2YWNA

Crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
150
Chain Sequence
GHMVEIGELAPDFELPDTELKKVKLSALKGKVVVLAFYPAAFTQVFRDSMAKFNQVNAVVLGISVDPPFSNKAFKEHNKLNFTILSDYNREVVKKYNVAWEFPALPGYVLAKRAVFVIDKEGKVRYKWVSDDPTKEPPYDEIEKVVKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-like protein
publication title Crystal structure of peroxiredoxin-like protein from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
total genus 43
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ywnA00
3M9JA 2N5FA 2YV9A 4I2TA 2FD3A 5GAND 2E7PA 1USBA 5B8BA 3P7XA 3GSTA 4KH7A 2X8GA 4IBPA 3GURA 2L6DA 2B7KA 2GGTA 2IFQB 5COHA 1TOFA 3L9VA 1WOUA 1OKDA 1Z6MA 3VI7A 2HZFA 3Q18A 1TI1A 4BPYA 1GULA 5HR1A 2HSHA 3BBYA 1XW9A 2F8FA 3HVXA 1ACVA 1Z6NA 3WD6A 4I8BA 4ZL7A 4D73A 4AGSA 2RM6A 4FO5A 2M46A 4Q5QA 4ID0A 4OFMA 4V1Ag 2B6MA 3U6VA 4MZCA 1I9DA 4LL1B 4IGJA 3MNGA 4WETA 4PNGA 1JZWA 2IN3A 2LQQA 4O92A 1XOAA 6GSXA 5GSSA 1K0CA 1V9WA 3DYRA 1X9SB 2JU5A 3HDCA 1BJXA 2HRNA 3FZ5A 2L5LA 2WCIA 4HEA2 4K9ZA 2VCVA 3L9UA 4NMUA 2HRFA 3TKQA 4J56E 1T4ZA 4MLYA 5DJMA 3HVSA 3IK9A 3RHCA 3HHVA 4BA7A 3TDGA 4AF2A 2VCXA 3SBCA 1ABAA 3CRTA 2GT5A 3VWWA 4MF5A 3ZL5A 2L57A 1WJKA 4XS6A 1TJDA 2GT6A 3QCPA 3K8NA 3A2XA 3EMXA 4HOJA 3O3TA 4AJ7A 1MEKA 4MK3A 2AB6A 1OC9A 2K6VA 4MA9A 1ZYQB 4KUNA 5EL8A 2WULA 2AHEA 3BD2A 1QFNA 1GNEA 3F6FA 2R37A 3GNJA 5CREA 5JWQB 3TRXA 2IIYA 4I97A 2C0DA 1TXXA 1X9WB 1E2YA 5IM9A 1K0OA 4EO3A 2JZTA 2GQLA 2EIRA 4NV2A 2MMZA 3GX8A 3H1NA 1FOVA 2GVPA 4TXVA 2VCQA 5IMZA 2AUVA 3LQ7A 5D93A 2RLIA 2IMKA 4EXJA 5A5KA 4Q5NA 1F2EA 3J7Yb 20GSA 3FZ9A 3GYKA 3H93A 4PX1A 2YCDA 5HR0A 1WMJA 4H86A 2HLSA 1T00A 2ON7A 3E0UA 3DVXA 2C1YA 4NXIA 3ISOA 2H66A 4HZ4A 1NHYA 3TJFA 3CTGA 4N11A 2H6XA 3U5RE 4WR4A 1S3AA 2FA8A 1DBYA 2HNLA 4KX4A 3N5OA 4KA0A 1EOGA 3FEUA 1W4VA 2VL2A 2IFQA 2VO4A 4G2EA 2CX4A 4PQ1A 3PR8A 1O8WA 2AAWA 4GLTA 1PD21 2JACA 5J9CA 5EVOA 3EVIA 2YANA 3GN3A 4DSQA 2VCZA 1O8XA 3KIJA 5ABRA 5DBQA 1LJRA 3CBUA 3M1GA 1YDKA 3Q19A 4K6XA 1X9MB 3R2QA 1AW9A 1AAZA 2GTUA 1GTIA 3F4TA 13GSA 3IK7A 3TKSA 3FHKA 3MWHA 2NTOA 1EV9A 3RAZA 5HFKA 3UVTA 1XPVA 3HYPA 1QXHA 4PQIA 3TOTA 2Z9SA 2BMXA 3D6IA 3FZ4A 2H1BA 3G9BA 4ZBBA 1ZL9A 5D9WA 3FW2A 4MH2A 5CYYA 3ZMKA 5LD0A 1K0NA 2VD0A 4OO4A 2CV4A 1MDIA 1ERVA 3QAVA 3LORA 5AIVA 4HZ2A 3M0FA 4KDYA 4GSSA 5AGYA 4Z7XA 5ID2A 1WWJA 2PBJA 1XVWA 2H70A 3HZ4A 2PMTA 5G5EA 3N9JA 4EDYA 1TK8B 2QGVA 4IVFA 6GSVA 4EL1A 5ENUA 1T1VA 2XPEA 2C3TA 1XVQA 3UARA 4TR1B 1G6WA 3DD3A 4BVYA 3EWLA 1JFUA 1GL8A 3QMXA 2DC5A 2FWGA 4ILFA 1DUGA 2XBIA 3GKXA 5KN3A 2OBIA 3TRPA 2YOIA 2C8UA 3ZVJA 2L6CA 4KGIA 4LMVA 4EDZA 3BJ5A 5DQSA 2HSYA 3HA9A 3ERGA 1O81A 1GUKA 2X64A 4IQAA 4MF6A 5IOXA 2LJRA 2HFDA 1K3YA 3HVVA 2AYTA 4FYBA 2QC7A 3KGKA 2KP2A 4TVEA 2FHEA 1TDIA 2XPDA 2QKEA 1QUWA 3LYKA 4JRRA 3D4MA 5IMFA 2FA4A 4HDEA 5F07A 3WGEA 4OCEA 3LXTA 2YWMA 1URMA 2KP1A 4N0ZA 4PURA 1A2JA 10GSA 4NHZA 3LG6A 5DALA 3I6AA 2R4VA 2VL9A 4AJ6A 5JWOB 4KDXA 5F0GA 4POBA 1SJIA 1WPIA 2EC4A 5ECRB 2J23A 1GTAA 5DJLA 1GP1A 2X99A 1ST9A 1CQHA 4XHMA 2ZUPA 1VRSD 2O89A 4F82A 5C04A 4GTUA 3SWLA 4YAVA 1JHBA 1O73A 5G1KA 1QK8A 1XWGA 2H30A 2YNXA 3RHBA 2YN1A 3UBLA 1EP7A 1B4QA 3HJMA 3ZVJD 3ZZXA 1ERTA 5J4UA 4GSNA 2IWTA 2C3NA 3ZFLA 5ELAA 4I5QA 1M2DA 3L9SA 2ZCTA 5IPGA 2GLRA 4HUAA 1B4PA 4O5RA 4XS1A 2YZUA 4YQMA 2QSIA 3DEXA 3EU4A 5KN1A 3KM6A 2FWFA 4POKA 4HI7A 3C73A 5JCUA 1TK0B 1PQNA 1W89A 2PVQA 2X8CA 3MAKA 1OC8A 1SKRB 4YH2A 1SENA 4PGTA 1M2BA 2C80A 2VLTA 3P8WA 3FYGA 2DMLA 6GSTA 3E9JB 2GZZA 4ZXGA 1TP9A 1F9MA 1EGOA 2TRCP 2LQOA 2DMMA 3F3RA 3GV1A 4EVMA 3D4TA 2HZEB 4JR4A 1SL0B 3F3QA 4TR1A 3ZLPA 2JZSA 11GSA 2L59A 3H79A 2RUFA 3F9UA 1J08A 1A2LA 2H75A 1HNBA 4NPBA 3ERFA 1X0RA 2VLVA 3NOFA 2H1GA 1XWCA 1LU4A 1Y6EA 5KN0A 5HR3A 4LA1A 1K0BA 3DGQA 2K18A 3OR5A 1YJ6A 2C4JA 1Q98A 3BOAA 5J5NA 4ZB9A 2FNOA 1PN9A 1NM3A 2VM2A 1HNAA 3Q6OA 5IPHA 2FUG2 2GDRA 1XCCA 2RM5A 2ES7A 3O6TA 4K7IA 1YKAA 1Z7PA 2O7KA 3HXSA 2DJ1A 2H76A 1JLVA 1G6YA 3HY2A 2A2SA 1S3DA 3A2WA 2WFCA 19GSA 2IJYA 3QFBC 4ZBDA 4HQZA 4DVCA 1NHOA 4RI7A 4TW5A 5CNWA 5IIZA 2IMEA 3DXBA 5ECSA 1UA5A 2LNTA 1GUMA 1B9YC 2O8VB 1IYHA 3D5JA 3PGTA 1DSBA 1WRYA 4GSTA 2E0QA 4K7NA 4IW9A 1SJ6A 1MTCA 1KBNA 5H5QA 2YV7A 5ID2B 4MJBA 1KTEA 3KMOA 1A24A 5G30A 1XWAA 1XW5A 2LJKA 4V2MA 2A4VA 2LEGA 3W8SA 1X5CA 3A3TA 3D0ZA 1U6TA 3FY7A 3KTLA 4IS0A 2CT6A 3DWVA 1HYUA 1JZDA 3KCMA 2WZ9A 5CRHA 2MMOA 1TU8A 4P3YB 3VWVA 1PMTA 1K3OA 4GF0A 1G7EA 5D9TA 1XXUA 3FZAA 1XWKA 2H6ZA 1LBKA 1JZOA 5EY6A 2GS3A 3ME8A 2MBSA 2H1AA 2TRXA 1SJZA 5F06A 5F05A 4KAEA 4IJ3A 4MH3A 5G5FA 5E59A 4OFNA 2OE1A 2HI7A 2B5EA 3G7YA 2V41A 4ZIJA 4TKYA 2C0GA 3FR6A 1K0DA 2V6KA 2FLSA 1SD8A 4G19A 5JWRB 1B8XA 4HJMA 2H19A 3VPQA 1V98A 3V1WA 1EV4A 2OA7A 1H4OA 2H1DA 4EC0A 1GTBA 2YZHA 4GRFA 3VPTA 3WGDA 3WGXA 4DSRA 2NBSA 2P31A 5DDLA 6GSSA 3DVWA 2FY6A 3QR6A 16GSA 2V32A 2ON5A 3KP9A 1UC7A 4ZL8A 3ZIJA 1B9XC 3HZ8A 4L5OA 3GUSA 2H71A 1VF1A 2HZEA 1T8EB 1M99A 4TXOB 5INYA 4ISDA 3CRUA 4WR5A 5DALB 3TKPA 3DMLA 5ELGA 3ZTLA 1C72A 4L5LA 3G7JA 3IOSA 1S3CA 4IELA 6GSUA 2VL3A 2KOKA 5IMVA 3PINA 4GXZA 1N2AA 1SK2A 3DRNA 2TIRA 2LV3A 1J9BA 2F3MA 2LS5A 1PL2A 3GTUB 5D73A 1GNWA 2HT9A 1ML6A 4NWYA 2MMAA 1NSWA 3ZRDA 3IXRA 2JSYA 5KN2A 1AC1A 1XOBA 4NHWA 2DBCA 5FHIA 1YZXA 2IL3A 5H5SA 3J7Yk 1N8JA 3GH6A 2WGRA 4V2NA 4DEJA 2EIQA 3F4RA 1EP8A 4JU5A 3TUEA 3A5WA 4MZWA 1XWBA 5J41A 1GSDA 3H4KA 5DAKB 3M9KA 1YQ1A 2F51A 2OADA 4O32A 2LUSA 5IMDA 1TRSA 1M7TA 4K7OA 3A2VA 4ECJA 3GX0A 2H0GA 1SL1B 2P5RA 3WT1A 1XIYA 3UMAA 2B1KA 3C71A 4IP6A 3GKMA 1TRUA 1FHEA 3LSZA 4F0CA 3UJ1A 3P90A 1OVNA 4RI6A 1AIUA 4WBRD 3WT2A 1MD4A 4ACSA 2VCTA 1SU9A 5E4WA 1Q4JA 3DKSA 4FIWA 3VWUA 1TTZA 4XRDA 3JCML 2PERA 4YQUA 4JZQA 2DJ0A 3EC3A 3IA1A 1X5DA 3GL3A 2FGXA 2OE0A 1YY7A 4NAXA 2H8LA 1PRXA 3MDKA 1HNCA 3KJYA 4X43A 4ECIA 2WS2A 4WEYA 4ECCA 1AXDA 3I43A 3ZMLA 3GHAA 1J0FA 4MCUA 4N0VA 1XFLA 3I69A 1AQVA 2DSAA 4I6XA 2GSRA 3HCZA 4MMMA 3F0IA 1R26A 1V58A 2P5QA 4K0GA 1H75A 2DJKA 1RW1A 5ECIB 5ECPB 3LXZA 4JBBA 1GSEA 1MD3A 4OWYA 2JL4A 1BYEA 2LRTA 2YPMA 3IHQA 4MZBA 4PQHA 3APQA 3EU3A 1YEPA 3KEBA 2OACA 5B6MA 2GSSA 5ECLB 3UBKA 4TXOA 3TCOA 1FO5A 1NW2A 1F37A 1QQ2A 1T4YA 4K8MA 3QDNA 1GWCA 18GSA 2PN8A 4MJEA 4RUVA 2OKAA 3KH9A 3EMPA 2C0EA 5HQPA 4WBJA 4PXOA 1TRVA 2IPAA 3RPPA 2KHPA 5HFIA 1EWXA 1ON4A 3M3MA 2F9SA 3RPNA 4CW9A 1GLQA 3CSIA 3GRXA 5ECKB 2LRNA 2E2GA 4AJ8A 3D21A 6GSWA 1GRXA 4GQFA 4XTSA 2C0FA 4WXTA 3GTUA 3TJKA 5IMCA 3UOMA 3VWXA 1ZCPA 2GSTA 4KSOA 5DCGA 4L0WA 4YAPA 5CP1A 1R5AA 4ZB8A 2JSZA 3RBTA 3CSHA 4GCIA 2GQMA 2H0IA 5D9VA 3IC4A 3LEFA 2OBKA 4KDUA 1GSUA 2XHFA 2GZYA 3LJRA 4IHUA 3BCIA 1VF2A 5B7CA 2OJLA 1VF3A 1OYJA 2XC2A 1OE7A 2WB9A 3IDVA 5A4VA 4HS1A 1FG4A 1XBSA 1OKTA 3IAS2 1EEJA 2I4AA 5DAKA 1GSQA 2KLXA 4QQ7A 3ERWA 2VUPA 2P0GA 3UEMA 1PGTA 3IAM2 3ZFBA 2I3YA 2VOCA 3C7MA 5HFGA 4X1UA 2RIIA 2DJ3A 1DE1A 1FAAA 2I1UA 4WF5A 3KTBA 3EURA 1U87A 4L0UA 1VF4A 4HU9A 3CMIA 1K3LA 1ZGNA 3F63A 4KW6A 1TW9A 2VAFA 2YWIA 2VD1A 3FR3A 3HD5A 3GH9A 2GSQA 4PNFA 3C1SA 3KZQA 5G31A 3GA4A 3GL5A 5GSTA 3L0HA 1DE2A 4MDCA 1AUCA 1GTUA 1Y25A 2LRCA 1Z3EA 1WIKA 1EEMA 2VLUA 4HJ2A 1SK0A 2YWNA 2M72A 2MBTA 2G2QA 2RUEA 4N10A 3LYPA 1A0FA 1I5GA 2OE3A 5D8IA 2CA8A 2VL2C 12GSA 3L4NA 4MJCA 5DCHA 3ZITA 4F0BA 2H01A 2MMNA 5GAPD 3CTFA 3QFAC 4LL4B 2I81A 2YJHA 2HXKA 4DSSA 1IYIA 1M0UA 1GSFA 2V1MA 4F9ZA 2L4QA 3CSJA 1U3IA 1SK1A 1ILOA 2IMDA 2NVLA 4LMWA 1A23A 2O87A 2B3SA 2CX3A 2H73A 2K8VA 3TKSC 4K2DA 4XS4B 1JLWA 1PSQA 2PVOC 2R3XA 2GQKA 3NZNA 4EF0A 3KXOA 2AJQB 1A0RP 3C8EA 3P2AA 2PUKC 2WDUA 3D22A 3HJOA 2F8AA 1B48A 2IMIA 1T7PB 4IQ1A 5F8BA 5IO0A 2X8HA 3AY8A 3UVHA 4E8HA 4X0XA 2B5XA 5LCZA 5FWGA 5JCWA 1YF1A 4FYCA 4J2FA 1VGLA 1SKSB 2CAIA 3ED3A 1R4WA 1Z9HA 1QGVA 1V57A 5CAXA 2DIZA 1SD9A 3FRCA 5A4WA 4QL7A 4J57E 5ECMB 4EE0A 1SL2B 1UVZA 4MP4A 2I9HA 1T3BA 5D9XA 5ECNB 1THOA 4HQSA 2KUCA 5AN1A 3TRQA 3MSZA 5B8AA 4KNDA 4GQCA 1CQGA 3IV4A 2CQ9A 1EZKA 3H8QA 1O85A 1GSSA 2CZ3A 3GKNA 1G0TA 3GKKA 4FYUA 3F8UA 4TN8A 2BJXA 1THXA 3QOUA 3ZYWA 2YWOA 2PGTA 1KEBA 3C1RA 1FVJA 4IJIA 4MPFA 3LGCA 8GSSA 3GFKA 3BCKA 1TKDB 5IMAA 3G7IA 5AIXA 4RQRA 3W6GA 1QMVA 3I9V2 2VM1A 2ZNMA 5IOWA 4TR4A 14GSA 6GSYA 1ERWA 2H6YA 4G9HA 5J9BA 1AQWA 5AISA 1RK4A 3RDWA 4IP1A 3IBHA 1GUHA 5C00A 4PUAA 4ZILA 3TKRA 5EPFA 3EINA 2LJAA 1KNGA 3O76A 5G1LA 3TJBA 4LLRA 4KCAA 2L4CA 3VLNA 1O6JA 1PX6A 5HR2A 1ERUA 2DJJA 4OD7A 4IKHA 4KE3A 4QL9A 4HU7A 2B1LA 1PKWA 1AQXA 3HJPA 3VURA 4F2IA 1PX7A 4EKZA 5KEJA 3QPMA 4KCEA 2L5OA 1PKZA 2H72A 4ZBAA 2VIMA 3GMFA 1A2MA 5IQYA 5CRWA 2XBQA 2MZCA 5ECHB 4XS4A 3TGZA 3NIVA 2MYGA 2LTKA 4TOPA 1FVKA 2NPBA 1TRWA 5J3RA 2AV4A 4V1Ap 1M2AA 5D96A 4Q5RA 1Z7RA 3HKRA 4BWSA 4WF4A 1TI3A 1EOHA 2WJUA 2JADA 2B5YA 2G0FA 5CRGA 1PA3A 3ME7A 4BL7A 5DQYA 3PH9A 3UAPA 1FB0A 3LFLA 4BVXA 3APSA 4MF7A 1TK5B 5B6NA 9GSSA 2FWHA 5G2ZA 4CDOA 1F3BA 4RQXA 1WP0A 4Q5FA 3S9FA 3KP8A 1V40A 1K0MA 4XIHA 3TKSE 3WYWA 3W8JA 5A4UA 4OMVA 2NDOA 1HD2A 2J9HA 1M9AA 1ZMAA 3LWAA 5CRDA 3DIEA 4ML6A 1BEDA 3EYTA 2WRTA 4POMA 2CAQA 5H5RA 2GZPA 2R2JA 4MPGA 2EIOA 1PL1A 3E3EA 4N30A 4OCFA 3TOUA 3KD0A 3QD9A 1ZOFA 4V2LA 5LNKe 5FT3A 5L71A 3FR9A 2LNSA 5DVBA 1YKCA 4XCSA 3ZIVA 2O85A 1U3AA 3EE2A 1K0AA 4DSSB 4D73B 4L8EA 3UL3A 4POLA 1A8YA 3TJGA 7GSSA 2YJ7A 1FB6A 4XRAA 4FH8A 4CHSA 4BWQA 1RQMA 4KSMA 2R6KA 5ECOB 1SKWB 2BTOT 1E6BA 2PPTA 1F3AA 4K0NA 1A8LA 4WKWA 4I2UA 3ZREA 3TB2A 3KMNA 2REMA 2LKUA 1GSYA 3GSSA 1GLPA 1BX9A 1M9BA 1OC3A 1X5EA 2FCHA 2E2MA 1SYRA 4MABA 4IN0A 4ZB6A 2DIYA 1TU7A 2V6OA 1MDKA 1XZOA 1GH2A 4ML1A 3FKFA 3F6DA 3KH7A 3L78A 4YQVA 5ECQB 2DJ2A 2HE3A 2N5BA 2R5GA 2CVKA 3VFIA 1ZYEA 2A2RA 4PUFC 2V2GA 1EGRA 4OO5A 2LSTA 17GSA 5JCGA 1BAYA 3Q74A 4TRXA 1UN2A 4TR0A 1BQ7A 2JZRA 4K1FA 4TR3A 3IRAA 1WE0A 3IE3A 1OC9B 2B7JA 2PWJA 4E8EA 4KB3A 4MJAA 1F6MC 4JE1A 4JEDA 1FW1A 4ZL9A 3QAWA 3IPZA 2PU9C 2ALBA 1R7HA 2H74A 1ZZYA 5IO2A 2YP6A 1OAZA 2N5AA 3TJJA 1Z5YE 2H0HA 3APOA 1R5PA 1BG5A 2K8SA 4ULXA 1O7UA 2CVBA 3VK9A 1V2AA 2FWEA 3FK8A 3QAGA 1XW6A 4JR6A 4F03A 4O7HA 3VI5A 2C3QA 3M8NA 2CVDA 1OE8A 4ECBA 1MDJA 3US3A 1JZRA 2HYXA 3F4SA 4EUYA 4NV5A 2K9FA 3GIXA 1U88A 1HQOA 3IR4A 2IMFA 3UIWA 1YF0A 2VCWA 4OFTA 3CYNA 1YEXA 1SYXA 2CZ2A 1G7OA 4GWRA 2D2ZA 2DLXA 4G10A 2M80A 22GSA 5CO3A 3CXGA 5GZZB
