR5A 4DPMA 4IDDA 1PO7A 1WQ4A 2ZRAA 1ZSNA 4CDMA 3MJSA 1IK6A 4G07A 3SQDA 5L3QA 5T4FA 2RAFA 5IF3A 1ZIOA 4LRQA 1O0BA 1NBBA 4QUEA 5AW4A 3MWDB 4IILA 2PKQP 4WIAA 4FBMA 4OTZA 5JJCA 4QBIA 3E22B 2BCJQ 3H1TA 3TSYA 4AMUA 4EEXA 2VF8A 2WZQA 3ROPA 5ITWA 2H1VA 1U4NA 3HNRA 5F4BA 2DTEA 2BFEA 4I4TB 2PDAA 5FP0A 3O93A 4G67A 3BE5A 3WY9A 3REQA 1OH5A 2QRUA 3K31A 3ZSUA 2E4UA 2A58A 2QTMA 3NHPA 3DPIA 1XCJA 3ZC4A 5SZJA 1D1QA 5J2TB 5A04A 3VR6H 4QOHA 3A4NA 1CW2B 1GAJA 2IODA 4YP1A 3V6MA 1IDN1 2JFOA 3HY6A 3U0VA 1UJBA 4BFXA 1U8UA 3EMKA 4AECA 1U8CB 2I1LA 2JVJA 1WKCA 3QUCA 3PC3A 1E6LA 1SVWA 2EIMC 2Y69C 2BMWA 5ALRA 4FT2A 4QARA 3CGGA 1XXLA 4RZHA 5A71A 3CKKA 4ZWNA 1FMVA 5TEVA 3HHEA 1ISHA 1MOSA 3IESA 4MV5A 1L4NA 1SR8A 2FMKA 1TLFA 1I2MA 3ILVA 4B6EA 1LBHA 3QWAA 1FYDA 4FYPA 5EZ5A 4IM7A 3E7FA 3AFMA 2TMVP 5K0LA 4ENRA 3INRA 2O0KA 4G78A 2HJWA 5JTTA 2AZMA 4L78A 3FF4A 5K20A 1K7EB 1JFLA 5AP9A 4N41A 1NXSA 1NJ2A 1HDEA 2ZBUA 4U63A 3ZCQA 3W90A 3I9OA 4MV8A 4EHLA 3OIFA 2GCGA 4NENB 5CVVA 5DNWA 4K26A 1M1NA 2DCUA 3HKDA 3RT7A 2CLIB 1T3LA 4DC9A 1YQXA 1OT5A 5CPBA 4KQHA 4MVJA 2QLBA 3HVHA 1Q7TA 1AGPA 4NJMA 4MCIA 4ZZ1A 5ER9A 1B68A 4WSOA 3QMMA 3VDQA 2VTEA 4BQPA 1T1IA 3DFIA 1GGJA 5AKIA 1L3BA 4Q66C 1KOLA 4FYJA 3ZU6A 1Y4ZA 1L5WA 2R0QC 2GEFA 4DRZA 3UJ3X 1P44A 2FFQA 2FX5A 2I55A 3L0PA 5GONA 5M2QA 3MS4A 4EY3A 3QMWA 3GPBA 2VHCA 4D9CA 2NUBA 2WG2A 2WKQA 3SHTA 4JVOA 3TBHA 5KU7A 1H0HA 1LS4A 4QOSA 4LC1A 1NV8A 4OI4A 1NVKA 1XVUA 2GYYA 1KH1A 1L5NA 3VX4A 4AJ4A 3AJEA 5F2EA 2C83A 2D7CA 2Q4TA 5JRZA 2V3VA 4UTXA 3KYCA 2C4MA 4IPTA 2XUDA 1XKXA 2UZAA 4L6RA 2GXQA 2W6MA 4UASA 1ZH0A 4M0DA 3W5DA 4D44A 1I2BA 3P27A 1V35A 1RRCA 2ZIGA 3PS9A 5AI4A 4II2A 4UXIA 5BUZA 1PUXA 3I1YA 1KMQA 1Y6ZA 3K0BA 3FMIA 1CNFA 5SY4A 3DJYA 4Y6OA 2I33A 1RKQA 3N2ZB 1JG6A 1CCWA 3FOEC 3OTOB 2IZZA 3D0RA 3FR8A 4X3PA 1XTUA 1H9BA 2DLNA 3BT7A 4CLEA 5ES4B 3MGAA 3UXMA 3T3MB 3PCRB 3QLJA 2QJOA 1WD7A 3I4CA 1R6BX 4RZXA 5L0HA 1YTLA 1WA5A 2LIVA 3ZBUA 1GPLA 3EWSA 1J2RA 1V16A 3V1NA 4ATNA 2C00A 1QOQB 1W9HA 4DTIA 1RQGA 2HLDD 4HNTA 3GPDG 3GVHA 5AUQA 4L4XA 3WSTA 3BFVA 4KRXA 1SBNE 4E32A 2JL1A 5LD2C 4NP6A 4RSGA 1JHXA 5JVDA 2EC5A 4HCJA 2BFDA 2IK8A 4CRWB 5D7BA 5FOVA 5L4LA 2B3DA 2HPZA 3GDFA 4TPKA 4MUNA 5FULA 2EZ8A 4NX2A 4LJ7A 1IW7F 2PYZA 5CT4A 4BVBA 4F12A 1DO8A 5EKUA 4R9NA 4OAPA 1MGOA 4TTTS 3Q6IA 4HF7A 4PINA 3ZQJA 1E0SA 5HM8A 1GL7A 3EXFB 5I4CA 1XRMA 3SQOA 2QVYX 5T41A 4XDZA 3KZOA 1MOZA 4CMIB 3U62A 1WUYA 3U39A 2H8AA 4OOFA 4J0QA 4NOMA 3F6PA 4BNYA 3OBIA 4IXDA 5C32A 5G0VA 3W1WA 3N39C 1CDEA 3PICA 1GU7A 2P68A 1Z4KA 1FQWA 2VL7A 4S1TA 1I2DA 3CKYA 2Z8YA 1U5BB 1QQ6A 1JMYA 1SQFA 5A4KA 2ZVDA 1M0WA 1U99A 9ATCA 3E9EA 3ZX4A 2PH7A 2YOGA 3CZ4A 4O63O 2VRCA 2QX8A 2F90A 1XRPA 1KI3A 2ACVA 1OLXB 2CLEB 4M8NE 3A6DA 5IN5A 1KK0A 5CA1A 2QZSA 1I0LA 2YVLA 4RY2A 3AY6A 2QSYA 1QHXA 3D7MA 4GI5A 4HLCA 8ATCA 2OK8A 3OKFA 2Y05A 3BH7A 1T8SA 1N75A 2Z6VA 2Q50A 1H2ZA 1XA0A 1XP8A 1Q57A 1DBIA 4DA6A 2CLKB 1UXGA 3VJLA 1K5DA 5KNCH 3ZE6A 3K0AB 3KHTA 1W59A 3I3OA 2Y4OA 2NSFA 5BN5B 1TO2E 5C1OA 3O1HB 4NZNA 3OOSA 3PNPA 3OIYA 4FYHA 3EY4A 1Y5IA 5IUJC 2A9RA 5IN4A 2EGHA 3MTQA 1Y37A 1ID8A 3IB6A 1LBQA 1FZQA 3OZFA 2YXLA 2OZPA 3E82A 1T4GA 3B36A 2QM0A 2LP4A 4GEGA 2GK4A 1KYXA 5H7XA 4UHJA 5BSEA 3FTDA 3NORA 1T8YA 5BMVB 3IV6A 3LU1A 5K0JA 1UAAA 3E0XA 1KZ7B 1ZRHA 2H7YA 3UMRA 1W88A 4UUPA 3I4LA 4BZQA 2O6LA 2Y9MB 1IG0A 2H1FA 4CNQA 1P0IA 4J94A 5CEEA 2H08A 3O8OA 5HBGA 1SC9A 1W47A 2GLXA 4PZZA 3N0RA 2ZWVA 2YZKA 2NMVA 4LDQA 3I9NA 5LUAA 3HZZA 4BNGA 3LL7A 5ADVA 1E2PA 4OGKA 1PRYA 5C5IA 5FWAA 4LVOA 4IIJB 3D6JA 4B7UA 4YAUA 2DPYA 4NCJA 3T4EA 1KMNA 4KO3S 2WZLA 3MAJA 4BO3A 5KYTA 3UJ8A 5F52A 4MAFA 4KQMA 4WUTA 1WCWA 5F1YA 1JQAA 1EJ2A 1UMCA 2C2GA 4Z9JA 4WCFC 2P0AA 5A3RA 1B6RA 4KL8S 1KEPA 3Q4GA 5BSTA 2QN7A 2Z58A 3KSAC 1C4WA 1O8BA 3GYGA 4WACA 1N2CB 3RFTA 5TGTA 5LKRA 1HYQA 4KMSA 2P2YA 5DS6A 5HTOA 1YRYE 3VHRA 5HKBA 3P0EA 1NKVA 5JT4A 4JB8A 1T5TA 1B8UA 4ENUA 1XPOA 3KQLA 4ITUA 2HREA 3K20A 2FJ0A 2FPPB 1W0KA 1OQAA 2BF7A 4Z7QB 5AKZA 3JZMA 1OBOA 1E2XA 1M6VB 4DEXA 3DEZA 1NY6A 4CM3A 3LIPA 1N8NA 3KVNA 4O4LB 2GESA 3SJZA 4MZDA 3T94A 4Y2UA 3PQ3A 1PJSA 4WFIA 1VL1A 3MYIA 2PD3A 1OH7A 3PDJA 1QC5A 3UAWA 4ZV7A 1LPBB 1U4SA 5CH8A 1X7WB 2QVGA 2E5FA 4IQ4A 2F1IA 1OW7A 1SHKA 1JHPA 3DDHA 2I22A 3ICOA 4I8XA 4ONSA 4KR7A 1EAYA 4M1MA 4ZTBA 2B98A 2VN8A 2J0SA 1D6MA 1PV2A 2LPMA 2JGDA 1QNFA 3OIUA 3WLNA 4B2LA 5A9SA 2Q0XA 2XS8A 4DC1A 2V0NA 4KXFB 4N8DA 3SHQA 1ZH6A 1LZKA 2WE8A 2A1UA 4HH1A 4L3VA 1J90A 4CCSA 2I91A 2AFHE 5AM1A 1IJFA 1ZI8A 4ZZ3A 5BNZA 3ZCSA 1GOTA 3MHPA 3FTFA 5DI9A 1MC4A 4PSVA 5P21A 1HPLA 3W4YA 4JCHA 5AW6A 1WW3A 1L5HB 3HJUA 2WMOB 3GT3A 4R40A 1JIXA 5EHNA 2A78A 2XXAA 2FW1A 3WHIA 2AHRA 3RVKA 3JSAA 1Y5NA 1XIVA 4S35A 3EPJA 4DIUA 2OV8A 4XQ0A 4D0SA 4B0OA 3BB3A 3ZG6A 1HE2A 2EPMX 3ADPA 1PNQA 1ZD9A 5JQGB 3LDFA 2FSUA 5GY7A 2QVCA 3V46A 2BEVA 1FLVA 3ILHA 3LGXA 3C63A 4K9KA 2YN4A 3A1DA 4KK4A 3EZLA 4BTVA 2NT4A 4MEBA 3WGMA 