2YVKA

Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from bacillus subtilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
349
Chain Sequence
b'MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioribose-1-phosphate isomerase
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 129
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yvkA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yvkA02
4ZEMA 4LDQA 2YVKA 4ZEOA 1T5OA 4LDRA 3ECSA 3A11A 1T9KA 5DBOA 3VM6A 2A0UA 2YRFA 1VB5A 1W2WB 3A9CA
chains in the Genus database with same CATH superfamily
4BO1A 3EZHA 1MOPA 2FEOA 5JS8A 3JQQA 4N7BA 4YV2A 4I5IA 3RK0A 2H18A 3ANMA 3FMIA 2YL7A 2VQ3A 4JK3A 4DTIA 2DI3A 4J6FA 721PA 4Q12A 3PXDA 4WQMA 1NM5A 4IIJF 4EJSB 4PYNA 1DQZA 1ZGAA 5BNTA 4XEVA 1SXPA 3N2YA 2YQYA 4DVYP 2QJRA 3KSUA 4DA0A 5GIPE 1KTVA 2LUOA 3HI4A 2HZBA 1T5HX 2R8XA 1Y63A 4HZIA 1TJ4A 2YY5A 1DS6A 3FYUB 4PLVA 3M33A 4LHYA 3I6MA 2XBLA 2OM2A 1LW6E 4YRIA 2HGZA 2GMWA 4HDNB 2ST1A 2H9IA 3BORA 1UKAA 4JI6B 1OCEA 1N32B 3V9PA 2GPSA 5DXAA 4TT3D 2I67A 3PWSA 4UREA 2ZYRA 5A71A 2NZXA 3DZCA 1UG7A 4H1WA 2KYRA 2B83A 1AQJA 3BJIC 1Q22A 3DFKA 3RJZA 4IYJA 4LPSA 1G7RA 4TQ9A 1KJ9A 3KXKA 4YJHA 1D6NA 4RIHA 1Z8FA 4IOJA 3U4CA 4JP3A 4BYGA 2B34A 4X97A 3NWBA 4Q4ZF 5H1YA 1IZ0A 2PN1A 4LAFA 1FQOA 2R6HA 3FFTA 3GVXA 2PX2A 2XHEA 2AQIA 2V8BA 4YRGA 3B8EA 2I7VA 5F52A 4ZEWA 1P6QA 5JRZA 1V1MB 3MX3A 5CD9A 2HREA 3HCOA 3EXFA 4HGYA 1OH7A 3GGJA 2DKOA 4B1FA 4KIWA 4UUAA 3BOSA 4Y2YA 3MB8A 2GHQA 3S2SA 3IHLA 5JH7B 3OCVA 1N2CE 1JMYA 4D79A 4TYYA 4XVQA 2IFTA 3KLMX 5K8CA 1VB5A 1FRFS 3PR3A 2X3UA 4KWHA 2QX4A 3KYBA 1UF9A 5AOVA 4YIKA 4DNPA 1UJCA 1FNSA 3FUTA 3IEIA 4IJMA 4OOFA 4MVCA 4O4LF 1BQEA 2UVQA 2I55A 5CEEA 4TTIA 3I1FA 2HEIA 2A1DD 4FMCF 3VJLA 2HJHA 3USES 3SEOA 2QU8A 3A1DA 2HU5A 4IDGA 3GZJA 3BEDA 2GZAA 4XTCS 2V7GA 5FLKA 3WHPA 1QHYA 5BVGB 4LZWA 1V16A 4OP3A 3C3WA 1H9TA 1PO7A 3BWBA 3C3XA 2VKTA 3UVEA 4E12A 3DE5X 1D2EA 3GL9A 5HKAA 4QXQA 3KOUA 3DCIA 2I22A 2LKDA 2CVHA 3GQBA 4PPFA 3PITA 3MWFA 1KJZA 4D74A 2ZUTA 4F4UA 3ZDCA 1A5BB 5JXGA 4RPCA 3EFOB 3B85A 3Q5EA 4AUKA 3NGXA 4PSKA 3OTWA 1UPXA 1NXXA 2G71A 3K0FA 1IVSA 5FTWA 1DRUA 3AR9A 1IB6A 1JF8A 4JKVA 4MUYA 3BD9A 1AEPA 4JUDX 1Z63A 4QGAA 1A7UA 4JSTA 2O2CA 1G8FA 3QUSA 1L5ZA 2O7VA 2VTEA 2DX7A 4DXAA 4RTQA 5LB4A 1Q11A 3NBUA 1IHPA 2DR3A 5KU1A 2H2WA 3CF4G 4CDGA 1H0KA 3BRWD 5CT8A 3M4XA 2VFAA 5DLEA 4XGQA 2ATIA 4K0DA 3ELWA 5E9JA 1KJIA 1YQTA 3ABIA 3TKLA 2FX2A 2XGMA 1DBVO 1C4KA 4QU0A 1EIZA 3T35A 3IMCA 5IDVA 3ZEIA 5KPDA 3VNUA 5LBTA 5HRAA 4OHBA 3DTTA 5A3QA 3LGAA 1GL3A 2ESRA 1QOQB 4M8IA 2O7QA 4H18A 2C59A 1P4SA 1VB3A 3NC0C 5KOJA 4EJ0A 4ENWA 2DYSC 3JQBA 2Q9UA 3HA5A 4MIOA 2R7SA 1NQ5A 3N0RA 4DMCA 4RANA 5HTOA 4TT3A 3KB6A 3PPVA 2Y0CA 4M1ZA 1TK3A 1N9KA 4MVOA 3UT5B 1C7QA 3QMKA 1RYFA 3RNOA 3MGBA 1BO6A 1R4AA 3B6ZA 1TMOA 3HFJA 4JKIA 4N3BA 5JSZB 5IJ9B 2VC9A 4UOZA 3KETA 3LUJA 3PGKA 2NO1A 1JWLA 2I6XA 2OEXA 1RPAA 3WFIA 4RL6A 2IOFK 1K9SA 4MVJM 3QBVA 4P4SA 4B74A 4Q4DA 2DU8A 1MOQA 3WGLA 3O8RA 1RQ2A 2ZDHA 3FNEA 3ANLA 4PJLA 1S8NA 1EINA 1WDWB 2ZRKA 2Q7OE 4PBRA 3RVZA 4NBVA 4WADA 5EKXA 3CNOA 3IVXA 4WKOA 3H0CA 5DFAA 3L7KA 5LYJF 4FFPA 5M34A 1QZTA 1R8XA 2O4UX 2ZS8A 4BE4A 4Q3LA 3E3NA 1NU7D 1EWYA 2B2XA 4RETA 3ETJA 3UZUA 4Y6SA 2QD1A 3GWGA 3C4VA 1RDFA 3ZDZB 3B71A 3T1NA 1LLUA 3JAWB 2UYCA 4YJKA 2PSSA 1TZKA 1DEXA 2GI4A 3ACBA 4YRAA 2QM7A 3NOQA 3LNTA 4RFSA 4A27A 4A7PA 1L5VA 1WUHS 4J3FA 4EG8A 1JHMA 5EJ6A 3MLBA 4YRSA 1EZ1A 2IV2X 4QQRA 4XI9A 1NF3A 1BXGA 3HEBA 1KYXA 2NYAA 4EKEA 4C4XA 1L9KA 1UK8A 1NBMD 2ZJYA 3BK7A 1XJQA 3TSYA 1UXOA 5C1PA 3KPWA 3T52A 4MKHA 2ZYIA 5BW5A 1Y98A 4O4IB 3T1YB 2A9FA 1ZJYA 1PGQA 5CYPA 1XNQB 4O63O 1HDIA 1TF2A 4L5BA 1KDRA 2E5FA 1JHZA 5DM60 4C2AA 3H9EO 1VA4A 2ANCA 1L4YA 3ZDFA 4J91A 1J23A 3OPYI 4O1HA 3C5VA 4RYLA 3MTJA 3N7TA 1SRRA 3A3YA 2ZUCA 5AT1A 4EP1A 3BJEA 3CNQS 2OHFA 3LWDA 4H0CA 3DAOA 4RPIA 3MMXA 2A33A 5AQ1A 4YT2A 2CD7A 3QEAZ 3I5YA 3TQQA 2XMCA 1SCAA 2WTUA 3RYCB 3OQ6A 2VJLA 4M0LA 5JD4A 4ITVA 4IINA 2I91A 3ZCPA 2Q6VA 3HYLA 1J33A 2CL6X 4W9NC 2O8VA 3CGGA 2PT7A 3VUFA 2BGGA 4IVRA 1KK2A 4UDXX 3VC2A 1IG3A 1S7CA 3ZK7A 3A6PC 3AC0A 2PEYA 3FAKA 4E14A 4FZRA 3EMDA 4YY3B 7REQA 3VH4A 1AZTA 3SP1A 1GRRA 2IS1A 2QM8A 4K9LA 2PUTA 2IF2A 1G59A 2QRZA 2J3HA 3LUCA 1RHJA 2YFHA 4BKRA 4QDXA 4PG6A 5LOVF 1E85A 1KTIA 3B1ZA 3HO6A 2ZVDA 4G09A 5D3QA 4TV9B 3RD5A 2PD4A 4D41A 4RF3A 5IC6A 3F1LA 4YUWA 1S96A 3FBWA 3MQ2A 4Q18A 1YB4A 4W7HA 2QQGA 2BUAA 2XMGA 4Q4JB 2X0FA 2PQ6A 5EP1A 4IGEA 5K0IA 2JATA 5I4CA 2X7XA 3DSRA 2AE2A 4BUZA 2FN8A 1HNWB 4YGYA 2QTVA 2ZWOA 4Q6WA 3IEVA 3SX4A 5DTIA 3NYIA 3WNVA 4R6WA 2Z9BA 3KAQA 3CH5A 4Y6LA 3ENQA 2Q7DA 1DKPA 2QU7A 1SCIA 5KSYA 4BMCA 4KE6A 1DMSA 4C20A 4JLDA 1OA0A 3K8QA 5HILA 5SY6A 5LQAA 2O48X 4CFZA 5CBPB 2YMLA 3E84A 5H0IA 2WWYA 1N78A 2AVNA 4UUQA 1F2TB 2G1PA 4CT5A 4RWEA 2GA0A 4TYWA 3KVNA 2OP0A 3EG5A 1LFAA 1OLUA 2BKAA 1P7VA 1UADA 1NLUA 4XAQA 2KMLA 5DW0A 4G67A 1FFDA 1KI8A 1L8XA 3SOZA 2FQXA 5SY9A 4OMFG 1OZFA 3Q7TA 4BXOA 2IODA 1Q7BA 3OPYA 1XK6A 4YB8A 4H1HA 1ZD9A 1EESA 1W6RA 1Q0DA 1VPEA 4KR9A 1G7CA 2HMSA 4HEA6 2H11A 3BIFA 