chains in the Genus database with same CATH superfamily
3M9JA 2N5FA 2YV9A 4I2TA 2FD3A 5GAND 2E7PA 1USBA 5B8BA 3P7XA 3GSTA 4KH7A 2X8GA 4IBPA 3GURA 2L6DA 2B7KA 2GGTA 2IFQB 5COHA 1TOFA 3L9VA 1WOUA 1OKDA 1Z6MA 3VI7A 2HZFA 3Q18A 4EIQA 1TI1A 4BPYA 1GULA 5HR1A 2HSHA 3BBYA 1XW9A 2F8FA 3HVXA 1ACVA 1Z6NA 3WD6A 4I8BA 4ZL7A 4D73A 4AGSA 2RM6A 4FO5A 2M46A 4Q5QA 4ID0A 4OFMA 4V1Ag 2B6MA 3U6VA 4MZCA 1I9DA 4LL1B 4IGJA 3MNGA 4WETA 4PNGA 1JZWA 2IN3A 2LQQA 2QA1A 4O92A 1XOAA 6GSXA 5GSSA 1K0CA 1V9WA 3DYRA 1X9SB 2JU5A 3HDCA 4Z2TA 1BJXA 2HRNA 3FZ5A 2L5LA 2WCIA 4HEA2 4K9ZA 2VCVA 3L9UA 4NMUA 2HRFA 4KF9A 3TKQA 4J56E 1T4ZA 4MLYA 5DJMA 3HVSA 3IK9A 3RHCA 3HHVA 2X49A 4EIPA 4BA7A 3TDGA 4AF2A 2VCXA 3SBCA 1ABAA 3CRTA 2GT5A 2R0GA 3VWWA 4MF5A 3ZL5A 2L57A 1WJKA 4XS6A 1TJDA 2GT6A 3QCPA 3K8NA 3A2XA 3EMXA 4HOJA 3O3TA 4AJ7A 1MEKA 4MK3A 2AB6A 1OC9A 2K6VA 4MA9A 1ZYQB 4KUNA 5EL8A 2WULA 2AHEA 3BD2A 4BVYB 2A2PA 1QFNA 1GNEA 3F6FA 2R37A 3GNJA 5CREA 5JWQB 3TRXA 2IIYA 4I97A 2C0DA 1TXXA 1X9WB 1E2YA 5IM9A 1K0OA 4EO3A 2JZTA 2GQLA 2EIRA 4NV2A 2MMZA 3GX8A 3H1NA 1FOVA 2GVPA 4TXVA 2VCQA 5IMZA 2AUVA 3LQ7A 5D93A 2RLIA 2IMKA 2HRKA 4EXJA 5A5KA 4Q5NA 1F2EA 3J7Yb 20GSA 3FZ9A 3GYKA 3H93A 4PX1A 2YCDA 5HR0A 4G0KA 1WMJA 4H86A 2HLSA 1T00A 2ON7A 3E0UA 3DVXA 2C1YA 4Z2UA 4NXIA 3ISOA 2H66A 4HZ4A 1NHYA 3TJFA 3CTGA 4N11A 2H6XA 3U5RE 4WR4A 1S3AA 2FA8A 1DBYA 2HNLA 4KX4A 3N5OA 4KA0A 1EOGA 3FEUA 1W4VA 2VL2A 2IFQA 2VO4A 4G2EA 2CX4A 4PQ1A 3PR8A 1O8WA 2AAWA 4GLTA 1PD21 2JACA 5J9CA 5EVOA 4K5RA 3EVIA 2YANA 3GN3A 4DSQA 4HSCX 2VCZA 1O8XA 3KIJA 5ABRA 5DBQA 1LJRA 3CBUA 3M1GA 1YDKA 3Q19A 4K6XA 1X9MB 3R2QA 1AW9A 1AAZA 2GTUA 1GTIA 3F4TA 13GSA 3IK7A 3TKSA 3FHKA 3MWHA 2NTOA 1EV9A 3RAZA 5HFKA 3UVTA 1XPVA 3R3EA 3HYPA 1QXHA 3EPTA 4PQIA 3TOTA 2Z9SA 2BMXA 3D6IA 3FZ4A 2H1BA 3G9BA 4ZBBA 1ZL9A 3FW2A 5D9WA 4MH2A 5CYYA 3ZMKA 5LD0A 1K0NA 2VD0A 4OO4A 2CV4A 1MDIA 1ERVA 3QAVA 3LORA 5AIVA 4HZ2A 3M0FA 4KDYA 4GSSA 5AGYA 4Z7XA 5ID2A 1WWJA 2PBJA 1XVWA 2H70A 3HZ4A 2PMTA 5G5EA 3N9JA 4EDYA 1TK8B 2QGVA 4IVFA 6GSVA 4EL1A 5ENUA 1T1VA 2XPEA 2C3TA 1XVQA 3UARA 4TR1B 1G6WA 3DD3A 4BVYA 3EWLA 1JFUA 1GL8A 3QMXA 2DC5A 2FWGA 4ILFA 1DUGA 2XBIA 3GKXA 5KN3A 2OBIA 3TRPA 2YOIA 2C8UA 3ZVJA 2L6CA 4KGIA 4LMVA 4EDZA 3BJ5A 5DQSA 2HSYA 3HA9A 3ERGA 1O81A 1GUKA 2X64A 4IQAA 4MF6A 1M3IA 5IOXA 2LJRA 2HFDA 1K3YA 3HVVA 2AYTA 4FYBA 2QC7A 3KGKA 2KP2A 4TVEA 2FHEA 1TDIA 2XPDA 3MYDA 2QKEA 1QUWA 3LYKA 4JRRA 3D4MA 5IMFA 2FA4A 4HDEA 5F07A 3WGEA 4OCEA 3LXTA 3PPUA 2YWMA 1URMA 2KP1A 4N0ZA 4PURA 1A2JA 10GSA 4NHZA 3LG6A 5DALA 3I6AA 2R4VA 2VL9A 4AJ6A 5JWOB 4KDXA 5F0GA 4POBA 1SJIA 1WPIA 3HVNA 2EC4A 5ECRB 2J23A 1GTAA 5DJLA 1GP1A 2X99A 1ST9A 1CQHA 4XHMA 2ZUPA 1VRSD 2O89A 4F82A 5C04A 4GTUA 3SWLA 4YAVA 1JHBA 1O73A 5G1KA 1QK8A 1XWGA 2H30A 2YNXA 3RHBA 2YN1A 3UBLA 1EP7A 1B4QA 3HJMA 3ZVJD 3ZZXA 1ERTA 5J4UA 4GSNA 2R0PA 2IWTA 2C3NA 3ZFLA 5ELAA 4I5QA 1M2DA 3L9SA 2ZCTA 5IPGA 2GLRA 4HUAA 1B4PA 4O5RA 4XS1A 2YZUA 4YQMA 2QSIA 3DEXA 3EU4A 5KN1A 3KM6A 2FWFA 4POKA 4HI7A 3C73A 5JCUA 1TK0B 1PQNA 1W89A 2PVQA 2X8CA 3MAKA 1OC8A 1SKRB 4YH2A 1SENA 4PGTA 1M2BA 3IC8A 2C80A 2VLTA 3P8WA 3FYGA 2DMLA 6GSTA 3E9JB 2GZZA 4ZXGA 1TP9A 1F9MA 4CY8A 1EGOA 2TRCP 2LQOA 4K2XA 2DMMA 3F3RA 3GV1A 4EVMA 3D4TA 2HZEB 4JR4A 1SL0B 3F3QA 4TR1A 3ZLPA 2JZSA 11GSA 2L59A 3H79A 2RUFA 3F9UA 1J08A 1A2LA 2H75A 1HNBA 4NPBA 3ERFA 1X0RA 2VLVA 3NOFA 2H1GA 1XWCA 1LU4A 1Y6EA 5KN0A 5HR3A 4LA1A 1K0BA 3DGQA 2K18A 3OR5A 1YJ6A 2C4JA 1Q98A 3BOAA 5J5NA 4ZB9A 2FNOA 1PN9A 1NM3A 2VM2A 1HNAA 3Q6OA 5IPHA 2FUG2 2GDRA 1XCCA 2RM5A 2ES7A 3O6TA 4K7IA 1YKAA 1Z7PA 2O7KA 3HXSA 2DJ1A 2H76A 1JLVA 1G6YA 1FOHA 2A2SA 3HY2A 1S3DA 3A2WA 2WFCA 2R0CA 19GSA 2IJYA 3QFBC 4ZBDA 4HQZA 4DVCA 1NHOA 4RI7A 4TW5A 2QA2A 5CNWA 5IIZA 2IMEA 3DXBA 5ECSA 1UA5A 2LNTA 1GUMA 1B9YC 2O8VB 1IYHA 3D5JA 3PGTA 1DSBA 1WRYA 4GSTA 2E0QA 4K7NA 4IW9A 1SJ6A 1MTCA 1KBNA 5H5QA 4MNNA 2YV7A 5ID2B 4PTSA 4MJBA 1KTEA 3KMOA 1A24A 5G30A 1XWAA 1XW5A 2LJKA 4V2MA 2A4VA 2LEGA 3W8SA 1X5CA 3A3TA 3D0ZA 1U6TA 3FY7A 3KTLA 4IS0A 2CT6A 3DWVA 1HYUA 1JZDA 3KCMA 2WZ9A 5CRHA 2MMOA 1TU8A 4P3YB 3VWVA 1PMTA 1K3OA 4GF0A 1G7EA 5D9TA 2A4HA 1XXUA 3FZAA 1XWKA 2H6ZA 1LBKA 1JZOA 5EY6A 2GS3A 3ME8A 2MBSA 2H1AA 2HSMA 2TRXA 1SJZA 5F06A 5F05A 4KAEA 4IJ3A 4MH3A 5G5FA 5E59A 4OFNA 2OE1A 2HI7A 2B5EA 3G7YA 2V41A 4ZIJA 4TKYA 2C0GA 3FR6A 1K0DA 2V6KA 2FLSA 1SD8A 4G19A 5JWRB 1B8XA 4HJMA 2H19A 3VPQA 1V98A 3V1WA 2DKHA 1EV4A 2OA7A 1H4OA 2H1DA 4EC0A 1GTBA 2YZHA 4GRFA 3VPTA 3WGDA 3WGXA 4DSRA 2NBSA 2P31A 5DDLA 6GSSA 3DVWA 2FY6A 3QR6A 16GSA 2V32A 2ON5A 3KP9A 1UC7A 4ZL8A 3ZIJA 1B9XC 1S3RA 3HZ8A 4L5OA 3GUSA 2H71A 1VF1A 2HZEA 1T8EB 1M99A 4TXOB 5INYA 4ISDA 3CRUA 4WR5A 5DALB 3TKPA 3DMLA 5ELGA 3ZTLA 1C72A 4L5LA 3G7JA 3IOSA 1S3CA 4IELA 6GSUA 2VL3A 2KOKA 5IMVA 3PINA 4GXZA 1N2AA 1SK2A 3DRNA 2TIRA 2LV3A 1J9BA 2F3MA 2LS5A 1PL2A 3GTUB 5D73A 1GNWA 2HT9A 1ML6A 4NWYA 2MMAA 1NSWA 3ZRDA 3IXRA 1PFOA 2JSYA 5KN2A 1AC1A 1XOBA 4NHWA 2DBCA 5FHIA 1YZXA 2IL3A 5H5SA 3J7Yk 1N8JA 3GH6A 2WGRA 4V2NA 4DEJA 2EIQA 3F4RA 1EP8A 4JU5A 3TUEA 3A5WA 4MZWA 1XWBA 5J41A 1GSDA 3H4KA 5DAKB 3M9KA 1YQ1A 2F51A 2OADA 4O32A 2LUSA 5IMDA 1TRSA 1M7TA 4K7OA 3A2VA 4ECJA 3GX0A 2H0GA 1SL1B 2P5RA 3WT1A 1XIYA 3UMAA 2B1KA 3C71A 4IP6A 5KOWA 3GKMA 1TRUA 1FHEA 3LSZA 4F0CA 3UJ1A 3P90A 1OVNA 4RI6A 1AIUA 4WBRD 3WT2A 1MD4A 4ACSA 2VCTA 1SU9A 5E4WA 3A5IA 1Q4JA 3DKSA 4FIWA 3VWUA 1TTZA 4XRDA 4G0LA 2PERA 4YQUA 4JZQA 3JCML 2DJ0A 3EC3A 3IA1A 1X5DA 3GL3A 2FGXA 2OE0A 1YY7A 4NAXA 2H8LA 1PRXA 3MDKA 1HNCA 5KOXA 3KJYA 4X43A 4ECIA 2WS2A 4WEYA 4ECCA 1AXDA 3I43A 3ZMLA 3GHAA 1J0FA 4MCUA 4N0VA 1XFLA 3I69A 1AQVA 2DSAA 4I6XA 2GSRA 3HCZA 4MMMA 3F0IA 1R26A 1V58A 2P5QA 4K0GA 1H75A 2DJKA 1RW1A 5ECIB 5ECPB 3LXZA 4JBBA 1GSEA 1MD3A 4OWYA 2X4AA 2JL4A 1BYEA 2LRTA 2YPMA 3IHQA 4MZBA 4PQHA 3APQA 3EU3A 1YEPA 3KEBA 2OACA 5B6MA 2GSSA 5ECLB 3UBKA 4TXOA 3TCOA 1FO5A 1NW2A 1F37A 1QQ2A 1T4YA 4K8MA 3QDNA 1GWCA 18GSA 2PN8A 4MJEA 4RUVA 2OKAA 3KH9A 3EMPA 2C0EA 5HQPA 4WBJA 4PXOA 1TRVA 2IPAA 1ZYPA 3RPPA 2KHPA 5HFIA 1EWXA 1ON4A 1ZYNA 3M3MA 5BRTA 2F9SA 3RPNA 4CW9A 1GLQA 3CSIA 3GRXA 5ECKB 2LRNA 2E2GA 4YKFA 4AJ8A 3D21A 6GSWA 1GRXA 4GQFA 4XTSA 2C0FA 4WXTA 3GTUA 3TJKA 5IMCA 3UOMA 3VWXA 1ZCPA 2GSTA 4KSOA 4L0WA 5DCGA 4YAPA 5CP1A 1R5AA 4ZB8A 2JSZA 3RBTA 3CSHA 4GCIA 4O5UA 2GQMA 2H0IA 5D9VA 3IC4A 3LEFA 2OBKA 4KDUA 1GSUA 2XHFA 2GZYA 3LJRA 4IHUA 3BCIA 1VF2A 5B7CA 2OJLA 1VF3A 1OYJA 2XC2A 1OE7A 2WB9A 3IDVA 5A4VA 4HS1A 1FG4A 1XBSA 1OKTA 3IAS2 1EEJA 2I4AA 5DAKA 1GSQA 2KLXA 4QQ7A 3ERWA 2VUPA 2P0GA 3UEMA 1PGTA 3MIXA 3IAM2 3ZFBA 2I3YA 2VOCA 1XG8A 3C7MA 5HFGA 4X1UA 2RIIA 2DJ3A 1DE1A 1FAAA 2I1UA 4WF5A 3KTBA 4FQUA 3EURA 1PN0A 1U87A 4L0UA 1VF4A 4HU9A 3CMIA 1K3LA 1ZGNA 3F63A 4KW6A 1TW9A 2VAFA 2YWIA 2VD1A 3FR3A 3HD5A 3GH9A 2GSQA 4PNFA 3C1SA 3KZQA 5G31A 3GA4A 3GL5A 5GSTA 3L0HA 1DE2A 4MDCA 1AUCA 1GTUA 1Y25A 2LRCA 1Z3EA 4X4JA 1WIKA 1EEMA 2VLUA 4HJ2A 1SK0A 2YWNA 2M72A 2MBTA 2G2QA 2RUEA 4N10A 3LYPA 1A0FA 4G0IA 1I5GA 2OE3A 5D8IA 2CA8A 2VL2C 12GSA 3L4NA 4MJCA 5DCHA 3ZITA 4F0BA 2H01A 2MMNA 5GAPD 3CTFA 3QFAC 4LL4B 2I81A 2YJHA 2HXKA 4DSSA 1IYIA 1M0UA 1GSFA 2V1MA 4F9ZA 2L4QA 3CSJA 1U3IA 1SK1A 1ILOA 2IMDA 2NVLA 4LMWA 1A23A 2O87A 2B3SA 2CX3A 2H73A 2K8VA 3TKSC 4K2DA 4XS4B 1JLWA 1PSQA 2PVOC 2R3XA 2GQKA 3NZNA 4EF0A 3KXOA 2AJQB 1A0RP 3C8EA 3P2AA 2PUKC 2WDUA 3D22A 3HJOA 2F8AA 4BL7B 1B48A 2IMIA 1T7PB 4IQ1A 5F8BA 5IO0A 2X8HA 3AY8A 3UVHA 4E8HA 4BVXB 4X0XA 2B5XA 5LCZA 5FWGA 5JCWA 1YF1A 4FYCA 4J2FA 1VGLA 3FMWA 1SKSB 2CAIA 3ED3A 1R4WA 1Z9HA 1QGVA 1V57A 5CAXA 2DIZA 1SD9A 3FRCA 5A4WA 4QL7A 4J57E 5ECMB 4EE0A 1SL2B 1UVZA 4MP4A 2I9HA 1T3BA 5D9XA 5ECNB 1THOA 4HQSA 2KUCA 5AN1A 3TRQA 3MSZA 5B8AA 4KNDA 4GQCA 1CQGA 3IV4A 2CQ9A 1EZKA 3H8QA 1O85A 1GSSA 2CZ3A 3GKNA 1G0TA 3GKKA 4FYUA 3F8UA 4TN8A 2BJXA 1THXA 3QOUA 3ZYWA 2YWOA 2PGTA 1KEBA 3C1RA 1FVJA 4IJIA 4MPFA 3LGCA 8GSSA 3GFKA 3BCKA 1TKDB 5IMAA 3G7IA 5AIXA 4RQRA 3W6GA 1QMVA 3I9V2 2VM1A 2ZNMA 5IOWA 4TR4A 14GSA 3LW9A 6GSYA 1ERWA 4USSA 2H6YA 4G9HA 5J9BA 1AQWA 5AISA 1RK4A 3RDWA 4IP1A 3IBHA 1GUHA 4O5QA 5C00A 4PUAA 4ZILA 3TKRA 5EPFA 3EINA 2LJAA 1KNGA 3O76A 5G1LA 3TJBA 4LLRA 4KCAA 2L4CA 3VLNA 1O6JA 1PX6A 5HR2A 1ERUA 2DJJA 4K5SA 4OD7A 4IKHA 4KE3A 4QL9A 4HU7A 2B1LA 1PKWA 1AQXA 3HJPA 3VURA 4F2IA 1PX7A 4EKZA 4CY6A 5KEJA 3QPMA 4KCEA 2L5OA 1PKZA 2H72A 4ZBAA 2VIMA 3GMFA 1A2MA 5IQYA 2DKIA 5CRWA 2XBQA 2MZCA 5ECHB 4XS4A 3TGZA 3NIVA 2MYGA 2LTKA 4TOPA 1FVKA 2NPBA 1TRWA 5J3RA 2AV4A 4V1Ap 1M2AA 5D96A 4Q5RA 1Z7RA 3HKRA 4BWSA 4YKGA 4WF4A 1TI3A 1EOHA 2WJUA 2JADA 2B5YA 2G0FA 5CRGA 1PA3A 3ME7A 4BL7A 5DQYA 3PH9A 3UAPA 1FB0A 3LFLA 4BVXA 3APSA 