2YVTA

Crystal structure of aq_1956
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
MPRKVLAIKNFKERFDLLPKLKGVIAEKQPDILVVVGNILKNEALEKEYERAHLARREPNRKVIHENEHYIIETLDKFFREIGELGVKTFVVPGKNDAPLKIFLRAAYEAETAYPNIRVLHEGFAGWRGEFEVIGFGGLLTEHEFEEDFVLKYPRWYVEYILKFVNELKPRRLVTIFYTPPIGEFVDRTPEDPKHHGSAVVNTIIKSLNPEVAIVGHVGKGHELVGNTIVVNPGEFEEGRYAFLDLTQHKIKLEQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aq_1956
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein aq_1956
total genus 90
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14582 Metallophos_3 Metallophosphoesterase, calcineurin superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2yvtA00
1HP1A 4UT2A 4H2FA 5JPFA 4J6OA 4DT2A 4JA7A 4Q7FA 2WDCA 3AUZA 1U32A 3JYFA 4F0ZA 1T71A 1OIEA 4TUGA 2NPPC 3H60A 3QFOA 4FBWA 5EQVA 4NZVA 3ICFA 2BCDA 3H63A 3LL8A 4FCXA 4V0WA 3N5UA 3QG5C 3KBPA 4H2GA 1UTEA 2JOGA 4DHLA 4WWLA 4V0VA 3H67A 5J28A 1NNWA 3IB7A 1KBPA 4JA9A 3TGHA 4H1SA 5JJTA 3H64A 4O43A 3RQZA 2USHA 1OIDA 4ORAA 4UWQA 2GJUA 2WDEA 1HPUA 3V4YA 3RL5A 3HVQA 4HD0A 3PSNA 1M63A 3E7BA 3H68A 1MF8A 2BDXA 2QJCA 3GVEA 3P71C 4LU9A 3IB8A 1HO5A 2CV9A 3FGAC 1XM7A 2Q8UA 3CK2A 1G5BA 3PSOA 4XPNA 4ORCA 1SU1A 4IYPC 2WDFA 3ZTVA 2ZBMA 4TUIA 5C1VA 1XZWA 3H61A 4ORBA 3QFMA 3RL4A 1S3MA 2P6BA 1S3LA 5INBA 2Z1AA 3EGGA 3K7WC 2DFJA 1Z2XA 1V73A 4ZVZA 4DSYA 4IL1A 2BQ8X 1USHA 5F3WA 4O5GA 2QFPA 4H2IA 3ZU0A 2Z06A 2WDDA 5B8IA 2R17A 4FBQA 4LTYA 3IVEA 1S95A 5GTUA 4MP0A 3T1IA 4KKZA 3RL3A 2QFRA 1WARA 2O8GA 1QHWA 4V0XA 3QFKA 2HYOA 2NXFA 2XMOA 1TCOA 3H62B 2A22A 3C9FA 2AHDA 1W24A 4YKEA 1UF3A 1QFCA 3DW8C 3THNA 3EGHA 5IOHA 2O8AA 4FBKA 4I5LC 4G9JA 1S8EA 1WAO1 1OI8A 3THOB 5HPEA 3H66A 5JPEA 3K7VC 5DNYA 4O24A 2NYLC 1II7A 3QFNA 1IT6A 2Z72A 3E7AA 4I5NC 1AUIA 4LACC 4KBPA 3AV0A 4B2OA 4OR9A 4UT3A 3DSDA 4UT3B 2NYMC 2YVTA 1S3NA 2HYPA 4ZX2A 4MOYA 1JK7A 2IAEC 3C5WC 4H2BA 3H69A 4M0VA 2IE4C 4H1YP 4MOVA 3DSCA 4O4KA 2IE3C 1Z2WA 1FJMA 3IVDA 1T70A 2HY1A 2KKNA 1S70A
chains in the Genus database with same CATH superfamily
