2YVKA

Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from bacillus subtilis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
349
Chain Sequence
MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITAAFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEAKTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLAKQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGADRIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQISGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 5-methylthioribose 1-phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords Methylthioribose-1-phosphate isomerase
total genus 129
structure length 349
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 2yvkA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 2yvkA02
4ZEMA 4LDQA 1VB5A 3ECSA 2YRFA 5DBOA 3A11A 2YVKA 3A9CA 4ZEOA 3VM6A 1W2WB 1T5OA 2A0UA 1T9KA 4LDRA
chains in the Genus database with same CATH superfamily
2OESA 3B0VC 5FR2A 4ZEMA 3K05A 2O7RA 2PYDA 1QG6A 2H5LA 2JLZA 4XW2A 4JC0A 1A1SA 521PA 4EFDA 1YRLA 3NC1C 4KPFC 1PG0A 1RD4A 4QI0A 4EI2A 5DISB 3IMGA 1LPBB 1OV4A 3PNVA 4CLHA 1Y1QA 3HCFA 1O89A 3ZYZA 1ZHZA 4JVLA 4RKWA 5L40A 4JTAB 4R2WA 4PG8A 1WKCA 3MMSA 3ODPA 4IIVA 2DFDA 2ZLBA 1KU0A 1M10A 2JLXA 1Y8ZA 3FFWA 1PEYA 1LX7A 2XF2A 4DT1A 1S5PA 1NZFA 2B8NA 3BRWD 3LRPA 3MT9A 4OQZA 5GGXA 3ZH2A 3T0FA 1G9TA 1TZJA 5JCJA 3F7NA 4GIBA 1J2RA 4TMYA 1U7PA 4N8DA 2GRAA 1SFRA 1Y5MA 1WOLA 2QZJA 3ASZA 1N3LA 4KO1S 3U3DA 4NYJR 1Z9BA 3HVJA 4UZEA 5B7PA 4ER6A 3HKKA 2XAUA 3SYRA 4XD7D 5CH8A 1QAQA 4L6IA 4A6EA 3HP7A 5JROA 1GGNA 4K86A 3RFCA 4URWR 2HF2A 3SN6A 1PW5A 2IUSA 3QGMA 1E8NA 3KQYA 5HSGA 2VZ8A 4CKEB 1G5IA 2QMEA 2EJCA 2OGZA 1D3AA 1JAHA 2R8ZA 3T7KA 3WJ2A 3ZBPA 5BQHA 1JZTA 2HCTA 2WWWA 3S9OA 2YJ6A 3G82C 4GQHA 4HZUA 4XWAA 3ZDZB 3ZY6A 1OX5A 3M9LA 2D6FA 4K6GA 3VYTB 3I0ZA 5E7QA 1R1DA 1CEXA 3LGAA 1DIBA 1E69A 4WCFB 4CM9D 3ZDAA 2DB3A 3HKDB 1KVRA 4BPBA 2Q6LA 4CTMA 3QOFA 3AV3A 3K9CA 3W77A 4LF5B 3GP5A 1HKHA 1YVUA 4PACA 3ZV7A 3A9SA 5ERYA 1JDBC 2J9FA 2PZ8A 1Y9DA 2FR1A 4GBED 4ESEA 2QUBA 2GYYA 4JR0A 4LXQA 4PSAA 1QIEA 4XX0A 1PSZA 1S4QA 4BGVA 5IKPA 1MA0A 4RM3A 1OXSC 1RJWA 4IOKA 4O0MA 4XUDA 3N8HA 4MRMB 3I23A 4TN5A 4NECA 4BECA 2IBSA 4DWVA 1W1WA 3ENQA 4WUVA 2EHDA 3QV2A 1ZW2A 5IUKC 2XKAA 1AH2A 3MCZA 3PFCA 5IXSA 3UBMA 4F0JA 3FOOA 1XELA 1DDIA 1K89A 1SM4A 1ZJZA 2J59A 2NOAA 4YGYA 4RULA 1MO4A 1QYIA 6AT1A 5F3DA 4RHUA 1S2LA 1UQUA 1GGJA 1KEEA 1LNZA 3L7YA 4IGFA 5LKRA 4MI1A 4DREA 4DQXA 4GF5A 3T1TA 1WU8A 1UOQA 2BUBA 3HDHA 3MMXA 2C5LA 1YB7A 2A9FA 4EABA 1ZD3A 3NJ8A 1NAIA 5TV2A 2QTVB 4IFTA 5LQMA 4CF7A 1ARZA 5IDYA 1Z33A 1HK7A 2YJ4A 1UPCA 1NSYA 2XV1A 3G89A 3MUFA 3Q5DA 4Z4EA 2QQEA 3GEMA 4OMDA 4R69A 1W5FA 5DM2A 1D6NA 1AUOA 1Q3KA 4MJ7A 1L5GB 4FQ7A 4NL4H 1JXOA 1Q1NA 2BSAA 4ZGBA 1JQLB 5ALNA 4EJ0A 4IHJF 5IAOA 4WHMA 4NEGA 1KRWA 3DE1X 5T4EA 2NGRA 2R1UA 4PR9A 4H0CA 2N1BA 3HFSA 5BYBA 4D3FA 1GITA 4QJIA 3EH1A 1TJ4A 5ICEA 4BKUA 2YFQA 1REQB 4P4SB 2EFGA 1E7SA 2PP4A 1JDNA 3JYHA 1SZPA 1TJPB 2XGMA 3PEWA 1Z7Qc 2ODPA 2QDKA 1FVOA 3QVTA 3LBNA 3E48A 2H0AA 3R3YA 1FFEA 3E2PA 2C04A 1II0A 1S7CA 2J9XB 2R68A 3CLUC 4N5NA 4I50F 1M8KA 4OGFA 4ZO9A 1OCEA 1V4NA 5K3BA 4KPEC 1XX6A 2G5GX 1FRFS 3QE4A 2CJXA 3OJOA 4PRYA 4G8BA 1Q0PA 2W4QA 3QUAA 2PA3A 4C4SA 4MKFA 3SF8B 5TGDA 3I4FA 1E4VA 5D3KA 4E5VA 4HYEA 3LBFA 4GD3Q 1U5CA 3PVZA 4M83A 2O7VA 2ZB2A 4HZUB 1CK4A 2I1QA 2PYIA 4U0JA 4CKWA 1MCZA 4QPNA 5EIFA 1CEEA 5JW6A 7ADHA 3CBQA 3FPJA 1MN6A 5CH3A 1B6TA 1QKRA 3RYTC 1E5DA 3ECAA 5BPHA 5C8XA 4YY3B 1DP4A 1C9NA 1E2PA 1UPUA 4NU0A 5AYVA 2MWQA 4G07A 4G7OF 2UAGA 4KMOA 3B53X 5DM0A 5JWOA 2FEXA 3FH0A 3MIZA 1TL7C 4HS9A 1K4KA 1P2SA 4WOKA 4A8JB 2PSEA 1VE1A 4KGVA 4N03A 1ONBA 1T5SA 2CLEB 5HKKA 4D56A 1YZGA 4OINF 1N1DA 1CUUA 2ZSEA 1L1RA 2ZBQA 3UJ9A 4FZ5A 2ZUBA 1C17M 1ODJA 1M1YB 5DSTA 5JZMA 2BE5F 1WSWA 3LW7A 3FCEA 4ZK6A 2P68A 2AOTA 1M3SA 3M1YA 2HMUA 2ZJ8A 3OFJA 1LDGA 1X87A 3BB1A 2PXAA 4L50A 2G9UA 4PX9A 3B1WA 3AFOA 3TAHA 3S28A 4FDUA 4Q19A 1WU7A 2PX5A 2HMVA 1LA2A 3BJEA 1OMOA 2WSSD 3BUSA 5HF9A 2ECQA 2AXPA 3K94A 2ID9A 4A1OA 1AHHA 2XLHA 1YFJA 1JIQA 1BEZA 2VQFB 4CEIA 1WB4A 4QATA 4YAJA 1GTL1 3L1IA 3LUHA 4LJ9A 1UCFA 3L6BA 4BBPA 4N48A 5ALOA 1L4GA 3YASA 1M2HA 3JT1A 1V7CA 3O26A 3HYSA 4RDHA 1PS0A 1XWJA 1IM2A 3DKVA 2CWWA 3RHZA 4XWJA 1V9CA 3GJ0A 4CR7A 2Z95A 3FDQA 3TMYA 1P0QA 2F1KA 4FHGA 3TQHA 2F8TA 1DAEA 3ESYA 1E3JA 2YV1A 3ZQYA 1EUDA 1P2GA 5CEFA 3ZG1A 2VNAA 2GX6A 2W2KB 3OZEA 5DULA 2CVOA 3MB8A 4LJ6A 4JLBA 5HTKA 4ARZB 4PRLA 3ZY2A 3H87A 1WV1A 2JC3A 4C7KA 4RQTA 2YIJA 2KK1A 4H7IA 1JDJA 4P4LA 2C9MA 2Y27A 1JSLA 2OBBA 2WJZB 2ZROA 4HGNA 5I8ZA 4ZK2A 2FEMA 3DZAA 3R0IA 1O0SA 3FOEC 2BFBA 2O0JA 3DUFB 4B87A 1A7JA 3FGZA 3M79A 1BHO1 4OU4A 3GZJA 4S3MA 5DEOA 5EKXA 2PZFA 4W8PA 4LE1A 3MXOA 3VR5D 1AGXA 3UMRA 3E5HA 1D03A 1GZSA 2VRCA 3OLCX 5CCDA 2QT9A 5HIIA 1AS0A 3O74A 2Q5HA 2B9EA 1EFPA 4BTVA 1K2VN 1P7ZA 2CCGA 2E89A 3OVMA 4IDDA 4RF5A 4X91A 1J00A 1QPZA 1GPLA 1SCAA 4X0RA 2IV3A 3KLOA 3EIEA 5E2IA 2BFNA 3HYNA 4TUYB 4LGYA 3CVJA 3TRKA 4P6IC 3IXQA 2VBIA 4JXJA 4AS1A 1K5GA 2AKAB 1GN8A 1N78A 3V4LA 1DTWA 2AE2A 3JALA 4R54A 2QRKA 4G26A 