4MF7A 1TK5B 5B6NA 9GSSA 2FWHA 5G2ZA 4CDOA 1F3BA 4RQXA 1WP0A 4Q5FA 3S9FA 3KP8A 1V40A 1K0MA 4XIHA 3TKSE 3WYWA 3W8JA 5A4UA 4OMVA 2NDOA 1HD2A 2J9HA 1M9AA 1ZMAA 3LWAA 5CRDA 3DIEA 4ML6A 2HRAA 1BEDA 3EYTA 2WRTA 4POMA 2CAQA 5H5RA 2GZPA 2R2JA 4MPGA 2EIOA 1PL1A 3E3EA 4N30A 4OCFA 3TOUA 3KD0A 3QD9A 1ZOFA 4V2LA 5LNKe 5FT3A 5L71A 3FR9A 2LNSA 5DVBA 1YKCA 4XCSA 3ZIVA 2O85A 1U3AA 3EE2A 1K0AA 4DSSB 4D73B 4L8EA 3UL3A 4POLA 1A8YA 3TJGA 5BMUA 7GSSA 2YJ7A 1FB6A 4XRAA 4FH8A 4CHSA 4BWQA 1RQMA 4KSMA 2R6KA 5ECOB 1SKWB 2BTOT 1E6BA 2PPTA 1F3AA 4K0NA 1A8LA 4WKWA 4ICYA 4I2UA 3ZREA 3TB2A 3KMNA 2REMA 2LKUA 1GSYA 3GSSA 1GLPA 1BX9A 1M9BA 1OC3A 1X5EA 2FCHA 2E2MA 1SYRA 4MABA 4IN0A 4ZB6A 2DIYA 1TU7A 2V6OA 1MDKA 1XZOA 1GH2A 4ML1A 3FKFA 3F6DA 3KH7A 3L78A 4YQVA 5ECQB 2DJ2A 4BIKA 2HE3A 4A5PA 2N5BA 2R5GA 2CVKA 3VFIA 1ZYEA 2A2RA 3IHGA 4PUFC 2V2GA 2UZ8A 4Z2RA 1EGRA 4OO5A 2LSTA 17GSA 5JCGA 1BAYA 3CQFA 3Q74A 4TRXA 1UN2A 4TR0A 1BQ7A 2JZRA 4K1FA 4TR3A 3IRAA 1WE0A 1M3JA 3IE3A 1OC9B 2B7JA 2PWJA 4E8EA 4KB3A 4MJAA 1F6MC 4JE1A 4JEDA 1FW1A 4ZL9A 3QAWA 3IPZA 2PU9C 2ALBA 1R7HA 2H74A 1ZZYA 5IO2A 2YP6A 1OAZA 2N5AA 3TJJA 1Z5YE 2H0HA 3APOA 1R5PA 1BG5A 2K8SA 4ULXA 1O7UA 2CVBA 3VK9A 1V2AA 2FWEA 3FK8A 3QAGA 1XW6A 4JR6A 4F03A 4O7HA 3VI5A 2C3QA 3M8NA 2CVDA 1OE8A 4ECBA 1MDJA 3US3A 1JZRA 2HYXA 3F4SA 4EUYA 4NV5A 2K9FA 3GIXA 1U88A 1HQOA 3IR4A 2IMFA 3UIWA 1YF0A 2VCWA 4OFTA 3CYNA 1YEXA 1SYXA 2CZ2A 1G7OA 4GWRA 2D2ZA 2DLXA 4G10A 2M80A 22GSA 5CO3A 3CXGA 5GZZB
chains in the Genus database with same CATH topology
3M9JA 2N5FA 2YV9A 4I2TA 2FD3A 5GAND 2E7PA 1USBA 5B8BA 3P7XA 3GSTA 4KH7A 2X8GA 4IBPA 3GURA 2L6DA 2B7KA 2GGTA 2IFQB 5COHA 1TOFA 3L9VA 1WOUA 1OKDA 1Z6MA 3VI7A 2HZFA 3Q18A 4EIQA 1TI1A 4BPYA 1GULA 5HR1A 2HSHA 3BBYA 1XW9A 2F8FA 3HVXA 1ACVA 1Z6NA 3WD6A 4I8BA 4ZL7A 4D73A 4AGSA 2RM6A 4FO5A 2M46A 4Q5QA 4ID0A 4OFMA 4V1Ag 2B6MA 3U6VA 4MZCA 1I9DA 4LL1B 4IGJA 3MNGA 4WETA 4PNGA 1JZWA 2IN3A 2LQQA 2QA1A 4O92A 1XOAA 6GSXA 5GSSA 1K0CA 1V9WA 3DYRA 1X9SB 2JU5A 3HDCA 4Z2TA 1BJXA 2HRNA 3FZ5A 2L5LA 2WCIA 4HEA2 4K9ZA 2VCVA 3L9UA 4NMUA 2HRFA 4KF9A 3TKQA 4J56E 1T4ZA 4MLYA 5DJMA 3HVSA 3IK9A 3RHCA 3HHVA 2X49A 4EIPA 4BA7A 3TDGA 4AF2A 2VCXA 3SBCA 1ABAA 3CRTA 2GT5A 2R0GA 3VWWA 4MF5A 3ZL5A 2L57A 1WJKA 4XS6A 1TJDA 2GT6A 3QCPA 3K8NA 3A2XA 3EMXA 4HOJA 3O3TA 4AJ7A 1MEKA 4MK3A 2AB6A 1OC9A 2K6VA 4MA9A 1ZYQB 4KUNA 5EL8A 2WULA 2AHEA 3BD2A 4BVYB 2A2PA 1QFNA 1GNEA 3F6FA 2R37A 3GNJA 5CREA 5JWQB 3TRXA 2IIYA 4I97A 2C0DA 1TXXA 1X9WB 1E2YA 5IM9A 1K0OA 4EO3A 2JZTA 2GQLA 2EIRA 4NV2A 2MMZA 3GX8A 3H1NA 1FOVA 2GVPA 4TXVA 2VCQA 5IMZA 2AUVA 3LQ7A 5D93A 2RLIA 2IMKA 2HRKA 4EXJA 5A5KA 4Q5NA 1F2EA 3J7Yb 20GSA 3FZ9A 3GYKA 3H93A 4PX1A 2YCDA 5HR0A 4G0KA 1WMJA 4H86A 2HLSA 1T00A 2ON7A 3E0UA 3DVXA 2C1YA 4Z2UA 4NXIA 3ISOA 2H66A 4HZ4A 1NHYA 3TJFA 3CTGA 4N11A 2H6XA 3U5RE 4WR4A 1S3AA 2FA8A 1DBYA 2HNLA 4KX4A 3N5OA 4KA0A 1EOGA 3FEUA 1W4VA 2VL2A 2IFQA 2VO4A 4G2EA 2CX4A 4PQ1A 3PR8A 1O8WA 2AAWA 4GLTA 1PD21 2JACA 5J9CA 5EVOA 4K5RA 3EVIA 2YANA 3GN3A 4DSQA 2VCZA 1O8XA 3KIJA 5ABRA 5DBQA 1LJRA 3CBUA 3M1GA 1YDKA 3Q19A 4K6XA 1X9MB 3R2QA 1AW9A 1AAZA 2GTUA 1GTIA 3F4TA 13GSA 3IK7A 3TKSA 3FHKA 3MWHA 2NTOA 1EV9A 3RAZA 5HFKA 3UVTA 1XPVA 3R3EA 3HYPA 1QXHA 3EPTA 4PQIA 3TOTA 2Z9SA 2BMXA 3D6IA 3FZ4A 2H1BA 3G9BA 4ZBBA 1ZL9A 3FW2A 5D9WA 4MH2A 5CYYA 3ZMKA 5LD0A 1K0NA 2VD0A 4OO4A 2CV4A 1MDIA 1ERVA 3QAVA 3LORA 5AIVA 4HZ2A 3M0FA 4KDYA 4GSSA 5AGYA 4Z7XA 5ID2A 1WWJA 2PBJA 1XVWA 2H70A 3HZ4A 2PMTA 5G5EA 3N9JA 4EDYA 1TK8B 2QGVA 4IVFA 6GSVA 4EL1A 5ENUA 1T1VA 2XPEA 2C3TA 1XVQA 3UARA 4TR1B 1G6WA 3DD3A 4BVYA 3EWLA 1JFUA 1GL8A 3QMXA 2DC5A 2FWGA 4ILFA 1DUGA 2XBIA 3GKXA 5KN3A 2OBIA 3TRPA 2YOIA 2C8UA 3ZVJA 2L6CA 4KGIA 4LMVA 4EDZA 3BJ5A 5DQSA 2HSYA 3HA9A 3ERGA 1O81A 1GUKA 2X64A 4IQAA 4MF6A 5IOXA 2LJRA 2HFDA 1K3YA 3HVVA 2AYTA 4FYBA 2QC7A 3KGKA 2KP2A 4TVEA 2FHEA 1TDIA 2XPDA 3MYDA 2QKEA 1QUWA 3LYKA 4JRRA 3D4MA 5IMFA 2FA4A 4HDEA 5F07A 3WGEA 4OCEA 3LXTA 3PPUA 2YWMA 1URMA 2KP1A 4N0ZA 4PURA 1A2JA 10GSA 4NHZA 3LG6A 5DALA 3I6AA 2R4VA 2VL9A 4AJ6A 5JWOB 4KDXA 5F0GA 4POBA 1SJIA 1WPIA 2EC4A 5ECRB 2J23A 1GTAA 5DJLA 1GP1A 2X99A 1ST9A 1CQHA 4XHMA 2ZUPA 1VRSD 2O89A 4F82A 5C04A 4GTUA 3SWLA 4YAVA 1JHBA 1O73A 5G1KA 1QK8A 1XWGA 2H30A 2YNXA 3RHBA 2YN1A 3UBLA 1EP7A 1B4QA 3HJMA 3ZVJD 3ZZXA 1ERTA 5J4UA 4GSNA 2R0PA 2IWTA 2C3NA 3ZFLA 5ELAA 4I5QA 1M2DA 3L9SA 2ZCTA 5IPGA 2GLRA 4HUAA 1B4PA 4O5RA 4XS1A 2YZUA 4YQMA 2QSIA 3DEXA 3EU4A 5KN1A 3KM6A 2FWFA 4POKA 4HI7A 3C73A 5JCUA 1TK0B 1PQNA 1W89A 2PVQA 2X8CA 3MAKA 1OC8A 1SKRB 4YH2A 1SENA 4PGTA 1M2BA 3IC8A 2C80A 2VLTA 3P8WA 3FYGA 2DMLA 6GSTA 3E9JB 2GZZA 4ZXGA 1TP9A 1F9MA 4CY8A 1EGOA 2TRCP 2LQOA 4K2XA 2DMMA 3F3RA 3GV1A 4EVMA 3D4TA 2HZEB 4JR4A 1SL0B 3F3QA 4TR1A 3ZLPA 2JZSA 11GSA 2L59A 3H79A 2RUFA 3F9UA 1J08A 1A2LA 2H75A 1HNBA 4NPBA 3ERFA 1X0RA 2VLVA 3NOFA 2H1GA 1XWCA 1LU4A 1Y6EA 5KN0A 5HR3A 4LA1A 1K0BA 3DGQA 2K18A 3OR5A 1YJ6A 2C4JA 1Q98A 3BOAA 5J5NA 4ZB9A 2FNOA 1PN9A 1NM3A 2VM2A 1HNAA 3Q6OA 5IPHA 2FUG2 2GDRA 1XCCA 2RM5A 2ES7A 3O6TA 4K7IA 1YKAA 1Z7PA 2O7KA 3HXSA 2DJ1A 2H76A 1JLVA 1G6YA 1FOHA 2A2SA 3HY2A 1S3DA 3A2WA 2WFCA 2R0CA 19GSA 2IJYA 3QFBC 4ZBDA 4HQZA 4DVCA 1NHOA 4RI7A 4TW5A 2QA2A 5CNWA 5IIZA 2IMEA 3DXBA 5ECSA 1UA5A 2LNTA 1GUMA 1B9YC 2O8VB 1IYHA 3D5JA 3PGTA 1DSBA 1WRYA 4GSTA 2E0QA 4K7NA 4IW9A 1SJ6A 1MTCA 1KBNA 5H5QA 4MNNA 2YV7A 5ID2B 4PTSA 4MJBA 1KTEA 3KMOA 1A24A 5G30A 1XWAA 1XW5A 2LJKA 4V2MA 2A4VA 2LEGA 3W8SA 1X5CA 3A3TA 3D0ZA 1U6TA 3FY7A 3KTLA 4IS0A 2CT6A 3DWVA 1HYUA 1JZDA 3KCMA 2WZ9A 5CRHA 2MMOA 1TU8A 4P3YB 3VWVA 1PMTA 1K3OA 4GF0A 1G7EA 5D9TA 2A4HA 1XXUA 3FZAA 1XWKA 2H6ZA 1LBKA 1JZOA 5EY6A 2GS3A 3ME8A 2MBSA 2H1AA 2HSMA 2TRXA 1SJZA 5F06A 5F05A 4KAEA 4IJ3A 4MH3A 5G5FA 5E59A 4OFNA 2OE1A 2HI7A 2B5EA 3G7YA 2V41A 4ZIJA 4TKYA 2C0GA 3FR6A 1K0DA 2V6KA 2FLSA 1SD8A 4G19A 5JWRB 1B8XA 4HJMA 2H19A 3VPQA 1V98A 3V1WA 2DKHA 1EV4A 2OA7A 1H4OA 2H1DA 4EC0A 1GTBA 2YZHA 4GRFA 3VPTA 3WGDA 3WGXA 4DSRA 2NBSA 2P31A 5DDLA 6GSSA 3DVWA 2FY6A 3QR6A 16GSA 2V32A 2ON5A 3KP9A 1UC7A 4ZL8A 3ZIJA 1B9XC 3HZ8A 4L5OA 3GUSA 2H71A 1VF1A 2HZEA 1T8EB 1M99A 4TXOB 5INYA 4ISDA 3CRUA 4WR5A 5DALB 3TKPA 3DMLA 5ELGA 3ZTLA 1C72A 4L5LA 3G7JA 3IOSA 1S3CA 4IELA 6GSUA 2VL3A 2KOKA 5IMVA 3PINA 4GXZA 1N2AA 1SK2A 3DRNA 2TIRA 2LV3A 1J9BA 2F3MA 2LS5A 1PL2A 3GTUB 5D73A 1GNWA 2HT9A 1ML6A 4NWYA 2MMAA 1NSWA 3ZRDA 3IXRA 2JSYA 5KN2A 1AC1A 1XOBA 4NHWA 2DBCA 5FHIA 1YZXA 2IL3A 5H5SA 3J7Yk 1N8JA 3GH6A 2WGRA 4V2NA 4DEJA 2EIQA 3F4RA 1EP8A 4JU5A 3TUEA 3A5WA 4MZWA 1XWBA 5J41A 1GSDA 3H4KA 5DAKB 3M9KA 1YQ1A 2F51A 2OADA 4O32A 2LUSA 5IMDA 1TRSA 1M7TA 4K7OA 3A2VA 4ECJA 3GX0A 2H0GA 1SL1B 2P5RA 3WT1A 1XIYA 3UMAA 2B1KA 3C71A 4IP6A 5KOWA 3GKMA 1TRUA 1FHEA 3LSZA 4F0CA 3UJ1A 3P90A 1OVNA 4RI6A 1AIUA 4WBRD 3WT2A 1MD4A 4ACSA 2VCTA 1SU9A 5E4WA 3A5IA 1Q4JA 3DKSA 4FIWA 3VWUA 1TTZA 4XRDA 4G0LA 2PERA 4YQUA 4JZQA 3JCML 2DJ0A 3EC3A 3IA1A 1X5DA 3GL3A 2FGXA 2OE0A 1YY7A 4NAXA 2H8LA 1PRXA 3MDKA 1HNCA 5KOXA 3KJYA 4X43A 4ECIA 2WS2A 4WEYA 4ECCA 1AXDA 3I43A 3ZMLA 3GHAA 1J0FA 4MCUA 4N0VA 1XFLA 3I69A 1AQVA 2DSAA 4I6XA 2GSRA 3HCZA 4MMMA 3F0IA 1R26A 1V58A 2P5QA 4K0GA 1H75A 2DJKA 1RW1A 5ECIB 5ECPB 3LXZA 4JBBA 1GSEA 1MD3A 4OWYA 2X4AA 2JL4A 1BYEA 2LRTA 2YPMA 3IHQA 4MZBA 4PQHA 3APQA 3EU3A 1YEPA 3KEBA 2OACA 5B6MA 2GSSA 5ECLB 3UBKA 4TXOA 3TCOA 1FO5A 1NW2A 1F37A 1QQ2A 1T4YA 4K8MA 3QDNA 1GWCA 18GSA 2PN8A 4MJEA 4RUVA 2OKAA 3KH9A 3EMPA 2C0EA 5HQPA 4WBJA 4PXOA 1TRVA 2IPAA 1ZYPA 3RPPA 2KHPA 5HFIA 1EWXA 1ON4A 1ZYNA 3M3MA 5BRTA 2F9SA 3RPNA 4CW9A 1GLQA 3CSIA 3GRXA 5ECKB 2LRNA 2E2GA 4YKFA 4AJ8A 3D21A 6GSWA 1GRXA 4GQFA 4XTSA 2C0FA 4WXTA 3GTUA 3TJKA 5IMCA 3UOMA 3VWXA 1ZCPA 2GSTA 4KSOA 4L0WA 5DCGA 4YAPA 5CP1A 1R5AA 4ZB8A 2JSZA 3RBTA 3CSHA 4GCIA 4O5UA 2GQMA 2H0IA 5D9VA 3IC4A 3LEFA 2OBKA 4KDUA 1GSUA 2XHFA 2GZYA 3LJRA 4IHUA 3BCIA 1VF2A 5B7CA 2OJLA 1VF3A 1OYJA 2XC2A 1OE7A 2WB9A 3IDVA 5A4VA 4HS1A 1FG4A 1XBSA 1OKTA 3IAS2 1EEJA 2I4AA 5DAKA 1GSQA 2KLXA 4QQ7A 3ERWA 2VUPA 2P0GA 3UEMA 1PGTA 3MIXA 3IAM2 3ZFBA 2I3YA 2VOCA 3C7MA 5HFGA 4X1UA 2RIIA 2DJ3A 1DE1A 1FAAA 2I1UA 4WF5A 3KTBA 4FQUA 3EURA 1PN0A 1U87A 4L0UA 1VF4A 4HU9A 3CMIA 1K3LA 1ZGNA 3F63A 4KW6A 1TW9A 2VAFA 2YWIA 2VD1A 3FR3A 3HD5A 3GH9A 2GSQA 4PNFA 3C1SA 3KZQA 5G31A 3GA4A 3GL5A 5GSTA 3L0HA 1DE2A 4MDCA 1AUCA 1GTUA 1Y25A 2LRCA 1Z3EA 4X4JA 1WIKA 1EEMA 2VLUA 4HJ2A 1SK0A 2YWNA 2M72A 2MBTA 2G2QA 2RUEA 4N10A 3LYPA 1A0FA 4G0IA 1I5GA 2OE3A 5D8IA 2CA8A 2VL2C 12GSA 3L4NA 4MJCA 5DCHA 3ZITA 4F0BA 2H01A 2MMNA 5GAPD 3CTFA 3QFAC 4LL4B 2I81A 2YJHA 2HXKA 4DSSA 1IYIA 1M0UA 1GSFA 2V1MA 4F9ZA 2L4QA 3CSJA 1U3IA 1SK1A 1ILOA 2IMDA 2NVLA 4LMWA 1A23A 2O87A 2B3SA 2CX3A 2H73A 2K8VA 3TKSC 4K2DA 4XS4B 1JLWA 1PSQA 2PVOC 2R3XA 2GQKA 3NZNA 4EF0A 3KXOA 2AJQB 1A0RP 3C8EA 3P2AA 2PUKC 2WDUA 3D22A 3HJOA 2F8AA 4BL7B 1B48A 2IMIA 1T7PB 4IQ1A 5F8BA 5IO0A 2X8HA 3AY8A 3UVHA 4E8HA 4BVXB 4X0XA 2B5XA 5LCZA 5FWGA 5JCWA 1YF1A 4FYCA 4J2FA 1VGLA 3FMWA 1SKSB 2CAIA 3ED3A 1R4WA 1Z9HA 1QGVA 1V57A 5CAXA 2DIZA 1SD9A 3FRCA 5A4WA 4QL7A 4J57E 5ECMB 4EE0A 1SL2B 1UVZA 4MP4A 2I9HA 1T3BA 5D9XA 5ECNB 1THOA 4HQSA 2KUCA 5AN1A 3TRQA 3MSZA 5B8AA 4KNDA 4GQCA 1CQGA 3IV4A 2CQ9A 1EZKA 3H8QA 1O85A 1GSSA 2CZ3A 3GKNA 1G0TA 3GKKA 4FYUA 3F8UA 4TN8A 2BJXA 1THXA 3QOUA 3ZYWA 2YWOA 2PGTA 1KEBA 3C1RA 1FVJA 4IJIA 4MPFA 3LGCA 8GSSA 3GFKA 3BCKA 1TKDB 5IMAA 3G7IA 5AIXA 4RQRA 3W6GA 1QMVA 