2A59A 2D5CA 3UIEA 4P9NA 5KX5B 2DSTA 3PI7A 4TSRA 1GM5A 3H2ZA 5KMGB 3AIIA 5DU2A 2ARKA 4KBGA 1NBMA 4HTAA 2HTFA 4YCLA 4Y2QA 1D8TA 2R1UA 1KQPA 3IQDB 5GPGB 3MHTA 3PDJA 4FMDF 5HSWA 2LGJA 5EYPB 2BEVB 2V4UA 4G8CA 1WDLA 4FE4A 3UPDA 1U0RA 4YMTA 3S4YA 1C3OA 1P80A 1MW8X 4ZOLB 3BD8A 1ZD1A 2F55A 3L06A 3CR8A 3WLFA 2CF5A 3VV3A 3R74A 3PKZA 3HCEA 2OSVA 4KVFA 1OTYA 2ES4A 4ZAVA 2GZ1A 2P65A 4CHTA 1T5OA 4C1NA 1RRFA 3RBAA 3OEYA 2GB4A 1ZVVA 2P8SA 3LY5A 4JFRA 2P77A 4RADA 5A6JA 1Y3HA 3R8CA 5HK8A 2W22A 3OIGA 3I8OA 3DXJF 3PS9A 1U7HA 3VZBA 2W2TA 1CB0A 4QJBA 1VSUA 1AUOA 1GZVA 2EL9A 2OGZA 3AVWA 1L5OA 5DKFA 5BORA 2ZT5A 3KLNA 5FWXB 1C0KA 4D82A 3H3FA 1FEZA 1NUSA 1JG7A 4X8OA 3NHJA 1J2UA 3IQTA 4KRGA 2VWGA 3V4PB 1YL6A 2PMCA 4UM8B 1M57C 3WV5A 3FTFA 2RFLA 3OTOB 2ONZA 1VE5A 1OZGA 3FN4A 2W42A 4AJEA 4LYDA 1IEWA 3DNMA 3C3AA 2VRWA 3CNHA 4C6RA 5FNVB 1WXWA 3VR3A 2VNSA 4QUAA 4TTAA 1OE0A 2BEWB 3EC1A 4FYWA 4UC0A 4NRDA 3T4XA 4QGFA 5E3JA 1FRVA 3KFXA 1Q20A 4NARA 4X7RA 3UUEA 1JG3A 1G3UA 1FFXB 1XYVA 4F9FA 1EBFA 1MRSA 1FYDA 3T38A 2EWVA 3TDKA 1DC3A 2G9NA 4MRMA 4Q4AA 5J59A 2ZTHA 1OWNA 4YJ2F 3RYLA 2H85A 2W6NA 2C7VA 3NH9A 4UKDA 2YHIA 2ICWG 1G6KA 4KX5A 3MT8A 3EODA 5TT0A 1GSOA 4XVRA 1LPBB 2B7LA 3EFEA 3O8QA 4MKFA 2OOSA 5K0GA 4Q82A 2WMDA 3K96A 1JU3A 1I7QB 5HF9A 3FHDA 3UR3C 4MUGA 4W1PA 4C7MA 2B4YA 2ID4A 2G9ZA 5AXAA 4MJXA 3IBCA 3WBFA 3OFND 1Z45A 3I42A 2VR1A 4CMCA 2JI7A 4DNXA 4MLZA 4S12A 5DGTA 2FX3A 2K7ZA 3JVVA 1MJHA 2QUIA 5CM9C 1T3SA 3FFAA 3BL5A 3RI3A 5TQ2A 3TE6A 3UGTA 5LLSA 4D26A 3ZNPA 4JVSB 3ORYA 2Z8ZA 3WBBA 3BIJA 1ND6A 3V4OA 1SIUA 3HMKA 1X19A 1LC3A 2OCYC 4I55B 3U4MA 3VOSA 1MNQA 4UHKA 2PE5A 2JAXA 3LOQA 2MOKA 4DSTA 5DGCA 2IBSA 1RXSA 5JJCA 1R5BA 1TC2A 2C20A 2NZWA 3EVCA 1FRNA 1W5FA 4E0BA 1P3JA 2A35A 3R7NA 2HLPA 1T6NA 4UDOA 2AJDA 4AYWA 3DBRA 3HJBA 4GH5A 3OT5A 3H65A 3R9KA 1BJRE 3GFRA 3BE8A 1H3EA 3HADA 2VAWA 1KKLA 3HDVA 4E33A 3H11A 1HK7A 1Y5IA 1TAGA 5L4SA 5FA8A 1EEXB 5DYTA 5LLDA 2GRAA 1GJRA 3EDRA 3CRRA 3D0RA 2CDQA 3QYJA 1FZTA 5TX7A 1NI3A 3IP8A 4HK4A 4IG9A 3DTVA 4DS3A 1GA4A 1EP1B 5AHWA 3GX1A 5JZSA 1QAQA 3W1WA 5C2JB 3AR6A 2H63A 4J43A 2C2BA 4ES6A 2WV9A 3FWNA 3DZBA 4JLUA 4A23A 5DSZA 2X5KO 3VPFA 1YVDA 4V0NA 3TULA 2Y76A 1B43A 5C3MA 4GBJA 2QUAA 1PFUA 3KSBC 2QJTA 5JSHA 4CFSA 2YCBA 3GMTA 3MCVA 1I14A 1QF7A 4BPMA 1FS5A 2GZDA 4PYKA 4OIFA 4P7BA 1H6GA 3JTEA 1H6DA 4WBNB 5FPSA 3TUZC 1KNYA 2UVPA 1OLXB 2H0QA 1YB2A 5I7HA 3SVLA 4EATA 1LZLA 3VPSA 5EFOA 1M2EA 3L1JA 4KO4S 3CTPA 1H3NA 4GP6A 4BVBA 3GROA 3NANA 5H3CA 1BKSB 4ZN6A 1XZHA 1L4NA 2B92A 5G0TA 2HF2A 3GRVA 4EUHA 5KYYA 1QPZA 1EJ0A 4MQFA 3DW3X 4BTVA 2RI6A 3SE7A 2AEFA 2OWDA 1C41A 1KR2A 5JZMA 4FW8A 1OH8A 1FBNA 4Q05A 1OYWA 3I30X 5E4YA 4HT3B 4F4DA 1MIOA 3V6LA 2L18A 1REQB 4R9VA 1H2BA 4F6LA 5LB2A 3UG6A 1AHNA 1LSOA 5KQPA 2XXJA 5THKA 3ISJA 4I8IA 1Q0FA 3AG1C 3C7JA 2IH2A 5FQNA 2F3SA 3A11A 4XEFA 2JD3A 1K5GA 2P6VA 1CJTC 3ZDDA 4FDAA 3T1TA 4PFSA 1PEYA 4HRXA 4L15A 1SXGA 2FPKA 3GLHE 1SUPA 4BKUA 2QNBA 1A9QA 4OATA 2XCSB 4DQLA 5ALEA 5DIFA 2AOTB 3GELA 2H8KA 3M6FA 4O1IA 4LDRA 2IBTA 3T0FA 1GTJ1 4BECA 2Z2XA 1IM8A 3FLEA 1Z15A 4OHFA 4MK4A 1JPUA 3MUOA 2OD2A 2HF7A 4JYMA 2E0IA 2G62A 5GM2A 3JXEA 5JPDA 1KDTA 4ZT7A 5AVOA 4YR9A 1AUPA 3MBGA 3G9XA 4DHEA 3OJCA 5FUWA 3ZJVA 1U8AA 1KK1A 1FVFA 3ZWPA 4WFQA 1QV6A 3P0RA 2RGYA 5DWDA 3M49A 2YTZA 1OW7A 4PS0A 1NVVQ 2TECE 3NTLA 2ZJ1A 2QLTA 1V5WA 1T6BY 2YBEA 3LESA 3KYIA 3UWKA 3QMVA 1X1CA 3RS4A 1M6TA 2VAPA 3PJGA 2ZULA 1ZUHA 4MQMA 4W1SA 2EPKX 1BDMA 1A2BA 1T9GS 8ABPA 3KOWA 2UXBB 1YVIA 4CX9A 1JIXA 2PSFA 5G2OA 5FUXA 3IILA 3RHZA 3AWDA 5HDQA 3LGXA 3HKEA 3LLSA 1TZMA 4PTLA 4DDVA 4GKJB 2Q3JA 1E1RD 2ZD9A 3PXBA 3T9AA 3SC3A 2XZPA 4FHFA 2JANA 5DSTA 4WX2B 3GVCA 3VA7A 5JNSA 2I4NA 3D4IA 3EDQA 5C1DA 4NFSA 2Q3DA 1EGQA 2V6GA 3NAGA 1DXQA 3AEUB 1HLFA 1X7XB 5JNWA 1KI4A 5JZVA 2XKJE 1F8YA 3I2IA 2J1LA 3DGEC 4G36A 5LXTB 3MWEB 1Y6DA 2JIZA 1QQ6A 5FOTA 4IOKA 3QMPA 3VPBA 4B0OA 4OGFA 5CDYA 3HGTA 1JEJA 2RKWA 5EIXA 5CFLA 3O31A 1NVDA 1ZW2A 3M5CA 4JI8B 4R2JA 3LQQA 2WWHA 5CM2Z 5ALDA 2XYQA 1TLLA 2XB9A 4M9CA 1YTUA 1J8YF 3H5RA 4DNQA 2WVGA 2QMHA 2CV1A 4AAYA 2OXCA 4YACA 2P40A 2JK0A 5LZ9A 4BQFA 1R3DA 1P7ZA 4R7ZA 1U0LA 5IUJC 2R1VB 2YYSA 1VDMA 3GRZA 3FTPA 4NAUA 2WD9A 3JZIA 3ZWDA 1FIUA 1YDIA 1D1SA 3TTSA 3FUCA 3NI2A 2WFLB 1G4US 5IVHA 1AG9A 2I29A 2DPGA 1IXKA 3L0SA 4YO7A 3E35A 4PCLA 3ZZMA 5T4HA 4YT5A 1QP4A 3W2WA 3OOSA 2N46A 4C3EA 2NU9B 1CUCA 3RARA 4RJTA 1PF7E 1QFMA 4H16A 4IX9A 4N01A 1ES9A 2D1QA 2JHFA 3ENVA 1CFJA 5AJYA 3HVIA 1DOZA 1GAXA 3PFIA 4A4DA 4OIPF 1OJ7A 4PZPA 1SXJB 3SC2A 1DOHA 4EG5A 4IM7A 3G7SA 1XZLA 2CY0A 2PR2A 1T9BA 4RMJA 4Z9HA 3ITNA 5K8IA 1DWPA 1I36A 1VMAA 3SEAA 3QHAA 4YRCA 3ZZUA 1Y1KE 1P2VA 5CYGA 2DFPA 4AY5A 3WL4A 3O91A 1ZVZA 3BH0A 3E9EA 1WV1A 2Z6QA 3TR5A 2VF8A 1EG2A 3DEYX 2ZT8A 4GKVA 1JVSA 1K4KA 2G83A 4BAGA 5IG2A 4KV9A 2IYYA 2ZBEA 2C57A 2R25B 3DXZA 4RIFA 4BIMA 4OLJA 1ZOLA 4CDRA 4DNOA 1RHUA 5DX8A 3P4YA 3HNJA 5BMOA 3K6KA 4COKA 4JJGA 2EW8A 5CNKA 2PUDA 1GPUA 1S2MA 2X8AA 3Q7GA 2OHOA 5ECDA 2XVMA 1XZJA 2KM1A 4WAUA 2ADOA 2XI4A 1UEXC 2Q46A 1B7GO 3ZDQA 2IK8A 2IH5A 3BB1A 4ZK2A 1QP8A 3UGKA 