2YWKA

Crystal structure of rrm-domain derived from human putative rna-binding protein 11
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
b'QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative RNA-binding protein 11
publication title Crystal structure of RRM-domain derived from human putative RNA-binding protein 11
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ywkA01
2KRRA 3UD4P 1DBDA 3VAMA 2X1BA 1DRZA 1UW4A 2QFJA 2XNQA 3CCUS 1D8ZA 1N8RT 1P27B 1N88A 4Y00A 3R27A 2MGZA 1HD1A 2DNYA 2ADCA 1M5VC 4F26A 2KXHA 2KM8C 5IM0B 2KVIA 1WF0A 2U1AA 3CCLS 1H2VZ 3MI7X 4W90B 3K0JA 2JWNA 3CCMS 2MJUA 2DH7A 2AYMA 3SDEA 1YJNS 1KOHA 2YH1A 3R1HA 2NLWA 1VQ8S 1VQKS 2MKIA 2G0CA 2DGWA 2X1FA 3L3CA 2MQLA 1HL6A 4EGLA 3CD6S 1UFWA 1JMTA 2ADBA 1H2UX 2QEXS 3NS5A 4UQTA 3CUNA 2M9KA 1D9AA 3MUMP 2FY1A 1VBZA 2OIHA 3MDFA 3S8SA 1WHVA 3PIPQ 1WWHA 2YKAA 1U1NA 1WEXA 1IQTA 2A3JA 4ZKAA 1URNA 2CQPA 2DHGA 2AYBA 2L08A 2KM8B 3P6YC 1FT8A 5DDQC 2FC8A 4OZ0A 1WELA 5HO4A 3CC7S 3CCES 1ZH5A 2LA6A 3G71S 2DH9A 1X4BA 2RUGA 4M5DB 4WIIA 1SJ3P 2DH8A 3MOJB 2RS8A 2DHAA 3VALA 4A8XA 1SJ4P 3UCZP 5JVGQ 2DNRA 2OTJS 2M70A 1OWXA 3PIOQ 1U1MA 1FNXH 3NNCA 5CXTA 2KG1A 1ZZFA 1X5OA 1R8HA 2EK1A 1U6BA 1UAWA 1WI8A 2LXIA 1N54B 4WFAQ 3EX7B 3Q2SC 1XN9A 1RK8A 2MZSA 1FHTA 1FJ7A 3MD1A 3I55S 5IM0A 2N7CA 3UCUP 2UP1A 1SJQA 2HGNA 2VODA 3ULHA 3TYTA 3U1MA 5EN1A 1QM9A 4IO9Q 5DM7Q 2MQNA 2MJNA 3G6ES 1WG5A 2DNZA 2OSQA 3VAKA 3DLLQ 1M5OC 2XS7A 1R8PA 2ZJPQ 3BO3A 3S01A 4TU7A 2HYIB 2HGMA 1PGZA 2E5HA 2F9JA 2F3JA 2LYVA 1BY9A 1KC8T 2DK2A 4YUDA 1VQ6S 1U1LA 4U67Q 2MXYA 2KFYA 2MSSA 1H2TZ 2WBRA 1WTBA 1OPIA 4PKDB 4QU6A 2HGLA 3G4SS 2RU3A 2PEHA 3P49B 2DGOA 3U1LA 3N9UC 4WF9Q 2DHSA 2OSRA 4CH1A 2DGTA 3UE2A 2RT3A 2RS2A 1YJ9S 2X1GA 1RKJA 2KYXA 2MPUA 1A7GE 3VAIA 4IOAQ 2DNMA 2JX2A 2M8HA 2CQ4A 3ZZYA 1YI2S 1WF1A 1X0FA 1FJCA 3S6EA 2XNRA 1VQLS 3S7RA 2M88A 5GVQA 5DDOC 2M2BA 3SMZA 1DZ5A 4PR6A 2N82B 4J5OA 1FXLA 3MURP 5LJ3Y 3MUTP 2KI2A 3THPA 4P6QA 2J76E 1WEYA 4CH0S 2YH0A 1X5SA 1KOOA 3G8SA 2MKKA 4BS2A 4UY8T 1VQ9S 2XS2A 3CULA 2KXNB 1SXLA 2CQIA 2JVRA 2CQ2A 4PRFA 2DGQA 2DIVA 1VQOS 1NU4A 2MKCA 3BO4A 4W92B 5MLCV 3NMRA 4LMZA 2RRAA 3FEYB 1U2FA 2L9WA 3P5TL 1WI6A 2U2FA 2MY7A 1KQSR 2Q79A 2N3LA 1WF2A 2KG0A 1P1TA 4OZ1A 2K8GA 2DO4A 3P3DA 4TLQA 2X1AA 2XS5A 2KU7A 1Q81T 4C0OC 1K73T 2DGVA 2FPHX 2RRBA 2XB2D 2DNNA 5IQQA 3UD3P 1VC0A 1M1KT 2LCWA 5ITHA 3IWNC 5DM6Q 3UCGA 3VAGA 1KD1T 1Q82T 4QQBA 2CQ1A 1X4CA 3J7ZT 2CPDA 2QA4S 1G2EA 5LXRA 3H2VE 2VOPA 2KXFA 1DHMA 2DGUA 3I56S 5GAHU 1VQMS 2MGZB 2MZJA 3NNHA 1S72S 3G96A 1U1QA 3VAHA 3EGNA 2LXUA 3FEXB 1QVGR 2DIUA 2LQ5A 3J7YU 4ERDA 1Q86T 4FXWA 5LJ5Y 5CA5A 1VC5A 3MUVP 1VBYA 5IFMA 1WHWA 3SDEB 4F25A 2E5GA 2EVZA 5GAGU 1OIAA 1X4HA 2DHXA 3VAFA 3DXBA 2K3KA 4CIOA 1HA1A 2DO0A 4LIRA 5GADU 1X4EA 2DNKA 1A9NB 2DB1A 2DISA 2CQ3A 2VONA 1FO1A 3BEGB 3D2WA 2AYEA 2LEAA 1YIJS 1WG1A 1WHYA 3G8TA 2FC9A 1U1RA 3CCJS 1SJRA 1JJHA 4WCEQ 2M8DB 1VBXA 3CMAS 1VQ5S 2CQHA 3B4DA 3TO8A 1S79A 2G1DA 3CF5Q 1U1OA 5DDRC 1X4DA 3IRWP 3G9CA 1VQ4S 3MXHP 3EGZA 2G4BA 3LQVA 2NZ4A 2J8AA 2CPZA 3CXCR 4IOCQ 2LA4A 1K9MT 1YJWS 3RW6A 2CQCA 2KN4A 2CPIA 2MSTA 2MQPA 3B4MA 2GHPA 3MD3A 3CCRS 2KRBA 2DNLA 4C7QA 1FJEB 2KH9A 2CPHA 2MY8A 2E44A 1U1KA 3V4MA 2MHNA 2D9OA 1VC6A 3CMES 2MYFA 2MMYA 1UP1A 3US5A 3CC2S 3R1LA 2CQBA 4V19X 3NNAA 2CPXA 3VAJA 1NJIT 2MZTA 3THTA 3H2UB 4WFBQ 2MB0B 3ZZZA 1U1PA 5D78A 1M5KC 4QU7A 4Y0FA 2M52A 2I2YA 4TU9A 2D9PA 4IUFA 3LPYA 2BOPA 2O3DA 4WKRA 1L3KA 1Q7YT 1AUDA 2PE8A 3SXLA 2D3OR 2LMIA 1W2BR 2MQMA 2CPYA 1X4AA 1VQ7S 3JB9k 4FXVA 2YTCA 2M4MA 2XSFA 4C4WA 2MKJA 2GO9A 2OTLS 2V94A 2MKSA 4RU2A 4TU8A 2I38A 5GMKa 4Z2XA 2RVJA 2J0SD 2RQ4A 1X4GA 1WHXA 1YHQS 5HL7Q 2DITA 3RW7A 1X5TA 2KHCA 3CC4S 2DGXA 2ERRA 2ZJRQ 5LXYA 2VOOA 4YB1P 2M7SA 3CPWR 2DNOA 1NO8A 2E5JA 3Q2TC 4ED5A 1F9FA 1N52B 2CQDA 1B7FA 4YOEA 2F9DA 1CVJA 3HI9A 2JVOA 2MKHA 5FJ4A 5DETA 2AYGA 1U6FA 2DNGA 1YTYA 5DDPC 3CCSS 3TP2A 3CCQS 5H1SV 1OO0B 5LSLA 1O0PA 3BS9A 4CQ1A 1SJFA 3HHNB 3NS6A 2YWKA 2L41A 3CCVS 2FHOB 2DNHA 2SXLA 3CTRA 2AD9A 2E5IA 2N3OA 2RNEA 4WFNQ 2BZ2A 2CQGA 5LSOA 1WG4A 1YITS 2B0GA 1JJ2R 5JVHQ 1QVFR 2LEBA 2RQCA 1M90T 2MQOA 1VQPS 4QPTA 2CPFA 1HD0A 2HZCA 5CYJA 2OJ3A 1K8AT 2EK6A 2LKZA 2LECA 2M0GB 1X5PA 2CPEA 4F02A 2HVZA 1WEZA 2JRSA 2CJKA 1H6KX 2DNPA 1PO6A 3UWTA 3VF0B 3OW2R 4LJMA 2DNQA 2CPJA 2J0QD 5BJRA 2MZRA 1VQNS 2MQQA 2KT5A 1ZZNA 2DGSA 5D77A 1YWXA 2CQ0A 2ZJQQ 5GAEU 2MZ1A 1JJ4A 1X4FA 3BO2A 1M5PC 2MZQA
chains in the Genus database with same CATH superfamily