3I9V2 2VM1A 2ZNMA 5IOWA 4TR4A 14GSA 3LW9A 6GSYA 1ERWA 4USSA 2H6YA 4G9HA 5J9BA 1AQWA 5AISA 1RK4A 3RDWA 4IP1A 3IBHA 1GUHA 4O5QA 5C00A 4PUAA 4ZILA 3TKRA 5EPFA 3EINA 2LJAA 1KNGA 3O76A 5G1LA 3TJBA 4LLRA 4KCAA 2L4CA 3VLNA 1O6JA 1PX6A 5HR2A 1ERUA 2DJJA 4K5SA 4OD7A 4IKHA 4KE3A 4QL9A 4HU7A 2B1LA 1PKWA 1AQXA 3HJPA 3VURA 4F2IA 1PX7A 4EKZA 4CY6A 5KEJA 3QPMA 4KCEA 2L5OA 1PKZA 2H72A 4ZBAA 2VIMA 3GMFA 1A2MA 5IQYA 2DKIA 5CRWA 2XBQA 2MZCA 5ECHB 4XS4A 3TGZA 3NIVA 2MYGA 2LTKA 4TOPA 1FVKA 2NPBA 1TRWA 5J3RA 2AV4A 4V1Ap 1M2AA 5D96A 4Q5RA 1Z7RA 3HKRA 4BWSA 4YKGA 4WF4A 1TI3A 1EOHA 2WJUA 2JADA 2B5YA 2G0FA 5CRGA 1PA3A 3ME7A 4BL7A 5DQYA 3PH9A 3UAPA 1FB0A 3LFLA 4BVXA 3APSA 4MF7A 1TK5B 5B6NA 9GSSA 2FWHA 5G2ZA 4CDOA 1F3BA 4RQXA 1WP0A 4Q5FA 3S9FA 3KP8A 1V40A 1K0MA 4XIHA 3TKSE 3WYWA 3W8JA 5A4UA 4OMVA 2NDOA 1HD2A 2J9HA 1M9AA 1ZMAA 3LWAA 5CRDA 3DIEA 4ML6A 2HRAA 1BEDA 3EYTA 2WRTA 4POMA 2CAQA 5H5RA 2GZPA 2R2JA 4MPGA 2EIOA 1PL1A 3E3EA 4N30A 4OCFA 3TOUA 3KD0A 3QD9A 1ZOFA 4V2LA 5LNKe 5FT3A 5L71A 3FR9A 2LNSA 5DVBA 1YKCA 4XCSA 3ZIVA 2O85A 1U3AA 3EE2A 1K0AA 4DSSB 4D73B 4L8EA 3UL3A 4POLA 1A8YA 3TJGA 5BMUA 7GSSA 2YJ7A 1FB6A 4XRAA 4FH8A 4CHSA 4BWQA 1RQMA 4KSMA 2R6KA 5ECOB 1SKWB 2BTOT 1E6BA 2PPTA 1F3AA 4K0NA 1A8LA 4WKWA 4ICYA 4I2UA 3ZREA 3TB2A 3KMNA 2REMA 2LKUA 1GSYA 3GSSA 1GLPA 1BX9A 1M9BA 1OC3A 1X5EA 2FCHA 2E2MA 1SYRA 4MABA 4IN0A 4ZB6A 2DIYA 1TU7A 2V6OA 1MDKA 1XZOA 1GH2A 4ML1A 3FKFA 3F6DA 3KH7A 3L78A 4YQVA 5ECQB 2DJ2A 2HE3A 4A5PA 2N5BA 2R5GA 2CVKA 3VFIA 1ZYEA 2A2RA 3IHGA 4PUFC 2V2GA 2UZ8A 4Z2RA 1EGRA 4OO5A 2LSTA 17GSA 5JCGA 1BAYA 3Q74A 4TRXA 1UN2A 4TR0A 1BQ7A 2JZRA 4K1FA 4TR3A 3IRAA 1WE0A 3IE3A 1OC9B 2B7JA 2PWJA 4E8EA 4KB3A 4MJAA 1F6MC 4JE1A 4JEDA 1FW1A 4ZL9A 3QAWA 3IPZA 2PU9C 2ALBA 1R7HA 2H74A 1ZZYA 5IO2A 2YP6A 1OAZA 2N5AA 3TJJA 1Z5YE 2H0HA 3APOA 1R5PA 1BG5A 2K8SA 4ULXA 1O7UA 2CVBA 3VK9A 1V2AA 2FWEA 3FK8A 3QAGA 1XW6A 4JR6A 4F03A 4O7HA 3VI5A 2C3QA 3M8NA 2CVDA 1OE8A 4ECBA 1MDJA 3US3A 1JZRA 2HYXA 3F4SA 4EUYA 4NV5A 2K9FA 3GIXA 1U88A 1HQOA 3IR4A 2IMFA 3UIWA 1YF0A 2VCWA 4OFTA 3CYNA 1YEXA 1SYXA 2CZ2A 1G7OA 4GWRA 2D2ZA 2DLXA 4G10A 2M80A 22GSA 5CO3A 3CXGA 5GZZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9J A;  2N5F A;  2YV9 A;  4I2T A;  2FD3 A;  5GAN D;  2E7P A;  1USB A;  5B8B A;  3P7X A;  3GST A;  4KH7 A;  2X8G A;  4IBP A;  3GUR A;  2L6D A;  2B7K A;  2GGT A;  2IFQ B;  5COH A;  1TOF A;  3L9V A;  1WOU A;  1OKD A;  1Z6M A;  3VI7 A;  2HZF A;  3Q18 A;  1TI1 A;  4BPY A;  1GUL A;  5HR1 A;  2HSH A;  3BBY A;  1XW9 A;  2F8F A;  3HVX A;  1ACV A;  1Z6N A;  3WD6 A;  4I8B A;  4ZL7 A;  4D73 A;  4AGS A;  2RM6 A;  4FO5 A;  2M46 A;  4Q5Q A;  4ID0 A;  4OFM A;  4V1A g;  2B6M A;  3U6V A;  4MZC A;  1I9D A;  4LL1 B;  4IGJ A;  3MNG A;  4WET A;  4PNG A;  1JZW A;  2IN3 A;  2LQQ A;  4O92 A;  1XOA A;  6GSX A;  5GSS A;  1K0C A;  1V9W A;  3DYR A;  1X9S B;  2JU5 A;  3HDC A;  1BJX A;  2HRN A;  3FZ5 A;  2L5L A;  2WCI A;  4HEA 2;  4K9Z A;  2VCV A;  3L9U A;  4NMU A;  2HRF A;  3TKQ A;  4J56 E;  1T4Z A;  4MLY A;  5DJM A;  3HVS A;  3IK9 A;  3RHC A;  3HHV A;  4BA7 A;  3TDG A;  4AF2 A;  2VCX A;  3SBC A;  1ABA A;  3CRT A;  2GT5 A;  3VWW A;  4MF5 A;  3ZL5 A;  2L57 A;  1WJK A;  4XS6 A;  1TJD A;  2GT6 A;  3QCP A;  3K8N A;  3A2X A;  3EMX A;  4HOJ A;  3O3T A;  4AJ7 A;  1MEK A;  4MK3 A;  2AB6 A;  1OC9 A;  2K6V A;  4MA9 A;  1ZYQ B;  4KUN A;  5EL8 A;  2WUL A;  2AHE A;  3BD2 A;  1QFN A;  1GNE A;  3F6F A;  2R37 A;  3GNJ A;  5CRE A;  5JWQ B;  3TRX A;  2IIY A;  4I97 A;  2C0D A;  1TXX A;  1X9W B;  1E2Y A;  5IM9 A;  1K0O A;  4EO3 A;  2JZT A;  2GQL A;  2EIR A;  4NV2 A;  2MMZ A;  3GX8 A;  3H1N A;  1FOV A;  2GVP A;  4TXV A;  2VCQ A;  5IMZ A;  2AUV A;  3LQ7 A;  5D93 A;  2RLI A;  2IMK A;  4EXJ A;  5A5K A;  4Q5N A;  1F2E A;  3J7Y b;  20GS A;  3FZ9 A;  3GYK A;  3H93 A;  4PX1 A;  2YCD A;  5HR0 A;  1WMJ A;  4H86 A;  2HLS A;  1T00 A;  2ON7 A;  3E0U A;  3DVX A;  2C1Y A;  4NXI A;  3ISO A;  2H66 A;  4HZ4 A;  1NHY A;  3TJF A;  3CTG A;  4N11 A;  2H6X A;  3U5R E;  4WR4 A;  1S3A A;  2FA8 A;  1DBY A;  2HNL A;  4KX4 A;  3N5O A;  4KA0 A;  1EOG A;  3FEU A;  1W4V A;  2VL2 A;  2IFQ A;  2VO4 A;  4G2E A;  2CX4 A;  4PQ1 A;  3PR8 A;  1O8W A;  2AAW A;  4GLT A;  1PD2 1;  2JAC A;  5J9C A;  5EVO A;  3EVI A;  2YAN A;  3GN3 A;  4DSQ A;  2VCZ A;  1O8X A;  3KIJ A;  5ABR A;  5DBQ A;  1LJR A;  3CBU A;  3M1G A;  1YDK A;  3Q19 A;  4K6X A;  1X9M B;  3R2Q A;  1AW9 A;  1AAZ A;  2GTU A;  1GTI A;  3F4T A;  13GS A;  3IK7 A;  3TKS A;  3FHK A;  3MWH A;  2NTO A;  1EV9 A;  3RAZ A;  5HFK A;  3UVT A;  1XPV A;  3HYP A;  1QXH A;  4PQI A;  3TOT A;  2Z9S A;  2BMX A;  3D6I A;  3FZ4 A;  2H1B A;  3G9B A;  4ZBB A;  1ZL9 A;  5D9W A;  3FW2 A;  4MH2 A;  5CYY A;  3ZMK A;  5LD0 A;  1K0N A;  2VD0 A;  4OO4 A;  2CV4 A;  1MDI A;  1ERV A;  3QAV A;  3LOR A;  5AIV A;  4HZ2 A;  3M0F A;  4KDY A;  4GSS A;  5AGY A;  4Z7X A;  5ID2 A;  1WWJ A;  2PBJ A;  1XVW A;  2H70 A;  3HZ4 A;  2PMT A;  5G5E A;  3N9J A;  4EDY A;  1TK8 B;  2QGV A;  4IVF A;  6GSV A;  4EL1 A;  5ENU A;  1T1V A;  2XPE A;  2C3T A;  1XVQ A;  3UAR A;  4TR1 B;  1G6W A;  3DD3 A;  4BVY A;  3EWL A;  1JFU A;  1GL8 A;  3QMX A;  2DC5 A;  2FWG A;  4ILF A;  1DUG A;  2XBI A;  3GKX A;  5KN3 A;  2OBI A;  3TRP A;  2YOI A;  2C8U A;  3ZVJ A;  2L6C A;  4KGI A;  4LMV A;  4EDZ A;  3BJ5 A;  5DQS A;  2HSY A;  3HA9 A;  3ERG A;  1O81 A;  1GUK A;  2X64 A;  4IQA A;  4MF6 A;  5IOX A;  2LJR A;  2HFD A;  1K3Y A;  3HVV A;  2AYT A;  4FYB A;  2QC7 A;  3KGK A;  2KP2 A;  4TVE A;  2FHE A;  1TDI A;  2XPD A;  2QKE A;  1QUW A;  3LYK A;  4JRR A;  3D4M A;  5IMF A;  2FA4 A;  4HDE A;  5F07 A;  3WGE A;  4OCE A;  3LXT A;  2YWM A;  1URM A;  2KP1 A;  4N0Z A;  4PUR A;  1A2J A;  10GS A;  4NHZ A;  3LG6 A;  5DAL A;  3I6A A;  2R4V A;  2VL9 A;  4AJ6 A;  5JWO B;  4KDX A;  5F0G A;  4POB A;  1SJI A;  1WPI A;  2EC4 A;  5ECR B;  2J23 A;  1GTA A;  5DJL A;  1GP1 A;  2X99 A;  1ST9 A;  1CQH A;  4XHM A;  2ZUP A;  1VRS D;  2O89 A;  4F82 A;  5C04 A;  4GTU A;  3SWL A;  4YAV A;  1JHB A;  1O73 A;  5G1K A;  1QK8 A;  1XWG A;  2H30 A;  2YNX A;  3RHB A;  2YN1 A;  3UBL A;  1EP7 A;  1B4Q A;  3HJM A;  3ZVJ D;  3ZZX A;  1ERT A;  5J4U A;  4GSN A;  2IWT A;  2C3N A;  3ZFL A;  5ELA A;  4I5Q A;  1M2D A;  3L9S A;  2ZCT A;  5IPG A;  2GLR A;  4HUA A;  1B4P A;  4O5R A;  4XS1 A;  2YZU A;  4YQM A;  2QSI A;  3DEX A;  3EU4 A;  5KN1 A;  3KM6 A;  2FWF A;  4POK A;  4HI7 A;  3C73 A;  5JCU A;  1TK0 B;  1PQN A;  1W89 A;  2PVQ A;  2X8C A;  3MAK A;  1OC8 A;  1SKR B;  4YH2 A;  1SEN A;  4PGT A;  1M2B A;  2C80 A;  2VLT A;  3P8W A;  3FYG A;  2DML A;  6GST A;  3E9J B;  2GZZ A;  4ZXG A;  1TP9 A;  1F9M A;  1EGO A;  2TRC P;  2LQO A;  2DMM A;  3F3R A;  3GV1 A;  4EVM A;  3D4T A;  2HZE B;  4JR4 A;  1SL0 B;  3F3Q A;  4TR1 A;  3ZLP A;  2JZS A;  11GS A;  2L59 A;  3H79 A;  2RUF A;  3F9U A;  1J08 A;  1A2L A;  2H75 A;  1HNB A;  4NPB A;  3ERF A;  1X0R A;  2VLV A;  3NOF A;  2H1G A;  1XWC A;  1LU4 A;  1Y6E A;  5KN0 A;  5HR3 A;  4LA1 A;  1K0B A;  3DGQ A;  2K18 A;  3OR5 A;  1YJ6 A;  2C4J A;  1Q98 A;  3BOA A;  5J5N A;  4ZB9 A;  2FNO A;  1PN9 A;  1NM3 A;  2VM2 A;  1HNA A;  3Q6O A;  5IPH A;  2FUG 2;  2GDR A;  1XCC A;  2RM5 A;  2ES7 A;  3O6T A;  4K7I A;  1YKA A;  1Z7P A;  2O7K A;  3HXS A;  2DJ1 A;  2H76 A;  1JLV A;  1G6Y A;  3HY2 A;  2A2S A;  1S3D A;  3A2W A;  2WFC A;  19GS A;  2IJY A;  3QFB C;  4ZBD A;  4HQZ A;  4DVC A;  1NHO A;  4RI7 A;  4TW5 A;  5CNW A;  5IIZ A;  2IME A;  3DXB A;  5ECS A;  1UA5 A;  2LNT A;  1GUM A;  1B9Y C;  2O8V B;  1IYH A;  3D5J A;  3PGT A;  1DSB A;  1WRY A;  4GST A;  2E0Q A;  4K7N A;  4IW9 A;  1SJ6 A;  1MTC A;  1KBN A;  5H5Q A;  2YV7 A;  5ID2 B;  4MJB A;  1KTE A;  3KMO A;  1A24 A;  5G30 A;  1XWA A;  1XW5 A;  2LJK A;  4V2M A;  2A4V A;  2LEG A;  3W8S A;  1X5C A;  3A3T A;  3D0Z A;  1U6T A;  3FY7 A;  3KTL A;  4IS0 A;  2CT6 A;  3DWV A;  1HYU A;  1JZD A;  3KCM A;  2WZ9 A;  5CRH A;  2MMO A;  1TU8 A;  4P3Y B;  3VWV A;  1PMT A;  1K3O A;  4GF0 A;  1G7E A;  5D9T A;  1XXU A;  3FZA A;  1XWK A;  2H6Z A;  1LBK A;  1JZO A;  5EY6 A;  2GS3 A;  3ME8 A;  2MBS A;  2H1A A;  2TRX A;  1SJZ A;  5F06 A;  5F05 A;  4KAE A;  4IJ3 A;  4MH3 A;  5G5F A;  5E59 A;  4OFN A;  2OE1 A;  2HI7 A;  2B5E A;  3G7Y A;  2V41 A;  4ZIJ A;  4TKY A;  2C0G A;  3FR6 A;  1K0D A;  2V6K A;  2FLS A;  1SD8 A;  4G19 A;  5JWR B;  1B8X A;  4HJM A;  2H19 A;  3VPQ A;  1V98 A;  3V1W A;  1EV4 A;  2OA7 A;  1H4O A;  2H1D A;  4EC0 A;  1GTB A;  2YZH A;  4GRF A;  3VPT A;  3WGD A;  3WGX A;  4DSR A;  2NBS A;  2P31 A;  5DDL A;  6GSS A;  3DVW A;  2FY6 A;  3QR6 A;  16GS A;  2V32 A;  2ON5 A;  3KP9 A;  1UC7 A;  4ZL8 A;  3ZIJ A;  1B9X C;  3HZ8 A;  4L5O A;  3GUS A;  2H71 A;  1VF1 A;  2HZE A;  1T8E B;  1M99 A;  4TXO B;  5INY A;  4ISD A;  3CRU A;  4WR5 A;  5DAL B;  3TKP A;  3DML A;  5ELG A;  3ZTL A;  1C72 A;  4L5L A;  3G7J A;  3IOS A;  1S3C A;  4IEL A;  6GSU A;  2VL3 A;  2KOK A;  5IMV A;  3PIN A;  4GXZ A;  1N2A A;  1SK2 A;  3DRN A;  2TIR A;  2LV3 A;  1J9B A;  2F3M A;  2LS5 A;  1PL2 A;  3GTU B;  5D73 A;  1GNW A;  2HT9 A;  1ML6 A;  4NWY A;  2MMA A;  1NSW A;  3ZRD A;  3IXR A;  2JSY A;  5KN2 A;  1AC1 A;  1XOB A;  4NHW A;  2DBC A;  5FHI A;  1YZX A;  2IL3 A;  5H5S A;  3J7Y k;  1N8J A;  3GH6 A;  2WGR A;  4V2N A;  4DEJ A;  2EIQ A;  3F4R A;  1EP8 A;  4JU5 