3ZHSA 1D2EA 5IMBA 3K5HA 3WMXA 3FSEA 1T3LA 4RPLA 3X1YA 1M7BA 3BWDD 1ZITA 1K6JA 1VL0A 4D9BA 1JEOA 3PNLA 3BG5A 2HRQA 1GZ4A 5EY5B 2HSEA 4KNWA 2HDWA 1MAWA 3CJQA 3DDOA 1LS1A 4RF2A 4C4PA 3LHFA 4ZO6A 1G7CA 1PT6A 3R6TA 1KAMA 2VJBA 3FOCA 4MW1A 5C3UA 4NTAA 1C8VB 5E4TA 1KZ7B 2ATEA 2Q46A 1MAUA 3B1KA 1UFKA 3H3FA 2F3TA 2J3KA 4I46A 4I81A 1Q0DA 3NHJA 4RKFA 1C30B 2JVIA 3K0AB 1ZVZA 3RWOA 3ZW7A 3S2YA 3VH1A 3WFZA 4EMBA 3MJCA 3LP6A 5L7YA 2Q28A 4BO3A 5JY6A 1KJWA 4NG4A 4A5OA 2NVBA 1YACA 2WAYA 3D6AA 3KUKA 2G76A 3O2SB 3RFUA 3UMFA 2X13A 2PLFA 1HNZB 2LWIA 4H15A 1IJFA 4M6WB 4U7DA 5KUTA 3VSDA 4RVFA 4YALA 1XKXA 4OFWA 3HNJA 3LC1O 4HUJA 1HT1E 3SHQA 3O4JA 1TZMA 5AI0A 3SBDA 1GTZA 3T3PB 3UOGA 1NVFA 2R00A 4XFDA 1YFKA 3HTKC 1ZLXA 1UXGA 4JWTA 1FFWA 2ESRA 1MW9X 1JQKA 1ZXBA 3FNGA 4BGUA 2P8SA 3NBAA 4K9QA 1VSQA 3LPLA 5H0IA 5MHTA 4CMEA 4X61A 4ZMRA 5AVKA 1XTQA 2OSVA 1JJBA 2MSCB 4EMSA 4IFEA 2HJ3A 1JR6A 1DAFA 3B6MA 1SPXA 1JG2A 3JVEA 4JE9A 2GN0A 2YV2A 1FDIA 4HNHA 4MQMA 4Y0VA 5ALYA 3ZKWB 5ED4A 2AFRA 1XNRB 1G7RA 3M1LA 4DL9A 2V7BA 1W5AA 4AY2A 3SLGA 1YZAA 1XG5A 3LT0A 3RF7A 2VNHA 3HU2A 4FYKA 1ABEA 9ABPA 3FYUA 4M37A 2IEZA 5DP1A 3ABZA 3CZ4A 3P2KA 1M1XB 5C8YF 2R7MA 3BIFA 3EDQA 1I8TA 3TOCA 4F8EA 5AICA 1DJLA 2HWUA 1T6XA 1E1LA 1XLWA 5JZSA 2VJMB 1RKEB 2B1QA 3AEXA 2M98A 2IUTA 4IUDS 4DSTA 1T8YA 4OJMX 1CDZA 3C4VA 5LDDC 3UQZA 4QUJA 4KX3A 3BREA 2D1SA 3QFHA 3EF3A 2FXVA 2IQIA 4HH0A 1CZOA 4OIMA 2NU9B 1F4VA 3PFHA 4M8SA 3H84A 4URHA 4BU1A 1SVIA 3UAVA 3T7CA 3I5YA 3TOVA 4BKMA 5REQB 1PFGA 3DV0B 3H9EO 3QKSA 4PBSA 1YVIA 2O05A 4FM9A 2VDKB 4MS1B 3E35A 4DCJA 3RYCA 4R81A 4DLRA 1J2UA 1QVRA 2G06A 2Y77A 4Z4QA 1TD1A 1MPXA 1DJPA 4MCAA 2IYEA 1Q77A 5FO1A 2H7VA 4G0MA 4FUQA 2GXAA 1TYCA 4MR9A 4EG0A 2C2OA 4C2UA 2PZGA 1GRCA 5KOHB 3QVXA 3PE4A 1XJWA 3M6LA 5C7YA 2AVDA 3D2CA 4MCIA 4HRXA 4W5OA 1W29A 1OGJA 2OV8A 3W4YA 1NIPA 5K7SA 1C2TA 3C98A 5DW3A 5CUQA 3SC4A 2WILA 3UAXA 1XZJA 4ZHQA 2QM7A 3FTNA 1FW6A 2EIHA 2ZWMA 3E84A 3QPWA 4IO0A 4UD2A 4CQLB 5C9ZA 5JCXA 1SC3A 1PE0A 3O6XA 1WRBA 2O7QA 1ZN8A 4QUIA 4M9SA 1AF7A 1P1CA 4RKQA 1RJFA 1T2CA 4Z0HO 5LIRA 2C95A 1CZRA 2PT6A 1KY4A 1L5FA 4P5PA 5FUWA 4I9UA 3VKGA 4FB5A 3I9V1 2VATA 5E3JA 1K63A 5EWJA 4BV3A 2HQRA 3CEHA 4MW0A 5K8TA 1FUKA 2CLOB 3I83A 2ZRIA 3C3YA 5JS2A 1Y8QA 4NDNE 5AW8A 1V8OA 4NOKA 3I6IA 4YRDA 5AJZA 1GY8A 1G5ZA 3W2IA 2OCDA 4MSUA 1O7JA 1JG1A 4BG0A 1N1MA 2CVZA 2H5JA 4ERNA 5L0IA 2OAP1 2JGDB 3E5NA 3MILA 3OPVA 3PEYA 4N0PA 4EEXA 1SULA 3ES9A 3JR7A 2GZSA 3P45A 3QLTA 1W19A 4MMYB 2XLDA 3V5ZA 3EUWA 4OK5A 3IEVA 3I64A 3OCZA 2FPMA 3KCNA 1PV3A 4RANA 1APBA 3G02A 2AP3A 3LKBA 3MD9A 3ORHA 4FILA 5FUXA 3CRVA 1V11A 4KR9A 4XPXA 1G4AE 4RD3A 4BNFA 4EYOA 3ORQA 5P8WA 4BVEA 4L1KA 2BFEA 5HR5A 1HH4A 3KK0A 4DRYA 1N32B 2I62A 1GOTA 2KQUA 1MJGA 2P1ZA 3CRNA 4OB6A 3CT6A 2W93A 2QMQA 4YH1A 3FWHA 2ZB3A 4EB6B 1IBKB 1Q50A 4QPPA 3T35A 3OX2A 2VXCA 4QYTA 2GT1A 3AF2A 4OLFA 3KS9A 3S4YA 3U62A 3DCIA 2WL8A 2H2HA 1F8XA 4XTRA 3GPIA 2A5LA 1Z08A 3PUYA 4LTNA 3SC2B 1THGA 1OX4B 2OFXA 4RZ3A 1J42A 4FWBA 3LUJA 5KVAA 4KQIA 4EPTA 1NP3A 3DO8A 2VF7A 3L7LA 4MGKR 1Z5UA 5TY0A 4MVSA 1V3TA 3HU5A 3IVRA 4BZPA 3MUEA 1JIVA 3MRXA 4CLXA 1T3ZA 2CBZA 2FW9A 2DX7A 2QZ4A 3IIIA 5IDWA 5GJWC 3FUUA 5KVCA 4KPYA 4IIFA 2B78A 2FDRA 1U3CA 1DIHA 4JSTA 5T67A 1EWKA 1SVOA 2PZJA 4LX8A 5BO5A 4XQEA 1TFUA 2VZLA 5I4BA 5JYBA 5AW9A 1A8SA 2XA1A 3KR9A 3H2UA 4QT0A 4BO1A 1CVIA 4FOPA 2PRJA 4I1YA 2F43B 4CG1A 5A04A 3KFLA 3RT7A 5TMDA 1O58A 4K9SA 3JSEO 3M4BA 2G1AA 3B36A 4IJUA 4WXPA 1LDYA 2A1UA 1U31A 2F1IA 2QSJA 1FSFA 1RC1A 2WEKA 3BXPA 1X86B 3WG7C 4LSWA 1RADA 4YJHB 2HHJA 2VSNA 5AP9A 4TMWA 3GUYA 3OJLA 2V7PA 1AUVA 5AHOA 1NFQA 1U04A 1CNFA 1N0UA 4EW6A 3EIOA 4GM1A 4YXWA 3T0IA 5IFLA 3H1FA 1RVDA 2FOXA 4YI3A 1RXYA 1V7ZA 4WXEA 2ZPAA 1QIFA 2KNHA 5UKDA 1LDBA 3BA6A 4E70A 5EUBA 4WAUA 2VSQA 3G2IA 3G5MA 3CGWA 2W8BA 3QUSA 3VPCA 3H05A 1WN0A 4FQ8A 2H7BA 3EOBI 1JPJA 3QY9A 3ZHXA 4TWRA 2HQSA 3LUFA 3HCPA 221PA 1XV5A 3B6ZA 2Z08A 2ZCUA 4Q7KA 5KNDA 1NMZA 3NOOA 2SICE 3GDGA 3GLUA 1MO3A 1U3TA 1E7QA 3QPCA 4CCSA 4AKHA 1XSEA 4MYTA 3TZKA 4NBVA 1JZSA 1V6CA 5JQGA 3N70A 1YB1A 1VGQA 1V6AA 3JR3A 3IKVA 4IYJA 1NW6A 2BFCA 2GHQA 2QNBA 4PRZA 1XNQB 4G4SP 4FSXA 2I2WA 2Z56A 2Y6UA 2WG1A 5M29A 3VPXA 4UNSA 3TLCA 1RSZA 1CUZA 2HGZA 1JB9A 1TVKB 2V7WA 2X8BA 1MR3F 2NUAB 4G7HF 2VUSA 1JEAA 2QN2A 2VCEA 4EPXA 4ENWA 2ABWA 1RHMA 1BD4A 5HKKD 4EKEA 4D82A 2VDRB 4Y98A 3IAFA 1SF8A 4XIJA 3STTA 3ANLA 2P9GA 4QWWA 4RHTA 5F7JA 3WDSA 1WBBA 3EEIA 4O4HF 1ZVQA 2HJRA 2HPZA 4K1LA 3B9RA 3ZNNA 1J07A 5E95A 1I13A 2W7TA 2BV3A 4ANJA 1RAAA 4OL9A 3F3MA 3UFXA 4QQKA 1W2WA 1E58A 4NSNA 5H3LA 3V4VB 3T5AA 3UGTA 4GUDA 2BDUA 3HHEA 4NU5A 5B30A 2Q1WA 5EZSA 1JQDA 1VLHA 4NYMQ 4V0SA 3JWPA 3H2HA 1UK8A 1HFJA 1NQ5A 2WJWA 3DL7A 1WZEA 3EBLA 3A4MA 2GTPA 2QUIA 3AHIA 4B17A 5T8KA 1D4ZA 5CFPA 2B0JA 4NWIA 1FDWA 1OGIA 3GYBA 2XUZA 1U3DA 3DEFA 4MCJA 1NNLA 3W6UA 1SBHA 1AN9A 2N3ZA 3T5MA 2HA0A 2JRLA 3AF5A 3LF2A 3AEQA 2DUNA 3LFTA 3RUIA 4TMKA 3GZ4A 2AOXA 1LW6E 5EZYA 4WLFA 1HEYA 2TMDA 4MXDA 4MV3A 2W6OA 4KHPB 2RGCA 5ALRA 5BVHA 3ZVMA 5LD2B 5AJYA 2YHUA 3H4MA 2C7RA 2ZE7A 4QVIA 3V5XA 1R6UA 2VZ0A 1N9KA 1M0TA 3GIDA 3VR5A 3FFAA 3BQMB 