1Q0TA 2FJPA 1SU8A 5FJIA 5IT5A 5CD1A 1U0HC 3ZTWA 2ABWA 5ELMA 3NH6A 4CDGA 3L3BA 1RTKA 4TL9A 3TF5A 5CTJA 5T5QA 4M6WA 2P91A 4PW0A 1I01A 3FCUB 4UZFA 1G8MA 1EK5A 2CXTA 3JAKB 4BGEA 3GFQA 2PSHA 4HN4B 1EAMA 2OPBA 4KPUB 2V5UA 3QVVA 4L0QA 4HH0A 4MRMB 2B30A 3ZW8A 4DJ5X 2QUIA 1VM6A 4ZQEA 2FDRA 4GKJB 4UUQA 4ONEA 2P9QA 5AKLA 5FAXA 8OHMA 3SNKA 1UFQA 2F4NA 3P2OA 4RX1A 1E2FA 2YBEA 1EFVA 1L5FA 5BWMA 3A6PC 1W93A 4GAEA 2JLUA 3IXMA 3T4XA 3STYA 1SHTX 3V55A 1ZA1A 2JCSA 1YJ8A 1RT9A 4Q7LA 5JAMA 1YVDA 3VKUA 1VE1A 3I5AA 2RSLA 2QQGA 1EWRA 2Z2JA 4V1CA 4Z6KA 3HBJA 2ARKA 3SN6A 2DCMA 3O1IC 3KOOA 7AT1A 5K3SA 2QU7A 2QMUA 2EYUA 1ZM9A 5ETJA 3IXLA 1E8DA 3U0CA 1EP3B 2Q7OE 2A69F 1P77A 2O0MA 5E3CA 3DE0X 1DEOA 3MK31 4YT8A 2BFFB 1Y8AA 1YIDA 3OE7D 1QTNA 1O1YA 4OK6A 5A0VA 1DO2A 2P9JA 3WGYA 1BVRA 3DE2X 3ITEA 1IHPA 1X1DA 2G4LA 1GY8A 4EAAA 5ERYA 1T4BA 2JVIA 1EXWA 5H16A 4MWBA 2WUVA 2UUOA 4LLCA 2BFNA 4BS9A 2VT7A 1ACMA 1K6JA 1XDUA 1ZR4A 3HWSA 2IOYA 1J49A 5FNVA 4R84A 3SJ7A 2HWXA 3VO9A 4FDUA 3AERB 4TYWA 3IQFA 1IHUA 2ZT5A 1YL5A 4I1OA 3UG6A 3TLGA 3HYNA 2FB9A 3KQMA 5KDDA 4PSKA 3O31A 2BJWA 4XQ1A 3H8JA 1UM9A 4L9WA 3C6XA 3RS0A 4ZI2A 2HGSA 1IOVA 4EJSA 2NO6A 3A32A 3UWMA 1A8UA 4OK5A 1VRWA 1P60A 3K0FB 2VYCA 1CZNA 4GRAA 4Z86A 1HQYE 3N59A 4RZIA 1FP1D 4UU7A 1IZ9A 2HYIC 1V1MB 4ALMA 3H8SA 4DIEA 3SE7A 5DHPA 1DXYA 1GZ7A 2A5YB 3CFYA 1MOQA 4JLAA 4H0CA 1HORA 1PEYA 5AT1A 4TX1A 1Z0KA 3ME5A 1J23A 1WF3A 2BZ1A 4M0FA 2VOJA 5KBYA 4EKNB 3BMCB 4CN8A 3UMFA 2QXYA 1V96A 4BFTA 4Q4AA 3TKYA 3SIPA 1U0RA 1FSSA 1S3SA 1U9IC 2CLHB 3KZ1E 4Q9LA 1X14A 3Q87B 3FNBA 4G25A 3ASZA 3OPYI 4Q7CA 1A4IA 2RD2A 3DXFA 4R3UC 1O89A 1L3CA 3LY5A 2WWTA 4D9IA 5A62A 3ORQA 1NQUA 2WEKA 3TIGA 1JXAA 3ZDRA 1G20E 3HRKA 4OXRA 5FWXA 3GLGE 2HU8A 2P4EA 3OSZA 4WESB 2Q4EA 1J22A 5M5BA 4NQZA 4RIGA 3BTOA 1C2YA 3O47A 3KYBA 5ER6A 4PGFA 3OJOA 1J2TA 3KXIA 1F1JA 4E5KA 2IHBA 4I3FA 2PNJA 4N3GA 3ETDA 4H6WA 1SPXA 5K3EA 2GKSA 1Q0FA 3Q8MA 3RO7A 2A4MA 1LRLA 4LDNA 3UJCA 3FDQA 3FYCA 4HVAA 4EB8A 1XDDA 3MWGA 1T29A 2RHRA 5HF6A 1QRUA 5J4VA 2FMFA 6PFKA 4ILKA 1FNBA 1OX4B 4RKWA 2X0FA 3NHLA 2PRSA 3QV1A 2PEZA 1M8GA 1XCLA 5BQHA 2YJZA 3RVDA 2LD6A 2B0JA 2D7DA 4O2BA 1DAPA 4KNYA 4U9UA 3U7HB 2J46A 1GPNA 2BGGA 1KL7A 3W79A 2G7ZA 1KE1A 2OXIA 1OIWA 3L8JA 4NJEA 4REQB 2P61A 2QTVA 3TINA 1EBUA 5H1YA 4RLQA 3EZ9A 2DLCX 1J21A 1K27A 3FCXA 3LOPA 1UDAA 4TN1A 4CIDA 4MR7B 1Y34E 4ETWA 1Z2NX 2FY8A 3LFUA 3X1WA 5KJFA 1UPUA 5F9MA 2QA5A 1FTSA 5LZ7A 2OKCA 1W4RA 3TMYA 4F2WA 1JP7A 5ENVA 4WKNA 2NU8A 2UUBB 4KR3A 3ZGZA 3ZHVA 3TTYA 2QPLA 2PAFA 3DHVA 2HN9A 4KODA 4B8ZA 1D0YA 3HEMA 4U6SA 4NF2A 1MP0A 4QPDA 1PIWA 5E8RA 3S8EA 2QR5A 4FYMA 3K7DA 1USGA 1XNRB 2M6RA 1O54A 3ONVA 1Z82A 3GAAA 3HJTA 1PBNA 1OB5A 3BGIA 2DAPA 1L4HA 2X9GA 2Z83A 2OGZA 1BRMA 4K6HA 1URPA 3B0PA 4KGXA 4CEIA 1PZMA 1S2IA 4G1VA 2NQ8A 5EEGA 3ZI7A 3PITA 2VPWA 1Y1SA 2PUFA 1E3IA 4PIVA 1W87A 5CFNA 3OM1A 5BUOA 3DAFA 4F9TA 1EA8A 5LA6F 1CVLA 5FUQA 3O1LA 2XRHA 2OILA 2AE1A 1AO3A 3BJZA 1KOJA 3REFA 1XDSA 3IIEA 3T9EA 4Y98A 2R8BA 5IH7A 3ZJ5A 3AP1A 1E6WA 3D7SA 4U7TB 2NPUA 5I7UA 2EWWA 1W6UA 3EF3A 1BEUB 2DM6A 1U6HA 4G0HA 2JNWA 1CUUA 2QN8A 4PSCA 1B76A 1NT4A 4C08A 2ZE7A 4RXMA 3M6UA 1RQ7A 2TS1A 4CCWA 1AX9A 3CLTC 4Z53A 5BNWA 1SFRA 5CCDA 2HRQA 2PWAA 4P7JA 3Q8LA 1SXHA 2WYWA 4Z4GA 4UBLA 4BU1A 2UAGA 4AMGA 1X80B 2V6MA 3G8DA 3X3HA 5EZYA 1JLHA 4I9HA 2ZPTX 5EUMA 3PZRA 2G8LA 1ENOA 3O26A 1L7MA 1E2EA 4D3YA 5BWCA 4Y3UA 4YI3A 2VDKB 4UBKA 5KQLA 2HY7A 2CUKA 4CM9D 4C4SA 4QOJA 1S8FA 3K71B 5ENZA 4QYXA 4L72A 4JI7B 2IKSA 2AQHA 5FRDA 4RK4A 2H29A 4K6GA 4LYGA 4MW7A 4PO1A 2NPIA 1BQEA 2A5JA 2E89A 4J6FA 4BNHA 4ND5A 2V97A 4QYTA 3AI7A 3G0BA 1T3TA 1KR2A 1OFTA 2VP4A 1KVTA 1VCNA 4G1FA 4R01A 1EHCA 4L50A 3HI6A 4QXPA 1E60A 1UPBA 2C42A 2D1FA 3ZE0B 1K63A 3NNNA 3LUCA 1M57C 3M0EA 3O3MB 1P3JA 3WK7A 3EC7A 2FGYA 2OA0A 3BRWD 5CURA 1B23P 5JU6A 4X3OA 4AS3A 1XZJA 3HA2A 3NC0C 2ZIXB 1BDIA 3GZNB 3NHZA 4YJ2A 1R0LA 4OAOA 4A8JA 3ZV4A 4E1VA 4MWZA 3EH2A 3M5CA 2WUEA 4MGZR 2Q5EA 1DHTA 1NJSA 1QO0D 4E5SA 1ESCA 5D3KA 1H2YA 5AM0A 3JYNA 1EUYA 1HI9A 1N1DA 2FSGA 5EP2A 3G82C 2A14A 3V1LA 3EG9A 1BW9A 4EW3A 1GHTA 1V4AA 4QPZA 3IDAA 4AYTA 3QY9A 2FAPB 3K4QA 4OQZA 2HA2A 2FR1A 3PI6A 2FW9A 4GMXA 3LT4A 3EC1A 5HFNA 4B76A 3N0TA 3KWMA 1O57A 1UZMA 1U9ZA 1HKHA 1ODTC 4HPJB 5KPJA 4K88A 5AJZA 2AN4A 3GFGA 1FFSA 2P78A 1JQ3A 4ZYUA 2O2EA 3OEHA 4WKGA 1ZD8A 1YQUA 2J8ZA 1E2BA 5EGNA 2V5VA 1H6DA 2JIZA 3C2QA 2PUBA 4NATA 3L8MA 3M3HA 1KI8A 5A0FA 5E4FA 2AVNA 1WBJB 1AA9A 1NR1A 2ZRDA 1D04A 4NPCA 1RWQA 1KZ1A 3WMXA 1RQRA 3Q0IA 3G2IA 2A33A 3K9BA 1CKEA 4FOLA 4IVNA 1G4AE 2HPVA 3A4IA 3P2JA 4Y2HA 2ZI5A 5KSZA 3T6GB 4WNAA 1GZ6A 3LO5A 1E9CA 1YMUA 4AG6A 4QNNA 4GYYA 3TZKA 2W9YA 2HK9A 6NULA 1ODJA 1X8KA 3IBGA 4AT1A 4ZJZA 3Q41A 2BMJA 1M5RA 2HNKA 1ILWA 4ZVOA 3DBLA 3IQZA 5IJ0B 2VAMA 3ND8A 2RI0A 1RZVA 3CF6R 2RE8A 1RWBA 1C9JA 3R7FA 2OY0A 1K3TA 2Y0DA 4HNHA 2VTBB 1A04A 3MZ0A 2LK4A 1JQDA 4DY6A 5BQOA 1P45A 