A;  3TUE A;  3A5W A;  4MZW A;  1XWB A;  5J41 A;  1GSD A;  3H4K A;  5DAK B;  3M9K A;  1YQ1 A;  2F51 A;  2OAD A;  4O32 A;  2LUS A;  5IMD A;  1TRS A;  1M7T A;  4K7O A;  3A2V A;  4ECJ A;  3GX0 A;  2H0G A;  1SL1 B;  2P5R A;  3WT1 A;  1XIY A;  3UMA A;  2B1K A;  3C71 A;  4IP6 A;  3GKM A;  1TRU A;  1FHE A;  3LSZ A;  4F0C A;  3UJ1 A;  3P90 A;  1OVN A;  4RI6 A;  1AIU A;  4WBR D;  3WT2 A;  1MD4 A;  4ACS A;  2VCT A;  1SU9 A;  5E4W A;  1Q4J A;  3DKS A;  4FIW A;  3VWU A;  1TTZ A;  4XRD A;  3JCM L;  2PER A;  4YQU A;  4JZQ A;  2DJ0 A;  3EC3 A;  3IA1 A;  1X5D A;  3GL3 A;  2FGX A;  2OE0 A;  1YY7 A;  4NAX A;  2H8L A;  1PRX A;  3MDK A;  1HNC A;  3KJY A;  4X43 A;  4ECI A;  2WS2 A;  4WEY A;  4ECC A;  1AXD A;  3I43 A;  3ZML A;  3GHA A;  1J0F A;  4MCU A;  4N0V A;  1XFL A;  3I69 A;  1AQV A;  2DSA A;  4I6X A;  2GSR A;  3HCZ A;  4MMM A;  3F0I A;  1R26 A;  1V58 A;  2P5Q A;  4K0G A;  1H75 A;  2DJK A;  1RW1 A;  5ECI B;  5ECP B;  3LXZ A;  4JBB A;  1GSE A;  1MD3 A;  4OWY A;  2JL4 A;  1BYE A;  2LRT A;  2YPM A;  3IHQ A;  4MZB A;  4PQH A;  3APQ A;  3EU3 A;  1YEP A;  3KEB A;  2OAC A;  5B6M A;  2GSS A;  5ECL B;  3UBK A;  4TXO A;  3TCO A;  1FO5 A;  1NW2 A;  1F37 A;  1QQ2 A;  1T4Y A;  4K8M A;  3QDN A;  1GWC A;  18GS A;  2PN8 A;  4MJE A;  4RUV A;  2OKA A;  3KH9 A;  3EMP A;  2C0E A;  5HQP A;  4WBJ A;  4PXO A;  1TRV A;  2IPA A;  3RPP A;  2KHP A;  5HFI A;  1EWX A;  1ON4 A;  3M3M A;  2F9S A;  3RPN A;  4CW9 A;  1GLQ A;  3CSI A;  3GRX A;  5ECK B;  2LRN A;  2E2G A;  4AJ8 A;  3D21 A;  6GSW A;  1GRX A;  4GQF A;  4XTS A;  2C0F A;  4WXT A;  3GTU A;  3TJK A;  5IMC A;  3UOM A;  3VWX A;  1ZCP A;  2GST A;  4KSO A;  5DCG A;  4L0W A;  4YAP A;  5CP1 A;  1R5A A;  4ZB8 A;  2JSZ A;  3RBT A;  3CSH A;  4GCI A;  2GQM A;  2H0I A;  5D9V A;  3IC4 A;  3LEF A;  2OBK A;  4KDU A;  1GSU A;  2XHF A;  2GZY A;  3LJR A;  4IHU A;  3BCI A;  1VF2 A;  5B7C A;  2OJL A;  1VF3 A;  1OYJ A;  2XC2 A;  1OE7 A;  2WB9 A;  3IDV A;  5A4V A;  4HS1 A;  1FG4 A;  1XBS A;  1OKT A;  3IAS 2;  1EEJ A;  2I4A A;  5DAK A;  1GSQ A;  2KLX A;  4QQ7 A;  3ERW A;  2VUP A;  2P0G A;  3UEM A;  1PGT A;  3IAM 2;  3ZFB A;  2I3Y A;  2VOC A;  3C7M A;  5HFG A;  4X1U A;  2RII A;  2DJ3 A;  1DE1 A;  1FAA A;  2I1U A;  4WF5 A;  3KTB A;  3EUR A;  1U87 A;  4L0U A;  1VF4 A;  4HU9 A;  3CMI A;  1K3L A;  1ZGN A;  3F63 A;  4KW6 A;  1TW9 A;  2VAF A;  2YWI A;  2VD1 A;  3FR3 A;  3HD5 A;  3GH9 A;  2GSQ A;  4PNF A;  3C1S A;  3KZQ A;  5G31 A;  3GA4 A;  3GL5 A;  5GST A;  3L0H A;  1DE2 A;  4MDC A;  1AUC A;  1GTU A;  1Y25 A;  2LRC A;  1Z3E A;  1WIK A;  1EEM A;  2VLU A;  4HJ2 A;  1SK0 A;  2YWN A;  2M72 A;  2MBT A;  2G2Q A;  2RUE A;  4N10 A;  3LYP A;  1A0F A;  1I5G A;  2OE3 A;  5D8I A;  2CA8 A;  2VL2 C;  12GS A;  3L4N A;  4MJC A;  5DCH A;  3ZIT A;  4F0B A;  2H01 A;  2MMN A;  5GAP D;  3CTF A;  3QFA C;  4LL4 B;  2I81 A;  2YJH A;  2HXK A;  4DSS A;  1IYI A;  1M0U A;  1GSF A;  2V1M A;  4F9Z A;  2L4Q A;  3CSJ A;  1U3I A;  1SK1 A;  1ILO A;  2IMD A;  2NVL A;  4LMW A;  1A23 A;  2O87 A;  2B3S A;  2CX3 A;  2H73 A;  2K8V A;  3TKS C;  4K2D A;  4XS4 B;  1JLW A;  1PSQ A;  2PVO C;  2R3X A;  2GQK A;  3NZN A;  4EF0 A;  3KXO A;  2AJQ B;  1A0R P;  3C8E A;  3P2A A;  2PUK C;  2WDU A;  3D22 A;  3HJO A;  2F8A A;  1B48 A;  2IMI A;  1T7P B;  4IQ1 A;  5F8B A;  5IO0 A;  2X8H A;  3AY8 A;  3UVH A;  4E8H A;  4X0X A;  2B5X A;  5LCZ A;  5FWG A;  5JCW A;  1YF1 A;  4FYC A;  4J2F A;  1VGL A;  1SKS B;  2CAI A;  3ED3 A;  1R4W A;  1Z9H A;  1QGV A;  1V57 A;  5CAX A;  2DIZ A;  1SD9 A;  3FRC A;  5A4W A;  4QL7 A;  4J57 E;  5ECM B;  4EE0 A;  1SL2 B;  1UVZ A;  4MP4 A;  2I9H A;  1T3B A;  5D9X A;  5ECN B;  1THO A;  4HQS A;  2KUC A;  5AN1 A;  3TRQ A;  3MSZ A;  5B8A A;  4KND A;  4GQC A;  1CQG A;  3IV4 A;  2CQ9 A;  1EZK A;  3H8Q A;  1O85 A;  1GSS A;  2CZ3 A;  3GKN A;  1G0T A;  3GKK A;  4FYU A;  3F8U A;  4TN8 A;  2BJX A;  1THX A;  3QOU A;  3ZYW A;  2YWO A;  2PGT A;  1KEB A;  3C1R A;  1FVJ A;  4IJI A;  4MPF A;  3LGC A;  8GSS A;  3GFK A;  3BCK A;  1TKD B;  5IMA A;  3G7I A;  5AIX A;  4RQR A;  3W6G A;  1QMV A;  3I9V 2;  2VM1 A;  2ZNM A;  5IOW A;  4TR4 A;  14GS A;  6GSY A;  1ERW A;  2H6Y A;  4G9H A;  5J9B A;  1AQW A;  5AIS A;  1RK4 A;  3RDW A;  4IP1 A;  3IBH A;  1GUH A;  5C00 A;  4PUA A;  4ZIL A;  3TKR A;  5EPF A;  3EIN A;  2LJA A;  1KNG A;  3O76 A;  5G1L A;  3TJB A;  4LLR A;  4KCA A;  2L4C A;  3VLN A;  1O6J A;  1PX6 A;  5HR2 A;  1ERU A;  2DJJ A;  4OD7 A;  4IKH A;  4KE3 A;  4QL9 A;  4HU7 A;  2B1L A;  1PKW A;  1AQX A;  3HJP A;  3VUR A;  4F2I A;  1PX7 A;  4EKZ A;  5KEJ A;  3QPM A;  4KCE A;  2L5O A;  1PKZ A;  2H72 A;  4ZBA A;  2VIM A;  3GMF A;  1A2M A;  5IQY A;  5CRW A;  2XBQ A;  2MZC A;  5ECH B;  4XS4 A;  3TGZ A;  3NIV A;  2MYG A;  2LTK A;  4TOP A;  1FVK A;  2NPB A;  1TRW A;  5J3R A;  2AV4 A;  4V1A p;  1M2A A;  5D96 A;  4Q5R A;  1Z7R A;  3HKR A;  4BWS A;  4WF4 A;  1TI3 A;  1EOH A;  2WJU A;  2JAD A;  2B5Y A;  2G0F A;  5CRG A;  1PA3 A;  3ME7 A;  4BL7 A;  5DQY A;  3PH9 A;  3UAP A;  1FB0 A;  3LFL A;  4BVX A;  3APS A;  4MF7 A;  1TK5 B;  5B6N A;  9GSS A;  2FWH A;  5G2Z A;  4CDO A;  1F3B A;  4RQX A;  1WP0 A;  4Q5F A;  3S9F A;  3KP8 A;  1V40 A;  1K0M A;  4XIH A;  3TKS E;  3WYW A;  3W8J A;  5A4U A;  4OMV A;  2NDO A;  1HD2 A;  2J9H A;  1M9A A;  1ZMA A;  3LWA A;  5CRD A;  3DIE A;  4ML6 A;  1BED A;  3EYT A;  2WRT A;  4POM A;  2CAQ A;  5H5R A;  2GZP A;  2R2J A;  4MPG A;  2EIO A;  1PL1 A;  3E3E A;  4N30 A;  4OCF A;  3TOU A;  3KD0 A;  3QD9 A;  1ZOF A;  4V2L A;  5LNK e;  5FT3 A;  5L71 A;  3FR9 A;  2LNS A;  5DVB A;  1YKC A;  4XCS A;  3ZIV A;  2O85 A;  1U3A A;  3EE2 A;  1K0A A;  4DSS B;  4D73 B;  4L8E A;  3UL3 A;  4POL A;  1A8Y A;  3TJG A;  7GSS A;  2YJ7 A;  1FB6 A;  4XRA A;  4FH8 A;  4CHS A;  4BWQ A;  1RQM A;  4KSM A;  2R6K A;  5ECO B;  1SKW B;  2BTO T;  1E6B A;  2PPT A;  1F3A A;  4K0N A;  1A8L A;  4WKW A;  4I2U A;  3ZRE A;  3TB2 A;  3KMN A;  2REM A;  2LKU A;  1GSY A;  3GSS A;  1GLP A;  1BX9 A;  1M9B A;  1OC3 A;  1X5E A;  2FCH A;  2E2M A;  1SYR A;  4MAB A;  4IN0 A;  4ZB6 A;  2DIY A;  1TU7 A;  2V6O A;  1MDK A;  1XZO A;  1GH2 A;  4ML1 A;  3FKF A;  3F6D A;  3KH7 A;  3L78 A;  4YQV A;  5ECQ B;  2DJ2 A;  2HE3 A;  2N5B A;  2R5G A;  2CVK A;  3VFI A;  1ZYE A;  2A2R A;  4PUF C;  2V2G A;  1EGR A;  4OO5 A;  2LST A;  17GS A;  5JCG A;  1BAY A;  3Q74 A;  4TRX A;  1UN2 A;  4TR0 A;  1BQ7 A;  2JZR A;  4K1F A;  4TR3 A;  3IRA A;  1WE0 A;  3IE3 A;  1OC9 B;  2B7J A;  2PWJ A;  4E8E A;  4KB3 A;  4MJA A;  1F6M C;  4JE1 A;  4JED A;  1FW1 A;  4ZL9 A;  3QAW A;  3IPZ A;  2PU9 C;  2ALB A;  1R7H A;  2H74 A;  1ZZY A;  5IO2 A;  2YP6 A;  1OAZ A;  2N5A A;  3TJJ A;  1Z5Y E;  2H0H A;  3APO A;  1R5P A;  1BG5 A;  2K8S A;  4ULX A;  1O7U A;  2CVB A;  3VK9 A;  1V2A A;  2FWE A;  3FK8 A;  3QAG A;  1XW6 A;  4JR6 A;  4F03 A;  4O7H A;  3VI5 A;  2C3Q A;  3M8N A;  2CVD A;  1OE8 A;  4ECB A;  1MDJ A;  3US3 A;  1JZR A;  2HYX A;  3F4S A;  4EUY A;  4NV5 A;  2K9F A;  3GIX A;  1U88 A;  1HQO A;  3IR4 A;  2IMF A;  3UIW A;  1YF0 A;  2VCW A;  4OFT A;  3CYN A;  1YEX A;  1SYX A;  2CZ2 A;  1G7O A;  4GWR A;  2D2Z A;  2DLX A;  4G10 A;  2M80 A;  22GS A;  5CO3 A;  3CXG A;  5GZZ B; 
#chains in the Genus database with same CATH topology
 3M9J A;  2N5F A;  2YV9 A;  4I2T A;  2FD3 A;  5GAN D;  2E7P A;  1USB A;  5B8B A;  3P7X A;  3GST A;  4KH7 A;  2X8G A;  4IBP A;  3GUR A;  2L6D A;  2B7K A;  2GGT A;  2IFQ B;  5COH A;  1TOF A;  3L9V A;  1WOU A;  1OKD A;  1Z6M A;  3VI7 A;  2HZF A;  3Q18 A;  4EIQ A;  1TI1 A;  4BPY A;  1GUL A;  5HR1 A;  2HSH A;  3BBY A;  1XW9 A;  2F8F A;  3HVX A;  1ACV A;  1Z6N A;  3WD6 A;  4I8B A;  4ZL7 A;  4D73 A;  4AGS A;  2RM6 A;  4FO5 A;  2M46 A;  4Q5Q A;  4ID0 A;  4OFM A;  4V1A g;  2B6M A;  3U6V A;  4MZC A;  1I9D A;  4LL1 B;  4IGJ A;  3MNG A;  4WET A;  4PNG A;  1JZW A;  2IN3 A;  2LQQ A;  2QA1 A;  4O92 A;  1XOA A;  6GSX A;  5GSS A;  1K0C A;  1V9W A;  3DYR A;  1X9S B;  2JU5 A;  3HDC A;  4Z2T A;  1BJX A;  2HRN A;  3FZ5 A;  2L5L A;  2WCI A;  4HEA 2;  4K9Z A;  2VCV A;  3L9U A;  4NMU A;  2HRF A;  4KF9 A;  3TKQ A;  4J56 E;  1T4Z A;  4MLY A;  5DJM A;  3HVS A;  3IK9 A;  3RHC A;  3HHV A;  2X49 A;  4EIP A;  4BA7 A;  3TDG A;  4AF2 A;  2VCX A;  3SBC A;  1ABA A;  3CRT A;  2GT5 A;  2R0G A;  3VWW A;  4MF5 A;  3ZL5 A;  2L57 A;  1WJK A;  4XS6 A;  1TJD A;  2GT6 A;  3QCP A;  3K8N A;  3A2X A;  3EMX A;  4HOJ A;  3O3T A;  4AJ7 A;  1MEK A;  4MK3 A;  2AB6 A;  1OC9 A;  2K6V A;  4MA9 A;  1ZYQ B;  4KUN A;  5EL8 A;  2WUL A;  2AHE A;  3BD2 A;  4BVY B;  2A2P A;  1QFN A;  1GNE A;  3F6F A;  2R37 A;  3GNJ A;  5CRE A;  5JWQ B;  3TRX A;  2IIY A;  4I97 A;  2C0D A;  1TXX A;  1X9W B;  1E2Y A;  5IM9 A;  1K0O A;  4EO3 A;  2JZT A;  2GQL A;  2EIR A;  4NV2 A;  2MMZ A;  3GX8 A;  3H1N A;  1FOV A;  2GVP A;  4TXV A;  2VCQ A;  5IMZ A;  2AUV A;  3LQ7 A;  5D93 A;  2RLI A;  2IMK A;  2HRK A;  4EXJ A;  5A5K A;  4Q5N A;  1F2E A;  3J7Y b;  20GS A;  3FZ9 A;  3GYK A;  3H93 A;  4PX1 A;  2YCD A;  5HR0 A;  4G0K A;  1WMJ A;  4H86 A;  2HLS A;  1T00 A;  2ON7 A;  3E0U A;  3DVX A;  2C1Y A;  4Z2U A;  4NXI A;  3ISO A;  2H66 A;  4HZ4 A;  1NHY A;  3TJF A;  3CTG A;  4N11 A;  2H6X A;  3U5R E;  4WR4 A;  1S3A A;  2FA8 A;  1DBY A;  2HNL A;  4KX4 A;  3N5O A;  4KA0 A;  1EOG A;  3FEU A;  1W4V A;  2VL2 