4QGHA 2VWQA 1XXHB 4QYXA 1KZ9A 4ZT6A 3DD7A 5E9WA 1V1JA 3BM5A 2CBGA 2QMOA 2XM4A 4G0ZA 4UDVA 2AX3A 4BJTA 3KPUA 5LWQA 1Z4PX 2PIDA 2MYNA 5KQLA 3LE8A 4IHAA 3W8DA 4AG3A 3IEEA 1M0WA 1NV9A 2ZETA 2AN5A 2NZ8A 2CB0A 1ACLA 3GNLA 3MBIA 4KOAA 1QQ7A 3W9SA 4JLWA 2RMKA 3G2MA 4QOHA 1DFHA 2QV7A 3BDIA 3LNRA 4KLCA 4OHPA 3TRFA 5IUJC 1DRUA 3EUAA 1T34A 1C7IA 1UUFA 2X2PA 3DXZA 2A9QA 3GLGE 2F43A 1CX9B 2KYRA 1OSNA 1IY2A 1DEOA 2VUHB 2PH1A 4WKPA 2C77A 1KI2A 2PHZA 1AQLA 1I0IA 1VE3A 2W9XA 1CV2A 4EUNA 1YZQA 2GERA 3Q1LA 4PYIA 3EA5A 1Z3CA 3O1HB 2CDNA 4RWEA 4BTLA 4BFUA 1N6LA 3AJ8A 2V1XA 4EH1A 2AG6A 4G1BA 4L4UA 4REOA 1RXVA 2CJFA 2GTHA 2MINB 3TW8B 3ZXIA 1YB5A 4LERA 2TRSB 3E22A 2D1RA 2GAJA 4FZ3A 1KP9A 5CA0A 1ACMA 3LT4A 2X0RA 4JT4A 2R7TA 2X4GA 3ONFA 4RSRA 4EYEA 3IP8A 4K88A 4GDMA 1F3LA 3GGSA 2FZ5A 4P7GA 1ZD9A 1V5GA 3IESA 4EVIA 5IXYA 4KN8A 4AG5A 1JFRA 1EUQA 4KEAA 4HAWA 3HLYA 4Z9HA 1ZQ1A 2QU8A 3PNMA 3ZDLA 4E1AA 1KI7A 5IM5A 4N4WA 1G21A 5BVGA 4ZQBA 1RI5A 4PS1A 1WULS 1BW9A 3AETA 5EUQB 3H3JA 3UMSA 2F7SA 1G3IA 4B7AA 3E7WA 2ZYHA 3CY6A 4R9UC 1KAOA 4ZLCA 3QXSA 3WV4A 2H2IA 2FN7A 4EHHA 1NF8A 1FNDA 4K9DA 2QX7A 4WY8A 2HW8A 1NXPA 1Z18A 5GOTA 2M4EA 1OY1A 3ZWIA 1HDCA 3TD2A 1WCIA 1DTWB 4N47A 2DULA 1I36A 5JSLA 1E77A 3AW8A 3BZWA 3QKUA 2ST1A 3W79A 2IPAB 5FA8A 2P3LA 5LMZA 2QL9A 3L6UA 4D4GA 3MTIA 3KZKA 3PDIA 1RXSA 1P74A 3FPFA 4XX0B 1TQ2A 4IH4A 2BM9A 1PIWA 2VP0A 2JCBA 5JI3E 4BPMA 2OGWA 2TYSB 5CB6A 3OIGA 3LTEA 3AESA 1KEZA 4KRXA 4NK5A 4ZZ2A 2IH2A 5LNK1 1YFLA 4HGPA 1L5NA 4B6JA 1CGOA 1VMIA 2RKBA 4ZI7B 1AO0A 1DINA 2C9BA 1P72A 1EHYA 3IP6A 4Y1EA 3AFMA 2Z5GA 3LNCA 3TNFA 1CSEE 4IFBA 2L69A 1ZC3A 2CLHB 4PYKA 2XBUA 3WJ7A 4C0XA 1G8GA 2UUAB 1QTIA 3N24A 3HR8A 5F2NA 1QO0A 4Y1RA 2ZB7A 3B8HA 5AHXA 3AGTA 4Q3AA 4QAQA 5AI6A 5KYKA 1ECJA 2J9ZB 2Y1XA 5DS5A 3BC1A 1K75A 3K15A 3GAZA 3ZIAD 4D9CA 1KYIA 2V7QA 3HSSA 1E2IA 4CM5A 3N6VA 3IHWA 1GS9A 2HMTA 3AEKA 4PCUA 1JLRA 3V9PA 4BLQA 3FW1A 2CNWA 2F6RA 1CZNA 2EHJA 4JH0A 4UUQA 4X1OA 1VL5A 5M7EA 4H7DA 5DQZA 1M2FA 1SIUA 1ZUIA 2ZJBA 3D8HA 1ODKA 4GS5A 1ZOSA 3VTFA 1TLFA 3G50A 1RYYA 3UFBA 4OIQF 2WIAA 4IHJA 4AXXA 2WABA 2B8EA 1N5DA 1X7XA 1PKXA 1Q1ZA 2EW8A 1AVTA 1C1YA 1US8A 1W36C 3MJSA 1IBMB 1IG3A 3T9OA 1DXHA 3G0BA 3FNIA 2DU8A 1AXEA 1V95A 3GRVA 3URMA 3EULA 4MQFA 1IN1A 3DT6A 3QVVA 3CXUA 4BV9A 2NUTB 3ZHTA 5A5VA 4EQ6A 4K7JA 4YJGB 1LKZA 4NZPA 4Q1EA 3TNDA 5TVKA 1H4QA 1YBVA 2E7ZA 5EHNA 3OM8A 1K4MA 4GDFA 1SKUA 3LP5A 1KEWA 1ML3A 2D00A 5H80A 5J59A 3LPNA 4IWYA 5KNCH 4BKRA 2RGAA 2JZCA 2WU3A 4W7HA 2B94A 1MNEA 1JG6A 5FBZA 1L5HB 2C2KA 3ABRB 4MYRA 3PWZA 2GVDC 3KR0A 3KZXA 4NVRA 2N0SA 5JZ9A 1GV0A 4PO3X 4WFJA 4TLBA 4EGFA 4M8KA 4XJSA 3I2JA 1NF9A 3QQPA 2A2ZA 4IQGA 2ODAA 2IA5A 1JH9A 1TA4A 2JX0A 4EFMA 1J97A 4OAPA 2O3SA 1GGHA 3OOJA 2C2GA 4H1VA 1E20A 1P1IA 2GH1A 3GPCA 2YDXA 4LYHA 3HO8A 5HA5A 4HF7A 3AILA 4IUCS 3UJCA 2ZSUA 2AC2A 1TT5B 3BGSA 2PJDA 2V74B 2ZATA 3FAZA 3KOZA 3LUGA 3PHCA 3SOPA 4A0GA 1M7GA 1N5OX 2X9LA 4R9NA 2F8SA 3EQ2A 2B5VA 2H59A 3EVNA 1GKLA 4B2LA 1F17A 4P2BA 3KBOA 1DV2A 5JISA 4BFCA 3FYTA 4RIGA 3C8GB 4C29A 2ZUSA 3LW8A 3FNBA 3LWDA 3ZOKA 1XC7A 3B3JA 4GWKA 3NETA 4YECA 2BC5A 3C15C 2FHPA 2D4HA 4M9RA 3I1YA 3Q7PA 4B45A 1BWPA 1DQSA 2FZLA 3ZD7A 1X2BA 2D1QA 1QCCA 1R9JA 3C87A 3LSYA 5COBA 4EYSA 4HNUA 4BP9A 4KN5A 3NTUA 4UDXX 4OXYA 1KU2A 2VP2A 3T7EA 1WTYA 4DA4A 3TAXA 1E3LA 1ODLA 1QDUA 3GLHA 4YDSA 2J3DA 5FNVB 1FLDA 3E8SA 2SKEA 3PC6A 3CLSD 2IKQA 2HK6A 2FGJA 2X0KA 3I2HA 5E6UA 1TC1A 1XMPA 1Q2UA 2C7VA 2E4YA 3P4UA 4DNOA 3OEWA 1P31A 2SCUA 1PVOA 1TKRA 2NUBA 3JZMA 1RR6A 3CWZA 2NO0A 3RANA 1UL1X 4G89A 4IXMA 1TTQB 4P9TA 1ECBA 1IIBA 2HMAA 1T6IA 1CUIA 1DPFA 1NBME 2IEAA 2P0EA 3JQAB 4LHYA 5DSZA 5EE3A 1DMSA 5TNXA 4R41A 4R7ZA 3GGJA 3GF4A 1JT9A 2QRUA 2AJCA 4MVZA 3AY0A 3KYJB 1JGTA 1KMNA 4Y6RA 5FEMA 5L95A 2MR6A 4XYGA 2R6DA 3O2NA 1Y7HA 4CUKA 3FI9A 1EA5A 5E6RA 3K1IC 1KI8A 3MGAA 4L02A 4CV3A 3U60B 4U5XA 2XRHA 3OEHD 1UJ6A 1EMDA 1JQBA 4RENA 1IHPA 4OJTA 3DUFA 5CI8A 4C6TA 3EXFA 4LSZA 3T1YB 1TKBA 3C6XA 2BZ1A 4YAKA 4GXTA 4HHEA 1JJAA 4IQFA 4U6NA 4B40A 4YT2A 1R64A 4C7OB 2AMLA 1RRMA 2FNAA 2FWNA 2QSUA 2VVTA 4MGYR 4Y0AA 3G68A 3SS9X 1R5BA 3LGSA 4DOZA 4CM1A 3FDZB 3TWOA 3PCTA 2OLKA 2PWPA 3OE1A 2NXJA 1UC9A 4G5YA 3EIFA 1UJ4A 1FS4A 1VJ5A 2O2HA 1EFRD 5T5QA 3K8ZA 4UMEA 1EE1A 5EJEA 4CG2A 3E7DA 2KW5A 5I8WA 2ZYDA 3WTCA 2RB5A 3E5MA 5C4MA 1SUSA 3BVPA 3ZU2A 3BFKA 4XX1A 3NBQA 4QOGA 2SCUB 1R66A 2JHPA 4AY5A 1DWPA 1OWNA 1BE8A 4S1NA 4DIMA 1X7ZA 2P9JA 3IHUA 1DOWA 1U02A 4HN4B 2QAJA 1XLTA 1HQKA 3FB4A 3OM1A 4JL5A 1MVLA 2VPQA 1YB4A 2OCBA 4UXJA 4AZ3B 1YASA 5HQTA 4D98A 3CRW1 4GNKA 4M49A 3WYFA 4I44A 1A8UA 4YXFA 2CL6X 1UG7A 4X24A 1D4FA 1RQ7A 3EXIA 3OJCA 1X70A 4W5RA 2Z6AA 3F9RA 3U0BA 3P9PA 3KYJA 2IHJA 1I0LA 3MAJA 7MHTA 3KTOA 2KPOA 4PR0A 2FZCA 4HDNA 1Q11A 3B9QA 3KOMA 4LXGA 2BI7A 3QHQA 4U9HS 3IELA 2P0YA 3PUXA 3QLUA 2RI6A 4KL8S 5FOSA 1JSXA 2YWAA 2DBYA 3AR2A 2OQMA 5C52B 1V5FA 5AM3A 4AO8A 4PZEA 2BFDA 2NADA 4NXNB 4OKSA 4BLSA 4KDEA 2LK4A 4WCFC 3HTXA 1U5BB 1FFXB 2YL7A 3HKCA 2G70A 1WCWA 1KS2A 3TTSA 1OW3B 2ZJ6A 3AP3A 2MYUA 2CCKA 3KDAA 3AI1A 3COPA 4P54A 3RD5A 1ML4A 3M5PA 5DGDA 4UNPA 3SC2A 3LYUA 2Q8QA 4P4UA 3TIGA 