4I4BA 2IMWP 4FF4A 1FCAA 1V3RA 1XNQF 3NOGA 1YVFA 2YNFA 5C24A 3D0HE 4Y00A 1TV6B 4BWJA 2XBPA 2PMWA 1SIWB 3MI7X 3D68A 4GKJJ 2PEBA 4FN5A 1QSLA 4ECTA 4GC6A 2R8KA 1NJYA 5KFSA 3OVBA 3J81Y 3WQPA 3C6UB 1N33J 4HVZA 1RWUA 1L3TA 3D4JA 3CD6S 1UFWA 2IM1A 2HQDA 2WBMA 1VCTA 3KNGA 4XDDA 1VRUB 5FIIA 4C48A 2FZCB 3MDFA 4I7FA 5FDLA 1KP6A 3RR7A 1KLMA 3R97A 2VASA 5E5NA 3LP0A 3P5BP 2ZITA 2VF3A 2QLWA 1U26A 1X4BA 5C25A 2DH8A 2FJDB 3MOJB 4CLKA 4NXMJ 2DNRA 2W01A 3M6VA 4IQMA 4F4XA 4BWMA 2DD8S 2G9OA 2NXCA 1RT2A 4EZ9A 2GQQA 3MAQA 5M2UA 4PXEA 5IM0A 4HDGA 3K57A 2BABA 3HHDA 3TZWA 3BQ0A 2RUSA 1DAXA 3QMQA 3PEJA 4FS2A 3ZC4A 4TU7A 2FJEB 1U47A 1HQ2A 1F5AA 2XTJP 2IDEA 4NLPA 3NG8A 1AYEA 3IO1A 4JV2A 1T9WA 2EKNA 1Y5IB 2DGTA 1RKJA 4ECQA 2BM0A 1NSQA 5A76A 2DKOB 1BWEA 1RT7A 2BQ3A 1JWWA 1X0FA 3KFWX 2Z2LA 3LPEA 3L7OA 1VYAA 1SC6A 3IR7B 3THPA 4DUZF 5CD4H 1KOOA 2GMLA 5B0DA 2F40A 2KXNB 4KPCA 4L72B 3C19A 2DGQA 4DJBA 2ZC4A 4C3MA 3P5TL 2K06A 1YJUA 2MY7A 3CDBA 4HH1A 2FUG9 2Q79A 1WF2A 4KBIA 4OZ1A 4R25A 2KU7A 1GXTA 5KFPA 1SJ1A 3DLJA 3JS9A 1AXQA 2KVQE 4QQBA 1X4CA 4FF2A 2CPDA 3H5YA 4QWBA 4QZVB 4OL8A 2MGZB 3ADAC 4HTJA 3ETOA 1U0SA 1H3DA 1HI0P 3RYLA 4K4SA 2BR0A 1WHWA 5GAGU 4I64A 4LQ3A 1HA1A 3VV2B 4FKXA 4IO1A 3CE8A 1NMEB 4KT0C 4GMKA 4N76A 4ZCMA 2AU0A 2QE5A 2VV5A 1U1RA 1JJHA 3GV5B 1VQ5S 4BDPA 3NCQA 1G6BA 1UVKA 2QL9B 1NZAA 4C2MA 2WONB 1FRHA 3OL9A 3VGTA 3MMAA 3G86A 3N6NA 3MEDA 1YJWS 4G1IA 5KFMA 2Y8YA 2IA0A 2OKQA 4QYZK 2W2OP 3MFIA 4NA2A 4OX9J 5D0RA 1N5YA 4ID5A 2KH9A 2HNYA 3CEDA 1S9EB 1S49A 1HPZB 2MYFA 4JUZA 2CWKA 2J5AA 2G0JA 3US5A 5BR8F 1YRTA 3MR2A 5CCLA 2KT3A 2XZTB 3R2CJ 4YB5A 3M8RA 1VRQC 3TUJC 3K5NA 3SFGA 2A18A 2E9TA 4H4KC 5D4OA 1MU2A 5J2PB 4JI5F 5HANA 3F41A 4B08A 2F4FA 2DGXA 4TYAA 2DNOA 1I94J 4CLUA 3QZ7A 1V6HA 1PCAA 2OAUA 2OMLA 2HK3A 1V3ZA 3DDKA 1YLXA 3FK4A 3I31A 5CAAA 3NY0A 4CQ1A 3PHEA 1FRMA 3KLHB 1PJ6A 1K0VA 5HAOA 2N3OA 2CQGA 5LSOA 3P4UB 1J5EJ 1SKWA 4OYWA 1HWUA 1HWKA 3H20A 2ZM6J 2MQOA 3K5PA 3JSBA 1M5HA 4ELUA 2KJWA 2KFZA 1EP4A 1QJHA 1J27A 3IAS9 3V81B 4YB6A 3HLUA 1IKXB 2DNPA 3MCSA 3MMBB 5HP1B 3M8SA 2DNQA 1WUUA 3BGOP 2VKRA 2YKQA 3LA0A 3RG6A 3FQLA 3ITHA 2Z30B 4G3IA 1TKZA 3OTDA 2ZZTA 3RAQA 2NXNA 1R0CB 3IM9A 1G4CA 4JI1F 1P27B 2YWWA 4LSNA 1N88A 4JI6F 1TK0A 3CJ0A 2DNYA 3KDNA 2IY5B 1WF0A 2AKWB 1RTDA 4XTTA 3GQCA 5ETNA 1QAJA 1TFYA 2A1BA 1VFJA 2HQCA 2WVBA 4KAIA 3OV7A 3KLEB 1JMTA 3Q8QB 4DBQA 3M30A 3L95X 5LOQA 3MEGA 1MMLA 1UZHA 1JLBA 3SFUA 3EPIA 2EPIA 3CJ4A 3DRPA 3GFXA 3I0RA 2KM8B 2W4PA 4L75A 4OYIA 1XTZA 1VRTB 1R7IA 3KLVA 3DC2A 3UD5A 5JVGQ 3C2PA 2LXIA 1TV6A 3Q2SC 1FVSA 2MZSA 4XK8C 3N6MA 4ZJOA 4CZCA 4NYPA 4WZQA 2BVZA 1S48A 4B9VA 1YG0A 3HHKA 5HK4A 2DNZA 3R7SB 1FJGJ 3W7BA 1IM4A 5HMYA 3DLKB 1S7HA 3W66A 3PV8A 4ZP6A 1MWZA 4UW2A 4WXOA 2KZMA 1V9OA 1RA6A 4F0MA 4P2SA 5JUMA 2OSRA 5K14A 1T9YA 1J5OA 4DFKA 5DQIA 1KFSA 3T1YJ 1HR0J 3AB2B 4J5OA 3I6PA 4PYDA 4HHJA 1RDRA 5J2QA 4P74A 5LMUJ 3FDSA 1KVKA 4ITSA 2BE2B 3C6TA 2RKIB 4YFUA 1U2FA 3MTJA 4P75A 4CLFA 4EFAC 4DR6F 3PX6A 3MMCB 3BSCA 3H8YA 4O3PA 3B78A 2DO4A 4TLQA 2X1AA 4A8WA 2H5EA 4ZCLA 1K73T 4OI1A 1AZSA 3G82B 1RACB 3UCGA 2XMWA 4B3RF 5DO2A 1G2EA 5M2RA 3O3LA 1I3OB 5LXRA 4U8VA 3GG0A 2DGUA 1UPPA 4BC7A 2QX0A 3CIZA 3CO0P 1JB0C 1U48A 2E5GA 2CYYA 1T05B 1TAUA 4TYBA 5CYMA 2YVSA 1Y9OA 1ZTTA 2XC9A 4RW7A 2NUUG 4XPEA 3H4BA 3BBBA 2HHHF 1FKPB 3D66A 5HQ8A 2ZWOA 3DGVA 4PQUA 2HNZA 4Q8EA 4Z7YA 5CH7B 3T5LA 1HHTP 3KXDA 2G4BA 1C4CA 2IA6A 1F1BB 3FC9A 2RJZA 4DEZA 3CCRS 1X7VA 2DNLA 2EWHA 5IQ6A 2QA2A 1TKDA 5A8KB 2D9OA 4R5PB 5H9EK 3MPWA 3CCWA 1IWGA 1AFIA 1JLQA 2J6TA 3BPSP 2NXUA 5KT7A 3OUYB 1KS2A 4RBUA 1IM6A 5D78A 2Y1LB 3T5HA 2PMHA 3Q83A 4YEAA 2M3DA 4WKRA 2V5HG 5J2NB 1VHIA 1FF2A 1FK9B 3E01A 4OFZA 4ID8A 5ETSA 3UO0A 3CJ2A 4Q5VA 4M5LA 1C4AA 2OELA 3KNAA 3OHBA 2DITA 2RMLA 1DFDA 1SPBP 1K0TA 2E5JA 3E51A 2GZOA 3HI9A 3OFEA 1OO0B 2HHQA 4JI7J 3HHNB 2YY3A 3PDNA 5HJXA 4QWAA 4NCGB 3GP9A 3IN5A 2BRLA 3X1LB 3EUNA 3FQKA 5ETLA 4P10A 1S6PB 2CJKA 4F0KA 1S1XB 3OW2R 3GFHA 3RB4A 3OQ2A 1RZMA 1HW9A 3W3SA 3NGUA 2NXEA 2DEJA 5J2PA 3TZXA 3KYLA 4PG6A 4DPXA 3DYAB 2JZ5A 1CJTB 1F9EB 4ES2A 2QFJA 2VG7A 3Q8SB 2YQ1A 5DLFA 3SSQA 2IVYA 1PSDA 4O4RA 1QLNA 1WOSA 3RB6A 3FFIA 4OI2A 1GX5A 2C1EB 4XIUA 4YY3F 3K5OA 4TQSA 1RTIA 1NK6A 3NWRA 3ZNJ1 3U7JA 1RWWB 2QEXS 4K5RA 5DZ7A 3CUNA 4JYAF 4E2FB 2AX1A 1OQ6A 3S8SA 4DCPB 2R7QA 3GFZA 5BXIA 1XMQJ 3RBZA 4JBCA 2HKEA 1WC3A 2I5JB 1Y4ZB 5KFEA 1C0UB 3D3CJ 4LRFA 3OR2A 3VALA 5IS2A 4ECWA 1HQUB 2RIJA 1EQ0A 2AV5A 2HFVA 2B56A 1P9QC 3J81U 3I55S 1H72C 3GONA 1JLCA 4U7CA 3JQKA 2V8VA 2ZH2A 1OY6A 4CP5A 3ZO7A 4PYAA 4GVLA 1PC5A 1VLOA 3VAKA 3FSXA 3GSDA 4N8NA 2E5HA 5KFIA 1BY9A 2BEFA 2DK2A 1S12A 4ZN1A 3M8WA 2KFYA 3UDCA 3KHHA 2Z4PA 3P49B 3U1LA 1GH8A 2QLBB 1FE4A 4E8UA 2HZAA 2DY1A 2EKYA 2GIRA 4WP9A 5KG3A 2R8HA 2EC0A 5T14A 1PBAA 2QJ3A 2M88A 5DDOC 2E5LJ 2Q1LA 1NB7A 2OPQB 3VZHA 4C97A 4MH8A 2JDJA 3BKFA 3EDRB 2Z2ZA 5E7OB 1SKSA 1BUXA 3KK3B 4F4KA 3CULA 2LVWA 1CEZA 5MLCV 4WP8A 3D6MB 2MTLA 4USWA 1NM2A 4FVMA 2HQGA 3QGHA 2P8IA 1VIXA 4LF6F 3KLGB 4C0OC 4LRDA 4KHPF 4QBUA 4J9NA 5D0HA 5KG1A 4QYZJ 2IRYA 2E29A 3KOAA 3DLHA 3NNHA 1U1QA 2QL5B 3EGNA 1SIZA 2CJXB 2O66A 3ET6B 3T9NA 4DR5J 3EXCX 4MKVA 1KHVA 3WDOA 1FXDA 2VPZB 1HHQA 4MFBB 2XYGB 2B9XA 1QTNB 2E1PA 2V68A 1YIJS 2VQFJ 1Y0HA 4CWBA 4LFCJ 2ZOMA 1N56A 4PAAA 4JV1A 4X62F 2IC3A 2W7PA 4JI8F 3MMCA 1D0EA 2E1MC 3UNGC 8ATCB 2CPZA 4X4UA 4D3HA 3CDAA 1RSCA 1PILA 2CQCA 2J0XA 3J7YI 5T41A 2GHPA 1UWBB 2GVZB 5LL6d 1XMOF 1NSKL 2AF6A 2R7XA 3KHRA 1BQNB 4Q2LA 1RT3A 1U45A 1FEHA 1QY7A 3D1OA 1LKZA 3OVSA 2IJRA 5B0BA 3TOQA 3MM6A 2OFHX 2QA4G 4X4NA 3MPDA 1DURA 2OUGA 2M52A 2LDYA 2V50A 1UWAA 4RNHA 1NDKA 2DPJA 4ED7A 4F2SA 2QO3A 2CPYA 1X4AA 4OJGA 2ZUAA 3IBFB 2GHVC 1U0HA 1CJVB 