4QQRA 1N2JA 1SPBS 4OD4A 4NE9A 2AEFA 1JR3D 1KYVA 3D02A 5DGCA 2B8EA 5A6BA 1AIPA 4F3CA 1MAHA 1T0BA 4MI9A 4IX1A 1GZ4A 4XIFA 1ESMA 1NVTA 2D1TA 2JI7A 2QP4A 2A0KA 1YIAA 1H2AS 4A6EA 3BWBA 3FPLA 3ND6A 2G6TA 4F3NA 2VNAA 1FDUA 3OQVA 5LWQA 4MHSA 4HRXA 4HWPA 3DI5A 1YMVA 1NXVA 4PLVA 4E08A 3GJ4A 3DE8A 5AVTA 2DXIA 4BPBA 3L0IB 4PG8A 2XKAA 5IAEA 3ZQKA 3BXOA 4M9ZA 4XPZA 3BH6A 4K1XA 1OGYA 3F6YA 4K1OA 2F64A 5EE1A 1D09A 1CRQA 4X84A 1V7ZA 3OQOA 3OIGA 2C3PA 3IOEA 3OU7A 1K4MA 2XMZA 1WW8A 1IU9A 3GY0A 2QX9A 3WBJA 4BTLA 3NAQA 3IVCA 3JWJA 4W7IA 1UFVA 1GYQA 4H3SA 4V1CI 1YAHA 4DVZA 2EWVA 2C2ZA 5EMJA 1HEYA 3RPEA 3D5TA 2CVZA 1CY7A 4RVOA 1IZYA 3DEAA 3NATA 2FPGA 3U8PA 2UDPA 2NYRA 5A02A 3L1MA 1RAAA 4C0HA 4AX8A 4CLDA 3OG9A 5KQRA 3NALA 3LOQA 4BFLA 1Z3CA 1M2VA 3I01A 2JLCA 3M4ZA 5DOZA 2AJDA 2HMVA 2FZLA 4MQUA 5AW2A 4EKDA 1W4BA 5DLQC 3DYBA 2IJGX 2G62A 4FHEA 5BPHA 1J8QA 1TUEA 2ZYTX 3RVOA 1UBTS 1UFKA 4Z7OB 2O3QA 2E1RA 1Y9JA 1X77A 5DULA 1H1LA 4RANA 2GZ3A 1K5GA 1NBMA 2XYQA 4KP7A 4EQ6A 4IQFA 1R4MB 4NQFA 3IEVA 2A0BA 3UJHA 1RKUA 1SRQA 3OSUA 4KAJA 2QUKA 5ALVA 4EA6A 1W2GA 2GVDC 4Z3DA 2VPTA 3TEFA 4GMKA 3IJRA 4QXMA 1HRKA 4N7RA 1UP6A 5L95A 3EN0A 5AVXA 4B4OA 2YQ4A 1ZM2A 4EMTA 2Y66A 5AWFC 4BB0A 1R88A 2NAPA 5CLIA 2GGSA 3OQMA 1R5OA 5B3JA 2HADA 4XVRA 1GLNA 2BZ0A 4YDSA 3IO5A 3K1AA 1I5EA 3NR2A 2NSLA 4FUTA 2V7QA 3L7JA 4MVJF 2FX2A 3NCTA 5JVEA 4XH9B 3FLEA 2IBMA 3C15C 3ZU4A 2O0JA 4IG4A 3ZDAA 5L0DA 1SWWA 4DSOA 4PZPA 3GWNA 10MHA 4OATA 4KC0A 1UBRS 1WEKA 1KYTA 4TTJA 3NWEA 2RHWA 4MUHA 4XEKA 2RH4A 4YDRA 1ZJ6A 2PVPA 4KBLA 1YFLA 4ZVUA 4RPHA 1YHNA 2KNHA 2VWGA 1DZIA 4IVPA 4YLGA 3QGMA 2Q5JA 2QENA 4OX9B 1F1MA 1RVV1 4ODIA 4MROA 2OV3A 1PDOA 1DTWB 3D8NA 2R2GA 2GRUA 5CM8B 1TYAE 4R71A 5B55A 3HEAA 1P8JA 3T5DA 1XU4A 1I7PA 4FNAA 5AXCA 2ECFA 3DJNB 3L43A 5DHAA 5AC4A 2BFWA 1SY7A 3F5QA 2ZAYA 3KLPX 4K87A 3I39X 3L6OO 3DKRA 4TUYA 3ZZ0A 5EESA 4BQEA 3NP7A 5B1DA 3K2QA 3MX3A 3FVQA 4KDCA 4U5XA 4UZEA 4HZUA 1NBOA 1UM8A 2PJUA 2G1PA 2EPNA 2JRCA 5ITZA 3CU5A 4RK1A 4IDPA 1NVDA 1NPYA 1SXJD 3BZBA 2B9EA 2J3DA 4GBMA 3T0FA 3GLFA 8AT1A 4EQZA 1CZHA 1W5SA 1KBOA 3I04M 2VUSA 5TQ0B 3W4KA 1A5AB 2LP4Y 5J4KA 4HEJA 3MTJA 1NC1A 5F4ZA 1YI8A 5IKPA 1U6JA 3RW9A 1BCRA 1IZ8A 4CZ2A 4AY4A 5ECDA 1LI5A 1FTNA 1SC4A 1DPFA 3GFTA 4TS3A 3UPDA 4XB2A 4O3FA 1PVVA 4XOUA 4DLXA 4N6GA 3WL3A 3L1KA 4KWTA 1ZIPA 4ZOCA 5JVDF 4FESA 2Z30A 4GXTA 2WP8J 3ZIAD 3VBCA 4COKA 4EFDA 5FR1A 4O6VA 1HMOA 1Y4DE 1FX0A 3EIEA 4OQNA 1QG6A 1TA4A 3BH0A 4OHKA 1UDWA 4B4VA 4EYSA 1KYIA 5TB5A 4KVZA 2XKBA 4E7ZA 1ZOIA 1P1RA 4EHBA 4N3AA 5SV2A 2VNJA 4I5FA 2NU6B 1JFFB 1V5WA 1ZN2A 3BCSA 3ND9A 3OE5A 3U5TA 4QELA 1OUMA 3GQBB 1KXJA 1EFHA 1BHSA 2UU9B 4NCHA 1TM3E 1SRRA 3RHTA 5AI5A 3W2HA 3IJ5A 4KIJA 1YE3A 1S01A 2WIFA 4TSKA 3KKPA 1JU9A 5C8YB 4G5HA 4REMA 3AY0A 4I55A 4F60A 3SMQA 2AB0A 4I1YA 3KKNA 1B14A 4ZYVA 1RI4A 4FD2A 1MD9A 3JAWA 3NB0A 3HU2A 5CA1F 4XDYA 2ASEA 3VR3D 4BC1A 3OFVA 5EERA 2PUCA 2ETVA 1T3HA 2XL6A 3ST7A 5JE8A 4R31A 3DBHA 1ZK3A 1I80A 5I45A 4MYHA 2X7XA 3GANA 2WIBA 3KYJA 2C7GA 1L8OA 3G13A 4U1RA 3FHJA 3DWWA 4AK9A 4HO1X 4HV4A 1AZTA 4AUEA 3AUSA 2Q5HA 5BXYA 1YA7O 1WAMA 1RKXA 3VDRA 3FJYA 3VX3A 2WV9A 3KUXA 1UR5A 4G0PA 4PZ9A 4IEIA 4D8TA 3THSA 3THOA 3K73O 1Q0SA 2JZOA 1MQVA 3RTEA 5JFTA 1JU3A 4X3CA 3DLIA 5U4XA 4LF9B 1WASA 2UUIA 5AUNB 3F9IA 4DYHA 3AFIA 1R9GA 3OJFA 1ZVQA 1QBGA 4CIYA 5JZOA 5YASA 3PUYA 2ROQA 3KT3A 3LA8A 3EXEB 2GJ9A 2MMGA 4CODB 1A4RA 3WK5A 2R7XA 2CVQA 3CW9A 2EFYA 3JQ7B 2D3WA 2GCEA 1Z29A 2UVQA 3ADKA 1CHNA 3ZDQA 2RHHA 4PYNA 1J2JA 1K68A 1O0SA 1T91A 1MVLA 8MHTA 3IUQA 3R7AA 3CRRA 1VMKA 3A04A 4FMDF 3KSUA 1XZLA 4CLRB 2GAIA 2BFMA 1NN1A 1JR3E 2ZTVA 1QPBA 4GT1A 3S27A 2XIQA 4NXMB 2ZZKA 1TM2A 4F3TA 3QKIA 1VJGA 3RU7A 5GV7A 2PAAA 2WNSA 4DUYB 4GMHA 1B0ZA 3DMTC 2WWGA 1Z33A 3TSWA 4ACAA 4G4SP 3B1JA 1A4UA 3LW7A 3FXHA 2FI1A 3HYLA 2OD7A 1E2UA 1DADA 1CT9A 4IIXA 1SKQA 2J30A 1U94A 5KNLA 4MW3A 1Q0HA 4YALA 1EA5A 1SBTA 5J40A 4EA7A 1QSGA 1BU8A 3ZG1A 2IU0A 2KQUA 4LDPA 4JL5A 2ID4A 1THTA 1VCMA 3K94A 1ZCZA 2FJUA 3OX2A 4QTXA 1J2EA 4IDNA 4WGZA 2BLNA 3FN4A 2BZGA 4ILEA 4AMVA 3JVVA 1OPRA 2WDPA 3H2SA 3RV4A 1AKTA 4ZAFA 3GPCA 2ZSBA 2CK3A 5BWNA 4CHGA 2DG2A 1KZHA 4MHOA 2Q2WA 1UG7A 3PXBA 4RA6A 1ZICA 2JA1A 4CTNA 4R1MA 4Q37A 3RKUA 2BUAA 1ZGHA 3LCMA 4JBXA 1GV1A 1KA9H 4P4SB 2WIDA 4BFCA 1T6YA 8LDHA 2P4QA 1T9BA 2EBUA 4BMSA 4OI0A 3NMUF 4EF5A 3BFKA 3DDNA 4YWHA 1N5LA 1UL1X 3QTHA 2Z9CA 1QUEA 3MERA 2IY8A 4W8OA 4FYKA 5JT1A 4UPEA 1FYVA 3BEHA 2FW7A 5LYYA 3CX3A 3QF4B 4HUQB 1Y6DA 4AKSA 1AU9A 2PP4A 5K6RA 3ZDDA 1O87A 1RQ2A 1TIPA 3GWLA 1A97A 5CB8A 1AS0A 2BKVA 5ICCA 1P5JA 3FNFA 1NFFA 1GQFA 1E5XA 3I9FA 5J43A 1HDZA 3I9V6 4JUFA 3MIIA 2YVKA 3D9QX 4B6FA 2EFGA 1N2IA 4IYJA 3W5CA 3MT7A 3N53A 2NVBA 3UWSA 3FCYA 2R4QA 3OPYA 5BVGA 3EB9A 2YLIA 3IEPA 4OREX 1H9GA 5FTKA 1OH8A 1EFDN 1NMYA 4ON9A 1FFGA 4HX2A 3L4SO 2ENUA 5FKJA 2VSNA 3V8MA 5JH7A 1KY2A 1GQSA 4B3CA 3I9JA 3C5CA 3OJXA 4L27A 2K5UA 1RLUA 