2FHSA 3CSSA 3M4ZA 4HFJA 1VHWA 2C1XA 4Q4HA 3T38A 1ID8A 5IVIA 3EHNA 4O4JB 1PQPA 2QZPA 1DQPA 2C5HA 2P9EA 4CEHB 3R7NA 4DCOA 5HZHA 4G37A 4OUDB 2WVAA 1XAIA 1QORA 3RSGA 5LOVB 2CXHA 3LFHA 1ZJ4A 3Q3CA 4J4BA 1H1DA 1KZYC 2AN4A 3DZCA 4NX2A 4OM8A 5ALKA 3ZY3A 1OCCC 1YSCA 3AB3A 2I3BA 4XWYA 2FU5C 1KETA 2IOQA 1U0BB 2P7HA 1SUDA 4ICIA 2X9QA 2WQ7A 2V03A 1MX1A 3TI9A 3WVNA 3FRHA 1QK5A 3ROMA 1KZ4A 3SDSA 4BVAA 4DLLA 4IHQA 5TPWA 3E4CA 2CYDA 4HY3A 4B48A 2WINI 2FSFA 3GN2A 4OV6B 1MOSA 4QQFA 4Q4ZF 1Y1LA 3UH0A 1ZNXA 3KHUA 3BKXA 3ESAA 3ICPA 3K09C 3AH8A 3UG6A 3DFKA 4F4HA 1QVWA 3PF8A 3WR5A 4LN1A 3UXYA 4BFLA 2EKLA 1C9KA 2ID4A 2V59A 3K9GA 2Q4EA 4MGEA 2QTCA 4N12A 4IAOA 1WLYA 4GRIA 3O9MA 3GNSA 3H5OA 1SMYF 3BK1A 3HDGA 3JVVA 1X7YB 4BYMA 5IVPA 1TQGA 5GP1A 5H8WA 3T15A 4PZYA 1EFVA 1G8YA 4YBZA 4D8XA 1PT9A 4GECA 5DVZA 2HA6A 3UV3A 5A6BA 4MK4A 2DH5A 1P2TA 2JIMA 3RTEA 3WYNA 2D74A 4IJKA 4BWFB 1HW1A 3C6YA 4JX9A 4X6YA 3B7GA 3GT4A 1KRXA 2VT7A 3CLSC 2A92A 1N2CB 2MOKA 1EM8B 2OR3A 4JQSA 3CH4B 4OKNA 4WXMA 2HFIA 5ESDA 2DWUA 3IQWA 2NWQA 3M7IA 1EGAA 2PCLA 3HNPA 2WVHA 3QMVA 3KAQA 4D99A 2LW7A 1VOTA 5JS1A 4D9IA 4ND5A 4NOLA 4QXQA 3KKBA 4MVJH 4RZXA 1JH8A 3WYCA 3ZOZA 3THWA 2Y1CA 1HDGO 1PQ4A 1GSHA 3HXQA 3TQTA 1E8MA 2Q1XA 3PNKA 2PGIA 3TXYA 3WLHA 2C3UA 1A72A 2G80A 3SZ3A 4ARBA 1MB9A 2ZVDA 2MHCA 4YJ3F 1CZKA 1DARA 2R02A 3B70A 4EFNA 1QRDA 4OVKA 4F3NA 4XLNF 4GYJA 4FWIB 5C5EA 1CDOA 5FUBA 2DY0A 4K8RB 3PHIA 4NV3A 4ZZ1A 2WFZA 4WKBA 3EXHA 4W6ZA 3KPVA 2RHTA 2XQGA 4U2FA 2IS6A 3LLIA 4P3OA 3ZWWA 3DWEX 1URPA 1GFZA 2CSUA 3ECSA 4Z9IA 3DZGA 1BVYF 3FHCB 4L4ZA 4AL1A 4BLUA 1WM1A 3LBAA 1XDWA 4A92A 2BVNA 4PSDA 3EPPA 1IN8A 2Z2ZA 2C4MA 4Y0NA 2PUGA 2Q5LA 3FUTA 4FINA 5FYQA 2ZPUA 2WYHA 3D4PA 3T41A 4EA6A 1NU7D 1U6KA 1XF9A 2EZUA 2LV8A 3H7IA 4GYKA 4F5WA 4W5NA 2MMCA 4LY3A 1ENOA 1NXXA 2ONCA 3ANMA 1CUCA 1Y3IA 3VZQA 4E31A 2P6NA 1JVNA 4H1TA 2G0TA 4MVJP 4JP3A 1P0MA 4DCUA 4DMFA 1AM4D 1A7VA 1UJ5A 4ONSA 1TCVA 5TX7A 4BVBA 1GPMA 3X1WA 3U17A 2PL9A 3S0JA 4BBAA 4TROA 4BJ6A 1KERA 3CZ9A 4CS9C 3A4NA 5J9FA 3P5SA 4LXUA 1QH0A 2VTEA 1HE5A 1U5AA 3PEUA 4EPRA 4M7PA 1YMUA 2HCJB 1NHGA 3CG4A 2W6ZA 1EXVA 3CQZA 3GRYA 3STWA 2LIVA 1TA0A 3I1JA 2A30A 4QEKA 2PT7A 4TT3A 4AROA 4EG7A 5E7JA 3SXKA 1JA1A 3R5FA 4G01B 1XLVA 1OYYA 2D4AA 2QYTA 3L8DA 1I3OA 1KBZA 4PNPA 1UOPA 2XMSA 1G0NA 2GPWA 4AY6A 2XS8A 4AQYB 4O6YA 4TKZA 4E33A 4EX6A 5DXFA 5F4ZA 2LCFA 2WK1A 1QZUA 2OCKA 3TD9A 5CG2A 1UZUA 2VP4A 4UEWA 5C7OO 3OZWA 4HAVA 2WIGA 1NDQA 5BNWA 1TIKA 3FMSA 4EB3A 2AU5A 3Q9NA 2EP5A 4OHZA 5HIKA 3C3BA 1VB5A 1HFEL 1YOVA 4PC1A 2J6BA 2BHSA 5KOYA 2YJNA 2FK8A 1FX0A 2COUA 3WSWA 3CBGA 2K7ZA 1NN1A 3ZIAA 3TEFA 4FZJA 4LEIA 1OA0A 1T5BA 4M89A 4ALLA 1MABB 2I76A 4Q1AA 5IN4A 1HT3A 2NUPB 2VNJA 2FJPA 1KIAA 1DBRA 1V25A 3BQNB 3PD1A 1BXKA 4NTZA 5C1DA 4ZPXA 2HU2A 5B12A 5EUCA 4RTNA 2XDYA 4D4XA 3S70A 4CKYA 5HRCA 2XLVA 3RKOF 4DRIB 2DYSC 1JIJA 3OBIA 1X7GA 3QEMB 4V3BA 4N3AA 1RJEA 5JZOA 2HO5A 3NVMB 5JBNA 4YRMA 3BB4A 1V16A 3VHXA 3I5MA 4R6WA 1V26A 2WZDA 4FU0A 4KO8A 5C32A 1UJCA 5HVNA 5KTSA 3VPHA 4QZVA 3CIOA 3T1VA 2J0WA 1CJKC 1T9AA 3O6VA 5CT8A 5C5DA 3S7ZA 5M34A 1UEIA 5DBHX 3AVPA 1LBEA 3RF3A 4WK2B 1OBHA 1JFLA 1YA8A 5AKZA 3THOA 5JT1A 3QUTA 4Q4LA 3WWEA 5EERA 1XTBA 3S8MA 2Z3VA 4FD2A 2HO4A 4M0FA 2UUIA 4C7OA 3MBOA 4G4SO 2VCAA 3K2QA 5I9BA 5I7VA 1EXMA 1QU3A 4LY0A 1DCKA 2DBRA 4YAIA 1VPWA 1W44A 5FBLB 4CM4A 1F0PA 4MVJD 4D9EA 5C8YA 2Z9BA 1HLDA 1N0IA 1SOVA 2PANA 3MTJA 4JBNA 4MI6A 5DZSA 3I5XA 3NCHA 4E14A 5GVSA 1XK7A 2P4QA 3ZBQA 4R1MA 4ER9A 2JA1A 2X9NA 3DC7A 1NSTA 2XCSB 2ZFUA 1X9GA 3IDFA 3NC4A 4NARA 1QMGA 1ZM7A 5IBQA 4DCTA 1GDTA 1U1CA 4WZ6A 4TLMB 4ZXPA 4MICA 4B0OA 4FONA 4JC5A 3VR3A 4HDOB 1X9HA 4GVPA 1G20B 2ZBFA 1EUZA 1N8KA 3C3MA 3FOBA 4R8RA 5HF8A 1RHRA 1UBJS 3LJBA 3KAPA 2ZIGA 2FPPB 1U6HA 4BVHA 3FCSB 3LWBA 1PAUA 4AKSA 4AJ2A 2WICA 1X92A 2JIPA 1RCTE 4GAEA 4INPA 4RVSA 2P62A 5FCDA 1E7RA 2WB4A 3NYRA 4GKVA 2EFCB 3FTEA 1G3RA 1V5EA 3GRCA 3GVXA 1X74A 3ZVNA 4JI1B 3RH0A 1U1EA 4N5HX 1HKUA 4EGAA 3D4OA 4XVRA 1C1DA 4XE5A 3QSYA 3DVSX 4QTUB 1SBQA 3S29A 1V8FA 4LOHA 4XD2A 2R7NA 5ILQA 1H4VB 1ZVVA 1M1NB 1VRCA 7YASA 9LDTA 1BW9B 4R9SA 3RS8A 4LY6A 5K0LA 2GQ0A 1I4LD 4QNRA 3VXKA 1KP2A 2JGAA 4R1QA 1HA3A 1IZYA 4FFVA 4RGYA 4XPYA 2CXQA 2ATCA 3NGLA 1KE1A 3S2UA 2I78A 3TB4A 2AXNA 4YRSA 2NXEA 1JDSA 3AJ9A 4A0RA 4ZIRB 4BP8A 5DU2A 1QQ6A 2DTEA 1VJDA 3Q40A 3PQEA 5KYGA 3IQTA 3TULA 2QV0A 3U3XA 3NIDB 2O7SA 2YN0A 5IFKA 1KHTA 2H2WA 4NMLA 3PHHA 5FJIA 4TV8B 4OLAA 2MHRA 2C3MA 4Q9LA 4FGJA 1W30A 3L18A 4FKBA 1ZOLA 5DHFA 5BMVB 4L8WB 1SCUA 2E55A 1BXGA 4AJ4A 2R5NA 4L07A 1LSUA 3HKEB 1Y6ZA 2PV0A 1RYHA 2I2XB 3H1BA 2OV6A 4AJ9A 1HMOA 4OXIA 1YU9A 3WQRA 2W90A 4YRAA 2IZ6A 3OEYA 1L7OA 4JQCA 4CS9A 1C3OA 4K9OA 4UOZA 1V9LA 5ADUS 5E6SA 5A06A 3GFOA 1OD6A 1E64A 4EKWA 2OZVA 3PKJA 3RJZA 3J06A 1FFAA 2NN3C 4L95C 4BNHA 2Q99A 3C8DA 3AR6A 4WOJA 1N5IA 4JYAB 1FK8A 2IYOA 1GTMA 4R1LA 2FDCA 2EEZA 3DDZX 1TC2A 1NQXA 3AKYA 4G5HA 3C39A 1E60A 2FF5A 2O23A 4CLRB 5HIMA 4CLDA 4RO0A 1MO2A 2HEGA 4F56A 1Z45A 1V5IA 1SBTA 2BUCA 2BTOA 2EKDA 2HF9A 4L57A 4NMWA 5K0ZA 4CG3A 2QTBA 2ZZMA 3BFPA 1OWOA 2DSTA 2ZR8A 4OLHA 1KHHA 3DQPA 1RYBA 3RSFA 4YPVA 1JHRA 