4I2QA 4OI4A 3GR1A 3CJTA 1HNZJ 4ZVEA 1IUJA 4OZJA 2KHCA 3H25A 4WFZA 4A8QA 2UV8A 4ILMA 1NK8A 4F4YA 2ZH5A 5DETA 1KLNA 1OPZA 3DOMB 3A12A 3WBZA 2WW4A 1Q5YA 3HD2A 4NRTA 4WFNQ 2C3MA 1H74A 1WG4A 1RWVB 4QPTA 2CPFA 2MDAA 2OJ3A 1NDLA 1HI1A 5E41A 5E2QA 2HVZA 2XI3A 3MM5A 1CS4A 1OSDA 3UWTA 4F4AA 2HQIA 1JNZB 4M5KA 1VR6A 5BJRA 4J9LA 1I6JA 3MTKA 3HP6A 2ZJQQ 2P9EA 2QMXA 4P52A 3KK2B 2UXCF 2ZKTA 3CMQA 3R3TA 4FDFA 4WFXA 5D0EA 4D3GA 2Q43A 3M2UA 3U1NA 1FDDA 4HACA 1T9TA 3WIUA 4LVNP 2OPRB 3K0JA 3OXLA 3EVWA 1HHSA 3DRSA 3EZUA 4R8UB 3W5YA 4NLUA 3BR9A 3G2XA 3WHIA 1GNKA 3RRGA 3TA0A 3NS5A 4FYYB 1HNXF 4JI2F 3GWCA 4QW9A 1FWPA 1YZ7A 2G2YA 2KZZA 3JQMA 1T0TV 4DR7F 1KONA 4OZ0A 5F41A 1ZH5A 2A2CA 2XWYA 1NKCA 1T9VA 3LP1B 4I0WA 2W8LA 4EO6A 2RS8A 2DHAA 2OFGX 4OLPA 4H4OB 2UVVA 5CXTA 5KFLA 1X5OA 3HHLB 2NQPA 3ZTOA 3EX7B 4ZVPB 2ZH6A 3TRGA 2V9WA 4URQU 4WE1A 2HAIA 4LF8F 4A46A 3ULHA 3F73A 1MWQA 4I1TA 1QM9A 5DM7Q 2RH3A 3NEKA 3OTEA 3H90A 2W9CA 1O5JA 4M5IA 2YKMB 3BDPA 2ZOFA 4DV3J 1PGZA 5K8PA 4FF3A 1QD1A 2VA3A 1RT1B 1RADB 2D69A 2AJQA 3JAMY 1AA1B 2JL9A 4OX6A 3RU0A 1Y7PA 2RT3A 3VAIA 4IOAQ 1L5UA 1N33F 1MW7A 3PY8A 2VFVA 4K2JA 2GA7A 4FBUA 3S7RA 4TVAB 5GVQA 4DV2J 3V5RA 1HQUA 2KI2A 2BOAA 1S4FA 1BLUA 1X5SA 2P2CB 3PNIA 2XLKA 1NSAA 1R0AA 2R7UA 2HMIA 4LSLB 1GAOA 1S1WB 1LWXA 3FKBA 4Q7AA 3KWMA 6FD1A 3W9JA 1TL7A 4ATNA 2MHEA 3UN2A 2RRAA 5DQGA 1S0VA 2OEKA 1XMBA 2B6AA 4NXMF 2IAJB 3BPDA 4B3TF 1MG7A 1QUVA 1LFWA 3RR8A 1RAIB 1TUWA 2L3MA 4OV6A 4DR1J 2Y1IA 2VB6A 1T02A 3RJMB 1FA0A 1S1UA 5EUHA 4WWSA 5EGYA 1TK8A 3BGUA 4UF4A 2VOPA 2KXFA 2YPYA 1HQEB 1D8YA 4DSJA 1S9FA 4DFJA 5H9EJ 3TUZC 2ZDOA 2JOQA 1H0HB 1UVNA 2HHUA 4RUAA 1VC5A 5EHHA 4WU2A 1SV5B 1MLAA 3DXBA 4LIRA 2DO0A 5KG2A 3I4PA 1WDDA 4UQGA 2AYEA 4LF1A 1HKAA 1X9SA 1VBXA 1NDCA 2YKOA 2OEJA 4ZCKA 1X4DA 4Y65A 5GAHI 2EC2A 2VG6A 3PACA 1ELOA 4ZLPA 5K8NA 4S0MA 3TZZA 4EBCA 3ZZ0A 2E44A 3KJVA 4LF7J 4Z37A 2HSEB 3DN9A 1DJ0A 4G1PA 2R3VA 2OD4A 4O44B 3THTA 1RBLA 1ZBTA 1TL1B 4DCOB 2ILZA 2CNNB 4LREA 2DHHA 1QSSA 2HQ3A 4GO7X 3PO4A 2BANA 2HZVA 4IUFA 2RF2B 3PCOB 3SXLA 2VDIA 2RDJA 1VISA 2AEFA 2M4MA 1QDUB 4RW9A 1DQAA 3AQOA 1PAUB 2X3GA 3OBIA 2VU5A 2RQ4A 4K4VA 3M8YA 2QYCA 5HL7Q 2HHVA 3RW7A 3HKZD 2GGPB 3FGVA 3MM8B 1JJCB 3VGSA 3RAMA 3PYFA 2V0NA 4ECYA 3LGMA 4WFYA 3SCJE 4DR3J 4KGZB 2ZE2B 1F9HA 3AAWB 1YTYA 3D54A 1F2HA 2NYIA 4F2RA 5D15A 2JC1A 4M5NA 3IM8A 1G3OA 2W2NP 1CSJA 2E5IA 2DRAA 3MAAB 3R5CA 2VBYA 2F5GA 3FSIA 4K4YA 2W7AA 2HFOA 2BMBA 4OX9F 2JEJA 1FNMA 4IRDA 4ENOA 5A2QU 4ED1A 2Y9HA 4NWBA 2QV6A 1REGX 4AFFA 3HMJG 4X2BA 1JJ4A 1MROA 1L3UA 1UVJA 2VUGA 3M05A 5LT5A 1DBDA 3M9OB 5KFHA 4Y28C 4NZ7A 3LWLA 1ULRA 4F26A 2KXHA 4PUOA 2V6AA 3DOMA 1H7XA 4X64J 2W4CA 2YQ0A 3NGRA 4FYVB 3QZ8A 1UEVA 4B3OA 3K7RA 3HDSA 2MKIA 3L3CA 1I94F 1XNRJ 1NHUA 3PFOA 3GIIA 3SIPB 5HLFB 4ZKAA 3R5GA 5DDQC 1J5EF 1WELA 3CC7S 3CCES 3OJUA 4OLOA 2ZM6F 4P71A 3T5JA 3KK2A 2ATLA 3HT3A 5E3QA 4WZMA 2V4JA 1AT1B 2VQEJ 2GO8A 3KG1A 3GJTB 1YJTA 4KFBA 2CXEA 2R2RA 1X9WA 4MKAA 1DARA 5D3GA 5T7LA 3DRRA 5M2PA 3KJNB 4CLYA 1GXUA 5KFTA 4JB8B 3IA0A 2HYIB 4KH0B 2FJAB 2ZZMA 2B5JB 4Y34A 1DLOB 1JLGA 1OMSA 1D9FA 3I5CA 1UJ4A 4DL5A 3N6LA 2AMCB 3TNVA 3PJ9A 3UE2A 3TEGA 2X1GA 5KT5A 2QC3A 1K47A 2M8HA 2Y0BB 5J1NA 2V69A 2C2KB 2UVRA 1M5SA 2M2BA 3SMZA 2B51A 1FXLA 4OHWA 4PWUA 1HNVB 1LW2B 2J76E 2ALZA 2LFVA 2HBZB 2XY6A 3OL8A 3CT9A 1S10A 1VQ9S 3HHLC 4DOZA 5BYQA 3QSYB 3ZZPA 3A8IA 1HI8A 4RBVA 4CTAA 1SI9A 4RWXA 3R5DA 2QN6B 1EETA 1HBMA 1RT1A 3K89A 2VC0A 4DR2J 1S4EA 3DMJA 4CCHA 4KO0B 3AD8C 2J6UA 4MK7A 1QUPA 4HDHA 2VIHA 4MK9A 1FJGF 1CLFA 2FY8A 2MKYA 5F0UA 1Q0NA 2XULA 1T7PA 4DV6J 1HWJA 1Z2LA 5ETVA 1QSYA 3GJQB 2NR0A 3E8OA 2K3KA 4CLWA 5H9FJ 2DNKA 1TR0A 1KTQA 4LSLA 5HSPA 1EB0A 5LSRA 3QT8A 3JSMB 3T1YF 2B8QA 1UJ6A 4RNOA 1HR0F 1Y3JA 3OL7A 2FYXA 3V6DB 5LMUF 1B70B 2R42A 2NZ4A 3A13A 2J8AA 4IOCQ 2FIUA 4KGKA 2FZKB 2FTRA 2FVPA 4LFAJ 1TL5A 2YKNA 4R0JA 3CMES 1HQEA 1RT5B 1F6TA 1DTTA 2XO6A 5B0EA 1SC3B 2GW8A 3M8PB 4NLVA 4KH1B 1HWIA 2YWHA 1RAAB 3BREA 4DL7A 2WB4A 4QU7A 1UVIA 2I2YA 4J9UE 4J90A 1SV5A 2IRXA 2O3DA 3ISZA 2A6OA 4MTPA 2GS8A 4Q43A 1SC4B 2RHSB 4FP9A 1X5TA 4YMEA 1N0UA 2ERRA 3Q8VA 2M7SA 3PG9A 3QIPB 4V19J 4OIXA 4PXBA 3KLIB 4OYMA 2CZVC 3VR1A 5AXLA 3AJ2A 4ZPDA 3LGHA 4RBTA 1KQFB 2CKWA 2W1BA 3TJ9A 1TP7A 4I68A 1VQPS 2K1RB 1JLEB 2HZCA 1UVMA 4WBFA 1TFWA 1GMVA 5C42A 3GIKA 5JXSA 1HBNB 1H6KX 1SUQA 2RF2A 3W63A 1S57A 1CULA 4AQYF 3KHLA 5LMNJ 2DTJA 5L1KA 5GAEU 2LP4A 4H4MB 1A0OB 2MZQA 5IZHA 3RB3A 4PWDB 4EUVA 3GE9A 4WYWA 1U02A 1WC0A 1UFLA 1M5VC 2P9GA 3TJ8A 4Q0BB 2JWNA 1HMVA 3CCMS 3PYDA 3W2WB 4CM2A 4Q44A 2F8EX 1KOHA 4WK1A 2KTQA 8AT1B 1LK7A 2BQRA 4B9SA 2CVIA 3BGFA 2MQLA 1HL6A 1H2UX 2ZZNA 4UZBA 3UNYA 2H54B 3M2RB 1BGXT 2FY1A 1FRIA 5GMEA 1IR2A 1WHVA 4RW6B 4JI7F 1CJUB 1NK5A 4NXNJ 4ER8A 1IQTA 2YWGA 2BJEA 3M2VA 4L3NA 5DG7A 2CUYA 1NHKL 1HYSA 2OEMA 3HVTB 4M95A 3QLHB 4ED2A 3HT0A 3ENQA 1WI8A 2X3DA 4M5JA 3RRKA 3TVZA 4DSIA 2PI5A 4YDDB 1RK8A 1YBUA 1FHTA 2YWEA 2HGNA 1OYEA 1TL4A 2AZ1A 4N47A 4MMOA 2DEIA 2QT7A 3S01A 4HHUA 4QJVA 4Y2KA 1FRJA 4KPYA 3OSPA 2R8IA 3CJKA 4J9MA 1KC8T 4X4VA 5THWA 4ZPCA 1I51B 4B02A 1OPIA 3G4SS 