1HP1A 4UT2A 2ZOAA 4H2FA 5JPFA 4J6OA 4DT2A 4JA7A 4Q7FA 2WDCA 3AUZA 1U32A 3JYFA 4F0ZA 1T71A 1OIEA 4TUGA 2NPPC 3H60A 3E0JA 3QFOA 4FBWA 5EQVA 4NZVA 3ICFA 2BCDA 3H63A 3LL8A 4FCXA 4V0WA 3N5UA 3QG5C 3KBPA 4H2GA 1UTEA 2JOGA 4DHLA 4WWLA 4V0VA 3H67A 5J28A 1NNWA 3IB7A 1KBPA 4JA9A 3TGHA 4H1SA 5JJTA 3H64A 4O43A 3RQZA 2USHA 1OIDA 4ORAA 4UWQA 2GJUA 2WDEA 1HPUA 3V4YA 3RL5A 3HVQA 4HD0A 3PSNA 1M63A 3E7BA 3H68A 1MF8A 2BDXA 2QJCA 3GVEA 3P71C 4LU9A 3IB8A 1HO5A 2CV9A 3FGAC 1XM7A 2Q8UA 3CK2A 1G5BA 3PSOA 4XPNA 2DXLA 4ORCA 1SU1A 4IYPC 2WDFA 3ZTVA 2ZBMA 4TUIA 5C1VA 1XZWA 3H61A 4ORBA 3QFMA 3RL4A 1S3MA 2P6BA 1S3LA 5INBA 2Z1AA 3EGGA 3K7WC 2DFJA 1Z2XA 1V73A 4ZVZA 4DSYA 4IL1A 2BQ8X 1USHA 3FLOA 5F3WA 4O5GA 2QFPA 4H2IA 3ZU0A 2Z06A 2WDDA 5B8IA 2R17A 4FBQA 4LTYA 3IVEA 1S95A 5GTUA 4MP0A 3T1IA 4KKZA 2YEQA 3RL3A 2QFRA 1WARA 2O8GA 1QHWA 4V0XA 3QFKA 2HYOA 2NXFA 2XMOA 1TCOA 3H62B 2A22A 3C9FA 2ZO9B 2AHDA 1W24A 4YKEA 1UF3A 3D03A 1QFCA 3DW8C 3THNA 3EGHA 5IOHA 2O8AA 4FBKA 4I5LC 4G9JA 2DXNA 1S8EA 1WAO1 1OI8A 3THOB 5HPEA 3H66A 5JPEA 3K7VC 5DNYA 4O24A 2NYLC 1II7A 3QFNA 1IT6A 2Z72A 3E7AA 4I5NC 1AUIA 4LACC 4KBPA 3AV0A 4B2OA 4OR9A 4UT3A 3DSDA 4UT3B 2NYMC 2YVTA 1S3NA 2HYPA 4ZX2A 4MOYA 1JK7A 2IAEC 3C5WC 4H2BA 3H69A 4M0VA 2IE4C 4H1YP 4MOVA 3DSCA 4O4KA 2IE3C 1Z2WA 1FJMA 3IVDA 1T70A 2HY1A 2KKNA 1S70A
chains in the Genus database with same CATH topology
1HP1A 4UT2A 2ZOAA 4H2FA 5JPFA 4J6OA 4DT2A 4JA7A 4Q7FA 2WDCA 3AUZA 1U32A 3JYFA 4F0ZA 1T71A 1OIEA 4TUGA 2NPPC 3H60A 3E0JA 3QFOA 4FBWA 5EQVA 4NZVA 3ICFA 2BCDA 3H63A 3LL8A 4FCXA 4V0WA 3N5UA 3QG5C 3KBPA 4H2GA 1UTEA 2JOGA 4DHLA 4WWLA 4V0VA 3H67A 5J28A 1NNWA 3IB7A 1KBPA 4JA9A 3TGHA 4H1SA 5JJTA 3H64A 4O43A 3RQZA 2USHA 1OIDA 4ORAA 4UWQA 2GJUA 2WDEA 1HPUA 3V4YA 3RL5A 3HVQA 4HD0A 3PSNA 1M63A 3E7BA 3H68A 1MF8A 2BDXA 2QJCA 3GVEA 3P71C 4LU9A 3IB8A 1HO5A 2CV9A 3FGAC 1XM7A 2Q8UA 3CK2A 1G5BA 3PSOA 4XPNA 2DXLA 4ORCA 1SU1A 4IYPC 2WDFA 3ZTVA 2ZBMA 4TUIA 5C1VA 1XZWA 3H61A 4ORBA 3QFMA 3RL4A 1S3MA 2P6BA 1S3LA 5INBA 2Z1AA 3EGGA 3K7WC 2DFJA 1Z2XA 1V73A 4ZVZA 4DSYA 4IL1A 2BQ8X 1USHA 3FLOA 5F3WA 4O5GA 2QFPA 4H2IA 3ZU0A 2Z06A 2WDDA 5B8IA 2R17A 4FBQA 4LTYA 3IVEA 1S95A 5GTUA 4MP0A 3T1IA 4KKZA 2YEQA 3RL3A 2QFRA 1WARA 2O8GA 1QHWA 4V0XA 3QFKA 2HYOA 2NXFA 2XMOA 1TCOA 3H62B 2A22A 3C9FA 2ZO9B 2AHDA 1W24A 4YKEA 