2WOJA 5GOZA 2IXNA 4JJ8A 2C94A 1IN8A 2O3TA 4RL4A 3UK6A 4GWKA 1MB2A 2O8BA 1SIOA 3IL2A 1WSWA 2BFPA 2Z5VA 1I4EB 3HUTA 1SC1A 3CQ9A 4ISBA 3L6BA 2C42A 1E1RA 2WWRA 4ZMSA 1S4MA 1NSFA 3SDBA 2FV8A 4DLUA 1JEYB 4CL0A 4MVJD 4PR3A 4EGAA 4F4BA 1CNEA 2F7SA 3G2JA 2P41A 1L9XA 1L7NA 3IRVA 4IDAA 3UY4A 1U2SA 5JFGA 2OO3A 1W4ZA 2ZLBA 4C30A 4H9GA 1XZ8A 2GPYA 1Z34A 1SZPA 5KYUB 1HSOA 2FTKE 4XCXA 3FSGA 4DADA 4CIWA 4B6JA 4MINA 2G6BA 3H19A 4QUIA 4IHJB 4Q01A 3IO3A 5K1ZA 2PRSA 1GZUA 2XNDD 1ZVKA 4C0WA 4KRFA 4EYSA 2WWXA 2D1SA 4XGIA 4AJKA 5FBLB 1I0IA 3EH2A 1HGXA 4KNYA 1RI4A 3RKSA 2HHHB 4GKBA 1OBOA 4HN9A 2MYUA 4MVJI 4J4TA 4HRYA 1M66A 3ADOA 1FS6A 1P4HA 4TPKA 1JPVA 4DV0B 3JQRA 4O5OA 3TF5A 2QUZA 5AIBA 2BKVA 2QW1A 4MMXB 2IPLA 4W9NA 1AMOA 2A58A 4DRXB 1C80A 1C03A 1BHO1 2IHNA 5CTAA 3DXFA 1VGRA 2YHUA 4TLLB 1E8MA 2ZTSA 1EQAA 2NU7A 2DB3A 4L5AA 3E70C 2JAWA 4BGEA 1TYAE 4Z49A 3CSSA 3N0VA 2AEJA 3HDJA 4FYKA 1KEEB 1U1IA 4M36A 5HPYB 3KZ1E 1PR1A 3DV2A 4REQB 1SFRA 121PA 1YBFA 2KLHA 3ZIAA 3UANA 2CLHB 2IPMA 5B53A 4FJ0A 1X7WA 1X1SA 2GN4A 3N2GB 1GFIA 4OFXA 2OYSA 5HG0A 2WSBA 3HJGA 1IY9A 1NYTA 4W99A 3RODA 2YWCA 1O94C 1KOGA 3AIOA 3NHFA 4Q1AA 4RDAA 5LZ8A 4JV5B 5IK2D 4FN5A 2ECOA 4JEUA 4B85A 1YL5A 1N8NA 1YS1X 1VXOA 5K5EA 1GCOA 3A8TA 5T4BA 4RCZA 2GTHA 1ZJJA 4DJEC 1Z33A 1KYIA 3C15C 1FR0A 4H4EA 3EGOA 3NGMA 3VYSB 3WL5A 3ZGLA 3BAZA 1COZA 4J2OA 4RV9A 1Q0HA 2JCXA 3TLKA 4F6CA 1GEEA 1FS4A 2AP3A 2OEPA 1BZYA 1FFWA 4KI0A 4N7MA 1G20A 3UICA 1M2KA 2DTXA 2HNAA 1Z0KA 3JTMA 1PVOA 5F77A 2IXPA 3QLVC 4F56A 3G9TA 3DDWA 1DJPA 3GPDG 1E79D 3F67A 3QKSB 4GE3A 4KXFB 2PD3A 2QZ4A 1G5TA 1E59A 3KLOA 4O2AB 4OI1A 2ZJ3A 3M1IA 1AXRA 1P7PA 3WK9A 5FUQA 2KJGA 4DQXA 2X4IA 2PMKA 2R7KA 3ASUA 1NJFA 1IZZA 4G07A 1QANA 1P91A 3V55A 5BSGA 3CNNA 1ZD5A 4CG2A 4ALIA 4XKJA 3WXMA 4PSVA 3ZBTA 3FGPA 1HA3A 2EJWA 1ZJWA 2XH8A 2FY8A 4K9QA 1NVXQ 1UJ2A 1U1DA 4CKZA 2GFHA 4K9NA 2VDKB 4IS3A 2AG6A 4PLTA 5T41A 2QHXA 3TZ6A 1GL6A 1QHSA 1ISJA 3NMJA 3FXHA 1JOGA 1QGOA 2GBFA 1KJJA 4EFLA 1OKKD 2WFZA 1Q50A 1TUBA 3OZVA 5C53B 2HJWA 1Y48E 4OLFA 5AKIA 2QZZA 4CM8B 3BIOA 4I5DA 1QHIA 4OQYA 2XNDA 1JR6A 1XUOA 3N53A 3BTUA 2XQGA 3JRWA 3IPXA 3V3KA 3DL2A 1I2BA 3WBKA 3EIFA 2JCVA 1CULC 2ZCJA 4E5DA 3E18A 3P0EA 3M81A 5EEHA 4NG5A 1X1TA 5I7VA 1YRBA 3KQQA 3TMKA 1Z16A 3TEJA 2B4AA 2H7OA 4EY7A 5BV8A 3QA3E 3JX9A 3QP9A 2KBEA 2YRWA 1T1EA 2XAUA 1D1CA 1IY1A 3S29A 4ZCIA 3T4RA 1PJ4A 4PY2A 2QR2A 1G8XA 1A1VA 1B93A 3TPZA 2F43B 2YL0A 3RIEA 2WD7A 2AXNA 1DWOA 1QIHA 3SHTA 2YBDA 2VHTA 1NIPA 3HA7A 1KVTA 3RWMB 4H1UA 1OB5A 4IL5A 4EUSA 1QVAA 3FJOA 1JDBC 1QG0A 2J87A 1QIIA 2M64A 2AC2A 3IAFA 5NULA 2WV7A 3MT7A 4P7JA 1W59A 5BWNA 3JPWA 1VLQA 2IDMA 1YIOA 1CHDA 2OB1A 2Z57A 3C8MA 3AU8A 4XTKA 3G02A 4ENRA 5JBNA 4ZO9A 4MMZB 3RIMA 3IUJA 2B8TA 2NZJA 3MN1A 1U65A 3SI7A 2C7OA 4CLEA 1YFKA 3A9WA 3HJHA 1RYHA 2DHRA 2CEKA 1YAHA 1CY7A 2JFUA 1UKCA 4PX3A 1MXFA 3LC0A 5TY0A 4XARA 3QVGB 1XRPA 4MYRA 3MTGA 1JU9A 2XZTA 3CY6A 2ENWA 4OAOA 4R68A 1M2VB 2NVWA 2DPYA 4L4UA 5G02A 2H1HA 2ZYSA 5JRJA 1SD1A 1WQ1R 1D0YA 5IUNC 3QLEA 4TRMA 4HCJA 3RS8A 3NLLA 4YV1A 2CW0F 2Z4RA 4PRZA 3F46A 3AUUA 1L7XA 3F2IA 2HWKA 4G0MA 4GE0A 4BEVA 4QOHA 3N2LA 1ATIA 2AI2A 3H2JA 3M9LA 3KYDA 1KHTA 3K16A 5E1DA 1LW7A 4G9EA 1UBFA 3M6LA 1NLMA 4J30B 1Q7GA 1SB9A 3QBJA 3WNDA 2HMWA 1B15A 3X2FA 1KY2A 2ZXRA 2CJYA 5BN1A 2HEGA 4U5FE 3ZHOA 4B7CA 3DA8A 4DMHA 5BMVF 5JWRA 4WY5A 2RAPA 2V8OA 1XZGA 2RGGA 3BC1A 2VA9A 2HSZA 3ER6A 1QGYA 3MD9A 3ICEA 5K3OA 1NFNA 3C3YA 1U0GA 4MJ7A 2X86A 4BZQA 4H54A 4CEJA 3WLOA 2QZSA 1E0JA 1E3SA 4D4NA 3FLBA 4LK2A 3WJ7A 4KBLA 1LQ2A 3QMWA 3G4XA 5F1PA 3VGPA 3GCWA 4YJHB 1RAGA 4JJZA 3TLAA 3FLMA 2G0AA 4QA9A 4KW7A 3BRSA 4FAPB 2ZJ2A 1Q95A 4DJJA 1QIDA 3NIDB 4YUZA 2LKCA 5TC4A 1OKKA 2Q4DA 3BDAA 1EFLA 1DB3A 4W5QA 4P32A 4M21A 3BZUA 4B7UA 1LTHR 4U3JA 3CF0A 4WXHA 1ZOIA 3EXFB 4YXWA 2Q07A 5HJEA 2V0CA 3U9TA 1UJ5A 4GHWA 4JP5A 4MTOA 3L6CA 3FOAA 3RYTC 5CIYA 1D4AA 3ONDA 1I3OA 1XSEA 4QDTA 5EXTA 4JYBA 4M1YA 2Y3HA 3CVUA 3LUPA 4M1OA 1X9IA 5HJ7A 1MORA 4DC1A 1WZIA 1WDTA 1DBPA 2PGIA 2WJ3A 5TQJA 3DUWA 3KQYA 3THRA 4C14A 4B48A 1C8VB 2IHZA 4ZTUB 2ZJFA 1V16B 1NXVA 4UUPA 1KP3A 2FOIA 3FNBA 4G0HA 1C7EA 5C8DA 4U9EA 4N0EA 2GD0A 5EERA 3FB4A 5CNIA 2XVXA 1K6JA 4AYTA 1E9RA 4EDFA 3GQBB 4CTJA 3L49A 2PH5A 3O3CA 1LGYA 4KR7A 4GGOA 4C29A 5HUHA 4IWBA 3UGJA 5UKDA 1DKQA 4BVAA 1SC3A 2MIIA 3GOHA 2RK4A 4I36A 3K0FB 2RG7A 5B30A 2I76A 3UCFA 3CX7A 3QE2A 5IKMA 4MUAA 3OO0A 1MGOA 1ONBA 2A0WA 3TGWA 3DZKA 3H99A 2PFKA 3DVAB 3U3MA 3LP6A 3FSRA 1SPXA 3MCAA 4YPOA 1RVDA 5ELLA 1ML3A 3AUAA 2X0RA 3VH1A 2ODTX 1D9ZA 4IZ6A 2Q4BA 2HJMA 2O23A 2IWHA 2ORWA 1ZKDA 4LWZA 1VLLA 1TQGA 4PSUA 4YCSA 4ALMA 2GASA 2WM9B 1SQ6A 3D7KA 4PLGA 2E55A 1FLDA 1VA5A 1DVRA 3UXEA 2YWXA 4LQCA 4ZGWA 1ZHYA 2F1JA 4ZDIA 1K40A 5LDDC 3EZYA 4GECA 4EPVA 4OLBA 3STHA 1Z82A 5KOJB 3ZDRA 1A76A 3BTOA 2A1TS 1XF9A 5DNUA 4XH9B 3ZHUA 5ALRA 5DSXA 5EGSA 5HCNA 1WS6A 1WA5A 1MQAA 1JU4A 4CLHA 2FU5C 1U3TA 1LV7A 2WIBA 2OCCC 2YV4A 3HACA 3UGPA 3R09A 4P83A 2Y3GA 1WABA 4M46A 2ZS7A 5JCJA 4OQPA 2C03A 4BDSA 4K6HA 3PGVA 1GILA 1ZCJA 3O84A 1XWWA 3A6JA 3REFA 4U5CE 4Y1RA 3OX3A 2WIGA 3L8HA 