1S9GB 3MM7B 4WF9Q 2OP5A 1B3TA 3M8QB 2XCAA 2W9AA 1M1HA 3DDIA 4O0NA 3UVJB 4RJVA 3MCMA 2FZGB 4O3NA 1AB8A 4PR6A 1TMMA 4XO0A 1VIOA 4CH7A 4OYAA 4P7TA 4DLGA 4BHQA 3BV8A 1CC7A 1XMQF 3D6FB 4BS2A 1I1GA 3BSOA 5LM7E 2ROGA 3SI8A 4ZN3A 5B08A 4J9PA 3BZQA 2B3TB 3AQPA 4X4RA 4LMZA 7AT1B 3D1HA 2I0XA 1NPRA 2LXFA 3JAMU 4OX8A 1R3NA 1SCJB 3PW7A 2GVDB 2VPXB 2B7BB 1HNWJ 2JNJA 4Q2MA 2FPHX 3BSAA 2LCWA 2QFIA 4NCBA 4DQIA 3J7ZT 4DPUA 2GCFA 4PPDA 2YNFB 5C24B 5AE1A 2WOMA 2M5YA 2DY9A 4FBTA 1RJJA 1PG5B 3PKYA 1HNVA 1Q78A 5IFMA 4HI2A 1E6YA 2UUTA 1R6VA 1H98A 2CQ3A 3IWLA 1R0BG 3GILA 1VJWA 1FWLA 1EHWA 3ILIA 4OJHA 4O4GB 2E5LF 1SJRA 2UUWA 3CMAS 5FDLB 4I7FB 4JI4J 4LRBA 2P9CA 5JMNA 1RWXB 2IIHA 1VQ4S 1KLMB 1N34J 3CD0A 3LP0B 1K9MT 1N5TA 1BMQB 2MSTA 2UU9J 2XMKA 4NLOA 3GU0A 4ZJQA 3GYXB 4KO0A 2BRKA 2V4RA 5CABA 5GAGI 2B8PA 1RT2B 3A3NB 1C1CA 2O1PA 1OYDA 3FCVA 4HL9A 4WIQA 4ECRA 2OLWA 2AP6A 3QJLA 4DV7J 1N4LA 3HVWA 3C15A 1LXNA 4I2PB 3WZ0A 5A6WA 2MKSA 3D0GE 5GMKa 2KKHA 4DR5F 2FVCA 4WKYA 3O6QA 2QA1A 2IM2A 3W9HA 2ZJRQ 1JIHA 1RT7B 2F8HA 3IR6B 4DUYJ 5D4PA 4MK8A 1U6FA 2VQFF 3W2VA 4I6WA 2J7KA 3M6UA 4LFCF 3PYGA 2XMMA 3MWBA 5HQLA 2SXLA 2R2UA 2IDLA 2RNEA 4DG1A 3M8PA 1MMNA 1IR1A 4F02A 3LWMA 1RHKB 3W5ZA 3HZEA 2UUBJ 1WKKA 4OX7A 4O23A 5HI7A 2GAGC 1IQZA 2WSCC 4F50A 1BD6A 1RHQB 3RBDA 4F0HA 3VGVA 4B9UA 2AJ4A 3DHWC 1DRZA 4FPRA 2XSJA 5HQMA 2C2EA 5EX0A 3NLCA 4DFMA 3GV7B 5KFJA 2ZNYA 1ZM2A 1PBUA 2AYMA 1HNZF 2EFPA 3M1VA 1MWYA 3O1LA 5B0GA 4IFVA 2DGWA 2ACYA 1FRKA 2BM1A 4EGLA 2EG2A 3IP0A 1JLEA 1REVA 1IBKJ 4N5SA 2M9KA 3DRXA 1UJ5A 3PW2A 4QYRA 4YR0A 2YKAA 1U1NA 1RWOB 2A3JA 3AOCA 3MAHA 4BLGA 2NS1B 3TUPA 3MEDB 2LA6A 4C3LA 3P45B 1IBLJ 1EZZB 4WIIA 1N5YB 4ID5B 2HNYB 3V4IA 1TKTA 2DR6A 4F4ZA 2HBRB 4M1KA 1ZAXA 2WSFC 4CO1A 1N54B 3SSRA 4CLSA 4WFAQ 3ETMA 2N7CA 1WC1A 1SJQA 4OV1A 2MJNA 1RU2A 4TY8A 2V4QA 1TUGB 2JEIA 1R8PA 1RKIA 4OYPA 5E33A 1HBUA 3MR5A 5HJYA 3OFHA 4YUDA 1MU2B 3M2RA 1NJXA 2XGQA 1HBOA 3BB5A 1KQGB 3W8GA 2WVCA 2DNMA 5L38A 1UA0A 2CQ4A 1NKBA 2FD2A 2HHTA 4AE5A 1VQLS 2CG4A 1EQMA 1FKOA 3MURP 1KTVA 3EICA 1JLAB 1SKUB 4ZLJA 3PO5A 3HSGA 2W9BA 2HIQA 3OFGA 1EP4B 3N0VA 4OJ1A 2ZH3A 3R5AA 2UVUA 1U8SA 1W26A 3MM7A 2HPUA 1D3WA 4IH7A 3ITHB 5ITHA 5F8LA 1C0TA 2E7VA 1TKZB 3W61A 2HVIA 3BN7A 2CJ9A 2CQ1A 2QA4S 3H2VE 4LSZB 5C7PA 4DV3F 1X9MA 2PC6A 3TEHB 4LBPA 1LK5A 4NLQA 4AD6A 4B3SJ 1RTDB 3KDOA 5F8MA 5KT6A 1OIAA 3P8BB 3L7PA 4A8KA 3MHYA 2CADA 1FD2A 4K59A 1Z2ZA 4AYBD 3MEGB 2M8DB 4DV2F 2RB7A 1JLBB 2VFSA 2WZ1A 5EX3A 4ZIWA 3DRPB 3MXHP 1ITPA 3I0RB 2CJBA 3CXCR 3IG1A 4IOBA 1PC4A 3D6TB 4DV4J 2R9LA 4EK2A 2VFUA 3EZ5A 4HYKA 2YNHA 4L76A 1FFWB 1E6VA 3A1YG 1APSA 3D28A 4DQSA 4DMZA 3PVXA 4PXCA 3QO9A 2HS3A 1SL2A 3NNAA 4ETZA 2CPXA 1NJIT 4A47A 1O6XA 4ZCIA 3WX4A 1S7IA 1Y00A 1M5KC 4Y0FA 2XMVA 4HH0A 4TU9A 3OLBA 2UUCJ 3RZAA 4ZPTR 4LF5F 1S0MA 2BDPA 3UN3A 1H38A 1CC8A 2CNOB 1RAHB 1R8AA 4EYHB 1J2VA 4NCAA 2BXJA 3KJFB 4O4GA 2J0SD 4RNNA 4IR1A 4X4PA 2QYGA 5K14B 3WC0A 1J5OB 2VOOA 3HKWA 1BXNA 2F9DA 1ZAVA 5DDPC 3TP2A 1U2CA 3CCQS 3QFHA 3BS9A 1SJFA 5DRKA 4UT4A 3FNNA 5J2QB 3GR0A 3C16A 3J7Z5 2FLLA 5HBMA 1VK3A 4TLRA 2G13A 5KFBA 3IMQJ 1TK5A 2B4PA 3C6TB 4ANEA 3ZTQA 4LR9A 2KYZA 4C11A 1QVFR 2RQCA 4NEZA 2I6WA 2MEWA 2BQUA 2LKZA 2C22A 3JQJA 4M8LA 5E3AA 4LF7F 3I96A 4K7QA 2Y0SD 4I2PA 4DL2A 1VQNS 4OZ5A 1YWXA 1AZSB 3BO2A 2D41A 3QQCD 3ISNC 1S77D 2AGPA 4RR5A 3NBPA 3UD4P 1AW0A 2P5VA 2DVIA 1S6UA 2GQCA 1HNIA 4PXDA 1HD1A 4TQRA 1CJKA 1TQLA 4PPZA 2IM0A 3LANA 4EWTA 3W8PA 4E98A 2WB1D 3SDEA 1YJNS 4DS5A 2XMUA 4CNYA 3R1HA 5CYMB 3BH6B 3QAUA 1VQKS 1ICEB 3MECB 1YJVA 1VOMA 4DR3F 2ADBA 3OTBA 3NGSA 4I69A 4NEYA 1IKWB 4RW7B 5J1PA 2NSBA 4KGMA 5B0FA 2HS4A 3PM9A 2H4WB 4PQUB 2HNZB 1WKJA 2BACA 2DCLA 1FT8A 5I42B 3IS9A 2ASLA 4ETXA 4KYZA 2JEGA 1VMBA 4USHA 5E3PA 4B9TA 3ENAA 1QTMA 3MM9A 3CSKA 2QMWA 3AT1B 1JLQB 4LF2A 2EBEA 2J9CA 1C2PA 3FCHA 3SV3A 3PJWA 3Q8RB 3BO3A 2DR7A 1TELA 1UZDA 4B9LA 1HW8A 5ETOA 5I3QA 3E01B 2FLOA 1RCOB 4X64F 1RAOA 1TKXA 4PG7A 2AQ4A 1Q95G 2MPUA 5CYQA 1GK8A 2CZ4A 1HIYA 3MEKA 1WF1A 2Z0GA 1VHFA 2O01C 4PABA 1XNRF 3MGJA 2PD1A 3DLEB 1DZ5A 2DRBA 2R4FA 1IJEB 1XQIA 4CYUB 1SQEA 3E3XA 2Z8QA 2X51A 2XQCA 4HI1A 4IH6A 2EFNA 3JXOA 3PYEA 2J6SA 3NMRA 2AGOA 2V63A 4FZVA 2GJIA 3S1TA 3NMAA 1NH8A 3O2IA 1LWFA 4XAKA 2VBWA 3JTNA 1KQSR 2WVDA 3BF4A 4RO0A 1WORA 3ZZTA 4J7CA 5KG5A 2E7XA 1RTJA 4X84A 3V6HA 2DRDA 3VAGA 3FRYA 2VG7B 3MPVA 3B82A 5HMWA 2HNDA 1K44A 4DPWA 3I4HX 3G96A 2Y8WA 3WX8A 2IBOA 2LXUA 1EIYB 3DU5A 3FFIB 2AJ0A 2HRTA 3NAHA 4ERDA 2UUAJ 2J0WA 1WOPA 4F36A 4M5MA 2E66A 1JLAA 4ZS6A 1NPKA 1RTIB 1T95A 3T6JA 4K4ZA 4J37A 4QIEA 2ASYA 5KG7A 1F60B 2OPSA 3D2WA 4DL4A 3PR4A 3AOAA 4ZVOB 2J7UA 4L3KA 4WCEQ 3FCWA 3R7BB 2HFZA 4P9SA 2FLPA 1DY3A 5FLXY 4KIAA 1IBMJ 3R2DJ 2DR5A 4OYZA 3EVMA 3TQEA 3OR2B 1JQGA 1ZETA 1T03A 1NK7A 1TAQA 1X8DA 4JI0J 5F8GA 3PZPA 1JXVA 1S1TA 1KVJA 2MB0B 4J9OA 1JLCB 4DR2F 5HVGA 4NYOA 3FMBA 3AY0A 3QATA 1L3KA 4DPOA 2COLA 2GMJA 1Q8IA 2V94A 2RVJA 2B4OA 1F2GA 2ZBIA 1X4GA 1XBWA 4KSEB 2HG4A 5J2MA 4DV6F 5A0YA 2IYGA 3MMJA 1WDTA 3FRZA 3QGPA 2CQDA 4YOEA 2DCUB 1T8EA 2GNKA 3PRVA 3BH7B 5DG8A 3N01A 3GCWP 2VFTA 3OT9A 1GMWD 2FHOB 