3RV3A 2J5XA 5A5GA 2R7AA 4B3BA 1Y6RA 3ID6C 2UYGA 3IAEA 1G6KA 3BDAA 3JYOA 1TADA 4LGVA 4NH4A 3R7AA 3HJHA 4OGKA 3Q8KA 4UAGA 1X7XB 3TIXB 3EMKA 4D0SA 1ND5A 3AIMA 2FK7A 2EJVA 2WKWA 2YBEA 2ZSKA 3DBIA 3FY4A 4E5PA 4J1QA 2R96A 2IU0A 3BE6A 3N0TA 1PR1A 2BHRA 4PZUA 3WNZA 5H3HA 2YXLA 4YN3A 1G9SA 1FFTC 1EFLA 3QEJA 3WL3A 4CGZA 2I99A 4J9UE 2GOYA 4B4WA 3RYFB 2CV0A 1IH8A 4CLEA 5IEBA 1FPMA 2PR7A 4JBHA 4X90A 5DLPA 3MWKA 5E33A 1QGZA 2ODQA 3P2EA 3NRBA 3X0DA 2ATIA 1P7YA 3NDIA 4JEIA 3QMKA 4M0CA 2KC3A 3NMJA 2I0FA 4GRAA 1C14A 1RRFA 2QKYA 5FOXA 4KLRA 5BOSB 2VYVA 4O4LB 1YO6A 5DIZA 3VVLA 2JATA 5KHOC 5DYNA 4UTPA 2GA0A 2V5VA 2YCLA 4UCQA 3H1GA 4RTLA 1O3UA 5KYNA 3VZSA 1ADYA 4E7SA 1FUUA 1TJ3A 2P0AA 3CW8X 1YVDA 3O84A 4PG4A 2HDOA 4HDSA 4FFMA 4R51A 3U37A 3GHYA 3MGBA 5ITZA 1XQ1A 3FMPB 1AT1A 2QLJA 4HNQA 4RV5A 4BUZA 3SYTA 3TL6A 3BHIA 1KI6B 1CC1S 1S2NA 3GJ5A 4MJLA 4H7EA 2BEVB 4Q3LA 2OXRA 3DA8A 2Q3CA 3WHPA 3AVQA 4J7UA 4MR8A 3BMXA 4X8HA 4GGPA 1WP4A 4FUTA 5ALQA 1SVKA 1EJ6A 4XVQA 5HK8A 3VKVA 4JJ6A 3AWDA 2BKUA 1EK0A 3T5TA 4XR4A 3TK1A 2O48X 4UM9B 3OTQA 1XZ8A 3IQHX 4AN4A 3EK2A 3IR7A 1Y9ZA 1TO1E 3IQZA 4MW2A 3FWNA 3KQKA 5FWYB 3WNQA 1E3EA 1CF9A 3HCBA 2PA0A 2XOXA 3AGPA 4PTLA 3S99A 4LFCB 5COGA 4X7RA 1DPGA 3VDQA 5H7XA 1SA0A 3IUMA 4RVOA 4U8GA 4DLVA 2XS1A 2ORVA 4EPYA 1J23A 3DV9A 1MVOA 1HOXA 3K8YA 1I7DA 4EVSA 2IOFK 1N2IA 4FHFA 1Q95A 1ULUA 5A0FA 1VQ1A 1GKUB 1LLQA 1P18A 4WIAA 4WNYA 3VV3A 5CD1A 4GEKA 2XDQA 3A2MA 3GLSA 2YN4A 4HWTA 2NO4A 3IODA 4KXWA 4TRMA 4X0EA 1LGYA 5CXSA 4RS4A 3V4FA 2EZ4A 1SZCA 2OYSA 1PR4A 2WWTA 3DE4X 4MLCA 2JFNA 3HFJA 5KJ1A 1ZHYA 6NULA 3GP8A 1ST2A 1JTVA 3JSAA 5IT9A 2ZBUA 3T3HA 3IT1A 1R6XA 1E9RA 3RU7A 4CKEA 3K7DA 2FFQA 2G77B 3DXJF 1QM5A 2XHEA 4B8YA 1TUBA 1IEQA 3SHTA 3A04A 1HE1A 2O2ZA 1YKGA 3E18A 5EP1A 5F33A 4D79A 1K98A 1GA1A 4LCEA 4LKRA 3RRYA 3PHLA 4DSAA 4Q7QA 3RCBA 4AMUA 4AVYA 3BXEA 2NUPA 4KIUA 2VR1A 3T6BA 4CNBA 4XI9A 4Z1OA 3I62A 1IXKA 1MKYA 2Q62A 1KDZA 1AN0A 1VL8A 1WSAA 3TLGB 3H99A 3RUCA 2AWOA 4PRKA 4M9ZA 3V7FA 1C9JA 2J33A 4RCVA 1G2PA 2IIBA 4JP1A 2EPMX 2PWAA 2RH8A 3US6A 3HUDA 3PRHA 4HQOA 5FFNA 4RYLA 1TWCA 3GMTA 4ZVSA 5CDGA 1AA6A 4C06A 2Q5OA 4XEUA 3MHPA 5ARBA 4X41A 5CEJA 1NBHA 4TV8A 1FNTc 4K6CA 4YUWA 3KPYA 3K2BA 3QVGB 1IUKA 1MJHA 4QOJA 1DXOA 2YWDA 4J7XA 5A7HA 1EFAA 1IVYA 1VKHA 5E3CA 4QYIA 4J0IA 1CB7A 3A1TA 3FLEA 5JFTA 1H5NA 2XXJA 1ZR2A 3NANA 3REGA 2GNAA 1EXDA 2UXBB 3ZU6A 3NP7A 4ZC8A 3C3EA 4U2GA 2QQFA 1I0ZA 2ZYWX 1IDOA 1XEWY 5KAMA 1AGRA 1V3UA 5EHHA 3RYHA 4Y2GA 1ZK0A 3ZWKA 4FKZA 1ECPA 4PPFA 3F3SA 3SMVA 4DUYB 4BCCA 4YV7A 4FAPB 1DOZA 2C9OA 2Q7XA 2Z4SA 3A27A 3NAQA 4AIIA 4BWYA 4ZHQF 5DS4A 4TSKA 3IIJA 2OECA 3OCXA 4B85A 3PQ5A 2FUNB 1CB0A 1VYVA 4BMOB 3B3FA 1WXHA 4B8WA 1FXWA 1O97C 3QWHA 5THKA 4CWAA 4TMXA 1A04A 2AEEA 2RSLA 1ORIA 3C3KA 4ZCSA 1RAFA 1ONNA 2GK7A 3ESDA 3MQ4A 4GO1A 4LBZA 3PWKA 3UNGC 2HREA 5IBRA 1FW8A 5KAPA 1H9GA 4BMCA 3GRPA 1FYEA 4L4XA 2IOHA 3EPRA 3EQ7A 3VFDA 1T6QA 2PKQP 3M1CB 4PJJA 3IPMO 1ZP6A 2QDXA 2RFLA 2YWEA 3NIFB 3OLVA 4MARA 1NY5A 4NZNA 1YJQA 4EW2A 4H6VA 4LZWA 2H1OA 2WJIA 2Q8PA 4R7TA 4JXKA 4FYYA 2XYQA 1H85A 2VPPA 4HNAA 5A4IS 1B6SA 5DM60 1LLUA 1CYDA 3RQSA 2O2JA 3ZWXA 1AZWA 1GRVA 1ZHOA 3ZE1B 3WE7A 4DKXA 2IOFA 3RGGA 5FQNA 4IB4A 1JLHA 2ZYIA 2MU1A 1OT3A 3RS3A 3U26A 1F0YA 4MVWA 1ORVA 4W1SA 4V0NA 4WH0A 2P9BA 3HPRA 3MWJA 1NFNA 3FOZA 2VF2A 2WMYA 3CX7A 3WGMA 4N0EA 4QU0A 1N25A 3LBIA 4MWCA 4CLOB 3I04A 1KQPA 1LJ8A 5DYGA 1C8KA 1H6CA 2VLBA 3IAM6 4ONEA 3ZWQA 4I6JA 4A3SA 5A1JA 3D7LA 2ACVA 1IBLB 3CX3A 3EVAA 1U9CA 5DWDA 3ZU4A 4EY5A 2XKKA 5DX8A 4AJLA 1FU8A 1XAJA 3R3SA 3DMPA 2F4VB 3X2SA 4B7ZA 3OFKA 3IVMA 2ODEA 4I8XA 3B52X 4JN6B 2EQAA 5J2UF 1HE1C 4P8RA 3A9CA 2L6GA 2BC9A 3UTDA 4F4JA 4UASA 1SU6A 2JIOA 1ISJA 1FMCA 1WPQA 4MS4B 2O59A 1E9DA 1BN7A 3CINA 1TEHA 3K92A 2RE8A 4YA6A 4JUCA 5EJ4A 3B0PA 3HI6A 3GPLA 1FY2A 3P97A 2CZQA 4JLJA 1QVXA 5F77A 4KZKA 3VC7A 4A2CA 1U63A 3A6KA 4Y6GB 4HADA 3OETA 1NP6A 3HADA 2GSDA 2MSNA 4XKJA 5HDBB 2I8AA 4UBOA 3L93A 2X40A 2X0CA 3EG9A 5LJIA 2Y1GA 2IYRA 4BB9A 1U1GA 1Y37A 3O03A 4KOEC 1W49A 2VJMA 3AETB 3HJBA 4U5CE 2B1IA 4PHFA 3OZ7A 3RC1A 3DEYX 4F06A 3D7NA 4IMRA 1TWHA 4UUBA 3C8HA 3VKHA 2LPMA 4UVHA 5IPFA 4RZSA 2BEJA 3QHPA 1MD9A 3NEJA 1JNYA 5AVWA 1RI4A 3QTTA 3P9YA 5F9HA 2A7QA 2Q5CA 4JEMA 2OC4A 2YIVX 3LOUA 3OA1A 3AYZB 2HLDD 5DH9A 3W2TA 1ZHXA 3VNSA 2OMKA 1AY0A 2HYIC 3NXSA 1I33A 1ETUA 2FWJA 5EXDA 3I09A 3U8PA 3UQYS 1E99A 4MR7A 3DVRX 4UCWA 5AW2A 3F5SA 3HA3A 1DO8A 1VJGA 3LL7A 1XNGA 4YCNA 5FPPA 1LY1A 4G7ZF 2C96A 1M5TA 3SZRA 2IDZA 3AHCA 3QEMA 4L5YA 3I9LA 4M54A 1VJRA 5FBWB 4N65A 3IP9A 2EQBA 1TIPA 1KGSA 1Q7RA 2YS6A 4L8FA 3HVUA 3EMBA 4X6LA 4ZT7A 2WFAA 1DC8A 5SY9A 3W4KA 2OGUA 4RFLA 3V7YA 5B5SA 3ESRA 3HCEA 3L0IB 4WABA 5ANRB 3V42A 4DG9A 3FMIA 5EJ8A 2A9PA 1S8OA 3K8QA 1WEHA 2H18A 3L0OA 5G1OA 3PWSA 3RVSA 3H1TA 1QRAA 4QRIA 4GVLA 1P2DA 3ORSA 4JJ7A 3G49A 5THXA 1J49A 4A8TA 5COAA 4ATNA 3M82A 3TJ6A 1IOZA 3N05A 1GU7A 1JR4A 1NVXQ 2X7XA 4UHCA 3U5ZB 1Z75A 3IAHA 1KL7A 2OG2A 2WMDA 3FYSA 3SZMA 2NAPA 4ZQFA 2WSLA 4NQFA 1THTA 3GCDA 4FK8A 2J09A 4TRJA 3JRXA 2LKCA 2Y39A 3EARA 3SYLA 1G41A 1P44A 4M53A 4RTSA 4QYWA 5JRZA 1PFUA 4J03A 1MNQA 