4N6HA 4E21A 2D06A 2FFHA 1U3DA 1Q20A 5ALUA 1OFIA 4PLZA 3VNVA 1MQAA 1JT9A 2QNIA 3V3KA 4PNZA 5L4NA 2GHRA 3CUYA 3C5WP 2OBLA 2AOUA 3S1SA 1KU2A 3AEUB 1UUFA 2OBBA 5DDIP 4BKUA 4FGJA 4OP2A 2NZ2A 2YZ2A 3QOXA 2ZRFA 1P0CA 4GICA 5KKAA 1NSYA 5K0BA 5EKSA 2II6A 3FSGA 4TMWA 1SURA 4AQ7A 2WSMA 5BW8A 3GJZA 4R1NA 3TQFA 3QLVC 2IF0A 4EYEA 2PKYX 1J00A 1VHQA 5ITSA 3ESQA 2H4JA 3RYIB 1GVNB 2BHRA 5KYVA 2OESA 2IZ6A 3A2NA 1UF9A 4OD0A 3OA0A 2X4DA 1TKNA 2MDTA 5FBHA 3T7RA 4J16C 4PXYA 1UWCA 3BMOB 3KSMA 4PGHA 4OAQA 1KGSA 1H6BA 4TTRA 3PT9A 1E1QA 4F6RA 2FZVA 1Z8DA 4F2GA 5KJ1A 3L1JA 5DBOA 4P7GA 1PWZA 4MRAA 4AVYA 2P3OA 1SXJE 3HKBA 5MDHA 3EGXA 4JDPA 4JR0A 5L7YA 2QZ4A 4B73A 1RKEA 4JZAA 5H3CA 5J47A 3AETA 4O33A 2XB8A 1GPWB 5JNVA 3VH2A 5KYYA 1A9OA 4Q7EA 2X7JA 2HK6A 2IWHA 1C30B 1OZAA 4DLSA 1DKNA 2XM0A 3ER6A 2CBZA 3A7DA 3KT8A 4PLHA 3TG2A 3B71A 3NYJA 2PVSA 2KBEA 5BMOA 5GM1A 5F76A 2H54A 4FMPA 1OKKA 3ELDA 2AOTA 3LCUA 4C0AC 5E9QA 2LDXA 5CLGA 4PHTA 1PD1A 5IJ9A 2CJXA 2ZXPA 1GYRA 2VWHA 3EFOB 3BGVA 5T3UA 4XPXA 2Y1DA 5SYMA 2HZ7A 3MAAC 3S1AB 4O4JA 4RH0A 3WZLA 2D0IA 4UTVA 2PYDA 3FYDA 3EA5A 2RGAA 2AVDA 3P1JA 1CULC 2BHLA 4OXYA 1CEXA 2R7SA 5A5GA 4M21A 2VDQB 1CJBA 5E3JA 1D9XA 3D2BA 4O4HB 5IUNC 5LDDC 5T3YA 3SVTA 4RVFA 4I14A 3DO8A 3GXBA 5FNVF 2BI8A 4E07A 1PP4A 2WBLC 1VLJA 1ISSA 1SCIA 5GAJA 4MVSA 4BHTA 2JBHA 2QTCA 3IB3A 3IA2A 3SYRA 2EW1A 2A92A 2M32A 3SEFA 4C05A 2QD2A 1FP4B 6REQB 4M2LA 3MHTA 3DMNA 2Q2NA 1RAEA 4AUNA 4ROTA 1D6NA 3HJCA 1KSJA 4BFZA 4TLMB 3ZOZA 4DS3A 1E3LA 4BLTA 4UVIA 4JTAB 2WTXA 5IFKA 3NHKA 1WP4A 2C2WA 4MR9A 4K81B 2DR3A 4JLVA 2B5OA 3O74A 3OZWA 2GYWA 3PENA 3LQ1A 1G41A 1ITZA 2E6KA 3M70A 4NBWA 3LGSA 1I5OA 4YQFA 1SKYB 2XNSA 4LYYA 1NURA 3JALB 2VASA 4A2WA 4MVJG 1E96A 4JB3A 1WXDA 3O9MA 2D2EA 4AO6A 4I50B 2QK4A 3AHGA 2VUIB 5TPWB 4JEBA 3NYRA 1PW5A 1KR5A 3CR7A 2W4IA 1BFKA 4ENQA 4Q4JA 3RSCA 1OPXA 4A4AA 1DMSA 3GH1A 4RV5A 1P7YA 2C8LA 3GRCA 5CDFA 5LFAA 2OHOA 4PZEA 2EIHA 3ZLJA 1FJGB 5DJ5A 3RI3A 1UZNA 4MIEA 3A2LA 2XLEA 2IE0A 4ZQFA 3UB2A 3P32A 1DC6A 4OBBA 4FI3C 3ESDA 4MUAA 3PHJA 4E3ZA 2PU7A 4QRHA 4R68A 4ZV4A 5JAUA 2YKGA 4B0PA 2QPTA 4PPNA 1FNNA 3DEJA 2YW9A 3VSAA 3FOPA 3LNMB 3FX2A 4P82A 2J5QA 2WWFA 3LI2A 5LQNA 1WV1A 5DM2A 1M73E 4Q19A 4HMPA 3QJ5A 4LMBA 2AMFA 3FKQA 1C4OA 2G70A 3BQ9A 3H2VA 5BYKA 4ETNA 5IHXA 4I1RA 4F92B 1W0JD 4LRSB 2GAJA 2WHRA 3E5HA 3ADDA 4D42A 3R5TA 2QP3A 2VA8A 2VBFA 4ZICA 4XFDA 4AMBA 4WWHA 1FIUA 4KHPB 2HMQA 1JDPA 2D5IA 5CNMA 3S2YA 3HHPA 3A6ZA 1UC4B 2G0TA 5KSYA 3MLGA 1K40A 3D8RA 4BNXA 4RA9B 5ESRA 1SKAA 2INGX 1YNOA 3TL3A 4ZGWA 1NSTA 1ST2A 4IHJA 1YUMA 4HGQA 2E85A 2GN9A 5B58C 4Q1DA 5I7SA 2TMGA 3Q12A 4DANA 5GZ3A 3HCNA 2IEYA 4MVOA 5FTMA 3WJ1A 4LZOA 3ATPA 2O4CA 3N1UA 2J4FA 4RAOA 4F1WA 4YJHB 2IXNA 4CU2A 1V6SA 5I51A 3U4MA 1Y3CE 1JQBA 2CVHA 1AN9A 2ZUFA 4IF4A 4TYNA 3Q7RA 1WZIA 2ZLBA 3LIIA 4UE3S 3CSUA 2XBLA 5B1SA 1MT0A 3DOOA 4K86A 3ZCRA 4JLWA 3PFKA 4AJEA 5JCPA 1PTKA 4HZGA 1NMQA 1KBZA 3IKMB 4IIBA 4AICA 1TK9A 3WLPA 3KZMA 2AYYA 3LPCA 2M6LA 1NI5A 4WV3A 2PQ6A 1OI2A 3T7DA 3G5TA 1P0QA 2GJSA 3MOIA 2XBMA 1UPTA 4EAQA 1NZFA 4N06A 4A2NB 2PHZA 4KO4S 1RXCA 5ESDA 2Z3WA 1EE2A 4L57A 4XVCA 2XA1A 3CF2A 2EXXA 2NOAA 1BE6A 2Y6VA 1CY6A 2KB0A 1RI3A 1KI2A 1ZOSA 5KOYA 5C7YA 1FDOA 3C3BA 3CURA 3P9PA 1A8HA 3LAYA 1TEZA 1NVXQ 2YN2A 3MT8A 2ZXWC 3EA0A 1J06A 1EVJA 5FCDA 3K1YA 3COSA 4JUBA 3DW3X 3EAFA 4TMVA 2AG0A 3PUWA 3QYPA 4KO8A 2D5RB 1U80A 3UCXA 5EINA 3T9AA 5A6VA 3EFEA 2OV2A 1IWPB 2YWRA 1TTQB 1FYFA 3FSEA 2NUTA 1YOBA 2O1WA 4N5IX 3SQWA 3JSZA 2C0QA 3SBOA 3RBAA 1FYWA 5TX7A 3DZJA 1DB3A 4ZT7A 1Y4AE 3DT8A 1P1JA 5BNTA 2REQB 1LJLA 2HJ3A 5ALWA 4WFQA 2GX6A 2F8LA 3GUYA 2RGYA 4KTVE 5DCUA 5EY5B 1AQ6A 1PEKE 3WOHA 4D0GA 4CV3A 2UYHA 1KQOA 1QDLB 2RKWA 3AM4A 3KUCA 4QGAA 1NLXA 5CHYA 1MMDA 4IJVA 4ZHQA 3GP8A 1EQ2A 1CLEA 2BKAA 2OJQA 3ABRB 3QHAA 4MW2A 4Q4CA 3SWWA 2PGXA 4S3MA 1K3UB 3BXGA 4C43A 2ORED 3SS8A 3X2FA 3AF5A 3SR0A 3VH4A 1H4SA 2OGTA 2XSEA 3GJYA 1JH8A 2F00A 1SCDA 1ECFA 5IDYA 4Y1GA 3RAEC 4N8EA 2VDMB 3GCXA 1GPJA 2R11A 1HDXA 2NPFA 1U0OC 1M1YE 2I8LA 2V6FA 5EZYF 3OQIB 3AJAA 1R8XA 3WIEA 5BRJA 2NXWA 4GQIA 3EK2A 2HH9A 5AIAA 2UZ1B 2WTMA 5F2NA 3OCZA 3E8SA 3U4AA 4KSYA 3AEQB 4DLRA 3H17A 2WSLA 1H3NA 2BL2A 4D8UA 4GWGA 4LC9A 2COKA 5TLSA 1UQUA 3S68A 4MZXA 4WZAB 1E7WA 1EP1B 4A5OA 5TMDA 2D5LA 4YH1A 3Q1LA 4CS9A 1E85A 3AP3A 2DYKA 4WCDA 1YLMA 4IQ8A 2JLZA 3WJ2A 5L40A 3FLMA 3LC1O 4LNAA 5JBQA 3C43A 1M2OA 1XK6A 4CCYA 3EXAA 4AIIA 3K9HA 3RQSA 5ALKA 3ABMC 3V1UA 2JIDA 4GM4A 4R41A 5HJEA 1ZVMA 5AKHA 5G53C 2H7OA 5H82A 4FE7A 1NDUA 1W19A 1BQ3A 5HIAA 3V5XA 1VKRA 1DDGA 2BP7A 5F23A 5HW0A 1MQ9A 4C07A 2QNLA 3ZXUB 3PX3A 3AVWA 1JTEA 4BWFB 2YV1A 3QMVA 1NN5A 4YO8A 1XEWX 2XAUA 4NQRA 4XUCA 2RK6A 5TVKA 1I7NA 1XMSA 1HEIA 2AMJA 3WTCA 1D0SA 1Z5ZA 1BMFA 4KAFA 4HK4A 5T1DB 4GNKA 2GA8A 4YJ2F 4S2UA 4XD7A 3UJAA 5I7HA 5AKKA 1YU6A 5KSPA 3ZZUA 3KKQA 3O38A 2FGKA 1YONA 1JR8A 3JD2A 2YBDA 3PZBA 2EZTA 5K0SA 4J43A 2P40A 