1C81A 4L5YA 1ODIA 1OLSA 1GP2A 3JD1A 1AHPA 4ZODA 4TTTS 3DOIA 1JJVA 4P4SB 4OK3A 3Q87B 1P3DA 2BCGY 3HMQA 3ZVLA 1P0FA 3BSYA 3VJRA 3CR3C 2R11A 3IULA 5KYNA 3JQCA 4P34A 4UHBA 3DOJA 1FXWF 1PG2A 4A6DA 2GZ2A 1YASA 4G1EB 2AWYA 1M34E 4UHEA 3KUCA 1NX6A 4XLZA 3MUNA 1ZI9A 2AF3C 3KFLA 1VFPA 5LZ5A 1AXEA 3RTBA 2IEYA 4MS4A 5BOVA 4RVDA 4E18A 1K89A 1PQWA 2AZTA 3M4NA 4BOYA 3FCEA 3O92A 3ZI0A 3VPAA 4LI0A 1F6BA 2ECKA 3GN1A 1FNBA 3N6VA 4MVXA 4F60A 1G5ZA 3LH5A 4ID3A 2A7XA 4BMVA 2PFGA 2A9KA 4RFSB 1Z6YA 3I0NA 2C2OA 4HADA 1HYBA 1Z9BA 1BXGB 4F8YA 1NC1A 1BU8A 3W8EA 3I58A 2A1UA 2OO5C 3L43A 5EINA 2B1RA 3D6JA 3ZCQA 1EKYA 4MLPA 2HCTA 2GLUA 3WQBA 5F5FA 2VHUA 3T5GA 2ACWA 2WNIA 3A1EA 3AF6A 3LQYA 1AQUA 1XKQA 4KFCA 1I5OA 2QE6A 2OE2A 3TZHA 3ZY5A 3ICCA 1FNDA 2VPXA 4INAA 1V45E 5DN6A 5J2TA 1CUWA 3P45A 5IP5A 4B32A 4LE0A 5E6UB 4L3WA 1YS2X 4EI7A 5KJFA 1LLFA 4PTZA 3ZD6A 4TYNA 4ND5A 4A8HA 4XFDA 3CF4A 2CDCA 2PRJA 3A26A 3NHPA 3B38A 3BJMA 5BSTA 4BGIA 4PFKA 1BWPA 3QVKA 3RYHA 5KYXA 1FP4A 1NVBA 5IWAB 3EZLA 3ZCTA 1C2YA 1Q44A 1IYZA 2UUHA 3A9TA 3OC0A 3EEOA 3UMIA 3UH1A 1E5LA 1JDNA 1BEUB 3KKMA 3RRXA 3F3SA 5COFA 1E77A 3CKMA 3G50A 1O94D 3FNFA 5FTLA 4GSKA 7REQB 1O6FA 4E2ZA 3HXKA 4HFRA 2WIFA 4DF3A 3MWLA 3LSYA 1NMZA 4R7GA 4GDFA 4URUR 4ER9A 1JB9A 1JAYA 1S2DA 1Z7BA 1R7RA 3JRMO 1RCPA 2WUVA 3BICA 1H2FA 3LP8A 1YHZA 1QHFA 3BCUA 1YI0A 2L9JA 4DZTA 2WMOB 2YS6A 1O5HA 3B13B 3GCXA 1XKTA 1L5WA 5CB8A 1GPMA 1E1CA 5FRDA 2YWEA 3SZ3A 5E7JA 2ZZNA 3RSQA 3DGFC 3K0KA 1X1AA 1RRMA 3PUJA 1P5FA 3JW8A 2P68A 3U5SA 4NBUA 3AI2A 1O96A 4MOWA 3IXMA 3HM2A 3E2IA 3VX4A 3EOAI 2PXXA 4E0IA 1BZ4A 2HA7A 2DULA 3W7AA 1WNTA 2QTVB 3CSDA 1CKEA 4JXZA 2WSSA 4NENA 2F62A 3WLQA 2A4KA 1GKIA 3HM9A 3FVVA 2HH9A 2IUUA 3RV4A 1GG9A 1HX7A 5J1TB 1PHPA 2FSPA 3ZHYA 2AV6A 2HSEA 2KLBA 1ZLXA 1OLUB 4RY0A 1M2HA 2GAFA 2PZJA 2OHGA 5JO0A 3EWSA 4EHIA 4OA5A 5K3EA 6NULA 4LMRA 3HO8A 3R3WA 1IG0A 1BAPA 4ZQCB 5EPUA 5DNYB 2BW0A 1JIKA 4BXOB 1E9BA 3OPYB 4IWXA 5C5CA 3FVWA 3RFFA 1TAUA 3T1QA 5E4TA 1F5NA 3U6BA 3QFFA 4TSFA 3O8LA 1QOZA 4Q5IA 3PHBE 2FUKA 4MUIA 2Q62A 4G0OA 5LJIA 2IE0A 3AR8A 2GGSA 4H3KB 1EG7A 1A9ZA 2H2HA 2HJ9A 3OUUA 3GJZA 2Q5HA 5AVSA 3S3TA 2MWMA 4DB2A 1NVMB 4DSNA 2B0HA 4BX8A 1P60A 3FHJA 2I6GA 1C3OB 5AI9A 2WOOA 3PEWA 1SJ9A 3DZAA 2O2SA 1TTPB 1Y0BA 4J32B 4G9GA 4E5NA 1QZUA 1VCNA 3I2HA 3HUDA 1VIAA 1ECBA 4A2WA 3I6BA 3GJ4A 2MTBA 4EPXA 5F5LA 2DKNA 3FYSA 1GCGA 3D3JA 3VR3D 4INPA 3FROA 4D0GA 3RRYA 5BURA 2XW6A 5JHGB 4QBTA 4WH0A 2HOQA 1RXUA 1Y4SA 4FT4A 1N2XA 1T8TA 3CFYA 3EZIA 4WOBA 1W8DA 3RIGA 4GFDA 2X9VA 5CFQA 4EG3A 1Q2UA 5AVQA 3E3OA 3G88A 2Y39A 3AP2A 2X4GA 4C07A 4UTXA 1ADCA 3DBLA 4FBMA 3QBEA 1MU0A 4NPCA 5AXCA 1O94A 5JFOA 1SVOA 4QJIA 4HJXA 3EDOA 2J9UA 1MTZA 4MUKA 4NU8X 2G72A 3HSKA 3T7SA 3ZY2A 1X7DA 4US1R 4DJFC 4Q4CA 3HDTA 4FWIB 2NTVA 3B9QA 3C3BA 2CGEA 3OLWA 2GXAA 1GL9B 2Z1DA 3S2IA 4FOTA 3UV3A 1JE1A 5K3DA 4KN8A 3SSMA 1P1HA 2B2NA 4N3AA 1SULA 5JV5A 3L0IA 1FPQA 2O9XA 2INGX 4FTWA 3T15A 3I61A 4IB4A 3GFSA 2AZDA 3QLVA 2YLGA 4P2BA 1P5JA 4R8SA 1CIJA 2F1HA 1H7IA 5KVSA 4MXDA 3GHHA 4O4HA 4J49A 2C3MA 4MRMB 1F51E 2OFWA 4Q4AB 3VU3A 2C7BA 2JHGA 2PZFA 3CT4A 2V7VA 4FP9A 3VHLB 4HR7A 2GUGA 4BLSA 3CVYA 2YHIB 2QVZX 3ZEAA 1HZZC 2HCJB 3ZR4B 4PRYA 3O8CA 4PR9A 4LJSA 2XF8A 1ZSVA 3CBGA 1KQFA 3P9KA 3O8QB 5KWIA 4RV4A 2Z6AA 3FVYA 5FTNA 3AONB 3TK0A 3LHDA 4BNUA 1F3OA 3GFBA 1ABEA 1RQPA 3ZC4A 1Z0IA 4H3SA 4AUNA 4HO1X 5BNIA 1PEDA 3OZXA 4F4FA 5LDHA 3AM1A 1DLJA 3JQ8B 2VEOA 2X9NA 2YXNA 4MP3A 5TQ2B 3QHPA 5CVUA 5F23A 4EG6A 3O0TA 3DTVD 1YB1A 3EARA 2L0XA 5GWXA 3NATA 5IEBA 4J76A 1JPNA 4LDKA 1FFYA 5IM4A 4CM7A 1EI9A 2QOEA 4B4WA 2VUHB 1KAEA 1Z7EA 2XDAA 1KVQA 3O2QB 4XGKA 2GZRA 1U2EA 5C5IA 3QYFA 2YZGA 2IYXA 4GEGA 4ZXPA 3LBHA 2IZ7A 3DBRB 1EYZA 3EQLF 1ZSNA 4JU9A 1CGOA 3RW0A 2EX4A 4CTKA 5H5JA 1J97A 4JGGA 2NTYC 4RNCA 1SBYA 2PGLA 4DLXA 4MWZA 1Q0TA 4X90A 4G37A 4Z51A 3H11B 1DDOA 3I1JA 1K8QA 4K5QA 4KACA 3W8NA 4JP1A 2OXTA 3O75A 3K0EA 1QZXA 2ZAOA 1XI2A 2JIPA 1ZW1A 3A1UA 2Y6UA 5T64A 1IK4A 5IH3A 4AFNA 5I45A 2N47A 3DTVB 3ENNA 5G0WA 2GCIA 4L27A 1NN1A 4LXYA 2IELA 1CUBA 1G8HA 2PVCA 3Q85A 1CGME 2PYDA 2H2FA 4XWTA 4K87A 2L7AA 4OXYA 4PC2A 1VP3A 4CV2A 1DIRA 2WWVD 4CEIA 4ZT2A 4HNTA 1M72A 2NYUA 4BZWA 2QQFA 3MUEA 4UQOA 2CB0A 4O6YA 4URWR 3KYCA 4GOMD 5HZMA 4CV3A 3ABQB 1T3TA 2FUG1 1SZCA 1LNQA 2UVPB 1F38A 4EA8A 3TZKA 4OJKA 3NZEA 3OJ0A 3W6OA 1R4NA 1HMOA 3QOXA 2GEKA 2XTAA 5JWHA 2QSYA 1Z2CA 4GRAA 5ALXA 4KVGA 3GZTB 4M8KA 5BSRA 4DM7A 1CJUC 2OFOA 1E86A 2BAGA 4J0HA 5E33A 1ANKA 1TJ3A 5KYYB 5AGFA 4MQFB 1D1TA 2J5QA 5DN9A 4DWWA 2PANA 2BZGA 1S7GA 4XQEA 3OA0A 5JLJA 4NTZA 4YIHA 1U7XA 3LT0A 4P7GA 4PM4A 1QFJA 2IZ5A 3DB1A 3LJKA 3LF1A 4Z4EA 3KD2A 5I47A 1MIOB 3NWJA 1B2RA 1LJLA 1LQUA 1MCZA 4RGQA 4OMUA 3R0IA 4X6UA 4UZSA 5AVVA 2GJAA 1FNMA 4YT8A 2ZBDA 3A0UA 4N6GA 1JJBA 4KAXA 5JJKA 5IXJA 3EBOA 1ZUIA 5TF4A 1IAQA 2BI7A 3QX3A 4KODA 4N5HX 3SBDA 3IR6A 2ZBQA 3AKCA 1N3BA 3A4YA 1OBCA 2QN1A 1HH4A 2XNKA 1DE0A 2WU3A 5CHEA 3KKNA 1MIHA 5F51A 4A16A 3QPAA 2H31A 2FMUA 4X24A 4KV7A 3W5HA 2B35A 3KT3A 3W77A 3W5BA 2Q21A 1FFCA 1LX7A 1YGPA 2YHBA 2II6A 1YB6A 1RTKA 2YS7A 3ELUA 