3VI3B 4A91A 1RM5A 3FSGA 2H4WA 2YL2A 2ZSAA 3UA3A 1GL3A 2YR0A 2GEUA 2HI0A 3M6MD 2RARA 4YJ2B 3TXAA 3PI7A 3K6SB 1H5QA 4M9UA 3H5VA 1UMCA 4GBJA 5DT2A 4DBZA 4E94A 1VLTA 4OJYA 1NVGA 1E5VA 1RAIA 2IE8A 3UCXA 2X1VA 1RLOA 1QO0D 2ID8A 4G6ZA 4LRUA 1UM9A 5HUHA 4I5IA 4JGGA 3HA5A 2PUHA 3LX4A 3WOHA 1B73A 2HIGA 4TRRA 3B6KA 1GLNA 2HJVA 2R1VB 1A5SB 3D6FA 4Q9HA 4C0JA 1OH8A 2QL6A 3ELBA 3H19A 5FWAA 4J7TA 1YS4A 1LRLA 4LDJA 4IWBA 3VRCA 5TEVA 2XWPA 5FOWA 1BE1A 2AEMA 4TXNA 4CMIA 1S2MA 2QZSA 2XZLA 5JSZB 2CDAA 4LI0A 3FSJX 4PG6A 1L4EA 4RACA 1F5NA 2CK3A 2EP8A 2Z2KA 1ECCA 2ZUFA 1Y7TA 2VFAA 2UV8A 3VO8A 1Z29A 2FPSA 2Q2VA 1N2CA 1W4AA 4TV9A 4G86A 3IBTA 4DBQA 3EXIB 5ALUA 3FUCA 1U6IA 4KTVE 4REQA 1M6NA 2EFEB 1N2ZA 1XVLA 1RKUA 1UDWA 3FDZA 2ZI3A 3KQQA 3PC4A 4NCXA 4WE3A 1D7AA 3ZX4A 4C4ZA 1PJTA 3W7AA 3ZXXA 4EIYA 2IY8A 2BMAA 2QRZA 1BNCA 1G6OA 3UB4A 1YZHA 3FDIA 3WDLA 2NTVA 3VZBA 5JUWA 1OTYA 2OFFA 2QLBA 1LE2A 1VJ1A 1Q91A 2EF0A 2X2OA 3N28A 5JPDA 3OFNA 1E7MA 3DPUA 4XYEA 2JJYA 2C1ZA 3ET4A 2DY1A 3QXGA 4RTKA 2GCOB 2V7XA 5A62A 1V16B 1DUSA 3VHXB 2GMWA 4V38A 3QRWA 3I9KA 3LC7O 3OMLA 4WWHA 3DYBA 4YIKA 3NHBA 5B1DA 1OAOC 3AC0A 1Z7BA 3X2QC 3BA1A 2YWCA 3NM5A 3WL5A 3THSA 3N7AA 3TKLA 2DJIA 3CZ5A 4X66B 1R8QA 621PA 5H83A 5B1BC 1U3FA 3L7OA 3MXTA 3RRZA 4AUMA 5C4IA 1N5KA 3KZOA 2V9ZA 1CR2A 3LD9A 1HSZA 4Q34A 2BT4A 2TMVP 1M6HA 4P4NA 3TL2A 1IUOA 5AOAA 3QYAA 1W0KD 2QD3A 1KSFX 4KQMA 1ZLYA 2HUJA 4IKOA 5CXUA 2VSXA 1YI0A 1ZL2A 4LK3A 1SHLA 4PAGA 2EIKC 1PJCA 3RODA 2VYFA 3L4BC 1J20A 5DCLA 1VLVA 5FULA 4ZWNA 3ZWAA 3BH6A 1VI5A 1G8AA 1JN0A 4OL0A 4TZ6A 1E92A 1H2WA 1M8GA 4A36A 2H4XA 2UZ0A 2I8LA 4PX5A 3ON5A 5TIIA 1HNNA 1P61B 5KJFA 1CRPA 4HJXA 4O0LA 2UUCB 3MVEA 1WOYA 1ZRSA 2FFRA 3A6DA 1PBNA 3GUHA 3I30X 2DQZA 2IXDA 2QAGC 1WSDA 3PHBE 3QNUA 4XR9A 4Z7JA 1H2HA 3Q10A 1N9ZA 2TMYA 4RUKA 1L4NA 3ZS8A 4PGHA 1P7WA 2ZEJA 4UEQA 1MEJA 1ZAKA 4L85A 1B6GA 4ZT2A 2XYPA 5JDIC 1FTNA 3TW0A 5EJIA 4O25A 3UUGA 3RVRA 3KX2A 1CERA 1VA4A 2HGSA 1ZUD1 5HUQA 7ABPA 1QG2A 2ZPTX 2N9UA 2PO5A 2GFQA 4RFSB 2FEPA 1ZH6A 2IU4A 3B2QA 4R0MA 1FA9A 2FSSA 4X3CA 2AX4A 2Q0XA 2O3UA 5E8RA 3RFVA 3T9CA 3FDXA 1Y4CA 1XN4A 1FS6A 3EA4A 3ZV3A 3VJMA 4RM2A 5B1EA 1JWAB 5EMNA 2EU8A 4TRNA 4X93A 4JI5B 3ILYA 5AVRA 2Z5FA 3CLUD 3DAYA 3IQDB 1DU4A 3LLUA 2DMRA 1GGFA 4BJHB 3CPSA 4EBBA 4BV2A 5I4IA 3EDYA 1E5QA 3E82A 3WY9A 3ZDYB 5CDFE 2AHRA 1PFWA 3KJEA 4A73A 5FB3A 3PPWA 5JD6A 3RS7A 2RJ3A 5J1TB 1YQGA 1UBTS 3EGCA 2JFYA 4Q3DA 4QBGB 3WLIA 2X9GA 4U5GA 4IIJF 2EOAA 3D6HA 2AOUB 4MV4A 5DSXA 1JECA 3WYEA 4M1MA 2AZXA 2DE0X 4KRFA 3AEKB 3EPKA 4PCLA 2WE8A 2Y9PB 1QIIA 1RQLA 4YYEA 4AJEA 2WPDD 2LKDA 1XZQA 4Z3DA 3BJZA 1K06A 1NNEA 1JJFA 1A69A 1MX5A 2I1WA 5K3FA 1TZBA 3D8BA 3RKSA 3VYUB 3LYHA 1O57A 3CO5A 3P9ZA 4JUFA 2AG0A 2C2MA 3HBNA 1T10A 3QE2A 4L0MA 3T4XA 3A9VA 3OQ6A 1XZBA 3OJEA 4JR1A 4A15A 3LDAA 4Y2VA 5E0KB 3GA5A 4PPQA 5GWXA 2FUCA 3WGKA 1F06A 4ETIA 5B6IA 5KTNA 1U28C 4LSGA 2K87A 2QBYB 2DYKA 3I9V6 3V2HA 4EUKA 4XVCA 4O1MA 3GFSA 2HTEA 5A3JA 3WK4A 4X71A 4OHWA 5LZ5A 4BRZA 3UMYA 3W2WA 3DMHA 3GQBA 2WAXA 1U28A 4GKKB 2HA7A 2OO5A 3F46A 3PIDA 1VIVA 1ZU4A 4TWIA 4BFWA 4WFKA 3GLIA 1Z3IX 1UPBA 4NYIR 2PGLA 1K6XA 2BE7A 4G5QA 1A8IA 3WX0A 4KDFA 3D5EA 3U0VA 1GFSA 3FMVA 3LDHA 4LIPD 1E9FA 1UKZA 5EZYF 5IYZF 5M3BA 2R6CA 4NC3A 3BCHA 1R0LA 4OIRF 1EA7A 2D2FA 4RGBA 3FOPA 1M0SA 1AK2A 1N7IA 3CEAA 4DNFA 3GP3A 3Q5EA 3DF9A 1OR3A 1SQ6A 1W2HA 2X2EA 2P9HA 1UEXC 4JVMA 3B38A 3Q3VA 1E1QA 4OHMA 5B58T 1KSGA 3UB2A 1A8QA 2C4HA 1P2VA 3PIRA 3WLMA 3VA7A 1PNRA 3MEQA 1Z6AA 2PX0A 3F4KA 2KJQA 2K2QB 2YZGA 2GHTA 1LH0A 1HDRA 2JFPA 3G5TA 3O9VA 4FDMA 1E0KA 3DZJA 5K5EA 1SVLA 1W85A 3HY4A 4EKYA 3IT2A 1BFKA 5ARDA 3N53A 1FZQA 2B5OA 2ACWA 3AESB 5IC5A 5EJ9A 1EJ0A 5K9ZA 3T7IA 3A1EA 3P96A 5MFPA 2FPPA 1DOHA 3C5WP 1LRJA 3CR8A 1KO4A 2VJLA 3H2KA 1B74A 4MDFA 2ZSIA 4ZI7F 1J33A 5CFLA 3C8GA 3ASOC 5FOTA 1P91A 3CR7A 1EG7A 3V4SA 3VZCA 3Q12A 3WA7A 4BJ6C 2QX6A 1N7JA 4AZSA 3U3ZA 4G0XA 1HSOA 3CFYA 2L6FA 3H0CA 5CK4A 2HD4A 3G0GA 4AKTA 1T15A 3G9ZA 4KR2A 1SC6A 4NCNA 4UAJA 4G8CA 4JD5A 4H77A 4EKIA 2A0YA 1YBMA 3GLTA 1MGOA 1PZFA 2E1RA 2IT1A 2JBHA 3VM6A 1DX9A 2CUZA 3HACA 1PJSA 5JPIA 3RAGA 1KXZA 3F7OA 3GRAA 4HMOA 5LLDA 3DMTA 2RGWA 1W0JA 2X0EA 1Q1BA 2VH5R 1IAQA 1M72A 4K1OA 4HDQB 2AEFA 4M1EA 1C0EA 3C1TA 4WLEA 3OFVA 4GZ3A 4A2PA 1X80A 1JLMA 3SJBA 3D8UA 5LC1A 4RZ2A 2J48A 5ALLA 1BZYA 1M6VB 4Q7MB 4CUJA 5LNK6 1JEEA 2HNKA 2PBFA 3NYIA 3C7AA 2W6MA 3BGWA 2I15A 1TK3A 3A58B 1FQKA 5ILOA 2VP5A 4C2TA 1YQWA 4KH0A 5FWXA 2ZWVA 1ADFA 1HETA 2DKNA 2F9LA 3AO0B 4WADA 1NVDA 2ZTLA 5BSHA 2FSIA 3VJKA 4I1PA 1A27A 1TCAA 1KNQA 1UH5A 2G3KA 3QWAA 4U63A 5CJPA 2VLIA 4FBMA 4C0LA 3WHLA 2ECKA 1ZRNA 4YL1A 2PS0A 3HCNA 4EQ6B 5LPNA 3N58A 1U9IA 2X41A 2XYGA 4GMKA 3KJHA 3RIYA 2I4IA 2H4ZA 5L7WA 3WISA 3R9IA 2XEDA 4Q5SF 2YLIA 1V4AA 3AXTA 3NEYA 1QIJA 3UG7A 3TS1A 3EFOA 3M0EA 1FDRA 1KEVA 3MW8A 2KBFA 2JA2A 3P9QA 3QVUA 4L0CA 4ALIA 4Q4CA 5BNZA 2NP7A 1DAPA 3PRYA 4JSRA 2H8KA 4FC6A 4R4JA 2FG7C 2OAGA 1KYWA 1D0ZA 5LKAA 1ZGJA 1JR3D 3RRNA 2C92A 3VC2A 2UVDA 5DTIA 4C7VA 4XWOA 4U5DE 2YLDA 4OKIA 3BF8A 4G1MB 4BTEA 4DRJB 4ZTZB 1BR1A 1IUNA 3Q3IA 2RAPA 4ITVA 4RGQA 2WP0A 3EZ9A 3SG0A 4DSUA 