1HC7A 1WHTA 3NBXX 4OHOA 1TCVA 4LWOA 3AB8A 4YR9A 3U7GA 4JYMA 4HDMB 3WTBA 1NTRA 5EK0A 5EXSA 4C1NA 1QLJA 3ZNNA 3KYDB 3BC1A 1IXYA 1C7FA 3QXSA 3KR9A 4RADA 2R85A 1XJ0A 3IKTA 3VR1A 4WXHA 1I1QB 5ALNA 3HDTA 3ZPXA 4X95A 2QRJA 3H4MA 3ZWNA 4DEYA 1OHHD 4GUDA 3PDUA 2C5AA 2HSEA 3UN1A 5FUXA 2WQ6A 1OW6A 2W43A 2UZ3A 3O10A 3G85A 2GPWA 3ZVNA 4X20A 3PKZA 4EGJA 1R74A 3M3PA 1LCIA 1B0PA 1YDFA 2Q1UA 1ENPA 3JQBC 4KWEA 2ETSA 4N7MA 1KORA 2EZ4A 1XYVA 1ODCA 2DTDA 1B1CA 3BX1A 4JN6B 4Q1CA 5BOSA 1RYDA 4LOJA 3A1NA 3TZBA 3VZSA 3TFOA 1DFIA 2PBFA 1OLSB 4J32B 4BKRA 5DHUA 1RMTA 2R9VA 5C0OE 1L3PA 2RAVA 2C7VA 4DMHA 1KEWA 1T3GA 1X94A 4EJ0A 4PQRA 4RSMA 1QX4A 4YROA 3TMKA 2Q3HA 1W85B 5FV7A 3IP3A 1TM1E 4FZ3A 3SF8A 2BR4A 3CWZA 3ZOKA 2J08A 4HMQA 3TJ5A 2FZEA 1LQTA 1GTL1 3D2CA 1UJ4A 4FJ0A 4PSDA 1FYEA 4D3XA 5HUHA 3LWBA 2WWYA 4CQJA 4ZCMA 2Q8QA 1N25A 1CJMA 3ZTTA 4FVTA 2ORIA 4C3EA 1BGXT 1X0XA 4HXEB 3QVWA 3PR3A 3R0ZA 3RTBA 2XTAA 1RJEA 5C7LO 2BV3A 5G1PA 4RTKA 1Q7BA 5CDTA 2ECOA 2FEKA 1OT3A 1M2NA 3CGWA 1T9GS 1TVEA 2R7AA 1PFWA 3QPDA 3I58A 4YJWA 3U5SA 1W6RA 1TEHA 3KOXA 1LSUA 1O5HA 3HCDA 1KEEB 3QVYA 1ZGBA 1H1TA 4Y2SA 1BXRB 3PL1A 4F4JA 5KNBA 5JANA 2GPAA 3T7CA 1LX6A 2ID8A 3VR4D 1BJRE 3EQLF 1N9KA 1SKMA 3GROA 1BFDA 1Z73A 1TVMA 1DT5A 5EE9A 3MCAA 2QAGC 3MGGA 1Q17A 2I0FA 2P3QA 4YONB 2GVZC 1QYDA 5FWYB 2YKZA 2Y71A 2FFBA 2H7VC 2OV4A 1NNUA 3FG9A 2QM7A 2PUGA 3MQ2A 2X2FA 3SEOA 4NR0A 3IAS6 4J91A 4QPPA 1TUBA 1NYRA 3P5BA 3T4RA 3AK4A 3D3WA 4BPRA 4PWYA 4JJIA 2HBYA 5EMNA 3QU5A 5CW1A 4RHFA 4FFBB 4J29A 2RG7A 3WLQA 4HXGA 3TAXA 2CWWA 4DLZA 3HPRA 2PEYA 2LWIA 2EG9A 4E13A 1TR2A 2Y0PA 1RS0A 5D3MA 3IL2A 1D2MA 4G2NA 3TRIA 2GPBA 5A6SB 5LJLA 4NCBA 2RGGA 2AWOA 1CGNA 3T1TA 4JZKA 4X91A 4KRYA 1O08A 3MMNA 4I9NA 2X3FA 4LWPA 5A4DA 3R5FA 3NG1A 3PVCA 5C2JB 3A36A 1QHHA 2ZRKA 3WB1A 1FQJA 4WW0A 1N6OA 4D26A 1SUSA 4Z7NB 2KX7A 1T5IA 3A1EA 2FDXA 3WL6A 1OZFA 3DULA 4KAXA 5JXIA 4AIRA 2ZIZA 5KUTA 4DIBA 3ZWIA 1T13A 1DKPA 2OBFA 1VHWA 3FYUC 5LBIA 3GEPA 1HH4A 2X5JO 3K30A 1AKNA 4JL8A 1NBEA 4DQKA 1A76A 3A1WA 1W52X 3ZQVA 3VTKA 2QVBA 1OU0A 3N2KA 4PX3A 3KZCA 4CHTA 1HT3A 3ZWWA 3K9NA 3GJ0A 4CIPA 4Q4DA 2P9GA 1B6SA 1R37A 1WABA 3MRVA 1TX4B 5AK5A 3CNOA 1DEHA 1Y48E 2ZB4A 1RXQA 3PNSA 1XZDA 5CDSA 3QFFA 2WM2A 1MT3A 1ZY2A 1N8SA 3IURA 5DGHA 3W5IA 2HV9A 1FS5A 1OAAA 4QHSA 4HNSA 4G36A 3G02A 3LX6A 3CCFA 1W7AA 5G02A 2NLOA 1XX6A 1RE0A 1QVZA 1SC3A 1MB2A 3Q9SA 3MWFA 4BEJA 1E2HA 4YFYA 4HX9A 3ORHA 2OHXA 1P9LA 5K4GA 4RDAA 1XCGB 4WKCA 4DRYA 1E79A 4TUYF 2GF0A 1S0UA 2M9MA 1H0SA 4JHLA 4EBFA 1LVGA 2PIDA 3AOEC 4ARIA 1K9SA 1M2FA 3W04A 5EI5A 2NP6A 4OI2A 2VPQA 3L41A 4HWKA 3TE6A 3P20A 4KE8A 4UVEA 5AFSA 4EG0A 4IRXA 3CXRA 4ZOLA 1CQJB 1OJ7A 1G5ZA 3FB4A 3IC5A 1UAYA 4BQNA 1G8YA 4A1FA 2NSJA 3K09A 3LCJA 1LC3A 5JHGB 1BR4A 3GVCA 3BIOA 1QRAA 1I2CA 2GILA 3QXGA 1WLSA 4IQ0A 1H5QA 1F8FA 4BEWA 2X0RA 4UCXA 3LTEA 2P5SA 1OZHA 3M6MD 1FP6A 4CF6A 4MPPA 1CQIA 2WVAA 4L74A 5AOAA 4I5GA 1XMXA 4Y2PA 3VR5H 1ZGGA 2XDYA 3EXIB 1FS4A 3BFXA 3CQZA 1X9GA 3HXQA 1YDEA 4YAGA 2GOYA 2BZSA 2PZEA 3H2HA 4ESEA 2CV0A 3C87A 1PI3A 3LX4A 1SXJC 4RK5A 5BXQC 1WDLA 2M2IA 1AKVA 4A4DA 1GTMA 3O8BA 1BCSA 3QBDA 2ZK7A 2PMCA 4JLUA 4DNOA 4L4RA 2JARA 2GD6A 5D87A 1Z13A 1CUDA 4C7XA 3NXKA 1PYGA 3VI3B 4QVKA 2X0IA 3SM3A 2IXGA 2W2TA 5EJEA 3EVNA 1RZRA 1ORIA 4OLAA 4H1TA 1ZZGA 5IAJA 2NQ2C 4YJKA 5ICFA 1LNQA 4KEAA 1KDRA 3LP8A 3UAGA 5CIVA 3O0TA 1X87A 3THWA 5CNIA 4I55F 2FPXA 3PQ5A 2XA9A 1NW4A 2JIMA 3CCCA 2QSJA 2ZJ1A 4TYYA 3CUUA 3CRVA 4P58A 4GYJA 1U0BB 1OFGA 2DHCA 2CFCA 4U5DE 1G1AA 2RCYA 5DT9A 4HNRA 4C89A 2WZDA 1Z34A 2ZR0A 3MQ4A 4CIXA 4GWKA 1TJ5A 4H1HA 2DTXA 2C5EA 3M1AA 4O6MA 3G0CA 2IOFK 5HEKA 3QOWA 3W4JA 4FGWA 4RIIA 4DG5A 2AX4A 3JYHA 3PRHA 3BMQB 4KQJA 4F56A 4P8RA 3KUUA 2IU3A 3HLKA 4F5DA 2YL7A 1TLTA 4BZZA 4AN4A 2ZIUB 4G86A 1QIGA 4TRNA 4JRZA 3IT3A 3Q7EA 5CB4F 1XTIA 2WL8A 4OJKA 4F4HA 4N7JA 3KJFA 2BE7A 3UOWA 3U9JA 2JVKA 4RGYA 2O2DA 4B35A 2VXBA 1D4ZA 3KL2A 5K51A 1DWUA 1I6MA 4ID3A 3DTVD 3KLNA 4XUDA 2A9FA 3IHWA 3BE4A 1YDIA 5EG5A 4NEHB 5KKCA 3FOBA 3L92A 3OOWA 1IN8A 3EMBA 4AS1A 3UXYA 2YMPA 3M2PA 4PGGA 4BEMJ 1B15A 4FNOA 4D4LA 1JFTA 2PGNA 1LTQA 2UXCB 3SKVA 1D2EA 1R3UA 3ZYCA 1FB5A 2PA0A 4RMJA 3W9SA 3B1ZA 3FDZB 1J7JA 1XVAA 5FDFA 3L6DA 3SQLA 2WICA 4R1SA 4U0KA 1YH3A 1U0JA 2VOEA 2PRIA 4B8WA 4KK3A 5JAHA 3IBCA 1Y6GA 1ZR2A 3T7SA 2QN2A 3SJUA 5CCEA 4R1QA 4LXYA 1JHVA 3RRZA 1VE5A 2Z57A 4PU0A 2ZTMA 2CYBA 3E9VA 1IEVA 3BGOS 1SIWA 4YECA 4FMCF 1AUXA 4J30B 1KU0A 4MCHA 5IHPA 1TTTA 1ZD5A 3BA1A 3A3KA 1Q7EA 4M89A 1YHYA 3NVMB 1BXZA 1YBHA 4X7RA 1P4RA 2YCBA 3UGQA 2D8AA 4D80A 5KOJB 4PYQA 1O97D 1TE2A 4QRIA 4UHDA 2WQ7A 2VK2A 2YH2A 2Z08A 3C6ZA 4ZLDA 1X39A 3AF2A 2HFJA 2EKPA 1FBNA 2Q5CA 2OWEA 3Q72A 3D4BA 1ZL0A 4H4CA 6YASA 2GBIA 3VJRA 3IQIX 3IEIA 2BBTA 3GNLA 3RSOA 3PRJA 4TKUB 1YZYA 1C02A 3C1TA 1OXKB 3R44A 3RYCA 5FLKA 3AVTA 2ZYSA 1P74A 5GTDA 3H11B 2Z1DA 1Y8QA 3MF4A 1JSCA 1ZITA 3K33A 5DNVA 1DOAA 1AF7A 4GP9A 