1UF3A 3D03A 1QFCA 3DW8C 3THNA 3EGHA 5IOHA 2O8AA 4FBKA 4I5LC 4G9JA 2DXNA 1S8EA 1WAO1 1OI8A 3THOB 5HPEA 3H66A 5JPEA 3K7VC 5DNYA 4O24A 2NYLC 1II7A 3QFNA 1IT6A 2Z72A 3E7AA 4I5NC 1AUIA 4LACC 4KBPA 3AV0A 4B2OA 4OR9A 4UT3A 3DSDA 4UT3B 2NYMC 2YVTA 1S3NA 2HYPA 4ZX2A 4MOYA 1JK7A 2IAEC 3C5WC 4H2BA 3H69A 4M0VA 2IE4C 4H1YP 4MOVA 3DSCA 4O4KA 2IE3C 1Z2WA 1FJMA 3IVDA 1T70A 2HY1A 2KKNA 1S70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP1 A;  4UT2 A;  4H2F A;  5JPF A;  4J6O A;  4DT2 A;  4JA7 A;  4Q7F A;  2WDC A;  3AUZ A;  1U32 A;  3JYF A;  4F0Z A;  1T71 A;  1OIE A;  4TUG A;  2NPP C;  3H60 A;  3QFO A;  4FBW A;  5EQV A;  4NZV A;  3ICF A;  2BCD A;  3H63 A;  3LL8 A;  4FCX A;  4V0W A;  3N5U A;  3QG5 C;  3KBP A;  4H2G A;  1UTE A;  2JOG A;  4DHL A;  4WWL A;  4V0V A;  3H67 A;  5J28 A;  1NNW A;  3IB7 A;  1KBP A;  4JA9 A;  3TGH A;  4H1S A;  5JJT A;  3H64 A;  4O43 A;  3RQZ A;  2USH A;  1OID A;  4ORA A;  4UWQ A;  2GJU A;  2WDE A;  1HPU A;  3V4Y A;  3RL5 A;  3HVQ A;  4HD0 A;  3PSN A;  1M63 A;  3E7B A;  3H68 A;  1MF8 A;  2BDX A;  2QJC A;  3GVE A;  3P71 C;  4LU9 A;  3IB8 A;  1HO5 A;  2CV9 A;  3FGA C;  1XM7 A;  2Q8U A;  3CK2 A;  1G5B A;  3PSO A;  4XPN A;  4ORC A;  1SU1 A;  4IYP C;  2WDF A;  3ZTV A;  2ZBM A;  4TUI A;  5C1V A;  1XZW A;  3H61 A;  4ORB A;  3QFM A;  3RL4 A;  1S3M A;  2P6B A;  1S3L A;  5INB A;  2Z1A A;  3EGG A;  3K7W C;  2DFJ A;  1Z2X A;  1V73 A;  4ZVZ A;  4DSY A;  4IL1 A;  2BQ8 X;  1USH A;  5F3W A;  4O5G A;  2QFP A;  4H2I A;  3ZU0 A;  2Z06 A;  2WDD A;  5B8I A;  2R17 A;  4FBQ A;  4LTY A;  3IVE A;  1S95 A;  5GTU A;  4MP0 A;  3T1I A;  4KKZ A;  3RL3 A;  2QFR A;  1WAR A;  2O8G A;  1QHW A;  4V0X A;  3QFK A;  2HYO A;  2NXF A;  2XMO A;  1TCO A;  3H62 B;  2A22 A;  3C9F A;  2AHD A;  1W24 A;  4YKE A;  1UF3 A;  1QFC A;  3DW8 C;  3THN A;  3EGH A;  5IOH A;  2O8A A;  4FBK A;  4I5L C;  4G9J A;  1S8E A;  1WAO 1;  1OI8 A;  3THO B;  5HPE A;  3H66 A;  5JPE A;  3K7V C;  5DNY A;  4O24 A;  2NYL C;  1II7 A;  3QFN A;  1IT6 A;  2Z72 A;  3E7A A;  4I5N C;  1AUI A;  4LAC C;  4KBP A;  3AV0 A;  4B2O A;  4OR9 A;  4UT3 A;  3DSD A;  4UT3 B;  2NYM C;  2YVT A;  1S3N A;  2HYP A;  4ZX2 A;  4MOY A;  1JK7 A;  2IAE C;  3C5W C;  4H2B A;  3H69 A;  4M0V A;  2IE4 C;  4H1Y P;  4MOV A;  3DSC A;  4O4K A;  2IE3 C;  1Z2W A;  1FJM A;  3IVD A;  1T70 A;  2HY1 A;  2KKN A;  1S70 A; 