2HBYB 3CTRA 5AXMA 2HFSA 5JVHQ 3NCRA 1WC4A 1K8AT 4LFAF 3C3LA 4K2XA 5JJBA 1WEZA 2RDDA 4K8RA 2R2TA 4MIAA 5A8WA 4LJMA 2VJVA 1C1BB 2MQQA 2KT5A 5L9XA 2JH3A 3EDQB 3C14A 5F0WA 4AXJA 2X1BA 3NKYA 1U25A 4DZDA 2AGQA 4NI2B 4C8ZA 4USIA 4DV5J 3ZZOA 3RTVA 1H2VZ 4K4WA 4QR2A 1PJ7A 5BYSA 3KLFB 3M6WA 5D6GA 2DYAA 4P2MA 2NLWA 8RUCA 1NAQA 2VH7A 2ROEA 3HD1A 3N4WA 3I32A 2ABYA 2GJFA 4YY3J 2Y1RI 4DR4J 2VPYB 2IC3B 1KNZA 4FVCA 3Q89A 1U8WA 3IGNA 3UDVA 4NLWA 4A48A 3P6YC 4DN9A 1IN0A 5HO4A 3ZTRA 2C28A 3ILJA 2WRMA 1YX2A 1O8BA 2EFGA 3OXGA 3VZIA 4KTQA 4K50A 1RT3B 3G8QA 4W98A 7FD1A 4PQAA 3MM6B 4I67A 4LR8A 3D5MA 5LMNF 1UL3A 3DOKA 2OSQA 2APOA 1D9DA 3DLLQ 2XLJA 1OY9A 2LYVA 3MECA 4MKBA 1WD6A 1NK9A 1WOOA 1IKWA 2MSSA 2WBRA 2PA3A 1U0HB 2EXUA 2DJWA 4PKDB 4I2QB 2KDOA 4U9RA 3QNWB 1R43A 4B3MJ 1XEZA 3W62A 4KHRA 2PN6A 3NGTA 5I42A 4CRJA 2BE9B 1S0NA 1NK4A 4ZLLA 4WU3A 2HW3A 5LJ3Y 3BM7A 2AHOB 3TARA 4NXNF 1DQ9A 2KJVA 4CLPA 1FESA 3M9MB 4WP3A 3TANA 3J80Y 1FERA 3T1AA 1RAGB 1RQ0A 3VQSA 3DRYA 1FDAA 3OFFA 3MM5B 3Q0AA 1CS4B 2KG0A 3QFWA 2XS5A 2D3UA 1YGYA 2BBEA 4USKA 4OI6A 2XB2D 2W2MP 2AWZA 3L7UA 1X31C 1EX8A 5A2QY 1LFPA 5K5MA 1UFKA 2FGOA 5AE3A 1DHMA 2NCKL 4GKKJ 3M2UB 2MLXA 3QRRA 3DLEA 2LQ5A 4HACB 4FXWA 3Q86A 4DV1J 5A8RA 3SV4A 1SH2A 1UW9A 3DRSB 4CYUA 3VAFA 3A8EA 1OY8A 4DX5A 1N0VC 5E3RA 3LGNA 4NZ0A 4NX9A 2HHWA 4HTIA 3KG4A 3A8JA 4RWWA 2YWFA 4DPYA 3TAMA 2G1DA 4ZPBA 3CJ5A 1MMDA 3QJJA 2ZH9A 4OI0A 3HJFA 3D3BJ 3LQVA 3SQGA 1UPMB 2V8GA 3RBXA 2NUHA 3A3PB 1OS5A 3MD3A 2KRBA 2MY8A 3GLJA 5HMXA 4JI8J 3KTQA 4KV8A 3O44A 1DTQA 4HT5A 4K4UA 3LOUA 2DT9A 4DZ6A 1FX4A 1LEOA 4WE1B 4RLEA 3QYYA 2PA8D 2W9CB 2D9PA 2DXFA 1JXLA 1AUDA 4C4WA 5KFGA 2JFKA 2WHOA 2BW7A 4TU8A 1XR5A 3BDEA 3CC4S 3LF0A 3ZXWA 5LXYA 3TW0A 4QWEA 3CPWR 1F3VA 3H2LA 1IKYA 4RZRA 3PW4A 1F0XA 2HRYA 5B09A 2JVOA 3FZBA 2D7SA 4ZP8A 3K17A 5H1SV 4CLZA 2L41A 3CCVS 1W25A 2DNHA 4JI4F 2J9DE 4ECZA 3LW5C 1IJFB 4QOTA 1R0AB 4RX6A 1YITS 1N34F 2HMIB 4L6V3 1O51A 1JJ2R 3LP2A 1RT6A 2K2PA 2BJ3A 1TL7B 2UU9F 2XWXA 4G65A 3WIVA 2M0GB 2CPEA 2LECA 2B6AB 3HO1A 1WACA 3CJSA 1LW0A 1F5BA 1QAIA 3VHQA 2FVQA 3ZFVA 1ZA2B 3UDLA 2MZ1A 4LIWA 4JV5J 1S1UB 1UW4A 2K7JA 2VFRA 4DV7F 4NLRA 2IJNA 4CO2A 2KM8C 2EFVA 3AJDA 1ACMB 2H1YA 2ZNZA 3VGUA 2UXCJ 3PW0A 2YH1A 1NXIA 3QGGA 3SCLE 3PTWA 2DXDA 5C2GA 1V5VA 2NPIA 3IXQA 2I1RA 4DUYF 3Q23A 2HBQB 4KHMA 1BQMA 5DG9A 5J1EB 1EJ7L 5KFOA 1WWHA 2N4CA 2ZBCA 2XYPB 1JX4A 1C1BA 3EGWB 3PX4A 1CPZA 2FC8A 2VG6B 4X66J 4LQ9A 5L9NA 2KO1A 3MR7A 2FDNA 4F7VA 1XIQA 3GFYA 3MEEA 3OR1B 3I0SA 3KJVB 5AXNA 4CO3A 4NRUA 3MF5A 1K1QA 3HFZB 2UUBF 1P1LA 4NI2A 4YR3A 4OZNA 1FJ7A 1RISA 2C2NA 3DLBA 4ZP7A 3UN5A 3W5XA 1N36J 4C8NA 4OHVA 3KLFA 2BANB 4ZHRA 2HLTA 3POTA 5HROB 1KN6A 4RW9B 3DLGA 4LF8J 4QU6A 2DGOA 2DHSA 2QRRA 1JLFA 1LOUA 4N41A 1KSPA 3IFEA 2LLZA 3G87A 4X65J 1YI2S 3QT6A 2PSZA 3DI6A 4MT1A 2BYCA 1JKHA 1IBKF 4USUA 3HVRA 2JLFA 4U95A 3EMTA 1RGVA 4DSKA 3FSYA 2VICA 2XY7A 4CNZA 5AXKA 4KY3A 2GHWA 4WYLA 3M32A 1TMJA 4OI3A 1IBLF 5H9FK 2XM3A 1LV5A 4DN0A 3CD5A 2JLEA 2K8GA 3P3DA 3T41A 4BCAA 4KKOA 4OZ2A 2WW8A 2D3O1 1VS3A 3OTOJ 2DNNA 1MROB 1SKRA 2F63A 4V1Ak 5DM6Q 2LQJA 1FFSB 2XI2A 4B3TJ 4WTYA 1RAJA 1W2IA 4U7UK 3IBCB 4FPIA 4PUOB 1RLDA 2HURA 4ECSA 3HHEA 1KBRA 3OPKA 1WKLA 1KKHA 3SYZA 4FF1A 4B3OB 2VONA 1FO1A 3LALA 1LNQA 4QIVA 3VVTA 1WHYA 2V2KA 2B9YA 3B8HA 4C3KA 2YBVA 4C8LA 2VPWB 4ZPVR 4DSLA 2PDAA 3OXFA 2VDHA 2CPIA 5D8HB 2VBXA 4ANDA 4M5DA 2B7CB 2YQ3A 4UOFA 2V4JB 1VGYA 3V4MA 3NS7B 4KFBB 3R1LA 4FYWB 2LU1A 4I6YA 3RB0A 1VDHA 4DX7A 2L48A 2FJXA 2ZBRA 4UOHA 1CG2A 5D3GB 1U6ZA 5T7LB 2PGCA 3DRRB 1TTHB 1U1PA 2RAQA 4F3MA 3NXZA 1S6QA 1S1VB 5AJ3J 4NLGA 2W2PP 2BOPA 2CJAA 4O3OA 2LMIA 5KT3A 2MQMA 2YTCA 2ZHBA 2UXBJ 5FLXU 1JLGB 2MKJA 4B3SF 2JLGA 2UVWA 5KFWA 2DR8A 1WNEA 2BA9A 4RW4A 4IG0A 4GC7A 4DHVA 3MR6A 3U27A 3OD2A 1VQSA 1NH7A 2MKHA 3SQOP 3PEHA 3IRXA 3NGDA 3DGPA 3ICLA 5DGAA 5L46A 1KVIA 3SBMA 1RT4A 3OSNA 2C3YA 2BZ2A 3AD9C 4LFBF 1OQ3A 1ZPWX 2VBZA 2B0GA 3W1YC 1M90T 5CYJA 4DV4F 3RUBL 4B17A 4CTAB 3GZ7A 3VF0B 2CVEA 4NLXA 1EETB 6FDRA 1HBMB 3HVAA 4XPCA 2ASDA 1N48A 5C5JA 4OJ3A 1U4BA 2CQ0A 5IT0A 4GKJF 1M5PC 3DMJB 2KHDA 3TZYA 4J9VA 3CCUS 2HIYA 2UUCF 2CDQA 3AOBA 5EDWA 1OSCA 4ZPWR 3MR3A 1GXLA 2U1AA 4W90B 2PI4A 3E2EA 3IBWA 2MJUA 2F1FA 3K58A 5F8JA 4DL0C 4H4KA 2YX7A 2AIRB 5G4DA 3AA9A 3D1QA 5I3UA 3L4BC 4UY85 3N5BA 5GAEI 2XMTA 1XK8A 4A8OA 3FBFA 3PIPQ 2DR9A 4USJC 2AYBA 3Q8YA 2W2QP 2HWTA 4IG3A 3ZZRA 1UMJA 4PG5A 4QIGA 4DF4A 3MCNA 2OGUA 2YKNB 4C8OA 1RTHA 3NNCA 1ZZFA 1X0PA 2EK1A 1BHNA 1V3SA 1UAWA 3BYPA 4ZK7M 4PZVA 2IBKA 1DTTB 4ZLNA 4ED3A 3UCUP 2GJ2A 4LVOP 3B54A 3O5TB 3WC2A 1U7LA 1M5OC 1NDPA 3SSSA 2HGMA 1GEHA 1FNOA 1LWCA 1N32J 2PEHA 5J1EA 5K8OA 2R7SA 5G0RA 1ZA1B 1YJ9S 2HVEA 2OHDA 4C8MA 3TUIC 1TL3A 4PEOA 2F4VJ 3D9BA 4OHZA 5A6PA 1IKVA 1Q1KA 3OR1A 1R6YA 3VWSA 3QT7A 3L9ZA 4EZ6A 1IBCB 3V6JA 3NAIA 3SZ2A 3ISND 1GTEA 2JVRA 1RWNB 4DDFA 1PYOB 2ZD1B 4LBIA 5E3CA 4NLSA 3TI0A 5C42B 2RQMA 2Q6BA 2U2FA 1SUQB 4USVA 3CDWA 3QBCA 4C6AA 1P1TA 3TX0A 3KK1A 1JK9B 1CULB 3DM2B 3J81j 4QWDA 5HROA 2EG1A 4EI2A 2POKA 1NUEA 2CG8A 4Y6IA 3IWNC 5IWAJ 4N56A 1L3VA 1CQNA 1RYRA 4A4JA 