1ORTA 2NTNA 2B5VA 2P67A 1OIXA 2XTZA 1RI5A 1FRVA 3PDCA 2OO3A 4G0QA 4M22A 3N0VA 1RRGA 3EXG1 2R1TB 1DINA 3L8YA 2FZWA 1YRAA 1A7KA 4BJ6C 3U56A 1ZKMA 1K6XA 3OCWA 1I36A 3E48A 1I51A 1SVMA 3P9ZA 3GGDA 5BOVA 3IP8A 5C7OO 5GONF 3HKEA 4GL4A 1O6GA 5JS1A 1XKQA 2QLFA 3VC2A 1CJUC 4BO2A 2OP1A 4DFDA 3ZZMA 5JH7F 3SX2A 5FLYA 4G8CA 4XWWA 1XXHE 3H42B 1SCAA 1DQPA 1OI4A 4D8YA 4XVUA 1MX5A 5KYUB 1YAJA 1YB5A 3U0BA 1G4WR 1NUAA 3PL5A 2VJDA 4I46A 1EG2A 4L5CA 5DLPA 3U7IA 5EP4A 3D54D 4WEOA 3D8UA 4BNVA 2KYHA 2BGUA 4BAGA 3KV3O 3U4QA 2CCJA 5KB3A 3AVXA 5B1BC 2IXDA 4MVJH 2YNMD 2O3RA 1RXSA 3HDYA 4KG7A 5K0EA 3LOUA 1DZ3A 3V5YA 1XZBA 2RGNA 1OXBA 1QPGA 3JXEA 1ISMA 2H07A 2G9RA 4FSHA 4DBQA 1QORA 4UPDA 4AJ9A 5LMUB 3TW8A 1VKHA 4M36A 2LDBA 5AR1A 5ALGA 3HJBA 4FINA 3W8IA 3TSZA 3A6EA 4RKQA 4RD3A 4KJZA 4UCQA 1LKXA 4B34A 4DLVA 3KKLA 1TYEB 1Y98A 3QEJA 3KZXA 4UNIA 4N3CA 1YJBA 1EZ4A 5AYVA 4MI6A 2Q8NA 3AIMA 3RHZA 2EKLA 2PL3A 1FZTA 4QU9A 3UV7A 4HQLA 3DXYA 1NI4A 5AHXA 3P0RA 3RG2A 2RONA 1XTJA 3WHPA 1T9CA 1ESZA 9GPBA 4CV2A 1O96A 2W4BA 1QYIA 4UAJA 1VKZA 4YV1A 2HWYA 1H2EA 1EJ6A 4GR4A 3H19A 1I7DA 3FFTA 3B29A 3NJ8A 4B6JA 3M83A 1CUWA 3G2HA 2YHAA 4FXPA 1U2DC 3M2TA 5NLLA 1X1SA 4UXJA 3LQ4A 5CVCA 5LUBA 5K0NA 3QX3A 4FWVA 2VUTA 2H1HA 2XM4A 4Q7KA 1CUGA 3UGOA 2PYIA 4EB0A 3MCUA 1S1MA 1AUQA 3QUTA 5EPOA 3WO1A 4HD8A 4GX5A 4XIJA 4JSTA 4WFKA 5BQFA 2C61A 3L93A 3PC2A 4DCVA 1IRXA 5FFFA 4O4JF 2QHXA 4QOFA 3HTKC 1EFKA 4ZTZB 1ZXBA 3X1MA 1U63A 4PQEA 3IRUA 4LSZA 1FDVA 4JBHA 3FVTA 2HO4A 3FKJA 3T54A 2XE7A 5HILA 3BG5A 1VIDA 2A8YA 5THXA 4ZODA 3RRNA 4ANFA 1CUXA 2P41A 2PO5A 2HMSA 3PNYA 4X00A 4JK3A 4WBSA 3SZGA 2OAGA 2DHRA 4QYWA 1KRWA 1E3MA 2C58A 2LUOA 1CU1A 4G0ZA 3EOBI 4QOEA 2QRNA 4BO6A 4NU0A 4XTRA 2GHTA 4GEKA 3S84A 1MEEA 3J7AC 1WG8A 1C3EA 2V4ZA 1SXPA 1MB3A 1V5IA 2DSNA 1OR8A 5BW6B 2Q3LA 4FN4A 3BDAA 1Y42X 2A4KA 2ZCVA 3JZ0A 1V6CA 1P61B 1OD6A 2Z2KA 3SJAA 1IUPA 1WXFA 4FKBA 3L79A 4PGMA 1V71A 1INLA 1JG1A 3OKCA 1AH2A 1QP7A 4A91A 4MS3B 1DOVA 3FTNA 3UA4A 4OB8A 4X66B 2FETA 2F1RA 5E2BA 1JBQA 5DH9A 3KUDA 4CG0A 1GXSB 2WJYA 4FQ8A 4XEFA 4XEHA 4E7PA 2O54A 3B9PA 4ZO8A 2O57A 2HR1A 3ZHCA 2VYVD 1P2SA 3TN7A 1GPUA 1GPAA 3VVMA 3MT0A 3RVSA 1FTQA 4JFRA 4AKHA 5DVWA 3WLMA 5CI8A 4OQ4A 1KERA 1ADGA 3TNYA 1QZUA 1XVTA 2QYTA 1LBEA 4RQBA 1KI6A 2Y67A 3MA0A 1RAGA 3DWFA 3O3NB 4N0QA 5B6PA 4J49A 3QA9A 1NOKA 1VMIA 3B9BA 4II7A 4ZU6X 1EI7A 2YS7A 3R20A 3RIHA 1ADJA 1F9EA 4ZK6A 3U49A 4U7DA 1KP2A 4U3JA 4PAOA 4XPIB 2C88A 2WG0A 3WRXA 1JIKA 3DEKA 3HR7A 3MS2A 1XAIA 2ZS8A 1X7ZB 3AESA 3AUJB 4LHSA 4OSPA 3W2TA 4CKBB 2NU7B 1LNZA 1M6EX 4XKJA 3KH2A 3SZRA 5LR6A 3CT6A 3F2VA 4BQQA 3BPSA 4V2UA 5KAPA 2BGMA 2ENWA 4BO9A 5CU7A 1S3FA 5KDOA 3GEIA 2HT6A 1NJFA 4I1UA 3WLIA 3OE1A 4IOMA 2ZTLA 4R2HA 3R76A 2LVBA 3UV3A 5CT5A 1N6RA 3W3AD 3PEEA 2GMWA 4TLLB 4OHCA 2NXCA 4DWOA 3FDIA 4IOLA 1PR0A 1KAEA 4IVQA 2MSEB 3QEOA 5B7PA 1WY7A 4IHJF 5F64A 5DW0A 3FWHA 3D1VA 4BO4A 3D6NB 1THZA 4DXHA 1U2RA 3VO1A 3AIOA 2GFIA 1CS0A 1MNDA 4EUFA 1K7SN 2JHFA 3FAJA 2BHSA 2OZVA 4HXYA 3OJCA 4K5QA 3LLSA 2JBAA 2W8BB 2XYRA 1QDUA 1S9HA 3BD8A 2BEJA 3MFNA 2R4TA 5BNIA 5IY5C 3LCVB 4R98A 2YZ7A 3CINA 4EUEA 1H2HA 3GC6A 2P2LA 5NULA 2R5FA 2G4VA 3ECSA 1D4AA 1H4TA 4EATA 2DFVA 5DE3A 2PH1A 2HHHB 4C76A 5T7BA 4BLWA 4N0MA 4BUZA 5T6BA 1SBZA 4PPYA 1VPTA 3AXTA 3HK2A 3A4MA 1ZQ9A 5EWMA 4EVSA 5BN3B 2JH8A 4NMWA 3WMRA 1BN7A 2OFFA 1DEKA 3H3JA 3QVJA 5EPUA 3URMA 1Z47A 3ACCA 3ND7A 2IDZA 3LPNA 4AY3A 1QVXA 3FUUA 1YKSA 1JZTA 1RCUA 1D1SA 4MITA 5A3JA 2Z1NA 4F8YA 2XA2A 4ZEWA 3UWOA 1ZCFA 4TTSA 2IPMA 3EIHA 1MW8X 4IH9A 2J8WA 3OTIA 4Q4LA 1VLLA 2DLDA 2HNAA 4NZMA 3BIWA 1TQ4A 2QE6A 2ON6A 1CR6A 1U31A 2ZCJA 4WJKB 4MS2A 4PYJA 3TZHA 3DUFB 4E11A 4B9EA 3VZCA 2W6OA 5LP6A 1MO4A 1IEWA 4J4TA 2J3MA 5KWSA 2PRJA 4WNYA 4JKVA 2CFIA 4WK2B 2M4EA 2O7RA 4WBXC 2RGBA 3CEPB 3ON5A 1DI0A 5M34A 4M1TA 4D6PA 4EFKA 1NBIA 5DI3B 2J3KA 4DMUB 1PJRA 1ATZA 1P6XA 5L4SA 4WA7A 1G59A 1MO6A 3C3YA 3HDVA 4IGIA 2GM3A 1I8TA 3GF4A 4GXQA 5KO2A 3A6KA 3O8QB 1SUAA 3ESCA 1EUQA 2B8WA 5TMBA 3FPGA 2OSVA 4KNWA 5IUKC 1NC3A 4DG9A 1L8XA 1X7XA 3C8GB 3F7TA 5F1KA 1WSWA 4ZHQF 3DH0A 3BXPA 1RBYA 1NOIA 4BNMA 5E4JA 3EJWA 1UXKA 3HPQA 2FFRA 2DOKA 1UODA 1XWWA 2IHNA 3QXJA 4JI1B 2O8NA 3GJ5A 1DUSA 5D91A 4DJTA 5I9NA 2Y3DA 3KK0A 2CMGA 2XQVA 2CCGA 4YUWA 2BI4A 1U2PA 3VVBA 5DEOA 5KMGA 1SB9A 4MMZB 3LK7A 2NUPB 2VDNB 4ZVNA 3R4CA 1ONSA 1LV8A 1AV7A 3B1VA 3KR0A 5K3FA 1UEIA 4AJKA 4TSFA 4FZ5A 1YJ5A 1Z6AA 3I8OA 4NBTA 4WN9B 4JC7A 4W1SA 4AJOA 1ZN7A 2B2CA 3TX6A 3GLUA 1QCDA 2WSIA 3NRBA 3T3NA 2AWCA 1IONA 2YRFA 4NMXB 3FW1A 2H85A 1I14A 5DYWA 1RPAA 4LG1A 3U16A 2BEKA 2IYEA 1E7YA 3KEFA 3QXXA 4MW9A 4DBRA 1SBQA 2XCSB 3ZGYA 1EVLA 4B3FX 4I5EA 2EFCB 1WCIA 4KN8A 2PXCA 1T1SA 1UIRA 5B2EA 5LA6B 2VKQA 1C1XA 3I1JA 4R16A 4CKXA 3OJEA 1OLUA 2EIJC 2ASRA 2PR7A 5DEIA 4K9MA 5AI0A 4QSMA 3OQ6A 2GK6A 1X6VA 4TYMA 4G6ZA 1OMOA 4PNEA 4EPRA 3SIRA 4YCJA 4QOIA 1I4LD 4JIMA 5K3OA 1GTVA 1M6TA 1CY0A 3K15A 