A;  2IFQ A;  2VO4 A;  4G2E A;  2CX4 A;  4PQ1 A;  3PR8 A;  1O8W A;  2AAW A;  4GLT A;  1PD2 1;  2JAC A;  5J9C A;  5EVO A;  4K5R A;  3EVI A;  2YAN A;  3GN3 A;  4DSQ A;  4HSC X;  2VCZ A;  1O8X A;  3KIJ A;  5ABR A;  5DBQ A;  1LJR A;  3CBU A;  3M1G A;  1YDK A;  3Q19 A;  4K6X A;  1X9M B;  3R2Q A;  1AW9 A;  1AAZ A;  2GTU A;  1GTI A;  3F4T A;  13GS A;  3IK7 A;  3TKS A;  3FHK A;  3MWH A;  2NTO A;  1EV9 A;  3RAZ A;  5HFK A;  3UVT A;  1XPV A;  3R3E A;  3HYP A;  1QXH A;  3EPT A;  4PQI A;  3TOT A;  2Z9S A;  2BMX A;  3D6I A;  3FZ4 A;  2H1B A;  3G9B A;  4ZBB A;  1ZL9 A;  3FW2 A;  5D9W A;  4MH2 A;  5CYY A;  3ZMK A;  5LD0 A;  1K0N A;  2VD0 A;  4OO4 A;  2CV4 A;  1MDI A;  1ERV A;  3QAV A;  3LOR A;  5AIV A;  4HZ2 A;  3M0F A;  4KDY A;  4GSS A;  5AGY A;  4Z7X A;  5ID2 A;  1WWJ A;  2PBJ A;  1XVW A;  2H70 A;  3HZ4 A;  2PMT A;  5G5E A;  3N9J A;  4EDY A;  1TK8 B;  2QGV A;  4IVF A;  6GSV A;  4EL1 A;  5ENU A;  1T1V A;  2XPE A;  2C3T A;  1XVQ A;  3UAR A;  4TR1 B;  1G6W A;  3DD3 A;  4BVY A;  3EWL A;  1JFU A;  1GL8 A;  3QMX A;  2DC5 A;  2FWG A;  4ILF A;  1DUG A;  2XBI A;  3GKX A;  5KN3 A;  2OBI A;  3TRP A;  2YOI A;  2C8U A;  3ZVJ A;  2L6C A;  4KGI A;  4LMV A;  4EDZ A;  3BJ5 A;  5DQS A;  2HSY A;  3HA9 A;  3ERG A;  1O81 A;  1GUK A;  2X64 A;  4IQA A;  4MF6 A;  1M3I A;  5IOX A;  2LJR A;  2HFD A;  1K3Y A;  3HVV A;  2AYT A;  4FYB A;  2QC7 A;  3KGK A;  2KP2 A;  4TVE A;  2FHE A;  1TDI A;  2XPD A;  3MYD A;  2QKE A;  1QUW A;  3LYK A;  4JRR A;  3D4M A;  5IMF A;  2FA4 A;  4HDE A;  5F07 A;  3WGE A;  4OCE A;  3LXT A;  3PPU A;  2YWM A;  1URM A;  2KP1 A;  4N0Z A;  4PUR A;  1A2J A;  10GS A;  4NHZ A;  3LG6 A;  5DAL A;  3I6A A;  2R4V A;  2VL9 A;  4AJ6 A;  5JWO B;  4KDX A;  5F0G A;  4POB A;  1SJI A;  1WPI A;  3HVN A;  2EC4 A;  5ECR B;  2J23 A;  1GTA A;  5DJL A;  1GP1 A;  2X99 A;  1ST9 A;  1CQH A;  4XHM A;  2ZUP A;  1VRS D;  2O89 A;  4F82 A;  5C04 A;  4GTU A;  3SWL A;  4YAV A;  1JHB A;  1O73 A;  5G1K A;  1QK8 A;  1XWG A;  2H30 A;  2YNX A;  3RHB A;  2YN1 A;  3UBL A;  1EP7 A;  1B4Q A;  3HJM A;  3ZVJ D;  3ZZX A;  1ERT A;  5J4U A;  4GSN A;  2R0P A;  2IWT A;  2C3N A;  3ZFL A;  5ELA A;  4I5Q A;  1M2D A;  3L9S A;  2ZCT A;  5IPG A;  2GLR A;  4HUA A;  1B4P A;  4O5R A;  4XS1 A;  2YZU A;  4YQM A;  2QSI A;  3DEX A;  3EU4 A;  5KN1 A;  3KM6 A;  2FWF A;  4POK A;  4HI7 A;  3C73 A;  5JCU A;  1TK0 B;  1PQN A;  1W89 A;  2PVQ A;  2X8C A;  3MAK A;  1OC8 A;  1SKR B;  4YH2 A;  1SEN A;  4PGT A;  1M2B A;  3IC8 A;  2C80 A;  2VLT A;  3P8W A;  3FYG A;  2DML A;  6GST A;  3E9J B;  2GZZ A;  4ZXG A;  1TP9 A;  1F9M A;  4CY8 A;  1EGO A;  2TRC P;  2LQO A;  4K2X A;  2DMM A;  3F3R A;  3GV1 A;  4EVM A;  3D4T A;  2HZE B;  4JR4 A;  1SL0 B;  3F3Q A;  4TR1 A;  3ZLP A;  2JZS A;  11GS A;  2L59 A;  3H79 A;  2RUF A;  3F9U A;  1J08 A;  1A2L A;  2H75 A;  1HNB A;  4NPB A;  3ERF A;  1X0R A;  2VLV A;  3NOF A;  2H1G A;  1XWC A;  1LU4 A;  1Y6E A;  5KN0 A;  5HR3 A;  4LA1 A;  1K0B A;  3DGQ A;  2K18 A;  3OR5 A;  1YJ6 A;  2C4J A;  1Q98 A;  3BOA A;  5J5N A;  4ZB9 A;  2FNO A;  1PN9 A;  1NM3 A;  2VM2 A;  1HNA A;  3Q6O A;  5IPH A;  2FUG 2;  2GDR A;  1XCC A;  2RM5 A;  2ES7 A;  3O6T A;  4K7I A;  1YKA A;  1Z7P A;  2O7K A;  3HXS A;  2DJ1 A;  2H76 A;  1JLV A;  1G6Y A;  1FOH A;  2A2S A;  3HY2 A;  1S3D A;  3A2W A;  2WFC A;  2R0C A;  19GS A;  2IJY A;  3QFB C;  4ZBD A;  4HQZ A;  4DVC A;  1NHO A;  4RI7 A;  4TW5 A;  2QA2 A;  5CNW A;  5IIZ A;  2IME A;  3DXB A;  5ECS A;  1UA5 A;  2LNT A;  1GUM A;  1B9Y C;  2O8V B;  1IYH A;  3D5J A;  3PGT A;  1DSB A;  1WRY A;  4GST A;  2E0Q A;  4K7N A;  4IW9 A;  1SJ6 A;  1MTC A;  1KBN A;  5H5Q A;  4MNN A;  2YV7 A;  5ID2 B;  4PTS A;  4MJB A;  1KTE A;  3KMO A;  1A24 A;  5G30 A;  1XWA A;  1XW5 A;  2LJK A;  4V2M A;  2A4V A;  2LEG A;  3W8S A;  1X5C A;  3A3T A;  3D0Z A;  1U6T A;  3FY7 A;  3KTL A;  4IS0 A;  2CT6 A;  3DWV A;  1HYU A;  1JZD A;  3KCM A;  2WZ9 A;  5CRH A;  2MMO A;  1TU8 A;  4P3Y B;  3VWV A;  1PMT A;  1K3O A;  4GF0 A;  1G7E A;  5D9T A;  2A4H A;  1XXU A;  3FZA A;  1XWK A;  2H6Z A;  1LBK A;  1JZO A;  5EY6 A;  2GS3 A;  3ME8 A;  2MBS A;  2H1A A;  2HSM A;  2TRX A;  1SJZ A;  5F06 A;  5F05 A;  4KAE A;  4IJ3 A;  4MH3 A;  5G5F A;  5E59 A;  4OFN A;  2OE1 A;  2HI7 A;  2B5E A;  3G7Y A;  2V41 A;  4ZIJ A;  4TKY A;  2C0G A;  3FR6 A;  1K0D A;  2V6K A;  2FLS A;  1SD8 A;  4G19 A;  5JWR B;  1B8X A;  4HJM A;  2H19 A;  3VPQ A;  1V98 A;  3V1W A;  2DKH A;  1EV4 A;  2OA7 A;  1H4O A;  2H1D A;  4EC0 A;  1GTB A;  2YZH A;  4GRF A;  3VPT A;  3WGD A;  3WGX A;  4DSR A;  2NBS A;  2P31 A;  5DDL A;  6GSS A;  3DVW A;  2FY6 A;  3QR6 A;  16GS A;  2V32 A;  2ON5 A;  3KP9 A;  1UC7 A;  4ZL8 A;  3ZIJ A;  1B9X C;  1S3R A;  3HZ8 A;  4L5O A;  3GUS A;  2H71 A;  1VF1 A;  2HZE A;  1T8E B;  1M99 A;  4TXO B;  5INY A;  4ISD A;  3CRU A;  4WR5 A;  5DAL B;  3TKP A;  3DML A;  5ELG A;  3ZTL A;  1C72 A;  4L5L A;  3G7J A;  3IOS A;  1S3C A;  4IEL A;  6GSU A;  2VL3 A;  2KOK A;  5IMV A;  3PIN A;  4GXZ A;  1N2A A;  1SK2 A;  3DRN A;  2TIR A;  2LV3 A;  1J9B A;  2F3M A;  2LS5 A;  1PL2 A;  3GTU B;  5D73 A;  1GNW A;  2HT9 A;  1ML6 A;  4NWY A;  2MMA A;  1NSW A;  3ZRD A;  3IXR A;  1PFO A;  2JSY A;  5KN2 A;  1AC1 A;  1XOB A;  4NHW A;  2DBC A;  5FHI A;  1YZX A;  2IL3 A;  5H5S A;  3J7Y k;  1N8J A;  3GH6 A;  2WGR A;  4V2N A;  4DEJ A;  2EIQ A;  3F4R A;  1EP8 A;  4JU5 A;  3TUE A;  3A5W A;  4MZW A;  1XWB A;  5J41 A;  1GSD A;  3H4K A;  5DAK B;  3M9K A;  1YQ1 A;  2F51 A;  2OAD A;  4O32 A;  2LUS A;  5IMD A;  1TRS A;  1M7T A;  4K7O A;  3A2V A;  4ECJ A;  3GX0 A;  2H0G A;  1SL1 B;  2P5R A;  3WT1 A;  1XIY A;  3UMA A;  2B1K A;  3C71 A;  4IP6 A;  5KOW A;  3GKM A;  1TRU A;  1FHE A;  3LSZ A;  4F0C A;  3UJ1 A;  3P90 A;  1OVN A;  4RI6 A;  1AIU A;  4WBR D;  3WT2 A;  1MD4 A;  4ACS A;  2VCT A;  1SU9 A;  5E4W A;  3A5I A;  1Q4J A;  3DKS A;  4FIW A;  3VWU A;  1TTZ A;  4XRD A;  4G0L A;  2PER A;  4YQU A;  4JZQ A;  3JCM L;  2DJ0 A;  3EC3 A;  3IA1 A;  1X5D A;  3GL3 A;  2FGX A;  2OE0 A;  1YY7 A;  4NAX A;  2H8L A;  1PRX A;  3MDK A;  1HNC A;  5KOX A;  3KJY A;  4X43 A;  4ECI A;  2WS2 A;  4WEY A;  4ECC A;  1AXD A;  3I43 A;  3ZML A;  3GHA A;  1J0F A;  4MCU A;  4N0V A;  1XFL A;  3I69 A;  1AQV A;  2DSA A;  4I6X A;  2GSR A;  3HCZ A;  4MMM A;  3F0I A;  1R26 A;  1V58 A;  2P5Q A;  4K0G A;  1H75 A;  2DJK A;  1RW1 A;  5ECI B;  5ECP B;  3LXZ A;  4JBB A;  1GSE A;  1MD3 A;  4OWY A;  2X4A A;  2JL4 A;  1BYE A;  2LRT A;  2YPM A;  3IHQ A;  4MZB A;  4PQH A;  3APQ A;  3EU3 A;  1YEP A;  3KEB A;  2OAC A;  5B6M A;  2GSS A;  5ECL B;  3UBK A;  4TXO A;  3TCO A;  1FO5 A;  1NW2 A;  1F37 A;  1QQ2 A;  1T4Y A;  4K8M A;  3QDN A;  1GWC A;  18GS A;  2PN8 A;  4MJE A;  4RUV A;  2OKA A;  3KH9 A;  3EMP A;  2C0E A;  5HQP A;  4WBJ A;  4PXO A;  1TRV A;  2IPA A;  1ZYP A;  3RPP A;  2KHP A;  5HFI A;  1EWX A;  1ON4 A;  1ZYN A;  3M3M A;  5BRT A;  2F9S A;  3RPN A;  4CW9 A;  1GLQ A;  3CSI A;  3GRX A;  5ECK B;  2LRN A;  2E2G A;  4YKF A;  4AJ8 A;  3D21 A;  6GSW A;  1GRX A;  4GQF A;  4XTS A;  2C0F A;  4WXT A;  3GTU A;  3TJK A;  5IMC A;  3UOM A;  3VWX A;  1ZCP A;  2GST A;  4KSO A;  4L0W A;  5DCG A;  4YAP A;  5CP1 A;  1R5A A;  4ZB8 A;  2JSZ A;  3RBT A;  3CSH A;  4GCI A;  4O5U A;  2GQM A;  2H0I A;  5D9V A;  3IC4 A;  3LEF A;  2OBK A;  4KDU A;  1GSU A;  2XHF A;  2GZY A;  3LJR A;  4IHU A;  3BCI A;  1VF2 A;  5B7C A;  2OJL A;  1VF3 A;  1OYJ A;  2XC2 A;  1OE7 A;  2WB9 A;  3IDV A;  5A4V A;  4HS1 A;  1FG4 A;  1XBS A;  1OKT A;  3IAS 2;  1EEJ A;  2I4A A;  5DAK A;  1GSQ A;  2KLX A;  4QQ7 A;  3ERW A;  2VUP A;  2P0G A;  3UEM A;  1PGT A;  3MIX A;  3IAM 2;  3ZFB A;  2I3Y A;  2VOC A;  1XG8 A;  3C7M A;  5HFG A;  4X1U A;  2RII A;  2DJ3 A;  1DE1 A;  1FAA A;  2I1U A;  4WF5 A;  3KTB A;  4FQU A;  3EUR A;  1PN0 A;  1U87 A;  4L0U A;  1VF4 A;  4HU9 A;  3CMI A;  1K3L A;  1ZGN A;  3F63 A;  4KW6 A;  1TW9 A;  2VAF A;  2YWI A;  2VD1 A;  3FR3 A;  3HD5 A;  3GH9 A;  2GSQ A;  4PNF A;  3C1S A;  3KZQ A;  5G31 A;  3GA4 A;  3GL5 A;  5GST A;  3L0H A;  1DE2 A;  4MDC A;  1AUC A;  1GTU A;  1Y25 A;  2LRC A;  1Z3E A;  4X4J A;  1WIK A;  1EEM A;  2VLU A;  4HJ2 A;  1SK0 A;  2YWN A;  2M72 A;  2MBT A;  2G2Q A;  2RUE A;  4N10 A;  3LYP A;  1A0F A;  4G0I A;  1I5G A;  2OE3 A;  5D8I A;  2CA8 A;  2VL2 C;  12GS A;  3L4N A;  4MJC A;  5DCH A;  3ZIT A;  4F0B A;  2H01 A;  2MMN A;  5GAP D;  3CTF A;  3QFA C;  4LL4 B;  2I81 A;  2YJH A;  2HXK A;  4DSS A;  1IYI A;  1M0U A;  1GSF A;  2V1M A;  4F9Z A;  2L4Q A;  3CSJ A;  1U3I A;  1SK1 A;  1ILO A;  2IMD A;  2NVL A;  4LMW A;  1A23 A;  2O87 A;  2B3S A;  2CX3 A;  2H73 A;  2K8V A;  3TKS C;  4K2D A;  4XS4 B;  1JLW A;  1PSQ A;  2PVO C;  2R3X A;  2GQK A;  3NZN A;  4EF0 A;  3KXO A;  2AJQ B;  1A0R P;  3C8E A;  3P2A A;  2PUK C;  2WDU A;  3D22 A;  3HJO A;  2F8A A;  4BL7 B;  1B48 A;  2IMI A;  1T7P B;  4IQ1 A;  5F8B A;  5IO0 A;  2X8H A;  3AY8 A;  3UVH A;  4E8H A;  4BVX B;  4X0X A;  2B5X A;  5LCZ A;  5FWG A;  5JCW A;  1YF1 A;  4FYC A;  4J2F A;  1VGL A;  3FMW A;  1SKS B;  2CAI A;  3ED3 A;  1R4W A;  1Z9H A;  1QGV A;  1V57 A;  5CAX A;  2DIZ A;  1SD9 A;  3FRC A;  5A4W A;  4QL7 A;  4J57 E;  5ECM B;  4EE0 A;  1SL2 B;  1UVZ A;  4MP4 A;  2I9H A;  1T3B A;  5D9X A;  5ECN B;  1THO A;  4HQS A;  2KUC A;  5AN1 A;  3TRQ A;  3MSZ A;  5B8A A;  4KND