#chains in the Genus database with same CATH topology
 1HP1 A;  4UT2 A;  2ZOA A;  4H2F A;  5JPF A;  4J6O A;  4DT2 A;  4JA7 A;  4Q7F A;  2WDC A;  3AUZ A;  1U32 A;  3JYF A;  4F0Z A;  1T71 A;  1OIE A;  4TUG A;  2NPP C;  3H60 A;  3E0J A;  3QFO A;  4FBW A;  5EQV A;  4NZV A;  3ICF A;  2BCD A;  3H63 A;  3LL8 A;  4FCX A;  4V0W A;  3N5U A;  3QG5 C;  3KBP A;  4H2G A;  1UTE A;  2JOG A;  4DHL A;  4WWL A;  4V0V A;  3H67 A;  5J28 A;  1NNW A;  3IB7 A;  1KBP A;  4JA9 A;  3TGH A;  4H1S A;  5JJT A;  3H64 A;  4O43 A;  3RQZ A;  2USH A;  1OID A;  4ORA A;  4UWQ A;  2GJU A;  2WDE A;  1HPU A;  3V4Y A;  3RL5 A;  3HVQ A;  4HD0 A;  3PSN A;  1M63 A;  3E7B A;  3H68 A;  1MF8 A;  2BDX A;  2QJC A;  3GVE A;  3P71 C;  4LU9 A;  3IB8 A;  1HO5 A;  2CV9 A;  3FGA C;  1XM7 A;  2Q8U A;  3CK2 A;  1G5B A;  3PSO A;  4XPN A;  2DXL A;  4ORC A;  1SU1 A;  4IYP C;  2WDF A;  3ZTV A;  2ZBM A;  4TUI A;  5C1V A;  1XZW A;  3H61 A;  4ORB A;  3QFM A;  3RL4 A;  1S3M A;  2P6B A;  1S3L A;  5INB A;  2Z1A A;  3EGG A;  3K7W C;  2DFJ A;  1Z2X A;  1V73 A;  4ZVZ A;  4DSY A;  4IL1 A;  2BQ8 X;  1USH A;  3FLO A;  5F3W A;  4O5G A;  2QFP A;  4H2I A;  3ZU0 A;  2Z06 A;  2WDD A;  5B8I A;  2R17 A;  4FBQ A;  4LTY A;  3IVE A;  1S95 A;  5GTU A;  4MP0 A;  3T1I A;  4KKZ A;  2YEQ A;  3RL3 A;  2QFR A;  1WAR A;  2O8G A;  1QHW A;  4V0X A;  3QFK A;  2HYO A;  2NXF A;  2XMO A;  1TCO A;  3H62 B;  2A22 A;  3C9F A;  2ZO9 B;  2AHD A;  1W24 A;  4YKE A;  1UF3 A;  3D03 A;  1QFC A;  3DW8 C;  3THN A;  3EGH A;  5IOH A;  2O8A A;  4FBK A;  4I5L C;  4G9J A;  2DXN A;  1S8E A;  1WAO 1;  1OI8 A;  3THO B;  5HPE A;  3H66 A;  5JPE A;  3K7V C;  5DNY A;  4O24 A;  2NYL C;  1II7 A;  3QFN A;  1IT6 A;  2Z72 A;  3E7A A;  4I5N C;  1AUI A;  4LAC C;  4KBP A;  3AV0 A;  4B2O A;  4OR9 A;  4UT3 A;  3DSD A;  4UT3 B;  2NYM C;  2YVT A;  1S3N A;  2HYP A;  4ZX2 A;  4MOY A;  1JK7 A;  2IAE C;  3C5W C;  4H2B A;  3H69 A;  4M0V A;  2IE4 C;  4H1Y P;  4MOV A;  3DSC A;  4O4K A;  2IE3 C;  1Z2W A;  1FJM A;  3IVD A;  1T70 A;  2HY1 A;  2KKN A;  1S70 A; 