4LOLA 3AVYA 2AA3A 1KFEB 1TO1E 1GN8A 3RU3A 5B7NA 3NRBA 3PBKA 1Y7HA 3UB4A 5AKEA 1T1GA 2WQ7A 1H9BA 2X1HA 4AE4A 4OD0A 3VSAA 3EA5A 1J9ZA 1YBMA 2FVYA 3R41A 1DFHA 1SKYB 5I7AA 2AN3A 4R05A 3QKTA 4NS1A 3RM3A 3KYIB 2IH4A 1Z39A 2JIZD 3LTEA 2QTFA 1M2NA 3KPVA 2CZCA 1KSFX 3OLZA 3T54A 1NQXA 3KSAC 1HM5A 3GBSA 1IN6A 3GR6A 2D0DA 4MR7A 2FMFA 2OKGA 1U94A 5P21A 1RWNA 5M7EA 4ATNA 5IFLA 1VSTA 1XBTA 4LY0A 1CLEA 2HRDA 4FEYA 2NUPA 2JVIA 5B3JC 1DAOA 3K35A 3U9SA 2X1MA 2B1JA 1NW9B 1IHXA 2W71A 3SBOA 3ND9A 3LYUA 5DK6A 3B1JA 1W44A 2OG1A 4RESA 1FY2A 2XB4A 3UWSA 3GXBA 5H4HA 2WAXA 3C6YA 3FSJX 4KXVA 5T5QA 2I8AA 1YZGA 3MK31 1JGTA 1RBMA 1XZIA 1YQWA 4X66B 5KNDH 5AI5A 5D5HA 3QVXA 3TWOA 4MX8A 1T6IA 4K0KB 5KQRA 1KZYC 1GZ5A 1UXJA 3VC7A 3PWZA 3ZU4A 4OXKA 1G41A 2A5FA 4A82A 1GPWB 4Q1CA 4RUKA 2BUBA 5J43A 3OIFA 4ARBA 1ORJA 1MMFB 1H1LA 1U28C 2IOFA 1C8LA 2CWDA 2W93A 4W8OA 3DM5A 1MC1A 1R74A 4CCSA 5KQGA 3DMPA 4IEFB 4XUDA 5DCYA 2OD7A 3FCUB 2NXNA 3F98A 2J46A 1MR3F 4E2XA 2MSWA 3KQTA 4UBMA 1M0WA 5DGXA 3FHTA 5ENDA 4OFZA 3CNBA 1KZHA 2WYIA 2H0RA 1ZM3A 3H2UA 4JVOA 1L7AA 1TMGE 4EI2A 1Z56C 2Q7RA 1Y4UA 1HR0B 3AR2A 4F3KA 3AILA 2JFQA 2JJQA 3KKZA 5EWLA 3BWYA 1L0BA 3ZDYB 4Q47A 4KO2S 1DJMA 3SSOA 4ZAGA 3SC2B 1NP3A 3FFWA 1XZNA 2WVQA 1FMTA 3MJVA 1HDEA 3OCUA 3GT7A 3OF2A 3E0QA 2I66A 1XE3A 3G8CA 4DLSA 3HP1A 3DBOB 3STUA 5JYEA 1JAHA 1BOOA 3SX2A 4FFDA 3U3JA 2MSCB 1U7DA 1HY3A 2AB0A 5FI5A 2P2SA 3GWLA 1U9ZA 4TWAA 2AOUA 4ZVPA 3THWA 2FPOA 2VYVA 3V5ZA 2LSEA 2GCPA 4CDYA 4YONB 1OI4A 1V6SA 4BO9A 2B21A 5BRJA 2VCYA 3QKWA 5COBA 1UJNA 1M9NA 2ALJA 4MB0A 2BKXA 2XVAA 1UT6A 1L7CA 3V8PA 2G08A 2Q1UA 5IABA 3FH0A 3LUBA 4JEIA 4CIPA 1JYFA 2WY2D 1VRCA 5EHHA 2PUCA 3X1JA 4PRKA 3FSGD 4N65A 1D2RA 2I65A 1GKKA 1D2MA 2Y1KA 3QLJA 3ZX4A 2JIDA 5KTKA 2O19A 2DWUA 2O8BB 2JI4A 3TTWA 3CZAA 3P52A 1IAVA 3T1VA 1TD1A 3AXSA 2QNIA 2GO1A 4PO8A 3RQSA 3UJPA 4I4NA 2EILC 3BBLA 1VKJA 2A5GA 1RVV1 2WIDA 1H93A 3G9UA 1O03A 3LPMA 2EJUA 4QPDA 2OO5A 3ICWA 4C6TA 2GWRA 2BGKA 3AF5A 1SU8A 3SHOA 5A5GA 1QJCA 1N5JA 1EGMB 5M04A 3G0HA 3GFPA 2Z3VA 5BQ3A 1UBHS 4J8PA 4F06A 4DR4B 3ZQVA 1AM4D 2MSEB 1W1IA 3NH6A 4DWOA 3I9FA 3IA2A 4B46A 3LZ6A 1E58A 4H7FA 3K2EA 4DRZA 4JLAA 5CH8A 4EKDA 1RKCA 3D4NA 3VGJA 2OAQ1 3LYLA 1NQWA 1DEKA 5EN4A 2B7CA 2PT9A 3LHFA 2ZRIA 3AY6A 3WB1A 4FFVA 3TNYA 2YWDA 1ORHA 1YR7A 4YL0A 1YDEA 3ZIAD 1ZL0A 2O5VA 1KI6A 2ZXOA 3ASVA 1YBVA 3VU1A 3T9OA 4NCBA 3CZRA 2G8NA 1T6ZA 3AT1A 3E22A 5EUCA 2XZOA 2VSXA 3HN7A 5JS6A 2HQOA 3A4TA 3WADA 4UNPA 2RH8A 4LF9B 1OT3A 1X42A 1JHVA 5KQSA 2C3YA 1APCA 1HQCA 3BREA 2FW7A 4DA4A 1FMCA 2XTNA 1L2TA 5GM1A 2NU7B 2IUTA 3I28A 2XOKD 4ITUA 4ETWA 2G77B 1CP3A 4F97A 1ZRNA 4PX9A 4IO0A 3B82A 2IBFA 1U8YA 3I9OA 4ZRDA 4YRNA 4IJ5A 1A4XA 1EDEA 4K0RA 1C3JA 4KC9A 4OHRA 3VR6A 2G76A 3GLSA 3V8EA 4B71A 1KRHA 1X7WB 3VU8A 1HMPA 3K8YA 4TLBA 3QMMA 4P81A 2C58A 4W7SA 2X8LA 3CJQA 2QZJA 3ZIDA 3JQEA 2X5NA 1R66A 4ONEA 1WHTA 5EJMA 4OD5A 4D0NA 4ME6A 2SHKA 1XB2A 3FZYA 2GJKA 5EMNA 3IAXA 3AUFA 2P4QA 1WG8A 1WZEA 4L9RA 3KQLA 1RKUA 2YWFA 1G20B 3ESAA 2EFYA 2QLMA 2LV8A 1UKZA 4JLOA 3RU9A 4O4JA 4R84A 1YR1A 2O06A 4REMA 3RSSA 3ZXXA 4BFTA 4JR0A 2RGUA 2K4MA 2XDQA 3EUFA 1EX7A 2HU7A 4CIVA 4ZZ2A 1NX9A 5G1OA 1ZS9A 2CFCA 4M9RA 4R0NA 4GOND 4EFNA 3DFFA 3ZTZA 1QVZA 3S28A 1FFBA 1RFGE 2OWEA 4ZICA 5F9HA 1SGWA 3PNKA 1T9AA 3I9NA 5JVDA 1DKOA 2ZXUA 1QE3A 4XR4A 2G4LA 3W2IA 2AKYA 4PC1A 3JYNA 2NO5A 5F7XA 3X1KA 2PVSA 4TQGA 3B1FA 2R2AA 2WJWA 2O2XA 2FQWA 4Z4HA 3KK0A 2I8LA 4AQDA 2WYHA 1P3Y1 5K6RA 2WC1A 4C3BA 5EQFA 2LDBA 1UODA 1L7RA 2WAOA 2JEOA 3K1AA 1FCJA 3WAGA 5JRAA 3VR0A 4ECEA 3B0UX 1CVIA 1NNEA 2JCSA 5FOWA 4KJZA 2BM1A 4JXXA 3WO1A 4GX0A 3HBNA 3RVJA 1Z5PA 1MX1A 1HSZA 1TUBB 1ZESA 3QU9A 4YRKA 2BGJA 4ZVOA 4EHPA 4K88A 3ZU3A 1QR2A 4Q3KA 1BMDA 2VTBA 1UEIA 4MS2A 2LIPA 2J9WA 2C1XA 2BFNA 5LP6C 4G5XA 3U5ZB 4E31A 4KZKA 5FO0A 1R0WA 2W8BA 4KSBA 2V7PA 3HXOA 3CWQA 1RI3A 1YIDA 1ZHZA 4X8MA 2PMFA 4EK9A 3QRWA 3WG7C 3TQSA 2VWPA 5BR8B 1B41A 1G8MA 4IUCS 3OJXA 2AFIE 5I9LA 1Z6TA 2LD6A 4Q1BA 3ZWQA 1D0IA 3F74A 4HZGA 4J0KA 4ND3A 4RJLA 3H1BA 4QLAA 3CYFA 4AF7A 1CVLA 3ZJ5A 2QRNA 1ISGA 3OPXA 3O9ZA 2QD5A 1RXIA 1S9HA 4TLDA 3L6UA 1TYDE 2WD7B 3PCRB 2V1UA 4QYXA 4JEAA 2QI9F 3DB2A 5ER6A 2XOKA 5J2UF 5C0OE 2C5SA 4Y0NA 4EHLA 1AGRA 4UE3S 4D0RA 4FYVA 4U2CA 1ULAA 3A9VA 1SIWA 5A6AA 4KDFA 3V7WA 2PVPA 5JNVA 5K8TA 1HW1A 3DHNA 4PG5A 2R6JA 2WUDA 2EIJC 5KO2A 1SKBA 1C3XA 4QYSA 1MV5A 4UOEA 5JMTA 1XTKA 4MI9A 1IOZA 1XTIA 5DX1A 3U40A 3WODF 1R0SA 2DKFA 2J0EA 3TH5A 4D1YA 3U3RA 1FJHA 1LVUA 4JNCA 3K1IC 5EY5B 2V6IA 3VKUA 1ETHA 4GP7A 1MAWA 4Y2RA 4N5LA 2PRKA 4R1LA 2OZLA 4EY5A 1S7ZA 4GLBA 3E1KA 4NTBA 4N6OA 2FW6A 3BUSA 3PNPA 5COQA 4D57A 3JD2A 3EXG2 3YASA 4NV3A 3OLYA 4KI7A 5E7QA 4RU1A 3KEQA 4PN3A 3UJ3X 1P2DA 1HE2A 4IG4A 1JH9A 3DJNB 1SB8A 4BJ6C 1KI2A 3KQOA 1HZZA 1GA1A 3O5AA 3KLPX 3IJRA 1MB0A 2IEIA 2ONJA 3CLKA 1I6LA 5JHHB 1CQJA 3MAAC 2XJ9A 2YVKA 4FEGA 4J16C 1YB7A 3DNPA 5JJBA 3RAJA 1RJEA 1TTHA 1E63A 3KYDB 2IY7A 2Z4TA 1WATA 1U0EA 3MZ0A 3A3OA 2OLKA 4X6LA 2FOXA 1R5OA 2Q3EA 2VHCA 3PFGA 1FFEA 3EAGA 5E6RB 4BGVA 1N0VC 3U7HB 1G16A 3ZXYA 2ZIWB 1N2BA 2JI8A 3ZWBA 