3MJ4A 2YUIA 5T6MA 5IULC 4CF4A 1FMWA 2VF5X 1B43A 3PHIA 4ZT5A 4P3YA 3AFGA 5KQSA 4AG5A 1JR6A 5JEEA 2FUG1 2J5XA 5AVRA 5HS6A 4TZ0A 2JJQA 5E9JA 1UOOA 4R2LA 2WZBA 3NOQA 1CQPA 1U0TA 4YIHA 2QUAA 4YMWA 2I67A 1RBQA 2ZI3A 2I78A 2QTLA 2GJ8A 2POQX 1GNPA 1MNAA 2XUAA 2OOKA 3UCFA 2JIPA 3FB1A 3DGEC 1S4MA 1U02A 1PUIA 3ZHXA 1TEXA 2ZUEA 3KPVA 3OLQA 4Q4HA 3UAZA 1G60A 4A73A 5SYNA 3DZDA 3C8HA 3B1WA 5FPTA 2R87A 3LY7A 5BSRA 3FA2A 3SKYA 1XLTC 3KTAB 4NY1A 1RXUA 2A9PA 3T7AA 2FP4A 5CFPA 2VK1A 4ZDKA 5I9SA 3FTPA 3W05A 1IZ0A 4HXFB 3AI2A 4DHWA 3WYNA 2XHEA 1CJVC 2A1TS 1C0IA 4TTQA 2NXNA 4BX9A 2RHCA 3NX4A 5AM5A 3RAGA 1PTJC 1GN8A 1R10A 1VJ5A 4LFAB 3L7DA 4MWEA 2CC2A 5I9MA 4AFNA 4HPXB 2QV7A 3KELA 3BMNB 2ZXRA 2G25A 2HRBA 3TD6A 3DM5A 4DT1B 2QTNA 3DP7A 1GTRA 3BD6A 5FUVA 4CGYA 4YMLA 4MR8A 4HEA6 4TKVB 5HXAA 1KJ8A 2FCRA 3UYKA 4KVFA 2CNBA 1C17M 1FFAA 4QDOA 3E4CA 1MC1A 1R4NA 1N8TA 2WF9A 2PD6A 4RPCA 4KR2A 1T36B 1LE4A 2YOFA 1X0VA 2XYGA 1V25A 4JEUA 3LVRE 1O5OA 2PQ0A 1RXYA 3EMDA 4PSAA 1BHO1 2OD9A 1M1XB 3CR8A 3WWZA 2PV0A 3TTXA 4RK0A 1VYTA 2YWGA 2Q0QA 1GAXA 4Q9HA 2Q6TA 2PL9A 1BE8A 2C9MA 1DMRA 4DNPA 1HLGA 2AFIB 4OXXA 1Q2UA 3ABQB 1N2BA 5CAEB 4OB6A 4HQNA 2BF4A 1LGYA 4QL3A 4M9RA 4K9RA 1N9GB 3JASB 2LNDA 5DHFA 5KTPA 2ZSUA 4RHEA 5EIOA 3B1YA 5EJ4A 2Q00A 2WZFA 3FFWA 5GGYA 4CFYA 4D9JA 1ONNA 4GX2A 1GUYA 1KAGA 1HW1A 4OQFA 1G8GA 3DOEA 3AF3A 3NXSA 3EGIA 4O2BF 1FUYB 1QF9A 2QN3A 3T3GA 2OFOA 3DZHA 3AV3A 4I2NA 2HD4A 3DZFA 3DWEX 1JJFA 2HTFA 1G8XA 3IQDB 3TTVA 5KTMA 1YS6A 4BKQA 1OCCC 5CJ2A 1Y9DA 1F60A 1MXFA 1DJQA 1QGZA 3T6JA 3F3SA 1SOUA 5P8WA 1NQAO 1DWQA 3G9TA 2WF6A 2P2CA 1NE7A 4HFKB 2NZXA 4TXJA 1HDRA 1SD5A 2FRDA 3FJOA 4DDWA 3G1WA 4NULA 2O8DA 1G18A 1HQKA 1PZNA 3IPLA 2PQ2A 3FY4A 3N86A 2BJHA 1ETUA 2PMDA 5HFAA 4CUZA 2E18A 1T25A 1QHSA 3FFXA 5ERGB 2N0SA 3Q8KA 4LDKA 4LXQA 5E6UB 4MS4B 3SYNA 3ILYA 5CNKA 4ARSA 3GUZA 5JY6A 2H7XA 4B3IA 1WZ2A 3OAAA 3F0TA 4R9SA 4NMMA 1G8JA 3MD9A 3GP5A 3RS8A 2FUEA 4LHEA 4RVSA 1N2SA 1JDUA 2FZGA 2C1ZA 1VPLA 3T1NA 3L4EA 3QMKA 2HFKA 4WLEA 1GSIA 3F4LA 1VLMA 1VPVA 5G1NA 2HPHA 5BT9A 3PDHA 4ED9A 2YXPX 3I5YA 2OV1A 3L8EA 3GLIA 1EH5A 1YACA 4REOA 1XQVA 5JI2E 2J9XB 3VXKA 1A9QA 4BJTA 4NLLA 4R54A 13PKA 1GITA 2DQYA 2VCHA 5BPFA 5INTA 4WERA 2OUKA 4G9GA 3CY6A 3DL2A 3K6JA 2ZWAA 3E9YA 1KIMA 3TNLA 4RIHA 2IGTA 2GJ4A 1VKJA 4YN3A 1UJ2A 2GB4A 2IDMA 2IYTA 2I4OA 4R8LA 1R66A 4DNXA 3REQB 3RS9A 1S2MA 2EF0A 2WAOA 5EP3A 2VPIA 1DARA 2IEGA 1LXCA 3VBEA 3K8YA 3AR8A 2FG7C 1DVRA 4IAOA 1G6OA 2J9RA 1E6KA 2Z04A 1EVQA 3QH4A 5E7JA 3JQEA 4LF5B 1H0KA 2Q3JA 4FOOA 1E61A 1KNYA 1X38A 4Y67A 3HUDA 3LT0A 3GRUA 1FXUA 4V2IA 1SKBA 3MJEA 5HYVA 1NHGA 4A26A 1EUDB 3U37A 2I6TA 3SK0A 3AFOA 3HSYA 2GHIA 1YKGA 1LJ8A 4JBGA 3NQ41 3OU2A 3BKWA 2EP7A 4AM8A 3HCBA 2MYNA 3PTLA 1JQJC 2W45A 4BMXA 3I9MA 4EW2A 4JOQA 4H27A 4ZGBA 5F12A 4V0MA 4RYDA 1Z2PX 3U09A 2EAUA 4MPTA 5TF4A 2BMEA 5JZBA 1FL9A 4DCGA 2ZVPX 1QNLA 1C41A 4FCVA 3UQZA 2IXFA 4U5BE 1UJMA 2HUNA 2E1PA 3DT6A 4RK6A 1IN7A 1YL6A 3QBEA 4IDAA 5F78A 2B25A 4LNUB 1B4DA 3E23A 4DVGA 4RK7A 4CSAA 3VU3A 3MWJA 4QQFA 2XWQA 1EX7A 4G7OF 4DLLA 2HIAA 4F4FA 5BN4A 1FR0A 1GGMA 1T2DA 5KVSA 4PFSA 2FMXA 3FGZA 2YASA 2CBGA 1UAGA 4KXVA 1HNZB 3N2YA 1P6UA 5JBNA 2XZOA 4XM1A 3DAPA 2WZCA 4ZEMA 3H9EO 3ZK8A 5HV9A 4CDNA 3NYLA 4FE4A 5E1BA 3HM2A 1G8PA 4PBSA 2B4YA 2EKDA 2NVOA 1PQYA 4PGAA 1TK3A 1UBKS 4HRAA 2H92A 4B46A 3KYCB 5CPFA 4IRUB 3HL0A 4HLQB 1EIWA 3RK0A 1QFZA 1TD9A 1O0CA 1U2SA 2FSPA 3BILA 4DR1B 5FBZA 2HNBA 5AQ1A 4MUFA 3IQHX 3BCHA 1CFZA 2JD2A 3CKMA 3U31A 1B6GA 4ZFNA 1YV9A 3TB6A 1IWBB 1DP4A 1U2TA 2YWAA 4ND2A 1AZLA 1PT6A 1CLUA 4WK0B 4OB7A 3FKSA 4WXPA 4G5XA 4EX6A 3G5UA 1Y8ZA 5DGXA 2O4UX 3O39A 2XW6A 2A6PA 1OLOA 3ZCVA 2Q4BA 2RBEA 4NABA 2RC6A 3AINA 4DDUA 1YZNA 2O05A 1TJ3A 3OOHA 4QC2A 1V16B 3OLWA 4C3UA 1XKLA 2IS4A 4UU8A 1NW3A 2WPDA 1YA4A 2O1EA 1CUAA 3CF0A 5ICMA 5DTRA 2E48A 2BFBA 4GG1A 5DU2A 2IP4A 5JVDB 3S70A 2BFDB 2PVCA 4F9EA 1J8DA 2I87A 4CIWA 1NF3A 3ORSA 1PFQA 1HE4A 3LZ6A 7ABPA 1ISRA 3MJFA 3TGWA 2YMLA 1OAOC 2PUVA 1D6JA 4FAPB 4LE1A 1XD2A 3EPVA 1SUEA 1DUIA 3IMGA 2Z9BA 2P2ZA 4HMOA 1P5HA 4RVDA 3URKA 1YC5A 4BMZA 2BIFA 3ZLVA 3HSKA 2PT5A 2PRZA 1V26A 2R8OA 2PJRA 1ZRMA 1XN1A 4P7FA 1Q1QA 1CUZA 4FOPA 1ZW6A 4GRIA 2P0YA 4H2DA 2X4GA 4EFNA 4CLHA 1UKEA 4RHYA 3F7NA 2GKOA 2H4YA 3T06B 4JEHA 4U9IS 4P86A 1V11A 1P2GA 1GUZA 4EDFA 4N1AA 3OMXA 1V7PC 3KYIB 4UTZA 4O02B 5CA1B 2UYQA 3EBPA 5JYDA 5AI8A 4YYEA 1P9RA 4K9LA 1QIKA 1Z2OX 3TE7A 1VG1A 3P0HA 3TLZA 3KHSA 1PZGA 3PG5A 2R7KA 1L7XA 2H9AA 3I2HA 4POAA 5EJAA 4U00A 2GZMA 1JYFA 2R84A 1U0LA 4E09A 4V0QA 1N36B 1V3QE 2EIXA 4MYDA 2Y6UA 2COEA 2ST1A 4MQ4A 4MTGA 4K40A 3OQNA 2C5HA 3KU4A 4QI0A 1QZXA 4U7FA 5HRAA 1EFAA 4NNJA 4JWKA 4L0MA 2P2DA 2WP0A 1ORYA 2DF8A 1HDCA 3DFKA 4DEVA 2PT9A 5FOQA 3CE9A 3TCKA 1VOMA 1NF8A 4O59O 3PQ7A 2X40A 3CNEA 1ANKA 4UVGA 4AQYB 3HZHA 4G0NA 2KWIA 3SEQA 3USES 2IVFA 4LHXA 3THRA 3IAUA 4KPEC 4MYUA 2FR8C 3V8QA 4IJ6A 4K28A 4DCTA 3ITKA 