A;  4GQC A;  1CQG A;  3IV4 A;  2CQ9 A;  1EZK A;  3H8Q A;  1O85 A;  1GSS A;  2CZ3 A;  3GKN A;  1G0T A;  3GKK A;  4FYU A;  3F8U A;  4TN8 A;  2BJX A;  1THX A;  3QOU A;  3ZYW A;  2YWO A;  2PGT A;  1KEB A;  3C1R A;  1FVJ A;  4IJI A;  4MPF A;  3LGC A;  8GSS A;  3GFK A;  3BCK A;  1TKD B;  5IMA A;  3G7I A;  5AIX A;  4RQR A;  3W6G A;  1QMV A;  3I9V 2;  2VM1 A;  2ZNM A;  5IOW A;  4TR4 A;  14GS A;  3LW9 A;  6GSY A;  1ERW A;  4USS A;  2H6Y A;  4G9H A;  5J9B A;  1AQW A;  5AIS A;  1RK4 A;  3RDW A;  4IP1 A;  3IBH A;  1GUH A;  4O5Q A;  5C00 A;  4PUA A;  4ZIL A;  3TKR A;  5EPF A;  3EIN A;  2LJA A;  1KNG A;  3O76 A;  5G1L A;  3TJB A;  4LLR A;  4KCA A;  2L4C A;  3VLN A;  1O6J A;  1PX6 A;  5HR2 A;  1ERU A;  2DJJ A;  4K5S A;  4OD7 A;  4IKH A;  4KE3 A;  4QL9 A;  4HU7 A;  2B1L A;  1PKW A;  1AQX A;  3HJP A;  3VUR A;  4F2I A;  1PX7 A;  4EKZ A;  4CY6 A;  5KEJ A;  3QPM A;  4KCE A;  2L5O A;  1PKZ A;  2H72 A;  4ZBA A;  2VIM A;  3GMF A;  1A2M A;  5IQY A;  2DKI A;  5CRW A;  2XBQ A;  2MZC A;  5ECH B;  4XS4 A;  3TGZ A;  3NIV A;  2MYG A;  2LTK A;  4TOP A;  1FVK A;  2NPB A;  1TRW A;  5J3R A;  2AV4 A;  4V1A p;  1M2A A;  5D96 A;  4Q5R A;  1Z7R A;  3HKR A;  4BWS A;  4YKG A;  4WF4 A;  1TI3 A;  1EOH A;  2WJU A;  2JAD A;  2B5Y A;  2G0F A;  5CRG A;  1PA3 A;  3ME7 A;  4BL7 A;  5DQY A;  3PH9 A;  3UAP A;  1FB0 A;  3LFL A;  4BVX A;  3APS A;  4MF7 A;  1TK5 B;  5B6N A;  9GSS A;  2FWH A;  5G2Z A;  4CDO A;  1F3B A;  4RQX A;  1WP0 A;  4Q5F A;  3S9F A;  3KP8 A;  1V40 A;  1K0M A;  4XIH A;  3TKS E;  3WYW A;  3W8J A;  5A4U A;  4OMV A;  2NDO A;  1HD2 A;  2J9H A;  1M9A A;  1ZMA A;  3LWA A;  5CRD A;  3DIE A;  4ML6 A;  2HRA A;  1BED A;  3EYT A;  2WRT A;  4POM A;  2CAQ A;  5H5R A;  2GZP A;  2R2J A;  4MPG A;  2EIO A;  1PL1 A;  3E3E A;  4N30 A;  4OCF A;  3TOU A;  3KD0 A;  3QD9 A;  1ZOF A;  4V2L A;  5LNK e;  5FT3 A;  5L71 A;  3FR9 A;  2LNS A;  5DVB A;  1YKC A;  4XCS A;  3ZIV A;  2O85 A;  1U3A A;  3EE2 A;  1K0A A;  4DSS B;  4D73 B;  4L8E A;  3UL3 A;  4POL A;  1A8Y A;  3TJG A;  5BMU A;  7GSS A;  2YJ7 A;  1FB6 A;  4XRA A;  4FH8 A;  4CHS A;  4BWQ A;  1RQM A;  4KSM A;  2R6K A;  5ECO B;  1SKW B;  2BTO T;  1E6B A;  2PPT A;  1F3A A;  4K0N A;  1A8L A;  4WKW A;  4ICY A;  4I2U A;  3ZRE A;  3TB2 A;  3KMN A;  2REM A;  2LKU A;  1GSY A;  3GSS A;  1GLP A;  1BX9 A;  1M9B A;  1OC3 A;  1X5E A;  2FCH A;  2E2M A;  1SYR A;  4MAB A;  4IN0 A;  4ZB6 A;  2DIY A;  1TU7 A;  2V6O A;  1MDK A;  1XZO A;  1GH2 A;  4ML1 A;  3FKF A;  3F6D A;  3KH7 A;  3L78 A;  4YQV A;  5ECQ B;  2DJ2 A;  4BIK A;  2HE3 A;  4A5P A;  2N5B A;  2R5G A;  2CVK A;  3VFI A;  1ZYE A;  2A2R A;  3IHG A;  4PUF C;  2V2G A;  2UZ8 A;  4Z2R A;  1EGR A;  4OO5 A;  2LST A;  17GS A;  5JCG A;  1BAY A;  3CQF A;  3Q74 A;  4TRX A;  1UN2 A;  4TR0 A;  1BQ7 A;  2JZR A;  4K1F A;  4TR3 A;  3IRA A;  1WE0 A;  1M3J A;  3IE3 A;  1OC9 B;  2B7J A;  2PWJ A;  4E8E A;  4KB3 A;  4MJA A;  1F6M C;  4JE1 A;  4JED A;  1FW1 A;  4ZL9 A;  3QAW A;  3IPZ A;  2PU9 C;  2ALB A;  1R7H A;  2H74 A;  1ZZY A;  5IO2 A;  2YP6 A;  1OAZ A;  2N5A A;  3TJJ A;  1Z5Y E;  2H0H A;  3APO A;  1R5P A;  1BG5 A;  2K8S A;  4ULX A;  1O7U A;  2CVB A;  3VK9 A;  1V2A A;  2FWE A;  3FK8 A;  3QAG A;  1XW6 A;  4JR6 A;  4F03 A;  4O7H A;  3VI5 A;  2C3Q A;  3M8N A;  2CVD A;  1OE8 A;  4ECB A;  1MDJ A;  3US3 A;  1JZR A;  2HYX A;  3F4S A;  4EUY A;  4NV5 A;  2K9F A;  3GIX A;  1U88 A;  1HQO A;  3IR4 A;  2IMF A;  3UIW A;  1YF0 A;  2VCW A;  4OFT A;  3CYN A;  1YEX A;  1SYX A;  2CZ2 A;  1G7O A;  4GWR A;  2D2Z A;  2DLX A;  4G10 A;  2M80 A;  22GS A;  5CO3 A;  3CXG A;  5GZZ B; 
#chains in the Genus database with same CATH homology
 3M9J A;  2N5F A;  2YV9 A;  4I2T A;  2FD3 A;  5GAN D;  2E7P A;  1USB A;  5B8B A;  3P7X A;  3GST A;  4KH7 A;  2X8G A;  4IBP A;  3GUR A;  2L6D A;  2B7K A;  2GGT A;  2IFQ B;  5COH A;  1TOF A;  3L9V A;  1WOU A;  1OKD A;  1Z6M A;  3VI7 A;  2HZF A;  3Q18 A;  4EIQ A;  1TI1 A;  4BPY A;  1GUL A;  5HR1 A;  2HSH A;  3BBY A;  1XW9 A;  2F8F A;  3HVX A;  1ACV A;  1Z6N A;  3WD6 A;  4I8B A;  4ZL7 A;  4D73 A;  4AGS A;  2RM6 A;  4FO5 A;  2M46 A;  4Q5Q A;  4ID0 A;  4OFM A;  4V1A g;  2B6M A;  3U6V A;  4MZC A;  1I9D A;  4LL1 B;  4IGJ A;  3MNG A;  4WET A;  4PNG A;  1JZW A;  2IN3 A;  2LQQ A;  2QA1 A;  4O92 A;  1XOA A;  6GSX A;  5GSS A;  1K0C A;  1V9W A;  3DYR A;  1X9S B;  2JU5 A;  3HDC A;  4Z2T A;  1BJX A;  2HRN A;  3FZ5 A;  2L5L A;  2WCI A;  4HEA 2;  4K9Z A;  2VCV A;  3L9U A;  4NMU A;  2HRF A;  4KF9 A;  3TKQ A;  4J56 E;  1T4Z A;  4MLY A;  5DJM A;  3HVS A;  3IK9 A;  3RHC A;  3HHV A;  2X49 A;  4EIP A;  4BA7 A;  3TDG A;  4AF2 A;  2VCX A;  3SBC A;  1ABA A;  3CRT A;  2GT5 A;  2R0G A;  3VWW A;  4MF5 A;  3ZL5 A;  2L57 A;  1WJK A;  4XS6 A;  1TJD A;  2GT6 A;  3QCP A;  3K8N A;  3A2X A;  3EMX A;  4HOJ A;  3O3T A;  4AJ7 A;  1MEK A;  4MK3 A;  2AB6 A;  1OC9 A;  2K6V A;  4MA9 A;  1ZYQ B;  4KUN A;  5EL8 A;  2WUL A;  2AHE A;  3BD2 A;  4BVY B;  2A2P A;  1QFN A;  1GNE A;  3F6F A;  2R37 A;  3GNJ A;  5CRE A;  5JWQ B;  3TRX A;  2IIY A;  4I97 A;  2C0D A;  1TXX A;  1X9W B;  1E2Y A;  5IM9 A;  1K0O A;  4EO3 A;  2JZT A;  2GQL A;  2EIR A;  4NV2 A;  2MMZ A;  3GX8 A;  3H1N A;  1FOV A;  2GVP A;  4TXV A;  2VCQ A;  5IMZ A;  2AUV A;  3LQ7 A;  5D93 A;  2RLI A;  2IMK A;  2HRK A;  4EXJ A;  5A5K A;  4Q5N A;  1F2E A;  3J7Y b;  20GS A;  3FZ9 A;  3GYK A;  3H93 A;  4PX1 A;  2YCD A;  5HR0 A;  4G0K A;  1WMJ A;  4H86 A;  2HLS A;  1T00 A;  2ON7 A;  3E0U A;  3DVX A;  2C1Y A;  4Z2U A;  4NXI A;  3ISO A;  2H66 A;  4HZ4 A;  1NHY A;  3TJF A;  3CTG A;  4N11 A;  2H6X A;  3U5R E;  4WR4 A;  1S3A A;  2FA8 A;  1DBY A;  2HNL A;  4KX4 A;  3N5O A;  4KA0 A;  1EOG A;  3FEU A;  1W4V A;  2VL2 A;  2IFQ A;  2VO4 A;  4G2E A;  2CX4 A;  4PQ1 A;  3PR8 A;  1O8W A;  2AAW A;  4GLT A;  1PD2 1;  2JAC A;  5J9C A;  5EVO A;  4K5R A;  3EVI A;  2YAN A;  3GN3 A;  4DSQ A;  2VCZ A;  1O8X A;  3KIJ A;  5ABR A;  5DBQ A;  1LJR A;  3CBU A;  3M1G A;  1YDK A;  3Q19 A;  4K6X A;  1X9M B;  3R2Q A;  1AW9 A;  1AAZ A;  2GTU A;  1GTI A;  3F4T A;  13GS A;  3IK7 A;  3TKS A;  3FHK A;  3MWH A;  2NTO A;  1EV9 A;  3RAZ A;  5HFK A;  3UVT A;  1XPV A;  3R3E A;  3HYP A;  1QXH A;  3EPT A;  4PQI A;  3TOT A;  2Z9S A;  2BMX A;  3D6I A;  3FZ4 A;  2H1B A;  3G9B A;  4ZBB A;  1ZL9 A;  3FW2 A;  5D9W A;  4MH2 A;  5CYY A;  3ZMK A;  5LD0 A;  1K0N A;  2VD0 A;  4OO4 A;  2CV4 A;  1MDI A;  1ERV A;  3QAV A;  3LOR A;  5AIV A;  4HZ2 A;  3M0F A;  4KDY A;  4GSS A;  5AGY A;  4Z7X A;  5ID2 A;  1WWJ A;  2PBJ A;  1XVW A;  2H70 A;  3HZ4 A;  2PMT A;  5G5E A;  3N9J A;  4EDY A;  1TK8 B;  2QGV A;  4IVF A;  6GSV A;  4EL1 A;  5ENU A;  1T1V A;  2XPE A;  2C3T A;  1XVQ A;  3UAR A;  4TR1 B;  1G6W A;  3DD3 A;  4BVY A;  3EWL A;  1JFU A;  1GL8 A;  3QMX A;  2DC5 A;  2FWG A;  4ILF A;  1DUG A;  2XBI A;  3GKX A;  5KN3 A;  2OBI A;  3TRP A;  2YOI A;  2C8U A;  3ZVJ A;  2L6C A;  4KGI A;  4LMV A;  4EDZ A;  3BJ5 A;  5DQS A;  2HSY A;  3HA9 A;  3ERG A;  1O81 A;  1GUK A;  2X64 A;  4IQA A;  4MF6 A;  5IOX A;  2LJR A;  2HFD A;  1K3Y A;  3HVV A;  2AYT A;  4FYB A;  2QC7 A;  3KGK A;  2KP2 A;  4TVE A;  2FHE A;  1TDI A;  2XPD A;  3MYD A;  2QKE A;  1QUW A;  3LYK A;  4JRR A;  3D4M A;  5IMF A;  2FA4 A;  4HDE A;  5F07 A;  3WGE A;  4OCE A;  3LXT A;  3PPU A;  2YWM A;  1URM A;  2KP1 A;  4N0Z A;  4PUR A;  1A2J A;  10GS A;  4NHZ A;  3LG6 A;  5DAL A;  3I6A A;  2R4V A;  2VL9 A;  4AJ6 A;  5JWO B;  4KDX A;  5F0G A;  4POB A;  1SJI A;  1WPI A;  2EC4 A;  5ECR B;  2J23 A;  1GTA A;  5DJL A;  1GP1 A;  2X99 A;  1ST9 A;  1CQH A;  4XHM A;  2ZUP A;  1VRS D;  2O89 A;  4F82 A;  5C04 A;  4GTU A;  3SWL A;  4YAV A;  1JHB A;  1O73 A;  5G1K A;  1QK8 A;  1XWG A;  2H30 A;  2YNX A;  3RHB A;  2YN1 A;  3UBL A;  1EP7 A;  1B4Q A;  3HJM A;  3ZVJ D;  3ZZX A;  1ERT A;  5J4U A;  4GSN A;  2R0P A;  2IWT A;  2C3N A;  3ZFL A;  5ELA A;  4I5Q A;  1M2D A;  3L9S A;  2ZCT A;  5IPG A;  2GLR A;  4HUA A;  1B4P A;  4O5R A;  4XS1 A;  2YZU A;  4YQM A;  2QSI A;  3DEX A;  3EU4 A;  5KN1 A;  3KM6 A;  2FWF A;  4POK A;  4HI7 A;  3C73 A;  5JCU A;  1TK0 B;  1PQN A;  1W89 A;  2PVQ A;  2X8C A;  3MAK A;  1OC8 A;  1SKR B;  4YH2 A;  1SEN A;  4PGT A;  1M2B A;  3IC8 A;  2C80 A;  2VLT A;  3P8W A;  3FYG A;  2DML A;  6GST A;  3E9J B;  2GZZ A;  4ZXG A;  1TP9 A;  1F9M A;  4CY8 A;  1EGO A;  2TRC P;  2LQO A;  4K2X A;  2DMM A;  3F3R A;  3GV1 A;  4EVM A;  3D4T A;  2HZE B;  4JR4 A;  1SL0 B;  3F3Q A;  4TR1 A;  3ZLP A;  2JZS A;  11GS A;  2L59 A;  3H79 A;  2RUF A;  3F9U A;  1J08 A;  1A2L A;  2H75 A;  1HNB A;  4NPB A;  3ERF A;  1X0R A;  2VLV A;  3NOF A;  2H1G A;  1XWC A;  1LU4 A;  1Y6E A;  5KN0 A;  5HR3 A;  4LA1 A;  1K0B A;  3DGQ A;  2K18 A;  3OR5 A;  1YJ6 A;  2C4J A;  1Q98 A;  3BOA A;  5J5N A;  4ZB9 A;  2FNO A;  1PN9 A;  1NM3 A;  2VM2 A;  1HNA A;  3Q6O A;  5IPH A;  2FUG 2;  2GDR A;  1XCC A;  2RM5 A;  2ES7 A;  3O6T A;  4K7I A;  1YKA A;  1Z7P A;  2O7K A;  3HXS A;  2DJ1 A;  2H76 A;  1JLV A;  1G6Y A;  1FOH A;  2A2S A;  3HY2 A;  1S3D A;  3A2W A;  2WFC A;  2R0C A;  19GS A;  2IJY A;  3QFB C;  4ZBD A;  4HQZ A;  4DVC A;  1NHO A;  4RI7 A;  4TW5 A;  2QA2 A;  5CNW A;  5IIZ A;  2IME A;  3DXB A;  5ECS A;  1UA5 A;  2LNT A;  1GUM A;  1B9Y C;  2O8V B;  1IYH A;  3D5J A;  3PGT A;  1DSB A;  1WRY A;  4GST A;  2E0Q A;  4K7N A;  4IW9 