2VUSA 3DZDA 1SXQA 4YXWD 3AKZA 2E89A 5JMWA 3LUFA 3OQIA 2PZGA 2A0FA 4JYPA 4RDXA 4LTMA 4BFWA 4O2RA 4DVGA 3ZD7A 4XLNF 3ZE7A 3GDWA 4CEJB 1YO6A 1TVEA 3FPGA 1TC1A 4N0MA 1LFDB 4G26A 1JHYA 4L75A 2A84A 3D31A 2HA3A 4OREX 1R2QA 3WP0A 1LA2A 2YYZA 3GPIA 1Z4QA 2PX6A 3LLCA 2EWWA 5D91A 3E81A 4JZAA 3KAPA 4XEHA 2D4UA 1LU9A 2JEZA 3QENA 4F2GA 3M3HA 3KOOA 2QR5A 3U4QB 3W8HA 4KFTA 5I8PA 3KPJA 4LGVA 4U3JB 5B4VA 1J0AA 1LDGA 5BSWA 3WRVA 1NQTA 1JMWA 3PWKA 4DB4A 3NP9A 1AZSC 4QARA 2WVNA 2BMWA 5LBUA 1U4NA 4CIBA 1F8GA 4UNNA 2R4QA 3BSFA 3OBBA 3I37X 3C48A 1MMNA 2G88A 2XMSA 4JJKA 1USIA 1Z4OA 2JVKA 3P2YA 2NYVA 4P0PB 5HRCA 3MNFA 4BNNA 1JHQA 3PWTA 3WO0A 5HBRA 2AGVA 2H6EA 3G2KA 4BVLA 4MRPA 1NKTA 5AK4A 2C4MA 3U9MA 3R76A 2C9YA 3TUJC 4PNPA 2XWQA 2P6PA 1U0JA 4HVCA 2YXDA 2AD5A 3IE2A 2NNWB 2OHVA 1X2BA 1XQ1A 4I3FA 3JTLO 1WLYA 4O25A 3BHMA 4ERNA 2X6RA 3ESXA 2R8OA 2XITA 2IP1A 3ILVA 2Q0XA 1MNAA 4FKZA 1K2VN 3JVEA 2PKQP 4LECA 2IYWA 4BLRA 4GI2A 4LF5B 5JCPA 4HDRA 1ZK1A 4MLCA 2NU6A 4JC4A 2BKUA 2J3QA 3I05A 1GOTA 4HY3A 2PZMA 1NP7A 4HB2A 3TOSA 4OF4A 4HUJA 5H68A 2PZEA 4PIMA 4X6YA 5IT4A 1VDZA 1G1MA 4GQAA 4HXFB 2WUFA 1R6AA 3PICA 2IIPA 4NMXB 1VZ2A 3LHKA 4UZFA 4CS8C 4Y2TA 4RCVA 4BLWA 3GDGA 5JCJD 5C8ZA 3GFTA 2BOVA 1XL0A 3DE7X 3WLJA 2OK7A 1EVKA 3SMVA 5IEJA 4K6CA 4RZXA 4NZYA 4RZ3A 5FFNA 3IJEB 3MQFA 1TFKB 3REOA 1YVRA 3AHFA 5JNRA 5JCXA 4G5RA 4YNBA 3VYWA 2YOGA 4LJLA 5AK6A 2R47A 3UBMA 1GPBA 1WULS 4D6XA 2EFEB 4JWTA 3IBGA 2QTAA 4Y2GA 4JBYA 3IAS1 1NWHA 2C2GA 2G67A 5IT5A 2VZ8A 1T2VA 2H4XA 1QU3A 2IHVA 4MDEA 3QFTA 4MQ5A 1A9SA 3HU3A 1UAYA 3OSZA 4MV6A 5CLFA 3HYNA 2P9ZA 3EFBA 5J63A 2IEZA 1V35A 4Q7KA 4RHEA 2HBQA 4C3ZA 4Y1RB 3KVVA 3AKDA 4FHCA 5DM0A 5EAIA 1OLSB 4KYIB 4LFCB 1VQ1A 4YBZA 3DE4X 3FA2A 5HXAA 4WZZA 3OZWA 1G64A 1QO7A 4ZKEA 3RT9A 5T6MA 1EE2A 4Q34A 4R1PA 4HI0E 1YUMA 5B3JA 4BFLA 4OD4A 1FMJA 2PIAA 1UXHA 2WM8A 4NU6A 1JSXA 1NI5A 5CH3A 2FCRA 4G01B 3W7BA 5AW0A 3T5BA 2EFHB 1V95A 1LD3A 4FX5A 1ZA2A 3TINA 1R6VA 1DBSA 4IQFA 4MS4B 3QU7A 4J1SA 4ZAZA 1H1TA 1SKMA 3KEMA 1W1UA 2QYHA 4UNRA 4DRJB 5DN6D 4R6XA 4WCVA 1SKQA 3AR5A 1GZ7A 1MO4A 1HDGO 2N1BA 5HZHA 5JWOA 4Q7CA 1T4BA 1A27A 4EUNA 1QX4A 2QN8A 4IZHA 3TZCA 4JROA 3HE3A 3ZHZA 1SBNE 3PFWO 1EMDA 3F3MA 2X9QA 4WLOA 4B7ZA 3OEOA 2A1UB 2QW8A 1Y6ZA 1U28A 3EPLA 3THYA 3HCFA 4MVMA 5DNCA 4IXDA 2ECPA 3PPIA 1YDHA 2ZK7A 4TVSA 5TRTA 2VRNA 2NTNA 1SOMA 3NETA 4DDTA 4HDSA 3G3EA 2NWQA 1RAEA 3QE0A 3ANSA 3MMPA 2ZETA 5C32A 2C2XA 3NOVA 2JZCA 1ZGHA 5IDQA 3BILA 5J2TB 2WWTA 3MVEA 4FS8A 3FF4A 2LIGA 4FFOA 3H84A 3HGMA 2IEAA 2V96A 1G9SA 1AZLA 3ZY4A 3LECA 2X40A 3LF2A 4R9NA 4II2A 5FQOA 1RXVA 4S2EA 5E4FA 3FSEA 1F9AA 1LF5A 4DR6B 3AF1A 5SYMA 3WIEA 3FCSB 5KZMB 3C1AA 2H4YA 2A69F 2WYOA 3RYHB 4DWVA 2QRLA 1CR2A 1ZNZA 5KYXB 1N8SA 1FP4B 2VH1A 4QWWA 4B73A 5A1JA 5AHKA 2NLOA 3DMTC 1JPJA 1NTOA 2CLMB 4HNUA 3BRQA 2CL0X 4HH0A 2WHRA 3L1HA 3T0IA 4S1VA 5CT5A 4KR3A 3IP6A 4JI0B 4B87A 4UEKA 1DQSA 4CCAA 2WZCA 3TW0A 2O0KA 2JLRA 3L6OO 1CR6A 4G0ZA 1YQ9A 1CCWA 2HPZA 2WSSD 3EXIA 4GW3A 1AS3A 3C1TA 2Q2VA 1CETA 2FF5A 2ZDGA 4FCVA 3QEKA 4IQ4A 4QDKA 1T0HB 2I87A 2Q50A 2WKSA 3I6ZA 2JCYA 4IP0A 4L1KA 3TGPA 3C8HA 1WW2A 4C08A 1E1CB 5DJ5A 3M34A 2FPRA 4RPHA 4EG4A 4MW5A 2HJVA 3GJQA 3AHCA 1SD5A 3AJMA 4W7IA 3RH3A 1P72A 3MGKA 4DW8A 1ORTA 4QDLA 1TCBA 3GNTA 1S5PA 2NTEA 1O96B 3SE0A 5KKAA 1ZLYA 1A8IA 3RJTA 2BDEA 5SY4A 1T4GA 3PDIA 2J45A 3TJZA 4LS3A 1VCMA 4OKSA 2VH3A 2O0HA 3QWFA 1M5TA 3PC3A 4TSFD 3I6IA 3Q6NA 4I99A 2ZJAA 3H9CA 1EWRA 4NENB 4AX4A 4N03A 3CUKA 3TLYA 5BSHA 1M2FA 5BWBA 1Q0ZA 3O8DA 3Q12A 4OJYA 1TR2A 3STWA 3DDOA 1JEQA 1TYEB 3QPWA 2ZB4A 1OX4A 3AVUA 4RVHA 3SG0A 4YQFA 1AIPA 3CM0A 3ON5A 4BEBA 5LOVA 4V0SA 4AWXA 1QU2A 1Q0LA 4C4RA 4JLPA 5HE9A 1UOQA 3U3BA 1KMIY 1Q74A 4CM5A 1W4CA 1ZONA 3C7TA 2WB4A 3NMIA 1FVHA 4BLTA 1BA3A 3R3XA 2XPCA 4GR9A 4N82A 1MQ9A 3VSBA 4C04A 5KC8A 2V6BA 3L7NA 2HF8A 4PLWA 4N0PA 3VFDA 5LCXA 4M9UA 2E4WA 4KSCA 3ZQ4A 4GZ3A 1YA7O 1GVHA 1KQOA 1U31A 2OEVA 5HW0A 3FCOA 3PL1A 4GI5A 3SS8A 4CGZA 5FPQA 1BMFD 3W1VA 1P74A 1Y3DE 4P7KA 2HU2A 3RKUA 3CUWA 1CRQA 4EHFA 1OU0A 5D00A 2A78A 4P33A 1DINA 1K97A 1ESEA 2C0CA 2QYTA 5DYYA 3OMWA 1PD0A 1GKUB 4CM3A 3IALA 3HZRA 4UDYX 4WZAA 2XRZA 1D4FA 4PZYA 3MJCA 2I2WA 1EFRA 4C4TA 4ULWA 4C5CA 5KJ1A 3ER9A 2I2FA 1TUEA 3SZMA 4WXYB 2WW8A 2ZRBA 2FEMA 1YRLA 1ZN9A 3UGQA 2YICA 2OUKA 4C7BA 4C5AA 1CRWG 5DASA 1QOPB 3TLBA 3A2KA 5TPWA 4RAOA 3ONVA 5EKTA 3PLRA 3MLGA 3W5JA 5JI3E 2FMXA 4BFXA 2VDMB 4CW7A 1NUTA 4DFDA 3A4LA 3IUBA 3DBLB 4H60A 1GCUA 1N7HA 2FK8A 3U2MA 2PFSA 3ML1A 4GPIB 5K0LA 1ZRMA 2QL7A 4YMHA 5A6SA 1SPBS 3QV2A 2W9YA 1U0FA 2W98A 4BN4A 2YWGA 4PLHA 1T5BA 5GZ3A 2WM2A 3POVA 2OK8A 1U5CA 3Q3JB 3CLHA 1GKLA 4TN5A 3QE4A 3L0IB 4CKXA 1XEFA 4ZVLA 4U2DA 3OF3A 2HMQA 2VJOA 2DFNA 5KIAA 3I9V1 4NABA 1BGWA 1W49A 1SG0A 5CDGA 1TMKA 5JAOA 1U81A 4CS9C 1YJQA 2O2YA 1OIVA 5FPTA 3FWYA 1U6KA 4Y6GB 1VKOA 2ONYA 3A58B 4M0KA 2X0NA 3BJZA 3TTUA 3KKQA 3WICA 1PJAA 3NUQA 1AVOB 3RS0A 2J30A 4F3CA 1ENZA 4QBKA 3GFVA 1XP5A 1W4AA 1ILWA 4TQUS 1NRIA 3FI9A 1CUDA 1G17A 3KPHA 4G0PA 4L9AA 4LDZA 4EFMA 1DXHA 1AGNA 4Q4HA 3B9PA 4KO1S 4MVZA 2HL6A 2C3UA 1TEHA 3GJ7A 