3M4XA 2HHSA 3FEXB 2ZWPA 1Q86T 3J80U 2C2MB 2G2ZA 1HMVB 4DFPA 2RU9A 2CNLB 2AZ3A 4LR7A 3MUVP 5IT9U 1MN7A 2PMZD 1CBKA 1K1SA 3C6UA 5GADU 2DB1A 1B4SA 1PJ5A 3AB4B 3K2YA 1NK0A 3AHPA 4CDIA 2XLIA 1WG1A 1VRUA 4RL1A 3ILOA 2Q3PA 3CCJS 2DXEA 2G0IA 3CF5Q 3IRWP 5IT4A 3HJVA 3M2VB 4GO5X 3GYNA 5DLGA 5L1JA 5ETTA 2ZH8A 5KFFA 4C7QA 3EJMA 2GFFA 1HYSB 2R8JA 2MHNA 1N5SA 4NASA 1VC6A 5HMZA 4ZITA 2CQBA 4X4QA 2GIFA 3ZZZA 2H65B 3J7AN 3H59A 3A8KA 2H51B 9RUBA 2D3ZA 2CDRB 3CJKB 1W2BR 3CJQA 3FVYA 1FDBA 5F3ZA 5BYRA 2RHQB 3SCIE 4F8RA 4DQRA 2UUAF 4ANCA 2V67A 2ROPA 4DV0J 2YKPA 1N52B 2IPOB 1ZTWA 3BR8A 4Q8FA 2ZHAA 4DCJB 4USTA 1U09A 3H0PA 2Z58B 4UUXA 3H98A 1IBMF 3H42A 2LEBA 3UW1A 1GTHA 1S1VA 3O8WA 1PO6A 5SUHA 4Y2MA 1RAEB 1T3NA 3PRDA 4JI0F 3I9ZA 1ZZNA 2JSXA 4Y2AA 2F7VA 4MYUA 4DLEA 1N5QA 2KRRA 2XNQA 1N8RT 1D8ZA 4EU0A 3T9ZA 2LQ8A 2MGZA 4ZVUB 2WOMB 2WAQD 4AQYJ 3N5FA 5KFKA 4N8OA 3CCLS 2HVDA 3H5UA 4KGXB 2QGFB 2DH7A 2CA9A 3I82A 3CWJA 1E6YB 1KWMA 4F4WA 3KMSA 1YZ6A 4TXSA 1D9AA 1VBZA 4U96A 1F3FA 2JFDA 3M8ZA 2WONA 3ENWA 2K7KA 3Q22A 3IGVA 1AUSL 1Z4UA 5KFXA 3FBCA 4J9QA 2OO4A 1U49A 1S9EA 5K8MA 5ADZA 1HPZA 1U6BA 1Q79A 2EI5A 4ES1A 2QL7B 1C1CB 1TUVA 2PIIA 4O3SA 3TYTA 5EN1A 2MQNA 3G6ES 4ES3A 1ROFA 3JSYA 1U24A 2F3JA 3RGIA 3C15B 4FYXB 1WC5A 3GIRA 2LDIA 3EWGA 2MXYA 4DV5F 2HGLA 4AL7A 5KTQA 2W4DA 3N9UC 1YRXA 4ECXA 4AT1B 3HSZA 4U8YA 2KYXA 3C8YA 2ILYA 4QPXA 5KT2A 4RKUC 3KUGA 3HFKA 2VL1A 4IFYB 5KOWA 3S6EA 1FTCA 2QSWA 4XDCA 3GCXP 1FX2A 5KT4A 3W2VB 5KG6A 4P6QA 3KLHA 2W25A 4DR4F 4CH0S 3UR0A 3HFVA 4DG1B 4YP3A 2G2OA 3FMWA 4W92B 2WK4A 3V81A 1WTFA 3FEYB 3FBEA 1IKXA 1JNRB 2VA2A 4WJBA 3MMBA 5HP1A 2CZ9A 2BW2A 5ETPA 4N77A 3U02A 2H48B 1LQ9A 4JI3J 1YRUA 2Q6CA 4YQWA 2XSJB 3I56S 2FJWA 5KFAA 1LXJA 1S72S 1RABB 2F65A 1HLWA 1TVRB 4LUBA 4ILLA 4ED4A 1RHRB 5LJ5Y 5HVFA 4CI0B 4EEYA 2RD5C 4B3MF 3M1VB 4A8SA 1AFJA 1X4EA 4IFVB 1UETA 3KLEA 1S5ZA 3BQ2A 3HCXA 2ZD1A 3NRBA 3CDEA 1REVB 2BV3A 2IYIA 1NJZA 2RILA 3HSJA 2CQHA 3TO8A 3PX0A 3G9CA 2A6MA 4L74A 3DM2A 1VRTA 1Q4RA 1NKEA 1XC9A 2MQPA 2ZH4A 1FJEB 2BE7D 2RE1A 3R7NB 3V4IB 1SL1A 1PAEX 3NCPA 4LRCA 1TKTB 4ICLB 1Q8KA 4HLBA 1HFEL 2YPZA 1N6QB 4V19X 4P2FA 3H2UB 2Z57B 4WFBQ 1YKWA 5KFUA 4NZ6A 4ZVQB 4DQQA 4TY8B 1WSRA 2AJFE 2BUNA 3DLKA 2HAFA 4C0HA 1HBUB 4FXVA 4GKKF 3OJSA 3NP5A 3BBCA 2I38A 1HBOB 1WHXA 2ZH7A 4DV1F 3UFCX 3Q2TC 4ED5A 4O0IA 3CJ3A 3GPAA 5EWGA 1CVJA 1V5IB 2LQBA 2C3PA 5FJ4A 2AYGA 4LF9J 1FKOB 2GX8A 3R9LA 3EM1A 1MNEA 2ACMA 3NS6A 5KFZA 2CRLA 3EYZA 2V2ZA 3K5LA 2BE2A 4OZLA 3DNCA 2W9BB 2RDIA 1YBAA 2RKIA 1OJ4A 4IYQA 2EK6A 2FHJA 1MSWD 3C66A 1SH3A 4WPAA 1SB6A 2HVHA 4OHYA 5D77A 1G1XA 1VJQA 1NLKL 3G82A 1X4FA 2E7WA 3CCSS 3A4TA 2HLUA 1C0TB 4Y2CA 4AUKA 3AA8A 1U2RA 2FVSA 3TAQA 5F3TA 4UOCA 4IRCA 3DFEA 1RA7A 3DHXA 3SCKE 2KVIA 1T05A 2HRUA 4NLDA 4F3OA 3T19A 1FTRA 3R6LB 4G1QB 5C2CA 2MLYA 3Q24A 1FKPA 7FDRA 2B4VA 2V2VA 4DU8A 2NXJA 4YHHJ 1URNA 2DHGA 1YQHA 4IQXA 3T5KA 3BBFA 3IG1B 4IRKA 5K20B 2Z56B 2ALYB 3HSDA 3DU6A 2YNHB 4CLLA 3OL6A 4U7UD 4ED6A 1T3OA 1E6VB 1I5OB 2M70A 5A8KA 2WSEC 4R5PA 2UXDJ 2E1RA 3QO9B 2V9KA 1FEEA 4L73A 3H5SA 4FYDA 3OUYA 5D4NA 3U1MA 2VKZG 2OD6A 4IO9Q 3LAKA 5KFNA 4CO4A 3HZGA 4JV5F 1B64A 3CDUA 4K0KJ 3NWGA 2ZJPQ 4MYTA 5J2NA 2V8PA 2W7OA 3LO3A 1S6OA 1B0PA 3FZ2A 1FK9A 1VQ6S 4U67Q 1BWVA 3AFGA 2B43A 4X4TA 4ELVA 5IV3A 3D67A 1GMUA 5RUBA 4CH1A 3T1HJ 2IFXA 3P96A 2X7IA 1PYTA 1RHJB 4KJIA 4CLTA 1SQGA 3MUTP 1N5VA 2BJ8A 4AL5A 3C16B 3ZZUA 4ZVFA 1R8CA 4NCGA 3JYTB 5HBMB 1HWLA 1SXLA 4C11B 2CQ2A 4TN2A 4X66F 2DIVA 3OVAA 4EBDA 1UEUA 1VI7A 1S6PA 4KB7A 1S1XA 3K5MA 1X60A 2A0FB 5IOLA 2P6TA 3AXKA 1UEKA 4ALZA 1GFWB 4LF4J 1ZOTA 3B6BA 5GMDA 1VC0A 2BJ7A 3DYAA 4QCLA 1CJTA 1N36F 3NBPB 1HNIB 3EZOA 1RWPB 4IFYA 1Q53A 1FRLA 1CJKB 4KRWA 3VTIA 4AL6A 1Y10A 2IJFA 3HXMA 2G1HA 3SDEB 2XGPA 3GYGA 2GMHA 1RUSA 4CIOA 1A9NB 2DISA 3W60A 3CJ8A 3GJSB 4X65F 3QSIA 1B0TA 2BX6A 2FC9A 1IR0A 4IKAA 3B4DA 4P72A 2XY5A 5DDRC 5SZTA 3OHAA 3JSRA 2LU2A 2I5JA 3EGZA 1VK8A 3IS9B 1C0UA 1VQYA 2KN4A 2WVEA 2Z2YB 2L9DA 3D7SB 4MIBA 1NNDA 2JEFA 3KUHA 2CPHA 3PRBA 1U1KA 3MM9B 4DL3A 2Q66A 3IWXA 2H3EB 1Y11A 4FS1A 4ZVGA 1TVRA 3FEZA 2EFOA 3OTOF 2FHJD 4MKYA 1XNQJ 4KQZA 3LPYA 1KQKA 4QW8A 4DI6A 1VQ7S 2FVRA 1SC1B 1P6TA 4LRAA 2LQ9A 4ZVTB 3K8WA 3GG1A 4ZJLA 1TKXB 4DL6A 5CYQB 1L3SA 4LF5J 2YNIB 3CCZA 1LWEB 4P73A 3M6XA 1DQ8A 4DS4A 4BC9A 4F04B 1R8BA 2OPQA 2UZAA 3RAXA 5KG0A 2NYHA 4F3QA 1O0PA 3UPFA 3FJ2A 3GIMA 4DPTA 4ICLA 2N4DA 3UQSA 1N6QA 3ELHA 4JOUA 3KK3A 3K59A 5IC4B 4B9MA 2FB0A 1IWAA 4EYIB 3T3FA 2XCPA 4WTOB 3IAM9 1X5PA 2JRSA 3CO9A 1LWFB 2QMUB 3CW2C 2R8GA 3HM9A 1FVQA 3KLGA 1RTJB 4IH5A 4U6PA 1ZM3A 2B4UA 4RUHA 5KFCA 4Y2IA 3T6BA 5AJ3F 2HNDB 3HX9A 4NA1A 2E9ZA 5CZVA 2ADCA 3QGIA 2FJBB 2QLJB 2CFXA 3ET6A 2UXBF 4URSA 1NBEB 4ZVRB 2XMAA 1Q7LB 4GVBB 3FBBA 4DQPA 4MFBA 2W24A 2G0CA 3KKFA 2EFQA 2OPSB 1FFGB 4QR0A 5KFYA 2GIQA 3MUMP 5DJBA 4UUWA 4DUZJ 1FKAF 5U47A 4UZCA 2L08A 3MFHA 2H5JB 4A8FA 3VQTA 2P6SA 3G71S 2OH2A 2WVFA 2RUGA 3VCDA 3HK2A 1UWBA 2GVZA 4TY9A 1SJ3P 4A8XA 3UCZP 3TVKA 1Y3KA 1BQNA 4OYBA 2KG1A 3TJAA 1T03B 3F56A 1TU0B 1R8HA 2VC1A 3ILLA 3TA2A 1G7CB 3MCOA 3NOCA 3MD1A 1S1TB 5CQGA 2YNGB 