#chains in the Genus database with same CATH homology
 1HP1 A;  4UT2 A;  2ZOA A;  4H2F A;  5JPF A;  4J6O A;  4DT2 A;  4JA7 A;  4Q7F A;  2WDC A;  3AUZ A;  1U32 A;  3JYF A;  4F0Z A;  1T71 A;  1OIE A;  4TUG A;  2NPP C;  3H60 A;  3E0J A;  3QFO A;  4FBW A;  5EQV A;  4NZV A;  3ICF A;  2BCD A;  3H63 A;  3LL8 A;  4FCX A;  4V0W A;  3N5U A;  3QG5 C;  3KBP A;  4H2G A;  1UTE A;  2JOG A;  4DHL A;  4WWL A;  4V0V A;  3H67 A;  5J28 A;  1NNW A;  3IB7 A;  1KBP A;  4JA9 A;  3TGH A;  4H1S A;  5JJT A;  3H64 A;  4O43 A;  3RQZ A;  2USH A;  1OID A;  4ORA A;  4UWQ A;  2GJU A;  2WDE A;  1HPU A;  3V4Y A;  3RL5 A;  3HVQ A;  4HD0 A;  3PSN A;  1M63 A;  3E7B A;  3H68 A;  1MF8 A;  2BDX A;  2QJC A;  3GVE A;  3P71 C;  4LU9 A;  3IB8 A;  1HO5 A;  2CV9 A;  3FGA C;  1XM7 A;  2Q8U A;  3CK2 A;  1G5B A;  3PSO A;  4XPN A;  2DXL A;  4ORC A;  1SU1 A;  4IYP C;  2WDF A;  3ZTV A;  2ZBM A;  4TUI A;  5C1V A;  1XZW A;  3H61 A;  4ORB A;  3QFM A;  3RL4 A;  1S3M A;  2P6B A;  1S3L A;  5INB A;  2Z1A A;  3EGG A;  3K7W C;  2DFJ A;  1Z2X A;  1V73 A;  4ZVZ A;  4DSY A;  4IL1 A;  2BQ8 X;  1USH A;  3FLO A;  5F3W A;  4O5G A;  2QFP A;  4H2I A;  3ZU0 A;  2Z06 A;  2WDD A;  5B8I A;  2R17 A;  4FBQ A;  4LTY A;  3IVE A;  1S95 A;  5GTU A;  4MP0 A;  3T1I A;  4KKZ A;  2YEQ A;  3RL3 A;  2QFR A;  1WAR A;  2O8G A;  1QHW A;  4V0X A;  3QFK A;  2HYO A;  2NXF A;  2XMO A;  1TCO A;  3H62 B;  2A22 A;  3C9F A;  2ZO9 B;  2AHD A;  1W24 A;  4YKE A;  1UF3 A;  3D03 A;  1QFC A;  3DW8 C;  3THN A;  3EGH A;  5IOH A;  2O8A A;  4FBK A;  4I5L C;  4G9J A;  2DXN A;  1S8E A;  1WAO 1;  1OI8 A;  3THO B;  5HPE A;  3H66 A;  5JPE A;  3K7V C;  5DNY A;  4O24 A;  2NYL C;  1II7 A;  3QFN A;  1IT6 A;  2Z72 A;  3E7A A;  4I5N C;  1AUI A;  4LAC C;  4KBP A;  3AV0 A;  4B2O A;  4OR9 A;  4UT3 A;  3DSD A;  4UT3 B;  2NYM C;  2YVT A;  1S3N A;  2HYP A;  4ZX2 A;  4MOY A;  1JK7 A;  2IAE C;  3C5W C;  4H2B A;  3H69 A;  4M0V A;  2IE4 C;  4H1Y P;  4MOV A;  3DSC A;  4O4K A;  2IE3 C;  1Z2W A;  1FJM A;  3IVD A;  1T70 A;  2HY1 A;  2KKN A;  1S70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...