4EHIA 5EXPA 1TAUA 1E2HA 4OH7A 1KEKA 2PMBA 4Z99A 1CF2O 1X80B 3OD5A 1V2GA 4B7UA 3KALA 4FB4A 2YZ2A 4EGJA 4XIFA 1IUPA 2BAGA 3L4KA 4B4KA 2IYZA 4A4DA 2GFIA 2J5RA 2DOKA 3EOZA 1O9BA 2HZ7A 1WPGA 1SU8A 1PX0A 2O1XA 3LJKA 2NXNA 4MMZB 4RY9A 4D42A 1ZJ5A 4RMIA 3FPLA 4HEA6 2QD2A 4U9EA 1YJCA 5JEDA 1QU2A 2GBCA 1AE1A 1C30A 3VYWA 2V8OA 3K0AA 4FCTA 2OEXA 3DE9A 1B42A 5BSFA 1U65A 2E48A 1TECE 3KQNA 3I8XA 1ELOA 4EKGA 1IC6A 1OPRA 4HV4A 3RO7A 1ZK2A 1UC5B 2BIFA 2IZOA 1XBTA 2EF1A 3Q7TA 4C2AA 2IHYA 5FO0A 3SEFA 3DYVA 3NNDA 2YUIA 3RQFA 3R76A 2WZCA 3OZGA 4F71A 3WWCA 1LK7A 5BR1A 5BV0A 2UYYA 1RJ9B 1H8HA 4O2LA 1PG2A 3IRVA 4MTLA 1YH3A 2J9YB 1VG9B 4BO4A 1Z7YA 2IEDA 4C4OA 1BX1A 4GEHA 1IPFA 2QLAA 4I2NA 5ICFA 4CUZA 2XVMA 5HTOA 2FZKA 3DJUB 5LZ2A 4FQ5A 4H6WA 3CXRA 4BMZA 1OW8A 3EIXA 4JEUA 3QI7A 3TK0A 1NC1A 4KJXA 5AJXA 5JI2E 4B6GA 2GN8A 3E9CA 1TIBA 4QDZA 2H48A 2IYUA 4EEKA 4M98A 4ID3A 1U2GA 4DMKA 1XTJA 4H16A 1NR1A 1SCJA 1FTQA 1HEIA 2AHOA 4GYWA 2R86A 2WUFA 2PWZA 3DWGA 1T2FA 5A4FS 1UZMA 3DOOA 1MLDA 1FDOA 1ZBQA 2KMLA 2O1SA 4CV1A 4QT4A 3DYIA 3NBYC 1UBOS 1SXJC 1X1RA 1YS6A 3MJTA 4AK9A 3R4CA 5AKYA 5IH7A 2ALJA 4JASB 4E5YA 3O8QA 5TPWB 1EP3B 1HL7A 1WABA 1G8FA 2TSYB 3BMOB 3EHDA 3KPJA 1YXMA 3HYTA 4FIZA 3IAS1 4GQAA 3UT0A 4BNYA 3QLUC 4JROA 7REQA 3JQ8A 5J5CA 4QVKA 4DJEC 1SBIA 3LT5A 3NOXA 5KU7A 4XUCA 4G1FA 1KE2A 4LZPA 3U7IA 5MF6A 1QX4A 2AUNA 3F8WA 1TU3A 3SICE 2GLUA 5I51A 4F2DA 3BGIA 3OEHA 3R0ZA 4MUIA 4NLLA 1A95A 2GPNA 5I7SA 2FQQA 2VJKA 5G0UA 3NORA 2ZUDA 1Q0FA 1RHUA 3IVAA 1C4OA 3VQTA 3VPAA 1ZRMA 2IDMA 2W4BA 2I9KA 2XF8A 2WD8A 2P4UA 3DT9A 5EGSA 1Q0TA 3OQPA 1EWQA 4ZTUB 3BAFA 3REOA 3BYZA 4EX7A 1E2XA 4GGMX 5JAHA 1UDXA 3C4JA 4O1IA 5DTRA 5ETJA 4YL0A 1O5IA 4B6RA 5JQGB 1Z37A 3T99A 2C83A 2WJ3A 1XR3A 2NSLA 3FUVA 1QTNA 4ZOAA 4HO1X 5CGZA 1X9IA 3C3JA 3DCNA 2JBWA 4CFSA 2OCIA 1AKWA 4LJKA 3O94A 4ITUA 4E5SA 1Z0UA 2XB6A 3TN7A 1N7HA 4WLNA 3LLCA 4C7MA 1VLZA 2CMGA 1VCOA 4N9QA 3KKKA 5AFSA 4EA8A 3K9BA 4MPJA 4ZCRA 1E4EB 4IDEA 4LDAA 4K9NA 4O6VA 3AM3A 3ZZTA 4CMJA 3DMDA 1EQAA 4B7XA 4BC0A 1H0HA 3NVAA 4IMJB 5L0CA 3UF0A 2GKSA 3T1QA 4FYVA 1R00A 1OU4A 4G0UA 3VF0A 1A0OA 1ZYUA 2O3QA 3KAJA 4WL0A 5CX1B 3ROPA 1ABBA 4D26A 1X3SA 2CHGA 3DKAA 2HQBA 3M4NA 4LC0A 3OZAA 4RVUA 4AE4A 6CHYA 4O7GA 3FBGA 4YX9A 2JAXA 4RPGA 5A4DA 1PS8A 4RFVA 1Y3HA 3H5LA 1J70A 3JD4A 5AC4A 4IXTA 2G08A 4UHEA 1KVTA 2OP1A 1W4BA 3BL5A 1XTZA 3HXLA 5CBKA 2GCNA 5KYUA 3S81A 3IB3A 3P0FA 3IHKA 1NF2A 4TS1A 3DOUA 4TM7A 1GQSA 4UARA 3QLVA 3ZHBA 2I6QA 3ELYA 1ZVJA 4AZWA 1Q44A 1Z6XA 4HUQB 1T6YA 1E3WB 3MGGA 4FSDA 4HZGA 3OHMA 4JTDB 1QBKC 3L7DA 5ESWA 2NU6A 2G82A 4BQSA 2NYAA 4OI1A 5AW7A 4MVMA 3NH9A 2H7OA 4EHLA 5JSYA 3L0BA 2JHFA 1ISHA 2LD4A 3A6JA 2BRUC 1T8SA 4XEKA 1N3IA 1NP7A 3MPUA 4GLLA 1KVQA 2IYAA 2RAFA 4B2PA 1U94A 2YTZA 1XU4A 3N2KA 1WDKA 2WYWA 3G1TA 4RA9A 2JFVA 4FFWA 4UHJA 421PA 2FEOA 4RTJA 1LSJA 1UFVA 5EXEA 3I6MA 5AESA 5AVTA 4XIYA 5BWNA 4P4TA 5CYPA 1I94B 4E2XA 4ARCA 3NDBB 1GGVA 3GLIE 2DPMA 4I14A 2ZP1A 1QKIA 3HUEA 1CPYA 2NZVG 3BMCA 3TQCA 3A11A 3UK7A 3RADC 1I2ZA 2W00A 2YVAA 2XH8A 1FTWA 3CH7A 2PE5A 1CS0A 1LW7A 2YZSA 1NKSA 1YOBA 2GHRA 3DB2A 3FR8A 3RJ5A 2V98A 1OU0A 1T5LA 2OSBA 3O5AA 5EQTA 4U02A 4RE5A 3RVLA 2P6OA 4BLRA 2VG8A 1R0XA 1O6FA 1R27A 3NM6B 1IOWA 2N46A 3C8MA 1KAQA 2BY4A 3G2KA 5HM8A 1EDBA 3ZDXB 4JIGA 4KVGA 1U8ZA 3EVGA 3HUUA 3IQFA 3F49S 3M9XA 3SKYA 3VNUA 2HKIA 1Y7PA 3LA6A 3M4XA 1ST6A 3OA2A 1QGOA 1UDRA 4LV5B 1JFSA 3EA0A 4UDYX 1OOEA 4MUAA 4E46A 4Z0TA 1G8PA 1VE5A 4HWKA 5JVDB 1JHXA 4MVJI 4D7AA 2JCVA 3SVZA 1EA8A 1D1CA 1PWHA 3ZCSA 3UFXB 2P2YA 2JPUA 4HDRB 4PIVA 4TV8F 2HIHA 2YQZA 3EWAA 2Y3GA 2R7UA 3GCZA 4M0UA 4RY2A 2HLDA 4UXIA 4ZZ0A 4PU0A 4WK4B 1Z6YA 1O6BA 1GPDG 3HB4X 3JRTA 1FNCA 2O2XA 3PDHA 1B8NA 3TKYA 3WZLA 4F3KA 3I4LA 4NP6A 4WBNB 2IODA 2QPOA 1Q0RA 1LPNA 1P0CA 1TCCA 1Z13A 2DYRC 4ZVRA 4F7WA 1PKEA 8GPBA 3FNRA 4AJJA 2QGFA 1F48A 3FKSA 3U5TA 4C87A 4AE4B 2FG5A 4BVJA 1SVUA 1BOFA 2B4TO 3GLFB 3IB6A 2GM9A 1PO7A 2P67A 2QS9A 2YC4C 4XSGA 5FIUA 4HVCA 3NZEA 1NMXA 5BSTA 3ZHZA 2JAPA 4KIFA 1L7VC 4DJAA 1B0AA 3RG2A 4Y2XA 5B3AA 4OJQA 5A6SA 1YE5A 5KYUB 3UAGA 1XMXA 2GAOA 1G5PA 2G7MC 3NPAA 3QIAA 4U7HA 1ESCA 2V26A 2QBYA 4N39A 1IZMA 3LI2A 5LB4A 5TPZD 1VJCA 5BW6B 3LO5A 1H1LB 4BEJA 1Y8RB 2D0DA 1UZLA 3JPYA 4MUJA 4ZAVA 3GCXA 4OSEA 5BQOA 5FUYA 1DKUA 4IF6A 3ZE9A 4KWCA 3LPDA 1GQQA 3IRUA 4HNSA 4X00A 3UJPA 4R2LA 2ZSJA 3OCVA 1R50A 1WUYA 1LTHR 4E1VA 1LKXA 3LS1A 1M2JA 1ZN9A 2O52A 4UEOA 2W2VA 3L7MA 5EZ6B 2HU5A 2QVYX 4DBVO 3ZN2A 5CLHA 4H4EA 2R03A 4LISA 3ZTYA 4JCHA 1Z16A 2CFRA 4TTTS 4DJFC 1U80A 1UINA 1O97D 1ZN2A 3HGQA 1BRMA 1JHPA 3MB5A 4CCYA 5I9TA 3NT4A 1NW7A 4CTNA 3NCTA 3V3KA 1Z0JA 2I22A 3HL4A 4L8GA 4C07A 1GNTA 4D3SA 1Z47A 1R5OA 4HQRA 3WGYA 4TYPA 3DE2X 5CURA 1MGPA 3IUSA 2Y0CA 3ZI7A 4D6PA 1ANKA 2V0CA 1B23P 1RQRA 1QIGA 3ZVRA 2B99A 2EWVA 1QGDA 4RD1A 4D4KA 2R7VA 1DG1G 5FTMA 2X42A 4J1TA 2XD4A 4ARIA 4HGZA 1J0CA 3SGLA 1VTKA 1AKUA 3ITDA 2V8BA 1E3IA 4PONA 3PC8C 4QDKA 1NUQA 5KX5B 2JLUA 5IJ0B 1Z7GA 2J9WA 3NU1A 3UJ6A 3HH8A 5TQJA 5CFOA 5EINA 3UMBA 1C4WA 5BV2P 2CLKB 1AKRA 4G8DA 4IS3A 4R8LA 3RAEC 1ZM9A 1A5TA 5KSPA 1N9GA 2NXWA 2WU8A 3AZPA 5HHTA 3BXGA 1DG3A 1WVMA 