2VZ9A 1TZ0A 2C2RA 3UR3C 3KG0A 2VG5B 5IC6B 2IMOA 5D0GA 2EEYA 4G1QA 3GSIA 3PJXA 1CJVA 3TVYA 2QSFA 5J2MB 2RS2A 3A3OB 5A0YB 3TAPA 4KE5A 3LH2S 3ZZYA 2JC0A 3LUYA 1EARA 1RI7A 3GV8B 3BSNA 4NLTA 4Q45A 1A6LA 3CGIA 3AH6A 2R7RA 1RLCL 3QRPA 1WEYA 2YH0A 2ZBPA 3QPIA 4ZOSA 4DR1F 3PKMA 4IR9A 3BO4A 2I8EA 4A8YA 3DOLB 4ED8A 2Y1JA 4H54A 5A8WB 5BR8J 1M0SA 1YJRA 4M63A 1Q81T 2RRBA 1ZM9A 2XEXA 2HEKA 5ETMA 3C14B 1P9YA 1Q82T 2FLNA 3DKDA 2V2QA 2GAHC 2ZVSA 2XZWA 2MZJA 4AXIA 3VAHA 4JI5J 1QVGR 3J7YU 4MIWA 2OPRA 1N32F 4HT7A 4JV0A 1XWLA 5CA5A 1FD8A 1S99A 3V2UC 2EVZA 1NCLA 1X4HA 5L1IA 4HR2A 4YDXA 4R8UA 3JYTA 3N79A 3UDEA 4DUTA 5ETKA 2HHPA 1GX6A 3M7VA 2WCXA 3ENVA 4URGA 2ZEJA 1RXOB 2F4VF 2ASJA 4NA3A 4YR2A 1S79A 4OHXA 1U1OA 4WK3A 4RUBA 2RQKA 2J9EA 4EMDA 3QWUA 2NSCA 1M1GA 3X3UA 4QR1A 3LP1A 2J8SA 3UI3A 1RP5A 4H4OA 5DZ6A 2H5IB 3HHLA 3R5BA 2WTFA 1S97A 2MMYA 2HFNA 3CC2S 2CNKB 3TWZA 2DPIA 2ZBQA 1S59A 3VAJA 1PYSB 3W9IA 3ZNUA 5B0AA 1GT8A 3DOKB 1GMWA 1RCXB 4JI1J 2YKMA 2VJUA 5IWAF 2BJ1A 2ATCB 1Q7YT 4JI6J 1SVDA 2PE8A 5ETQA 3CIMA 4X4SA 4OMFG 2Z2MA 5EWFA 4I56A 4Z2XA 4QIWD 3MPUB 3CD7A 1WJ9A 3MPYA 2RRNA 4LT6A 4GRSA 3N28A 4J9RA 1F9FA 1FI4A 4CO0A 4Y3CA 1FXRA 1VLYA 4NYZA 5LSLA 1ZS6A 1NB2A 1BC6A 1YBTA 5HVHA 4IDKB 2XG8A 1KHWA 3W65A 1S1WA 1SQFA 4ZPAA 1GQEA 1XERA 3I5AA 5CZXA 3GMGA 2IAJA 3JTPA 5CCMA 3VVUA 3J7A1 2CPJA 2ZOGA 2J0QD 2MZRA 1B7YB 4ECVA 3FUYA 4QWCA 2DGSA 1QE1B 2FQQB 4ELTA 2NREA 2CJQA 2XHCA 4F67A 3VAMA 3Q8PB 2YNIA 1BE4A 3EXYA 2PT0A 3R27A 1LWEA 2YX4A 5L1LA 2BKNA 1JXEA 2QIFA 2FGCA 2XMJA 5A8RB 1KFDA 1D09B 2AT1B 4O3QA 2I9SA 4NPOA 5F8IA 5DQHA 2IVFB 3ONQA 4DV0F 2IHR1 1R27B 2AEMA 1UVLA 1YDLA 2VQEF 3TAMB 1WEXA 4PG8A 4DSFA 4K4TA 3ZTPA 4DU7A 3SQGB 3D6HB 1RWKB 2PO4A 4FXDA 4LBHA 2OMOA 2AW0A 2V8HA 2O67A 5E0OA 2QLFB 2AEJA 2XZDB 1SJ4P 3PIOQ 1U1MA 4DR6J 1FNXH 3G6VA 3KJQB 4NOHA 4KV8B 2V8DA 1DTQB 5DGBA 2AX0A 4NE9C 4O44A 1XN9A 1TL1A 4RW8B 2E1AA 4FNHA 1Q16B 2A10A 1S0OA 2QTWA 3I9V9 2BKPA 4USMA 1QAYA 4B3RJ 1WG5A 4GVBA 2ZVIA 2XS7A 2VD3A 2F9JA 2B9WA 1D1UA 3I87A 3KMQA 4CO5A 4KC5A 1H2TZ 2RU3A 5KOXA 4M5GA 1IXKA 1FDNA 5EWEA 3HULA 3QRQA 2GGPA 3HF5A 3MM8A 1RHMB 2FJVA 3BGRB 2H4YB 1IKYB 1FE0A 2ZE2A 2B9EA 1FJCA 2XNRA 1YSJA 4K4XA 2HHHJ 1ZM4A 1KEKA 1CQMA 3MAAA 3G6XA 3G8SA 2MKKA 3W64A 2OI2A 3R6GB 1PIEA 3LP2B 1RT6B 4PRFA 4DXLA 2YNGA 1NU4A 4QIFA 2MKCA 3CJRA 4M94A 2UV8G 2L9WA 4ZA1A 2VG5A 2XYHB 5AT1B 5F9NA 1WI6A 4TKTA 2N3LA 1LW0B 2DBBA 5IV4A 5HATA 1KDNA 3Q8UA 4HEA9 2QG9B 1KD1T 3H40A 3HHLD 2C2OB 2CWXA 2L9NA 5GAHU 2ZUGA 3AD7C 3MOZA 2DIUA 4I6AA 4R0EA 1H7WA 1VBYA 4F25A 2GC8A 5I4MA 1F5CA 3TA1A 2DHXA 1NJWA 5KFDA 2QLXA 2EBGA 3G8TA 4YN3B 1BQMB 1B0VA 2BJDA 3DOLA 1Q8BA 1NEEA 2ZFHA 3EPGA 5HLFA 4WXWA 4KR0B 3AODA 5B0CA 4N7TA 5IXUA 5D4LA 2K3IA 4TNOA 4K5SA 2N7YA 2ZC3A 3B4MA 4J91A 3OTCA 1T9UA 3MEEB 3I0SB 1MN9A 2VHGA 5F8NA 1UKUA 2MZTA 6AT1B 5CHCB 4RU9A 4OQJA 2OPPB 2A2DA 4RNFA 5AE2A 4CT8A 3OLAA 2RSQA 4PG4A 4JI3F 4ZHRB 2BKOA 3L09A 2D3OR 2B5JA 3POTB 1B99A 2CAJA 1RTZA 3JB9k 1DLOA 2XSFA 1RHUB 1SL0A 3DLGB 2GO9A 2FHKA 4RU2A 5B7WA 3TR5A 1S76D 4ZVSB 1JLFB 1NPPA 2C3UA 3F44A 2D74B 3QWPA 1EAYC 1XR7A 1NO8A 3AXMA 3EGVA 1NHVA 2DNGA 4JYAJ 3DI6B 1JKHB 5I3PA 2YWKA 2O5DA 1LW2A 1URRA 4X4OA 2GQ2A 2JJ4D 3R5JB 3BYRA 5KFQA 3DCAA 2PFDA 3QT5A 1EKSA 1WSVA 3DXSX 4JP8A 4ZDNA 3M32B 4YB7A 3BQ1A 3LAMA 4P7VA 2ZH1A 3PR5B 1KRPA 1RYSA 4NMXA 2HQFA 4DSEA 3H5XA 1RU1A 4G6VB 4KKOB 3BKUA 3SEOA 4HHHA 5C25B 2QZ8A 4RNMA 3PXGa 2AJ2A 1NZ8A 4UOGA 2E1CA 5L39A 2ZKUA 1Z1ZA 2EW9A 1T11A 5IM0B 5ETRA 2LEPA 2ZHOA 4OYOA 3HPOA 1R89A 2NZCA 4IDKA 1VQ8S 2MLZA 2X1FA 5MAOA 2KB2A 2IRUA 4J9KA 5IT9Y 4UQTA 3JSMA 4A8MP 3MZIA 3NL0A 4LF9F 1Q5VA 4J9SA 3CB4A 2OIHA 2E9RX 1UCNA 3JTOA 3V6DA 3LTOA 3RBEA 2R7TA 1T9XA 1NRKA 1BQXA 1Y5NB 3GB0A 3DDNA 5L8RC 2CQPA 3PW5A 1RAFB 2F8MA 4C8YA 2NPFA 1QE1A 2DH9A 4M5DB 2OTJS 1OWXA 4Z7CA 4KGVB 5KG4A 4FNIA 1RT5A 3ZTSA 4LF6J 4BBYA 3TQ1A 4ZP9A 4KHPJ 4DX8H 2UP1A 3QAEA 2VODA 3EVOA 3AJ1A 2YXLA 2JHEA 1S6QB 2IM3A 3BN4A 1W7WA 2V34A 1SBRA 4P2XA 3RRHA 1U1LA 1WTBA 3D0IE 3QJPA 1RE1B 3CVKA 4DF8A 4RW4B 3TX8A 4IG0B 1A7GE 3PFEA 3QIPA 2D1CA 1NSPA 2JX2A 3IR5B 2HWIA 3KLIA 3BKTA 4YS2A 2N82B 4MJKA 3IRXB 1P8GA 3DGPB 4X62J 5F9LA 4C98A 4NMLA 4OYXA 2R7OA 4PCQA 4M5HA 1RT4B 2BJ9A 4YHHF 1PKUA 2H9ZA 1HNWF 4RW8A 4UY8T 2XS2A 2J7WA 2CQIA 2K1RA 1T94A 1VQOS 3GTYX 1XMOJ 4MAKA 1HBNA 5DS7A 5K9FA 2W8KA 4B9NA 3GJRB 2UXDF 2GV1A 3MMAB 4OZ3A 2DGVA 2MQ8A 5IQQA 4H4MA 3UD3P 1H73A 1M1KT 4PWDA 4ED0A 2R2SA 4ZMMA 4K0KF 2C2DA 3BGRA 5F8HA 1VQMS 1HARA 3BGLA 2C42A 4Q0BA 3W2WA 2CJYB 2IVMA 1R31A 3T1HF 1AROP 4ILRA 3C46A 4EO8A 2CIMA 5I3UB 3BEGB 2J9DA 4NLYA 2LEAA 3THVA 4ZVHA 2KFNA 4C8KA 4NL5A 4RW6A 1CJUA 1WC6A 4CM0A 2YX1A 3K8VA 1UTAA 1UA1A 2PFFB 3GIJA 4E0DA 5KAKA 1IVZA 2LA4A 2HWHA 1RBAA 3PHTA 3RW6A 4IG3B 1YK9A 3NGKA 4O3RA 2FHMA 1Y5LB 3EE3A 1RTHB 1QAXA 3HVTA 4HKQA 3QLHA 5HN0A 5GADI 1UP1A 3KUEA 1ZAWA 4CT9A 3H4DA 1Q8LA 4DWIA 4LF4F 1RB0A 4UTGA 1EKRA 4EBEA 4PWWA 1YJ7A 1RBOB 5FD1A 9ATCB 2AJ1A 2R7VA 3M9NB 4C0BA 3CCTA 2C2ZB 1LWCB 2OTLS 2C3OA 1S9GA 2XO7A 2HFUA 4ZIVA 1YHQS 1ZPVA 5G0RB 2Y3YA 2HS0A 3M8QA 3I5BA 2R7WA 4YB1P 3KHGA 5KFVA 4LSNB 1B7FA 1FWKA 3UVJA 2ZDPA 3V6KA 1TL3B 3R8YA 1HNXJ 1XJWB 4JI2J 4FKYA 1SH0A 4C9DA 1IKVB 3CNQP 2AD9A 2HHXA 3QIDA 4W4MA 1FRXA 4DR7J 1ZYQA 4RUCA 4ECUA 3F0NA 3M30B 1HD0A 1VBKA 3H7HB 2OPPA 2KT2A 3IC1A 1XR6A 2KL8A 2GVDA 4DX6A 4LFBJ 2XHWA 3KK1B 1RWMB 5CD4A 3G6YA 2HK2A 5KFRA 3BJYA 1KR4A 4RPFA