3D81A 1P1JA 2A9JA 3GAAA 4U02A 3HB1A 4Z7NB 4IEEA 2BELA 3OT1A 5IH7A 3UOAB 1SELA 2OVFA 4O2BF 1GG8A 2A6EF 2IUEA 3GGPA 5I7FA 4E13A 1ESCA 4YLYA 3ZCUA 4JA2A 5IJXA 3ESZA 3WNBA 4URXR 5LP6A 1C4OA 1UC4B 2ZI3A 4ZCTA 3VDNB 3O21A 1OH6A 1B26A 2XMDA 1VJGA 3GEEA 1IBMB 3UAXA 5EHIA 3OX4A 3PC6A 2C84A 3R7WA 4V39A 5I48A 1WWPA 3ANYB 4J75A 4OMDA 2D8AA 3Q2KA 4KK3A 4UCQA 5LDGA 1UFVA 4CL2A 1BMFA 4EHAA 3K0HA 5LKAA 4PZ9A 1TMYA 5BSEA 4K9OA 3IXLA 4J4BA 3AUTA 3Q6MA 2X5JO 1YU6A 1ST2A 1H2EA 1R6XA 4EMSA 3US6A 1DDIA 3M5WA 5JXWA 5AJVB 1H22A 4DGSA 1VL8A 3MWDA 4UXJA 1RM3A 2CXUA 1T5LA 5CHYA 1DKRA 2YX1A 1QH1A 1BMQA 3BHIA 3WGGA 4EYQA 5HMMA 4D8XA 3CV3A 3C6ZA 2I8CA 1Z3IX 2ZIEA 2FLWA 4JP8A 1IN7A 2TS1A 3T1OA 4EEZA 3AXTA 2JRCA 3ZHQA 2O5RA 3G5TA 1F2UA 3AUSA 4CEIB 1TJYA 4NBRA 3C3KA 1K08A 4DR5B 4EEXA 3QEBZ 3LL7A 5DHAA 3K1IA 1B8NA 2B82A 3KYCB 5IVKA 2BSQA 3NPAA 1MH9A 2QUKA 3QI7A 2BGUA 4WRRA 1Y8AA 2BFWA 2EFGA 4LVUA 2QVLA 2HJSA 3PIRA 3L0BA 4M1TA 1WKVA 5SZIA 2IYZA 1MQ8B 1R4NB 3Q98A 2BFBA 1WVIA 3LBNA 1F20A 4Y6OA 3CG4A 2GN1A 2VZLA 3HEMA 4NE2A 4BJ6A 3QOFA 5EE0A 1KR5A 3BMCA 3PXAA 4PYRA 2H3EA 5THQA 2X7HA 3SKYA 3ICQB 5IBRA 1Q1EA 2V9PA 1N92A 4AX8A 4MS1A 4U2EA 4J16A 4Z4GA 4J7XA 4H7HA 2C5GA 3RVPA 3SD7A 1T9GR 4KQKA 2FWIA 2YMQA 2AT1A 3Q8KA 4WERA 4ETNA 4XGNA 1N77A 2X4LA 2C0PA 3EIXA 4QE3A 4DOMA 4DLZA 1JP7A 4BNGA 3NMKA 1R5NA 1V3TA 5TQ0A 4N3CA 2VDQB 3IA7A 3GYGA 2GCOA 1OI3A 1NLFA 2C1ZA 4RE5A 2P9FA 4Z9JA 4TS1A 2YDYA 4OKNA 3V4LA 1Y7PA 4PEVA 3FDXA 4UUMA 1EVYA 4LSWA 2XD9A 2JLQA 1OZAA 3IPMO 1LS6A 5EHGA 1BE0A 4KPEC 4AY2A 3A2LA 5AVWA 5FHQA 3R2JA 2AUMA 2VNJA 4WLNA 5AVZA 5DI9A 3U9LA 3JAKA 1UPBA 3L1UA 4F4CA 4YROA 3M2PA 1Q0GA 4QAQA 3ZHTA 3ETGA 2FP4A 2O2DA 3WIUA 1XRRA 2GK3A 2MJLA 2OFFA 5IAEA 3KSDO 4D45A 4AE4B 3LAYA 3J7AC 2N9UA 4RW0A 3KTAA 2VP5A 1R18A 1QQ3A 5KC9A 4PFPA 3MRSA 5CVDA 2UZAA 1CPYA 3AV3A 4FE7A 3M89A 4EHKA 1N1MA 4LRSB 3N76A 2BMDA 1LBSA 4NZMA 5IBPA 5B36A 3HBJA 1IZ7A 2M2IA 1G4UR 2GWWA 4MR7B 2JA1A 4ZI7F 2XOXA 3AUXA 5ALGA 4K3VA 5LMCA 4QIHA 2QRQA 1J2JA 4U00A 1L5LA 1JH8A 3LLVA 2NUPB 3G0IA 2X0IA 3ZZNA 1X87A 4NG4A 2ZEJA 1SH7A 4KUGA 3CH4B 4U2BA 3DE8A 5HCIA 1R9JA 1I3NA 1ECFA 3JWJA 1DP4A 3TW8A 1GTVA 1UPTA 1DX4A 2FXIA 5DB4A 4LC9A 4C7KA 2KS6A 1WBJB 3FTDA 4R83A 2FAPB 3K72B 4OGWA 2BHLA 4LBVA 2H48A 2XDWA 4ML3A 3QF7A 1B8VA 4NI5A 1GU0A 5C8YA 1MEEA 3LT2A 2GAAA 2WABA 1EUCA 2WZDA 1XD8A 5FR1A 4IDQA 2G1AA 4Q24A 1J07A 3WLTA 3F0TA 1XTBA 5EIEA 3IVCA 2H4ZA 2JGEA 1H1LB 3MLEA 3BXOA 3BWVA 3C1OA 5BO5A 5HOQA 3BQNB 5E3AA 1ULHA 1V2HE 1PWXA 2JKVA 1J70A 1E9CA 1NFQA 1QG4A 3DT8A 1PQYA 1FB5A 3NTQA 1NSGB 5G0UA 1WPQA 1XJCA 5LBIA 4CS8A 2XM0A 4DR7B 1XAHA 4ID9A 5KI6A 4R1SA 2XYVA 3UW3A 4A2QA 1YWGO 1SUDA 3PTZA 4WWHA 2O2JA 3JZAA 3CC8A 2FLKA 1WMDA 1NKVA 2GM9A 1E7QA 2EWMA 5AVTA 2ATXA 4NDAA 2YWBA 3QTTA 4WK2B 3KXIA 2Y77A 3HXLA 4E15A 3KRTA 4XTRA 1JT2A 3AF3A 2DUNA 4L8YA 4PK4A 1PJSA 2VYVD 2HAEA 1WBDA 4PO1A 4R8LA 1QF6A 5AC4A 3EUAA 4Q9LA 3GJXC 3ORQA 3UMJA 3A36A 3AG2C 1XMSA 1JECA 4RTSA 3CF6R 2AVKA 1GGEA 1M1NA 2PT5A 3MGGA 3EZGA 1N2GA 2N0SA 5PGMA 1H1DA 1NXPA 1JEEA 4ZCSA 1U9JA 2GCNA 3DWIA 4XWOA 1IXSB 1WCIA 1ZW6A 1ZN8A 2GK7A 1OWPA 2C99A 2HFIA 5J5AA 4NE9A 2EBHX 2RHWA 1VHDA 4IXTA 5CNJA 1I8TA 3DFZA 2LQGA 4I2NA 3MELA 2EARA 2I62A 4XIGS 1PGPA 4AF8A 2O8DA 3LE8A 3QXSA 3ZHCA 2G0NA 3WJAA 1EDOA 1GNLA 4EZBA 4E22A 1UC5B 1KPGA 5G3YA 4HFNA 3HKEB 5K6AC 4UMFA 2AOUB 4YV0A 1D3AA 3THWB 3WGTA 4TZ6A 5I51A 4P4NA 3FTEA 2YZKA 2OC4A 2GKOA 5CIVA 1KMNA 4DJAA 5E9WA 1MXHA 4DCNA 1BKDR 4AYXA 1Z7Qc 2C77A 3FPEA 2FPWA 2I15A 1XLUA 1VKNA 3N7AA 1W73A 3ADCA 5LKRA 3DDZX 3ONFA 1L1FA 3O4IA 4J0EA 2O3JA 5AKYA 1E2HA 4IIYA 4FYMA 3TCKA 1TU3A 1TIKA 2NNLD 2VDUE 1VG8A 4PFOA 1CY8A 4LI3X 4DM4A 4QULA 4WVLA 4Z53A 3E15A 3D6AA 2JFVA 1TW2A 1VPLA 1DEOA 4AZSA 3DFUA 3T9DA 1L8AA 3FUWA 3I64A 1EJ2A 4V24A 1MNEA 4G1VA 1G1AA 1JEOA 1WSDA 1X8KA 2BC5A 1N6OA 4XQ1A 3A25A 1AH2A 2BJHA 1V74B 4P08A 1IM2A 4DDMA 4TUYF 1ZR4A 4F1KA 5DLJA 4C6TB 3G9QA 1E3JA 4KWIA 3JRXA 1FP2A 5TMBA 4HRVA 2UZ3A 2H07A 1OR3A 3LT4A 4EA6A 3NIBA 2X6TA 3AY7A 2DUWA 3T06B 3GJRA 3UJDA 3WK5A 2Q3FA 1Y81A 2QSJA 2O2GA 2XUZA 4D9HA 4HQKA 1E1KA 2HIGA 2B78A 3C98A 2RGEA 4QTTB 1QBKC 2IPOA 1NUUA 1GD1O 3R7AA 2P6NA 1K9VF 4OHCA 4E5PA 1OPXA 3HK2A 2HHLA 1KI3A 5D87A 4JKYA 1FFTC 3ABKC 3KL4A 3EHDA 2X13A 4QD3A 3DH0A 5BXYA 1CLUA 1BR2A 5ANRB 2WQ6A 1W0CA 4OL9A 2WYUA 3N70A 2O8EA 2X0EA 1PZHA 2CMDA 4JQOA 3VZPA 1U2DC 3I2FA 4IYRA 5DS6A 821PA 3VR6D 3QEOA 3WWDA 2KI5A 1GQAA 4PYOA 2C7GA 1HNNA 1PWHA 4J3NA 5LU9A 4TMZA 3E22B 4WK4B 1FQKA 1D6SA 1A7VA 3NHBA 2RG1A 1A4UA 4Y1EA 3H5LA 3DMTA 5EGYA 2CHUA 3WLLA 1YQEA 3ZJ4A 3E3AA 1ZMBA 1FDIA 1WUKS 2P3LA 2HJRA 1Z4KA 3AP1A 2PKWA 3HN2A 4DLTA 3DCYA 3BB4A 4R01A 3W5SA 4JJEA 3ZKAA 2WSYB 1XCGB 3WWEA 1E96A 2ZI4A 1XZAA 4IIBA 1ORSC 5JOQA 3UA3A 1BNCA 2AU5A 1HFWA 5EJAA 5BW8A 1E1MA 5CFMA 4Z4QA 4Z9XA 3FNGA 4Y2JA 3JYYA 5AW7A 5CT4A 3AVVA 4GNKA 5COGA 4ZGGA 4BJ5C 1E7YA 3TKYA 4OYLA 1N6HA 1UIMA 1FUKA 2ZUVA 4JTAB 1UBSB 2YL1A 5JTTA 3F49S 1KVRA 3G17A 1DNPA 1XXHE 1WHTB 3JZMA 2FVXA 2G9QA 1L7VC 1K04A 1HOXA 1ZNWA 4B84A 1I9GA 2QPAA 4YMGA 4ENVA 1Y6QA 1ZD2P 3GUYA 4P58A 