4RESA 4DMCA 4F5EA 3LCVB 5IZCC 3EBOA 4GGOA 4D9MA 3LHIA 1XROA 4XASA 2CLLB 3MTAA 4PINA 1Y3AA 3RVPA 1N77A 3EGWA 1L7MA 4F8JA 2EGUA 3WIDA 3AVVA 3WLTA 4MQUA 3V1LA 1RXCA 1N6RA 4N5DA 3K9QO 4QULA 3RK4A 3EXG2 2ADFA 1O94C 2AWYA 2AL7A 2NIPA 3P7MA 4REMA 3GPDG 4RKRA 4G63A 2XIJA 5CW2A 5EEHA 1FTSA 3X44A 4RMJA 3P0HA 5L3VA 4CBEA 5EJMA 4FJ2A 2NPUA 1W8DA 4D6XA 5D92A 3USES 4B3IA 5D8DA 1IRXA 1H0KA 4KQWA 5ERGB 1W85B 1YIDA 4CM7A 4GI7A 2GWRA 1C1XA 5MDHA 2G1KA 1ISFA 2P1RA 3I5PA 4UVEA 3UANA 1ZH4A 2REQB 1EYZA 2CJPA 3W05A 2GLTA 2HFKA 4BNGA 3QITA 1VFNA 2PQMA 4LS3A 3G2QA 1Y34E 5B3LA 3ZGYA 4MW4A 4BN4A 4RORA 3OCUA 2PRKA 4BN5A 1JAFA 1HYHA 4HSGA 4YMLA 1FUEA 2OGTA 3LUCA 2C7BA 3EQZA 3IA2A 1T6BY 3IALA 4LCBA 3QE0A 4R16A 2JFOA 2YXDA 2FUKA 3TSZA 2V7QD 4MIKA 1ECGA 4HTFA 2GM3A 4KPUB 2R0QC 3RVDA 2YJ5A 5BQ5A 4HDAA 2XVAA 4LQCA 3RQGA 3EVZA 1PR5A 1HO3A 3WGOA 4YR9A 5A3RA 2R25A 1V48A 4H59A 1ZDMA 1U11A 4LRWA 4BXOA 5JZBA 3BKWA 4AYTA 2P9YA 1LSOA 1FFSA 2AGVA 2OO3A 1CJTC 5LQUA 3A2KA 1Z8FA 3D0QA 4JLVA 5L53A 2CNKA 3MJHA 5LOVF 1NJSA 5EN4A 4BC1A 3L8MA 5KSYA 1W581 3B7WA 4HNAB 1WGWA 1SUFA 2W22A 4U5EE 2PH7A 4ENTA 3KPWA 1CJUC 4XFJA 3CSDA 2FI1A 1Y6DA 3S0XA 3W8HA 1O77A 1UBMS 2L0XA 2ZVJA 1RHQA 4BMPB 1MU0A 1J5PA 1PEAA 2CXPA 2JCGA 3N75A 4K9PA 2VHZA 1TVCA 3RSZA 5CVUA 4E5KA 4N40A 4LX0A 2G6TA 1R6BX 2BBOA 2WUVA 1PR2A 4OFZA 3TLKA 2LCHA 1YZTA 1UP6A 3BWCA 1ZIYA 4U39A 2C4UA 4QGGA 4ZVVA 4ZKDA 1V47A 1JIKA 1MXFA 3MJRA 5I7RA 3L77A 2AMVA 3T61A 2XCTB 1J8VA 3EIQA 1WDTA 3PX2A 3BCSA 3KKQA 5EKTA 2YLGA 1C3VA 5EZ5A 3UZUA 2RHOA 3FFXA 4QU8A 2FEWB 2ERCA 2GESA 3FJYA 3Q85A 1EUCB 3KLPX 3QXHA 4CG0A 1EESA 2FW6A 5HKAA 5KTKA 5T8KC 4EHFA 3KSDO 4UPVA 2DUJA 1IOLA 5T4BA 3IGFA 1X19A 3IE2A 3IDSA 4YO8A 2PSHA 3KLMX 2WPDA 1NMQA 4JITA 3Q6IA 4NV0A 3ZJ5A 4KQXA 4NG5A 1Q57A 1JKXA 1N8SA 3DR5A 5CVJA 3SDBA 2OK8A 4PCVA 1V7QA 4D2IA 3UK2A 1LE4A 3QKIA 1VE9A 5TVGA 1J4AA 5ALZA 2ERYA 3RASA 1TOAA 2EW1A 4ALMA 3BIOA 4R5MA 2IYFA 4XDZA 3R24A 5A69A 1XDSA 5HZKA 1NQAO 4PFKA 2WM3A 4CTJA 1DDGA 2JFWA 4QUKA 2B69A 2O8CA 1UWCA 4J07A 3KQPA 4X6UA 1GLVA 2QP4A 3LKVA 1GT91 4BE7B 3C6KA 3MM4A 4PXAA 1R5JA 1DKNA 2I87A 2XADA 3ZW8A 4PZLA 2OKCA 1NVEA 2J3MA 3EFEA 3QLVC 4Q01A 5CRIA 1C0LA 5G2OA 1GQAA 5DNEA 3K1ZA 5ALHA 1UBFA 1YIAA 5G4KB 1J21A 3S1LA 1BAPA 2EX1A 2CFCA 3GD5A 5FNVF 1ZI9A 4W9NA 4MUGA 4DIOA 1RTKA 1RMYA 2AS0A 3CE6A 3FDFA 4CQNA 3WLAA 1U5BA 4JLMA 1I4WA 1VBMA 4MLDA 1R4MB 1I2DA 1ODTC 4L8VA 5G0TA 4ZARA 2I4NA 2ZBVA 2PNJA 1XB2A 3PPVA 1P5ZB 2JJQA 1CUXA 1QK4A 5EJAA 5KWEA 1CPRA 3EASA 3UJ3X 3ZDBA 1R4TA 2HPVA 2CMDA 2XTMA 4CETA 3ETJA 4DY4A 3F6RA 4RDXA 5F5FA 4GVXA 3JD3A 3WRYA 1TYBE 3DL0A 4DM3A 1ZOIA 2XZDA 5A3QA 3RRXA 3WL4A 2W6JD 3D7KA 1LLDA 3WLRA 4QXMA 2KQ9A 1J22A 2ZRPA 4K03A 3NBMA 4Q9AA 1QOQB 4QA9A 3OZSA 1ZMXA 4DSNA 3HA7A 3SSNA 1MT0A 3D6NB 5DRYA 2RD9A 1E9BA 3I92A 5I7HA 4QARA 2ZUCA 1K6MA 4ZHQB 1QX3A 1EEXB 2NYUA 3KYIB 4LJYA 2BKXA 4RW0A 1PEDA 3WP1B 3P9SA 5C5CA 1R0ZA 1Z35A 2NSJA 5IAEA 2JJ2A 5BNFA 3SF8A 4XJVA 3VO1A 4ZAGA 4YRGA 1KDPA 1J6UA 5FA5A 3GQVA 4I1OA 1XTSA 4Z2AA 2RI1A 5JSUA 3ZWBA 1KKUA 3NG1A 2GZRA 3CVVA 4EUKB 1R74A 2QL7A 3LECA 4L27A 2XB2A 3LPCA 3LZCA 2GGSA 2ROQA 2XODA 5J4LA 3IPYA 2H9AA 3HZHA 1TB4A 4XTKA 1J7JA 3K73O 2Z1NA 3MN1A 2J3LA 2ORED 3RYLA 4B3FX 4BKQA 1EE9A 1HV8A 3WGNA 2WM8A 3NYLA 1GZUA 2PJZA 4W8KA 3FB1A 3BCUA 2DTDA 4IG4A 5IANA 5KREA 1PJZA 2YNMD 3HYCA 4FGKA 4BDSA 1PR0A 2GZDA 2BEUB 4BNKA 2A1TS 5J4KA 2QSZA 5AW5A 3V2GA 1Y42X 1VSVA 5HRUA 3CA8A 4B3MB 1Z12A 4ZPJA 4ZI2A 4DLAA 10MHA 2Z8XA 1JEYB 3AWIA 3UJDA 1DKOA 3WL6A 3K9HA 4O4JF 4BQRA 2CEKA 4G25A 2EYUA 3BL6A 1XQXA 3SLKA 5L0HA 4PSUA 4B32A 4CT4B 5HFJA 5TDHA 1PZHA 3LCCA 1NMYA 2MR5A 3GJSA 4ZVLA 5H59A 3B5JA 2DM6A 1WDLA 4FX5A 2VAMA 5B3JC 3BJMA 5B6PA 3RB8A 3LXUX 3WYGA 3PUIA 3GCWA 3TYXA 4CU5A 4JYCA 1BVRA 4TWBA 1Z2OX 4PYMA 1P75A 1FYDA 2WG0A 3WLJA 3B3GA 5KTOA 1O8CA 3ZLJA 1W25A 3CJTA 1CCWA 1T1JA 1V7PC 2LUOA 5BRAA 3TZEA 1BJTA 5J2UB 2FPWA 1E6UA 4CIXA 4AL4A 5SZJA 1ZN7A 2PFSA 2QWXA 4FFDA 4DPLA 5E8JA 4B81A 2RGBA 3HL0A 1J09A 3LDGA 4YJHA 3OZXA 4DR5B 4B6QA 4LMRA 4EG8A 5G0WA 1CULC 1FS5A 3RUDA 1E1RD 2PXCA 4N0MA 5CPBA 5NLLA 2IXMA 1H23A 4A6PA 2A5YB 1I1QB 4XPIB 1GTSA 1HMPA 5CNKA 3U3FA 1IQUA 1RQPA 2OHGA 3MFQA 2X4LA 1OYVA 4J3JA 1IBSA 1TEVA 1NXSA 4BO6A 4IJVA 1B0UA 1GXSB 1H3EA 2QVZX 3KFXA 2YHIB 1D04A 3AERA 5A5DA 1XU9A 1NBMD 1ETHA 1WPXA 4X85A 4E4TA 3N39C 4IJ6A 5AD1A 2ZYGA 1KMIY 1Z8NA 3IVCA 3KSBC 2OUKA 2G88A 3DB1A 1AS3A 1P19A 2ZXWC 4G0OA 4KIWA 2HMSA 3ROGA 4DARA 7AT1A 2DFTA 3A1NA 3VPGA 2WIJA 2N42A 3HM2A 1CUJA 3BHNA 3PT9A 4XJXA 1L7NA 2FW7A 1Q16A 2GPAA 4URVR 1PR6A 2R6JA 1OXXK 1EQ1A 3OTGA 4LOIA 4D0GA 1U7WA 5BV8A 2UUBB 5L3SB 3E58A 1D8TA 2WWVD 3ZWVA 3LNMB 6PFKA 2O2GA 2WG2A 3QEOA 3P27A 3AUUA 3NNNA 4B6OA 1L7BA 5J3JA 4YJFA 3CWCA 1EFHA 1RM0A 1YONA 2QUJA 3R5KA 3O7WA 3WGLA 1BO6A 4QTYA 5IT0A 4WV3A 1Q6ZA 4KBFA 4JKYA 1PL0A 3QW4B 1LI7A 3FKSD 3EVFA 2DB4A 1CUYA 1GTG1 2C2WA 1OFUX 1QFXA 4UFOA 1FSGA 4WA7A 4AS2A 3PXDA 5KWSA 1RW4A 4HEHA 1JQJC 1QUEA 2Y0PA 2CLFB 2QQ5A 4G0VA 3IURA 1R3UA 4U6QA 5EIBD 3ZNPA 1XAHA 1JBKA 4DLPA 1KAEA 5FAKA 2G6BA 2C94A 4BO8A 2ZUWA 5KYWA 1T0IA 2RGGA 2I3DA 1TRKA 2LDBA 4GR9A 3QKRA 3X1XA