A;  1SJ6 A;  1MTC A;  1KBN A;  5H5Q A;  4MNN A;  2YV7 A;  5ID2 B;  4PTS A;  4MJB A;  1KTE A;  3KMO A;  1A24 A;  5G30 A;  1XWA A;  1XW5 A;  2LJK A;  4V2M A;  2A4V A;  2LEG A;  3W8S A;  1X5C A;  3A3T A;  3D0Z A;  1U6T A;  3FY7 A;  3KTL A;  4IS0 A;  2CT6 A;  3DWV A;  1HYU A;  1JZD A;  3KCM A;  2WZ9 A;  5CRH A;  2MMO A;  1TU8 A;  4P3Y B;  3VWV A;  1PMT A;  1K3O A;  4GF0 A;  1G7E A;  5D9T A;  2A4H A;  1XXU A;  3FZA A;  1XWK A;  2H6Z A;  1LBK A;  1JZO A;  5EY6 A;  2GS3 A;  3ME8 A;  2MBS A;  2H1A A;  2HSM A;  2TRX A;  1SJZ A;  5F06 A;  5F05 A;  4KAE A;  4IJ3 A;  4MH3 A;  5G5F A;  5E59 A;  4OFN A;  2OE1 A;  2HI7 A;  2B5E A;  3G7Y A;  2V41 A;  4ZIJ A;  4TKY A;  2C0G A;  3FR6 A;  1K0D A;  2V6K A;  2FLS A;  1SD8 A;  4G19 A;  5JWR B;  1B8X A;  4HJM A;  2H19 A;  3VPQ A;  1V98 A;  3V1W A;  2DKH A;  1EV4 A;  2OA7 A;  1H4O A;  2H1D A;  4EC0 A;  1GTB A;  2YZH A;  4GRF A;  3VPT A;  3WGD A;  3WGX A;  4DSR A;  2NBS A;  2P31 A;  5DDL A;  6GSS A;  3DVW A;  2FY6 A;  3QR6 A;  16GS A;  2V32 A;  2ON5 A;  3KP9 A;  1UC7 A;  4ZL8 A;  3ZIJ A;  1B9X C;  3HZ8 A;  4L5O A;  3GUS A;  2H71 A;  1VF1 A;  2HZE A;  1T8E B;  1M99 A;  4TXO B;  5INY A;  4ISD A;  3CRU A;  4WR5 A;  5DAL B;  3TKP A;  3DML A;  5ELG A;  3ZTL A;  1C72 A;  4L5L A;  3G7J A;  3IOS A;  1S3C A;  4IEL A;  6GSU A;  2VL3 A;  2KOK A;  5IMV A;  3PIN A;  4GXZ A;  1N2A A;  1SK2 A;  3DRN A;  2TIR A;  2LV3 A;  1J9B A;  2F3M A;  2LS5 A;  1PL2 A;  3GTU B;  5D73 A;  1GNW A;  2HT9 A;  1ML6 A;  4NWY A;  2MMA A;  1NSW A;  3ZRD A;  3IXR A;  2JSY A;  5KN2 A;  1AC1 A;  1XOB A;  4NHW A;  2DBC A;  5FHI A;  1YZX A;  2IL3 A;  5H5S A;  3J7Y k;  1N8J A;  3GH6 A;  2WGR A;  4V2N A;  4DEJ A;  2EIQ A;  3F4R A;  1EP8 A;  4JU5 A;  3TUE A;  3A5W A;  4MZW A;  1XWB A;  5J41 A;  1GSD A;  3H4K A;  5DAK B;  3M9K A;  1YQ1 A;  2F51 A;  2OAD A;  4O32 A;  2LUS A;  5IMD A;  1TRS A;  1M7T A;  4K7O A;  3A2V A;  4ECJ A;  3GX0 A;  2H0G A;  1SL1 B;  2P5R A;  3WT1 A;  1XIY A;  3UMA A;  2B1K A;  3C71 A;  4IP6 A;  5KOW A;  3GKM A;  1TRU A;  1FHE A;  3LSZ A;  4F0C A;  3UJ1 A;  3P90 A;  1OVN A;  4RI6 A;  1AIU A;  4WBR D;  3WT2 A;  1MD4 A;  4ACS A;  2VCT A;  1SU9 A;  5E4W A;  3A5I A;  1Q4J A;  3DKS A;  4FIW A;  3VWU A;  1TTZ A;  4XRD A;  4G0L A;  2PER A;  4YQU A;  4JZQ A;  3JCM L;  2DJ0 A;  3EC3 A;  3IA1 A;  1X5D A;  3GL3 A;  2FGX A;  2OE0 A;  1YY7 A;  4NAX A;  2H8L A;  1PRX A;  3MDK A;  1HNC A;  5KOX A;  3KJY A;  4X43 A;  4ECI A;  2WS2 A;  4WEY A;  4ECC A;  1AXD A;  3I43 A;  3ZML A;  3GHA A;  1J0F A;  4MCU A;  4N0V A;  1XFL A;  3I69 A;  1AQV A;  2DSA A;  4I6X A;  2GSR A;  3HCZ A;  4MMM A;  3F0I A;  1R26 A;  1V58 A;  2P5Q A;  4K0G A;  1H75 A;  2DJK A;  1RW1 A;  5ECI B;  5ECP B;  3LXZ A;  4JBB A;  1GSE A;  1MD3 A;  4OWY A;  2X4A A;  2JL4 A;  1BYE A;  2LRT A;  2YPM A;  3IHQ A;  4MZB A;  4PQH A;  3APQ A;  3EU3 A;  1YEP A;  3KEB A;  2OAC A;  5B6M A;  2GSS A;  5ECL B;  3UBK A;  4TXO A;  3TCO A;  1FO5 A;  1NW2 A;  1F37 A;  1QQ2 A;  1T4Y A;  4K8M A;  3QDN A;  1GWC A;  18GS A;  2PN8 A;  4MJE A;  4RUV A;  2OKA A;  3KH9 A;  3EMP A;  2C0E A;  5HQP A;  4WBJ A;  4PXO A;  1TRV A;  2IPA A;  1ZYP A;  3RPP A;  2KHP A;  5HFI A;  1EWX A;  1ON4 A;  1ZYN A;  3M3M A;  5BRT A;  2F9S A;  3RPN A;  4CW9 A;  1GLQ A;  3CSI A;  3GRX A;  5ECK B;  2LRN A;  2E2G A;  4YKF A;  4AJ8 A;  3D21 A;  6GSW A;  1GRX A;  4GQF A;  4XTS A;  2C0F A;  4WXT A;  3GTU A;  3TJK A;  5IMC A;  3UOM A;  3VWX A;  1ZCP A;  2GST A;  4KSO A;  4L0W A;  5DCG A;  4YAP A;  5CP1 A;  1R5A A;  4ZB8 A;  2JSZ A;  3RBT A;  3CSH A;  4GCI A;  4O5U A;  2GQM A;  2H0I A;  5D9V A;  3IC4 A;  3LEF A;  2OBK A;  4KDU A;  1GSU A;  2XHF A;  2GZY A;  3LJR A;  4IHU A;  3BCI A;  1VF2 A;  5B7C A;  2OJL A;  1VF3 A;  1OYJ A;  2XC2 A;  1OE7 A;  2WB9 A;  3IDV A;  5A4V A;  4HS1 A;  1FG4 A;  1XBS A;  1OKT A;  3IAS 2;  1EEJ A;  2I4A A;  5DAK A;  1GSQ A;  2KLX A;  4QQ7 A;  3ERW A;  2VUP A;  2P0G A;  3UEM A;  1PGT A;  3MIX A;  3IAM 2;  3ZFB A;  2I3Y A;  2VOC A;  3C7M A;  5HFG A;  4X1U A;  2RII A;  2DJ3 A;  1DE1 A;  1FAA A;  2I1U A;  4WF5 A;  3KTB A;  4FQU A;  3EUR A;  1PN0 A;  1U87 A;  4L0U A;  1VF4 A;  4HU9 A;  3CMI A;  1K3L A;  1ZGN A;  3F63 A;  4KW6 A;  1TW9 A;  2VAF A;  2YWI A;  2VD1 A;  3FR3 A;  3HD5 A;  3GH9 A;  2GSQ A;  4PNF A;  3C1S A;  3KZQ A;  5G31 A;  3GA4 A;  3GL5 A;  5GST A;  3L0H A;  1DE2 A;  4MDC A;  1AUC A;  1GTU A;  1Y25 A;  2LRC A;  1Z3E A;  4X4J A;  1WIK A;  1EEM A;  2VLU A;  4HJ2 A;  1SK0 A;  2YWN A;  2M72 A;  2MBT A;  2G2Q A;  2RUE A;  4N10 A;  3LYP A;  1A0F A;  4G0I A;  1I5G A;  2OE3 A;  5D8I A;  2CA8 A;  2VL2 C;  12GS A;  3L4N A;  4MJC A;  5DCH A;  3ZIT A;  4F0B A;  2H01 A;  2MMN A;  5GAP D;  3CTF A;  3QFA C;  4LL4 B;  2I81 A;  2YJH A;  2HXK A;  4DSS A;  1IYI A;  1M0U A;  1GSF A;  2V1M A;  4F9Z A;  2L4Q A;  3CSJ A;  1U3I A;  1SK1 A;  1ILO A;  2IMD A;  2NVL A;  4LMW A;  1A23 A;  2O87 A;  2B3S A;  2CX3 A;  2H73 A;  2K8V A;  3TKS C;  4K2D A;  4XS4 B;  1JLW A;  1PSQ A;  2PVO C;  2R3X A;  2GQK A;  3NZN A;  4EF0 A;  3KXO A;  2AJQ B;  1A0R P;  3C8E A;  3P2A A;  2PUK C;  2WDU A;  3D22 A;  3HJO A;  2F8A A;  4BL7 B;  1B48 A;  2IMI A;  1T7P B;  4IQ1 A;  5F8B A;  5IO0 A;  2X8H A;  3AY8 A;  3UVH A;  4E8H A;  4BVX B;  4X0X A;  2B5X A;  5LCZ A;  5FWG A;  5JCW A;  1YF1 A;  4FYC A;  4J2F A;  1VGL A;  3FMW A;  1SKS B;  2CAI A;  3ED3 A;  1R4W A;  1Z9H A;  1QGV A;  1V57 A;  5CAX A;  2DIZ A;  1SD9 A;  3FRC A;  5A4W A;  4QL7 A;  4J57 E;  5ECM B;  4EE0 A;  1SL2 B;  1UVZ A;  4MP4 A;  2I9H A;  1T3B A;  5D9X A;  5ECN B;  1THO A;  4HQS A;  2KUC A;  5AN1 A;  3TRQ A;  3MSZ A;  5B8A A;  4KND A;  4GQC A;  1CQG A;  3IV4 A;  2CQ9 A;  1EZK A;  3H8Q A;  1O85 A;  1GSS A;  2CZ3 A;  3GKN A;  1G0T A;  3GKK A;  4FYU A;  3F8U A;  4TN8 A;  2BJX A;  1THX A;  3QOU A;  3ZYW A;  2YWO A;  2PGT A;  1KEB A;  3C1R A;  1FVJ A;  4IJI A;  4MPF A;  3LGC A;  8GSS A;  3GFK A;  3BCK A;  1TKD B;  5IMA A;  3G7I A;  5AIX A;  4RQR A;  3W6G A;  1QMV A;  3I9V 2;  2VM1 A;  2ZNM A;  5IOW A;  4TR4 A;  14GS A;  3LW9 A;  6GSY A;  1ERW A;  4USS A;  2H6Y A;  4G9H A;  5J9B A;  1AQW A;  5AIS A;  1RK4 A;  3RDW A;  4IP1 A;  3IBH A;  1GUH A;  4O5Q A;  5C00 A;  4PUA A;  4ZIL A;  3TKR A;  5EPF A;  3EIN A;  2LJA A;  1KNG A;  3O76 A;  5G1L A;  3TJB A;  4LLR A;  4KCA A;  2L4C A;  3VLN A;  1O6J A;  1PX6 A;  5HR2 A;  1ERU A;  2DJJ A;  4K5S A;  4OD7 A;  4IKH A;  4KE3 A;  4QL9 A;  4HU7 A;  2B1L A;  1PKW A;  1AQX A;  3HJP A;  3VUR A;  4F2I A;  1PX7 A;  4EKZ A;  4CY6 A;  5KEJ A;  3QPM A;  4KCE A;  2L5O A;  1PKZ A;  2H72 A;  4ZBA A;  2VIM A;  3GMF A;  1A2M A;  5IQY A;  2DKI A;  5CRW A;  2XBQ A;  2MZC A;  5ECH B;  4XS4 A;  3TGZ A;  3NIV A;  2MYG A;  2LTK A;  4TOP A;  1FVK A;  2NPB A;  1TRW A;  5J3R A;  2AV4 A;  4V1A p;  1M2A A;  5D96 A;  4Q5R A;  1Z7R A;  3HKR A;  4BWS A;  4YKG A;  4WF4 A;  1TI3 A;  1EOH A;  2WJU A;  2JAD A;  2B5Y A;  2G0F A;  5CRG A;  1PA3 A;  3ME7 A;  4BL7 A;  5DQY A;  3PH9 A;  3UAP A;  1FB0 A;  3LFL A;  4BVX A;  3APS A;  4MF7 A;  1TK5 B;  5B6N A;  9GSS A;  2FWH A;  5G2Z A;  4CDO A;  1F3B A;  4RQX A;  1WP0 A;  4Q5F A;  3S9F A;  3KP8 A;  1V40 A;  1K0M A;  4XIH A;  3TKS E;  3WYW A;  3W8J A;  5A4U A;  4OMV A;  2NDO A;  1HD2 A;  2J9H A;  1M9A A;  1ZMA A;  3LWA A;  5CRD A;  3DIE A;  4ML6 A;  2HRA A;  1BED A;  3EYT A;  2WRT A;  4POM A;  2CAQ A;  5H5R A;  2GZP A;  2R2J A;  4MPG A;  2EIO A;  1PL1 A;  3E3E A;  4N30 A;  4OCF A;  3TOU A;  3KD0 A;  3QD9 A;  1ZOF A;  4V2L A;  5LNK e;  5FT3 A;  5L71 A;  3FR9 A;  2LNS A;  5DVB A;  1YKC A;  4XCS A;  3ZIV A;  2O85 A;  1U3A A;  3EE2 A;  1K0A A;  4DSS B;  4D73 B;  4L8E A;  3UL3 A;  4POL A;  1A8Y A;  3TJG A;  5BMU A;  7GSS A;  2YJ7 A;  1FB6 A;  4XRA A;  4FH8 A;  4CHS A;  4BWQ A;  1RQM A;  4KSM A;  2R6K A;  5ECO B;  1SKW B;  2BTO T;  1E6B A;  2PPT A;  1F3A A;  4K0N A;  1A8L A;  4WKW A;  4ICY A;  4I2U A;  3ZRE A;  3TB2 A;  3KMN A;  2REM A;  2LKU A;  1GSY A;  3GSS A;  1GLP A;  1BX9 A;  1M9B A;  1OC3 A;  1X5E A;  2FCH A;  2E2M A;  1SYR A;  4MAB A;  4IN0 A;  4ZB6 A;  2DIY A;  1TU7 A;  2V6O A;  1MDK A;  1XZO A;  1GH2 A;  4ML1 A;  3FKF A;  3F6D A;  3KH7 A;  3L78 A;  4YQV A;  5ECQ B;  2DJ2 A;  2HE3 A;  4A5P A;  2N5B A;  2R5G A;  2CVK A;  3VFI A;  1ZYE A;  2A2R A;  3IHG A;  4PUF C;  2V2G A;  2UZ8 A;  4Z2R A;  1EGR A;  4OO5 A;  2LST A;  17GS A;  5JCG A;  1BAY A;  3Q74 A;  4TRX A;  1UN2 A;  4TR0 A;  1BQ7 A;  2JZR A;  4K1F A;  4TR3 A;  3IRA A;  1WE0 A;  3IE3 A;  1OC9 B;  2B7J A;  2PWJ A;  4E8E A;  4KB3 A;  4MJA A;  1F6M C;  4JE1 A;  4JED A;  1FW1 A;  4ZL9 A;  3QAW A;  3IPZ A;  2PU9 C;  2ALB A;  1R7H A;  2H74 A;  1ZZY A;  5IO2 A;  2YP6 A;  1OAZ A;  2N5A A;  3TJJ A;  1Z5Y E;  2H0H A;  3APO A;  1R5P A;  1BG5 A;  2K8S A;  4ULX A;  1O7U A;  2CVB A;  3VK9 A;  1V2A A;  2FWE A;  3FK8 A;  3QAG A;  1XW6 A;  4JR6 A;  4F03 A;  4O7H A;  3VI5 A;  2C3Q A;  3M8N A;  2CVD A;  1OE8 A;  4ECB A;  1MDJ A;  3US3 A;  1JZR A;  2HYX A;  3F4S A;  4EUY A;  4NV5 A;  2K9F A;  3GIX A;  1U88 A;  1HQO A;  3IR4 A;  2IMF A;  3UIW A;  1YF0 A;  2VCW A;  4OFT A;  3CYN A;  1YEX A;  1SYX A;  2CZ2 A;  1G7O A;  4GWR A;  2D2Z A;  2DLX A;  4G10 A;  2M80 A;  22GS A;  5CO3 A;  3CXG A;  5GZZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...