4ME6A 2HMTA 4ESOA 1LFAA 1OR3A 2FUKA 2YLGA 4I4CA 3M1YA 1ZUD1 2IU6A 4IDHA 1QSPA 4FMDB 4ZCRA 3UHPA 4GIBA 1DX4A 1NTOA 2E49A 1N7GA 2W6QA 5PNTA 4ZVSA 2IXAA 2MSWA 3I37X 3L07A 4GHWA 1UMCB 3MTBA 3VH3A 1GU0A 3U1TA 1GNRA 2GA0A 2CXOA 4AP6A 4HVCA 1M83A 1QTQA 3F5SA 3GA5A 3WRWA 5HZMA 3T1YB 3X1ZA 3AEYA 3B89A 5DHTA 2J7PA 4IV0A 1I13A 2A9QA 4FSDA 1O97C 1VLZA 3D7RA 3V4PB 5HR5A 2IYZA 3O6XA 3VJMA 4CBVA 3NC4A 2WWHA 3G2NA 1JAHA 4H6XA 4EO4A 4TT3D 1U6IA 2YHUA 1BXKA 3P9IA 1R8JA 2ATIA 5J63A 5LMZA 1GNQA 2A3RA 2FSVC 4YGXB 5ICGA 2JFFA 3AIIA 2EZUA 3LQYA 2F17A 4TWBA 3ER9A 1UANA 3VAAA 4A36A 4O0MA 4WAUA 1UH5A 2AJBA 2IM8A 1R15A 1QC5B 5C52B 7MDHA 4K7BA 1H8EA 1KS9A 4QBGB 2MSLA 1IUKA 4HLUC 1M1UA 5JJBA 1D2HA 3D7LA 4OUKX 2CE2X 3CVJA 1ZM4A 4GGMX 5AJWA 4LSMA 1HYGA 2JGDB 2P4UA 4DLYA 4XARA 5HPYB 3ZWMA 4EJ2A 3BL8A 4YJ3A 221PA 3OTWA 5JPDA 4LLEA 4H4EA 3BGSA 4MKIA 2A1DD 3KVVA 4E70A 1NDHA 3OZVA 2VAXA 3STHA 4BNJA 1GAEO 2YW2A 2VJYA 1NMEA 2VJKA 3OC6A 3JQFC 5HX7A 2F3PA 7REQA 4LGMA 2EHJA 2VQ6A 1IY9A 3ITNA 3IEUA 3IX7A 3E9RA 3BIJA 1O95D 3AW9A 3UKDA 2GPNA 2Q7RA 3IP5A 3JTMA 5I8PA 5B1EA 3CSKA 2AWYA 4C6RA 4BUCA 1SCQA 3B60A 3BBPA 3WGGA 4UARA 3I23A 4XGRA 2XXAB 4BGUA 3FCCA 1F4VA 2YNMC 1FTGA 3U6BA 1GG9A 3JCUQ 2OTCA 2Q6OA 4KXUA 2VAVA 1X7YA 4DR2B 2RJNA 3RIPA 3LV8A 1MJGA 1S2NA 5EPEA 3V7UA 4YTEA 4V03A 2WWWA 4P0PB 1EIZA 2BEVB 4C7OB 5F35A 1R6VA 3I64A 3RFVA 4HYEA 4BMDA 1Q0MA 1YRHA 3V7YA 4DA8A 1GS9A 2N1MA 3DO5A 3ANXA 3MCWA 2JFQA 5K8TA 1T1JA 1XK7A 1EA7A 4L5AA 4MW1A 4TTAA 4UOQA 1TF2A 1K8RA 3MW8A 4GI7A 3FCSB 4L73A 4M6WB 3QP9A 1EFPA 3M49A 1ORWA 4RYLA 2R25A 5KOHA 2G1UA 5TQVA 2QY6A 4QFCA 4AKTA 1IDOA 4ZPJA 1RC0A 2WVQA 4X93A 4BRZA 4IXTA 2AQ8A 2XCQA 4W8KA 1GKIA 2V26A 1XWIA 2PSFA 2XVAA 4FWBA 4R69A 3EIXA 4K9DA 4BVHA 1KC3A 5HF8A 4Q39A 1NSFA 4EECA 4L9RA 3JVEA 4F8JA 4JP1A 4BLPA 1EFVB 3UR3C 1MXHA 1N1CA 2R6GA 2QX4A 3EFHA 2REBA 1DBPA 5DO9A 1RU3A 3TFQA 4KE9A 3HXPA 4LRYA 4DMMA 2IA5A 2GJAA 5MHTA 2QRVA 2AC2A 1Z6TA 4M9UA 3F7MA 1AQYA 3U44A 1QU2A 1OYOA 1X9IA 3F6RA 3ZWOA 1LQUA 3VPDA 1OV6A 1II8A 4MQLA 4FCCA 4KIGA 1GGEA 4YX9A 4YREA 1F2DA 1FMLA 4GI1A 1IPEA 1RM0A 5AQEA 3RUPA 3R7NA 3FPFA 2AK2A 2EP5A 4FMBB 5ES3A 1B2LA 2GAFA 1W94A 4MV1A 2QTFA 1E2NA 1SBHA 5M29A 4DJEC 2AMLA 3WMEA 4NC3A 4OU5A 1ADYA 1GL3A 3ENZA 4MRSA 4DDMA 1R0ZA 2XGJA 3Q9NA 1Y3FE 3N05A 3H1EA 1PJQA 1PQWA 4H7DA 4QGHA 4E4YA 2HDOA 4C3BA 4IJQA 3HUEA 4RZSA 1IBLB 2IY9A 1E2GA 2ZYWX 1C03A 5TY0A 1BAPA 4BPMA 3T95A 3Q7LA 2W2LD 1M2JA 2FLKA 2W2PA 2B4TO 4ZALA 4FEAA 1IL0A 1O4VA 3EXHC 2J9BA 5LZ5A 1FVHA 5BWLA 5FNVB 4KQEA 3M15A 5JRDS 1YA8A 2W2NA 4PLPA 4LGCA 3W2FA 3HCWA 1UBLS 3DDSA 5KEIA 1L7OA 5GINE 3E03A 3TLGB 2OK7A 5D3QA 4DV1B 3ASYA 1GCAA 1M10A 3BJRA 3F3MA 1NONA 2KBFA 2O3TA 3N6XA 5B1HA 2IUUA 3A06A 3OZIA 4EJSB 4WABA 3C8ZA 3ZI0A 2GUWA 2DHQA 3E8MA 1OBFO 2FX3A 4RQUA 1Y3BE 2FPSA 3GMSA 1KZ9A 2AS0A 5E7MA 5EWLA 3L9WA 3JZDA 1E5VA 2Q5FA 2ZJZA 3K6SA 3IOYA 3KXDA 2I2XB 3AKCA 4AYXA 3AR4A 3A1UA 1PG2A 3Q3GE 2HHCA 4E5MA 4EKWA 1T5SA 1JL3A 1ZWLA 4LJLA 2ZI4A 1G6HA 2CXRA 2BM9A 3ZWYA 2XNCA 2Y9PB 2A35A 4F11A 5AW1A 2DSTA 4AX2A 3EYAA 5DXFA 4HAIA 4KMMA 3QVGA 4BRWA 1LSSA 2IHYA 4BGVA 2WYHA 1BVUA 1YOVA 1D1PA 1R6TA 1A7VA 3NAZA 3LLKA 1KKLA 2PFGA 2OHFA 4YAWA 1GM5A 2YQ5A 3F1LA 2YUTA 3T61A 2P0EA 3AG2C 1C14A 1VTKA 2I9PA 2XHZA 3ET5A 1I4YA 5L7TA 1UT5A 5AW8A 1VXRA 2B21A 3RVZA 2CLOB 2GEJA 4JI0B 3PX2A 4NNPA 5TGZA 1SXGA 4NZYA 2PBZA 3AU8A 3FWPA 3SZ3A 3GGSA 3CONA 4B6PA 4QTTB 2IYXA 3UHFA 1W9MA 5JZSA 5JNWA 5CIQA 3PB3A 4E15A 5F3DA 3K35A 3JTEA 3LDGA 4U2GA 4GOND 3KVOA 1POXA 4ER0A 3GEEA 2HF7A 1PDVA 1W2HA 5FL7A 4GBED 1GNLA 2GCPA 3EWNA 2NVUA 1N7HA 3HN2A 1J8YF 1H23A 1P0FA 3EZHA 3G5MA 3QBVA 2RIRA 1WVMA 3MPUA 3BL6A 1BWPA 1MCZA 1WXGA 3UH0A 4HI0E 3GIWA 4IZ6A 3QUQA 1KP9A 4Y2GA 3H1GA 4C4XA 1F51E 3EVFA 1JSRA 4X1KA 3JSEO 2FP3A 4PK4A 4IH4A 1ZU5A 4OA5A 1N7IA 3P2EA 5I3CA 1BNCA 3A05A 4LOIA 4KQCA 2HA3A 4O2RA 1O94D 4CETA 5HKKA 4Q9KA 1AKUA 4WZBE 4FIZA 2APJA 2O2GA 2GARA 3QWBA 1FFYA 4ZU3A 2MINA 4Z1MA 5HQ3B 2VVTA 1LWOA 4PLGA 2O8EA 1P5FA 2BM0A 1BJTA 2LCQA 4QUDA 5F2KA 2WM3A 5U9CA 1USIA 1NP3A 3U40A 1YS1X 1ADBA 3EARA 3FAKA 3GM3A 3N5KA 3REOA 2Q62A 121PA 4DAOA 3VR6D 4P81A 4IDEA 5G41A 3IERA 3US6A 4MO2A 3IVRA 2GZSA 2RB5A 1KK3A 2O0HA 3I6MA 1UMBA 4U5QA 1R8QA 1MORA 3WV5A 1JLSA 4C06A 3SI7A 3NEJA 4MIYA 4JITA 4ZQGA 2OBMA 4WN3A 2C2YA 3WL8A 4AKIA 2NU8B 1ZRNA 3HZRA 1XFDA 4N54A 5TGDA 1UC8A 5CX1A 4QYSA 3DEYX 1TZBA 2FZCA 1DC8A 1FVOA 4PC2A 3MCZA 1PGJA 4BZXA 1AF4A 5KVQA 1UFBA 2FQWA 1K98A 2O1XA 4I4LA 2XLCA 1ZX1A 4B3HA 4NCAA 1A4XA 3KQKA 1D2AA 4PC6A 5DISB 4H31A 1K3FA 1M5TA 5LKAA 3J81k 2UXDB 4ND3A 2O7VA 4CEHA 3HUTA 3D3QA 3D59A 4GPAA 2HJMA 3ML1A 4ZVQA 4QVGA 3F8TA 2CLCX 2NTEA 4URVR 4N39A 1XJCA 2AGVA 3CVXA 4E5VA 1U2EA 4QT0A 1O6BA 3SXUA 4IHQA 3W1EA 2O9XA 3DKPA 1LZLA 3BF7A 4QX6A 4XR4A 1KO8A 5FI5A 4ZEOA 3FHCB 3W9UA 2A1TR 3P9SA 2A68F 4OV6B 4R05A 2AFRA 4DQUA 2Z0MA 1VZ2A 2VH3A 2B6HA 2VPYA 1ZEMA 2G72A