chains in the Genus database with same CATH topology
2HLUA 1C0TB 4Y2CA 4AUKA 4I4BA 3M05A 2IMWP 4FF4A 3AA8A 5LT5A 1DBDA 1U2RA 2X1BA 1FCAA 1V3RA 3NKYA 1XNQF 3M9OB 2FVSA 3TAQA 1U25A 1YVFA 2YNFA 5F3TA 5C24A 3D0HE 5KFHA 2AGQA 4Y00A 4UOCA 4Y28C 4IRCA 1TV6B 4C8ZA 4BWJA 4NZ7A 3DFEA 3LWLA 1ULRA 4F26A 2KXHA 4USIA 4PUOA 1RA7A 2XBPA 3DHXA 3SCKE 3ZZOA 2KVIA 1SIWB 3RTVA 3DOMA 1H7XA 1H2VZ 3MI7X 2W4CA 4K4WA 4FN5A 4QR2A 1QSLA 4ECTA 4GC6A 2R8KA 1NJYA 5KFSA 3OVBA 5BYSA 3KLFB 3M6WA 1T05A 5D6GA 2HRUA 3QZ8A 3J81Y 1UEVA 2NLWA 3C6UB 4NLDA 4B3OA 3K7RA 3HDSA 4HVZA 1RWUA 2MKIA 1L3TA 3L3CA 4F3OA 1I94F 3CD6S 1UFWA 1NAQA 2IM1A 2VH7A 2WBMA 1NHUA 1FTRA 3T19A 3PFOA 2ROEA 3N4WA 4G1QB 3KNGA 4XDDA 1VRUB 3I32A 5FIIA 3Q24A 2ABYA 1FKPA 7FDRA 2B4VA 5FDLA 3MDFA 4I7FA 2Y1RI 3GIIA 2VPYB 2IC3B 1KNZA 5HLFB 4FVCA 3RR7A 3IGNA 4A48A 4NLWA 1KLMA 4ZKAA 1URNA 2DHGA 1YQHA 2VASA 3P6YC 5E5NA 4IQXA 3LP0A 3T5KA 5DDQC 4DN9A 1IN0A 1WELA 5HO4A 3IG1B 3CCES 1J5EF 2ZITA 3OJUA 3CC7S 2C28A 4OLOA 4IRKA 2ZM6F 2QLWA 2WRMA 3T5JA 1U26A 1X4BA 5C25A 1O8BA 3KK2A 2ATLA 4ED6A 3DU6A 2DH8A 2EFGA 2FJDB 2YNHB 3OL6A 3HT3A 5E3QA 3MOJB 3OXGA 1T3OA 4WZMA 1E6VB 2DNRA 2V4JA 2M70A 3M6VA 5A8KA 3VZIA 4IQMA 4KTQA 2GO8A 3KG1A 2WSEC 4R5PA 4F4XA 4BWMA 4K50A 2DD8S 1RT3B 2E1RA 1YJTA 2G9OA 4KFBA 3G8QA 3QO9B 2V9KA 1FEEA 1RT2A 7FD1A 4PQAA 4EZ9A 2GQQA 3MAQA 3MM6B 5M2UA 2R2RA 4PXEA 5IM0A 4I67A 1X9WA 4HDGA 3K57A 3H5SA 3D5MA 4MKAA 1DARA 5D3GA 4FYDA 3OUYA 2BABA 5T7LA 5LMNF 3DRRA 1UL3A 5D4NA 3HHDA 3U1MA 2VKZG 2OD6A 5M2PA 3BQ0A 4IO9Q 3DOKA 3LAKA 5KFNA 1GXUA 4CO4A 3HZGA 1DAXA 2OSQA 2APOA 4JV5F 3QMQA 1D9DA 3DLLQ 1B64A 3CDUA 3NWGA 3PEJA 5KFTA 2ZJPQ 4FS2A 3IA0A 4MYTA 2XLJA 3ZC4A 4TU7A 5J2NA 2FJEB 2HYIB 2W7OA 1U47A 3LO3A 2FJAB 1S6OA 2LYVA 2B5JB 3MECA 1B0PA 3FZ2A 1WD6A 4MKBA 2ZZMA 1FK9A 4Y34A 1F5AA 1NK9A 1VQ6S 1IKWA 1DLOB 4U67Q 1JLGA 2MSSA 2WBRA 2PA3A 4NLPA 2DJWA 3NG8A 4PKDB 3I5CA 1D9FA 2B43A 1UJ4A 4I2QB 4X4TA 4DL5A 3IO1A 3N6LA 4ELVA 4JV2A 2KDOA 4U9RA 1Y5IB 3TNVA 4CH1A 2DGTA 3UE2A 1R43A 2X1GA 1XEZA 1RKJA 4ECQA 2BM0A 2IFXA 3P96A 1BWEA 5KT5A 4KHRA 1RT7A 2PN6A 5I42A 2BQ3A 2M8HA 5J1NA 1S0NA 1JWWA 1X0FA 3KFWX 1NK4A 2Z2LA 3L7OA 4KJIA 2UVRA 1M5SA 1SC6A 4WU3A 2M2BA 3SMZA 2B51A 2HW3A 3IR7B 1FXLA 5LJ3Y 3BM7A 4OHWA 4PWUA 3MUTP 1HNVB 3THPA 1LW2B 2J76E 4DUZF 2ALZA 3TARA 1N5VA 5CD4H 4AL5A 3ZZUA 1KOOA 1DQ9A 4ZVFA 2KJVA 1R8CA 2XY6A 1FESA 4NXNF 4NCGA 3OL8A 3CT9A 3JYTB 5HBMB 3M9MB 1S10A 2GMLA 3TANA 1HWLA 1VQ9S 5B0DA 2F40A 3HHLC 3J80Y 2KXNB 1SXLA 1FERA 4L72B 3T1AA 5BYQA 4C11B 2CQ2A 4DOZA 4TN2A 4X66F 2DGQA 2DIVA 3OVAA 4EBDA 1UEUA 1VI7A 3ZZPA 1RQ0A 3VQSA 1S6PA 4DJBA 3DRYA 1HI8A 2ZC4A 1FDAA 4C3MA 4KB7A 4RBVA 3P5TL 4CTAA 1YJUA 3OFFA 1S1XA 1SI9A 3MM5B 4RWXA 3K5MA 2MY7A 3Q0AA 3CDBA 4HH1A 3R5DA 2FUG9 2Q79A 1WF2A 2KG0A 4KBIA 2P6TA 4OZ1A 4R25A 1EETA 1HBMA 2XS5A 2KU7A 2D3UA 4ALZA 1YGYA 1GXTA 2BBEA 1RT1A 2VC0A 1ZOTA 4OI6A 2XB2D 2AWZA 1VC0A 5KFPA 1SJ1A 3DLJA 1AXQA 3DYAA 3DMJA 4CCHA 4KO0B 4QCLA 5A2QY 1LFPA 1N36F 4MK7A 4QQBA 3NBPB 2J6UA 1X4CA 1QUPA 4HDHA 5K5MA 2CPDA 4FF2A 4MK9A 3H5YA 1FJGF 2FGOA 5AE3A 1HNIB 1DHMA 1CLFA 4QWBA 4QZVB 4OL8A 2MGZB 4IFYA 1Q53A 4HTJA 1FRLA 3ETOA 3M2UB 4KRWA 3VTIA 3DLEA 1H3DA 2LQ5A 4AL6A 5F0UA 1HI0P 4FXWA 3RYLA 2XULA 4K4SA 1T7PA 2BR0A 5A8RA 3SV4A 1SH2A 2IJFA 1HWJA 3HXMA 1WHWA 3SDEB 2XGPA 1Z2LA 5GAGU 3DRSB 2GMHA 1QSYA 4I64A 3E8OA 3A8EA 3VAFA 2K3KA 2NR0A 5H9FJ 4CIOA 1HA1A 4LQ3A 2DNKA 1TR0A 1A9NB 2DISA 1N0VC 1KTQA 4LSLA 5E3RA 4IO1A 3CE8A 5LSRA 4X65F 4KT0C 4GMKA 4N76A 1B0TA 4ZCMA 3JSMB 3LGNA 4NZ0A 4NX9A 3T1YF 2AU0A 2FC9A 2HHWA 2QE5A 1UJ6A 4RNOA 2VV5A 1U1RA 1Y3JA 4HTIA 1HR0F 1IR0A 1JJHA 3OL7A 3KG4A 4IKAA 3GV5B 4RWWA 1VQ5S 3V6DB 2YWFA 3NCQA 4BDPA 3B4DA 2XY5A 3TAMA 1G6BA 1UVKA 2G1DA 1NZAA 3CJ5A 4ZPBA 2WONB 4C2MA 5DDRC 5LMUF 1FRHA 5SZTA 3OHAA 1MMDA 3OL9A 3JSRA 2LU2A 3QJJA 2ZH9A 4OI0A 2I5JA 3EGZA 3HJFA 1VK8A 3G86A 3MMAA 3LQVA 2NZ4A 2J8AA 3IS9B 3SQGA 2V8GA 3N6NA 4IOCQ 3MEDA 1YJWS 2FIUA 1C0UA 4KGKA 1VQYA 4G1IA 2KN4A 5KFMA 2FTRA 2NUHA 2FVPA 2IA0A 2L9DA 1OS5A 2OKQA 4MIBA 1NNDA 3MFIA 2JEFA 3MD3A 4NA2A 1TL5A 2KRBA 2YKNA 1N5YA 4ID5A 2KH9A 4R0JA 2CPHA 2HNYA 2MY8A 3PRBA 5HMXA 3CEDA 1U1KA 3MM9B 1S9EB 3KTQA 4KV8A 4DL3A 3O44A 2Q66A 3IWXA 1DTQA 3CMES 1S49A 2MYFA 1HPZB 1HQEA 4HT5A 1RT5B 2J5AA 4JUZA 3US5A 5BR8F 4FS1A 4ZVGA 4K4UA 3LOUA 1DTTA 1YRTA 3MR2A 2DT9A 5B0EA 1TVRA 2GW8A 2KT3A 3M8PB 5CCLA 3FEZA 4YB5A 4NLVA 3M8RA 4WE1B 2EFOA 1HWIA 2YWHA 4RLEA 3BREA 4DL7A 3OTOF 2WB4A 3TUJC 4QU7A 2FHJD 3QYYA 1UVIA 4MKYA 2I2YA 2PA8D 3K5NA 1SV5A 3SFGA 2IRXA 2W9CB 4KQZA 2D9PA 2A18A 3LPYA 2O3DA 3ISZA 1JXLA 1AUDA 2E9TA 1KQKA 4QW8A 4H4KC 1VQ7S 4MTPA 4C4WA 5D4OA 2FVRA 1MU2A 5KFGA 2JFKA 2WHOA 5J2PB 4JI5F 1P6TA 3F41A 4TU8A 4Q43A 2LQ9A 4B08A 1XR5A 3GG1A 3K8WA 4FP9A 1TKXB 3BDEA 4DL6A 1X5TA 3CC4S 4YMEA