5WRFA 1AC5A 4URHA 3B0VC 4Q7LA 5F1OA 4MV7A 3EGCA 4HYEA 4GPBA 2D62A 2JAQA 4KQCA 1OHHA 4AZTA 3KX2A 2IU3A 3E9QA 4O4JB 4OVKA 4BQSA 3HBLA 2TMVP 2CKDA 3CLRC 2P62A 5F9FA 4JTDB 2FHSA 4L73A 5FLEX 3X3HA 1PWEA 1XAJA 3LPNA 4B80A 1CDDA 2OD9A 2LBPA 1GFWA 5KSZA 2J9XB 5EIFA 5JVDB 2XZLA 1WU7A 1EUQA 2CDBA 5FTMA 3TX2A 5HZGA 3RDPA 1Z38A 3T61A 3DLAA 2EJTA 4WGYA 1UT5A 4ZOQI 2MT9A 3C4JA 1Z12A 2J4CA 2OFPA 1FJ2A 3PF8A 2JIOA 3H04A 5F5HA 5T8KC 1T10A 3IUNA 4BLOA 2CXOA 3NYJA 3K1AB 1HYGA 3LC2O 2XGSA 4E5KA 5LZ2A 4C6SA 4UM9D 2HBYA 1C7IA 4NMHA 3S27A 2F3TA 1IWPB 4TN1A 4GXNA 3D8SA 3WJ1A 4EI9A 3R40A 4Q66C 3JQ7A 1H05A 3I5AA 2VPZA 4OXQA 4TXHA 1Z4MA 1DC8A 2G36A 4UFNA 1B0UA 1OFVA 2VTBB 1M0SA 4ASUA 4JMLA 3BWEA 4D9JA 2OECA 4LBYA 2CL7X 3LKVA 2XE8A 4XD7A 4FONA 1JXQA 3MRVA 3GAMA 4RLFA 1E62A 1WMEA 2W8BB 4P54A 3LRXA 5FH9A 3PIDA 4ESEA 1T01A 3U0BA 3BM5A 2DZDA 3HKCA 3MIZA 3RG2A 2XJ4A 1C4XA 2P2LA 2BJVA 2CHEA 5FF9A 1EX6A 2AFRA 5A03A 2D4HA 2DF8A 3ANNA 1LB1B 4MTCA 3G2LA 1MB9A 2YYYA 2EKPA 3T8YA 4LNHA 3NRHA 1DCMA 3AU9A 1G291 4JOCA 1HTTA 2R7QA 3ROZA 4BO3A 4KAFA 4JI2B 2BHTA 2ZKLA 3PHHA 2QDKA 4MW8A 1RYBA 1N34B 3CU5A 4G24A 5K3SA 3SQNA 4OBEA 5AJWA 3KOXA 1XTZA 3GIWA 4IZOA 3ZWWA 1P62B 1EX9A 4RVFA 4YDHB 3TB6A 3ATPA 4ZO4A 2PP4A 2AX4A 3DMFA 4CJGA 1ZNYA 2I2CA 5FHRA 3OICA 3WK8A 4BP3A 1OXKA 4EWLA 4GBMA 5F12A 1IATA 3IDQA 1XKXA 3DFIA 4BNXA 1NMYA 2G8LA 4OU5A 1ZMRA 2H1SA 4MW0A 2YRXA 1L4KA 4UHFA 2X42A 1JJ7A 1XMIA 2OZLB 3ZE0B 2I2BA 4EG7A 4CS9A 4D80A 1GDTA 5DISB 2EP8A 1KI7A 3K9NA 2VF5X 3D7SA 4GZMA 2TYSB 4O5AA 5DS4A 2UUOA 3MWYW 3BTSA 4V0LA 2CBGA 3C2QA 2BR4A 2ZUBA 1W88A 4OBBA 1GEGA 3HY3A 2JDIA 1USGA 1H2WA 3TOVA 2QGNA 1XMPA 2H1LA 2QZPA 2Y4OA 2M1XA 4FYYA 1PYGA 3NDBB 2FLVA 3K6BA 3ZU2A 3EZ2A 3MBOA 4XPIA 1YRQA 1UK6A 2WJGA 1UBUS 3M2TA 3O4JA 4CNBA 1GFSA 1HEUA 3CUYA 5J47A 3AGPA 1KEVA 1ADGA 4I7EA 1Z2DA 4YRLA 4NQFA 1A8SA 5IMBA 3AZOA 3P0IA 2C00A 4GOOD 3NG1A 2NP7A 3JCUQ 3CX4A 4ZRNA 4YP9A 3OQIB 4MAMA 2B5VA 5ALUA 3TZEA 4X1YA 4MV1A 1VE6A 3CVWA 3NP7A 3NHRA 3P5SA 2FHPA 5FWYA 4GRIA 4KG7A 4YAEA 3N5KA 2ISSD 1PL8A 3CJRA 5KTMA 2YCLA 5JAQA 1WQ4A 3UAVA 3R3JA 2RHJA 1RT9A 3EY9A 1C30A 3QTHA 2AW5A 4S05A 4EA9A 2JIMA 2HV8A 3GJ8A 2YXBA 4XGRA 4QJ3A 3VR4H 3WA7A 1Y89A 1I2ZA 3ZE9A 4TMXA 1QV7A 2P79A 1ZOSA 2GRJA 3LQRA 3R6DA 1AQNA 3R9WA 3SXUA 4ENSA 3OJFA 2H59A 4NZNA 2QYSA 1QSPA 5JARA 3D7MA 2QLFA 3FYDA 3NKLA 2ZUWA 5BR7A 5GOTA 4CM9A 2AFHA 3S2EA 3ZKWA 4D3FA 3H9BA 4LBZA 2B4KA 7MHTA 3FOCA 3N0WA 1ID8A 2ZVPX 4WACA 4CMAA 1Y3CE 4QUDA 4YJ3F 3LT5A 2XYPA 2GUWA 1H66A 2OL4A 5T4EA 2FX5A 2XB8A 2DWOA 2K2QB 3QW2A 4GPD1 6ABPA 2JHPA 4D7AA 2ZVJA 1TO6A 1DBIA 5HFAA 4RORA 5DOZA 2ODPA 3HCDA 2Q8NA 4UEOA 4FGJA 4AZ3A 1GRNA 4UD2A 1TIPA 2C78A 1ADFA 2EW2A 1QJ4A 2D2IA 4F5DA 1R8QA 2PXHA 2IITA 1HYHA 3L7BA 2A1TR 4K6OA 2BFMA 4LZNA 4OHXA 2CDAA 4B6FA 3O38A 2DETA 4YPFA 4Q1DA 1TI7A 1PS0A 1FRQA 1YQXA 4PYJA 3JPYA 4FIZA 1NLXA 1THGA 4YL1A 1KZ9A 2IU0A 4FCCA 1Y6GA 4FYXA 4TLCA 5DVWA 1QLWA 5EOVA 5BR1A 4L02A 4HDRB 3G0CA 3R7FA 3UGOA 3UMRA 1X7HA 2HO5A 1PBTA 3ZZ0A 3CEPB 5AICA 2Q3MA 2IYNA 1NG1A 1BW9A 4IUYA 3DXXA 1QWOA 1JNYA 4DMLA 5IJWA 1JW9B 2XA2A 2YJTD 3O9VA 1MB4A 2BI4A 1RC0A 4GMXA 4K9SA 4I3GA 2JGFA 1W87A 1RHRA 1JLSA 2V4ZA 3IP1A 1A4RA 3IOEA 5IW8A 3OQNA 2OCAA 3DVSX 4ZQFA 1WLSA 2GHTA 4OQDA 1Z25A 4W9RA 2B0CA 3W04A 5ECYA 1WR8A 4BQEA 1FSSA 4YV7A 4C0KA 4JBXA 3MMNA 1T26A 3EZNA 1XN1A 2R751 2ZIFA 2IDKA 3ORSA 1Z07A 1EXMA 2ZJ5A 3EVFA 2Q3HA 3E9RA 3TRHA 4AJJA 4D98A 3DOCA 3BGDA 3B2EA 1RPJA 4IIJA 5JUWA 5DXFA 3GFGA 4MRRA 1T3ZA 2QS9A 4AM8A 3BD6A 4Q00A 2AWOA 2Q6TA 3B0PA 4L6CA 3M6XA 4J7YA 2VDPB 2Y0DA 3ADKA 5F3DA 5DEOA 2EZTA 1UXGA 2BGMA 2DCUA 3U49A 5JIBA 1THZA 3AOGA 2D06A 1IZMA 5A05A 3VSEA 1DQNA 3ITKA 2E4YA 4I1VA 3R6LA 3GZNA 3GZ4A 5U4QA 2DBYA 3IELA 4WABA 1F6DA 1QF9A 4GM4A 2P75A 1T9ZA 4C0SA 2GPJA 1TCAA 3KJNA 2A1IA 4J2TA 3E5RA 3FCYA 4CR7A 1W581 5JS2A 4EH1A 3VM6A 2VH2A 3UMKA 3HP7A 4IGKA 4B6RA 1S3SA 1ZYUA 4RLHA 3VPCA 2N1MA 1E6EA 4CKYA 3IPRA 3IPYA 1Y1PA 1RYYA 4EENA 3EEYA 3AI7A 4QG7A 5H8WA 4ZJYA 2X0KA 1KFBB 3K1JA 1G21A 3KT0A 3SVTA 3RKRA 1E3DA 3G89A 4NH0A 3W8RA 2ZS9A 3H3XA 3KB8A 3PHIA 4BQRA 4HBZA 4IY1A 5IC4A 3NX4A 2UUCB 2Z2ZA 1CK4A 1CTQA 2VHYA 2G17A 4MCIA 2NUBA 4FZJA 5F33A 5TGZA 3FOOA 3PR2B 4B33A 1JV2B 5KWSA 3TQHA 3VH2A 4ZPJA 2ZE6A 3S8EA 2QRKA 3V2IA 4BV2A 2Q3TA 2X0JA 3BEHA 5KYVA 2OAP1 4Q15A 1OV4A 4ETIA 1CJMA 4CCYA 2XF2A 4L0QA 5CA1F 1DZ3A 2RJ3A 3QUQA 5HQJA 5EMLA 1FQWA 1M10A 5BUOA 4ER5A 1YJ8A 4O4LA 2ZUUA 3UN1A 1UPFA 3TTVA 2VTVA 3THYB 1NFRA 1P0IA 4H7KA 4QBIA 1AUEA 1A5AB 3CXUA 3ZD9A 3GGOA 1XRJA 1ODJA 2WDZA 3I1IA 2JJ2A 5CDSA 2FW8A 4HDSB 3FZGA 3K4HA 1BRMA 4F2DA 1KOLA 3R44A 2WTXA 1W5AA 3HCCA 3VPHA 1DFIA 5AKKA 5E1MA 1AS2A 3AEQA 2Z8YA 1DJOA 4EW2A 4QBGB 5DCLA 2IYPA 4N39A 3QBDA 3LRPA 3T5CA 1A96A 3O4RA 2CXXA 4IIFA 3S7ZA 1ZAKA 1QAMA 3K31A 1ABFA 3RSHA 3T7TA 4P0QB 4O7GA 4DDHA 4NV0A 1QCDA 1NV9A 3QOYA 2A6PA 3ZTYA 2VYCA 4R1MA 2WM3A 2X7JA 3AHHA 1D5WA 2REXB 4JS0A 4B75A 3PJRA 5BRAA 2DY0A 2QLNA 2EINC 4L6IA 4PAOA 3BXZA 1YQUA 3UMHA 3OKAA 4IMJB 1IPEA 4BZPA 3FPCA 2NVOA 1Q92A 3B3GA 4NDNE 4PVDA 2XUJA 3ZCSA 3PHF2 3LS2A 3NT4A 5EIB