2YWNA

Crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
150
Chain Sequence
b'GHMVEIGELAPDFELPDTELKKVKLSALKGKVVVLAFYPAAFTQVFRDSMAKFNQVNAVVLGISVDPPFSNKAFKEHNKLNFTILSDYNREVVKKYNVAWEFPALPGYVLAKRAVFVIDKEGKVRYKWVSDDPTKEPPYDEIEKVVKSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-like protein
publication title Crystal structure of peroxiredoxin-like protein from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
total genus 43
structure length 150
sequence length 157
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ywnA00
3LG6A 2VL9A 2XPDA 3ZL5A 2GSQA 5F06A 2WRTA 1HD2A 2CV4A 1X9SB 1TOFA 5B6NA 4EXJA 5D73A 3GRXA 1TTZA 2PPTA 3IDVA 1URMA 2P31A 1EOGA 4BVXA 3DGQA 4EL1A 1TW9A 1GTIA 2AV4A 1GSYA 2CX3A 2V41A 3L9SA 1Z5YE 3KJYA 3ZIJA 2ES7A 5AIXA 3DVWA 4EUYA 2DC5A 1LU4A 2R5GA 3HJOA 4TR3A 1JHBA 1T1VA 3LORA 1O85A 5ECQB 1ILOA 2OBIA 4JU5A 3DXBA 3TOUA 3H1NA 17GSA 1WE0A 4HS1A 1AC1A 1HNBA 2AHEA 1G7OA 3C73A 2LQOA 1ABAA 2B5XA 5FHIA 1USBA 1QXHA 1XW5A 1GNWA 5HFIA 1OVNA 2L5OA 3BJ5A 3TCOA 2DSAA 3FZ4A 3MAKA 1M99A 4XS6A 1GWCA 2DJ0A 3DMLA 4IBPA 3CTFA 3VWUA 3I43A 4MJCA 1FAAA 3KTLA 1PMTA 3C1SA 2GZYA 5CP1A 4GQFA 4K1FA 5JCUA 5A4UA 1A2MA 3ZVJA 1H75A 2FHEA 2PERA 4RQRA 1EV4A 2QC7A 5F8BA 4ECIA 4HZ2A 3LJRA 1QFNA 1U3AA 2H1AA 6GSSA 3UVTA 3TJKA 1DSBA 4KDUA 3QPMA 2K8SA 3M1GA 1ZL9A 2YOIA 3LSZA 5C04A 1FVJA 1E6BA 1XIYA 2H76A 4IVFA 1XFLA 3GA4A 4KSMA 2B7JA 2WFCA 3VWXA 1O73A 1AQWA 2VAFA 2E2GA 4TVEA 3RBTA 4KUNA 1FB0A 3P2AA 3W8SA 2ON5A 3QAVA 5HFKA 4ZL7A 4JR4A 3KM6A 1S3AA 3EE2A 1TRVA 2G2QA 4F2IA 2WCIA 1NW2A 3DVXA 5DBQA 2HT9A 1H4OA 2MMOA 1ZGNA 4DSSB 4PGTA 2FA4A 2PU9C 1ZCPA 2ON7A 4RI7A 2C1YA 2CZ3A 4IJIA 4E8HA 4FO5A 1R5PA 4N0VA 1TK8B 2RLIA 3UMAA 3GX8A 2DIYA 5JCWA 5LD0A 1FHEA 1RK4A 1E2YA 2G0FA 3OR5A 2WGRA 1SKWB 4EDZA 1DE2A 2VCZA 1QMVA 4XS4A 3C8EA 1W89A 3F6FA 5ECKB 5KN1A 4TN8A 1FVKA 1RW1A 2VLTA 1GLQA 5CNWA 4GTUA 4XS4B 1XXUA 4MZWA 1ERWA 2JZSA 3BCIA 3MDKA 3QAWA 2N5BA 3UAPA 1TK5B 4N30A 1J0FA 2H6ZA 1WIKA 3EYTA 1MDIA 5C00A 4OFNA 4RI6A 22GSA 1A8LA 2XHFA 4V2NA 2J9HA 1YKAA 2WZ9A 4KB3A 3H8QA 3KIJA 5IPHA 3MWHA 11GSA 2R6KA 3KGKA 4YQUA 1K0BA 4Q5RA 4F0BA 2O8VB 4L5OA 4V1Ag 4CW9A 1EWXA 1GLPA 4MH3A 3WT1A 1FO5A 3P90A 1B9XC 1SYXA 2F8AA 3M3MA 2ZCTA 1UN2A 1Q4JA 3F8UA 1V9WA 3IXRA 1BYEA 4NHZA 4O7HA 3FZ5A 4ZL8A 5D9WA 3J7Yb 2IL3A 4GXZA 5DAKB 2HFDA 2B5YA 3APSA 5G1KA 4WR4A 1AW9A 1ERVA 4YH2A 2YZHA 3GL5A 2B1LA 2PN8A 2V1MA 2K6VA 5IIZA 3GKXA 4PQIA 3UEMA 3ZITA 2OE1A 1VF1A 3FZAA 1V58A 4HZ4A 2C80A 2L6DA 4PNGA 4XCSA 2GT5A 1F3BA 3K8NA 5D96A 3Q74A 3BBYA 2FNOA 5ECMB 2C3TA 3E3EA 1GSFA 1IYIA 4X1UA 4J57E 2QSIA 2FUG2 4ZBAA 2FWGA 3ERGA 1A24A 2YP6A 4EKZA 1CQHA 5ECOB 1EGOA 3ZYWA 3VK9A 5A4WA 1GNEA 4FYCA 2HNLA 1Z6MA 2GSTA 1B8XA 3N5OA 4KW6A 2FWHA 1TK0B 3H4KA 5ID2B 3FW2A 3V1WA 3EU3A 4WEYA 2VM2A 2XBQA 4PURA 3H79A 2P5QA 2EIQA 2H70A 5IPGA 3ISOA 4K8MA 1VGLA 1ZOFA 5DCHA 4TOPA 5GAPD 3TKRA 3LYPA 4KCEA 1HNCA 4PQ1A 4MPFA 1BJXA 4IJ3A 4TXOB 2V6OA 3HYPA 1THOA 1DUGA 4MABA 4GSNA 3L78A 3VFIA 4K7OA 3GYKA 3GH9A 2FY6A 3IC4A 1TKDB 2IFQB 1AIUA 3I6AA 3UJ1A 4D73B 1OYJA 1B4QA 1T00A 2CVBA 1X9MB 1K3OA 1S3DA 2JZRA 3KXOA 5CO3A 3EURA 2YV9A 1O81A 1T4ZA 1QUWA 3IK9A 3W6GA 4POKA 4QL7A 4DVCA 5G2ZA 4IW9A 4ML6A 2CA8A 2IWTA 4ECBA 2GTUA 3EMXA 2GS3A 4MF7A 2RM5A 5A4VA 5HR1A 2B6MA 2KUCA 4F82A 2MYGA 1WMJA 2HXKA 2GZPA 3CYNA 4TR0A 1KBNA 3ZIVA 5IOWA 3TKQA 2X8GA 5IO2A 4BWSA 2NPBA 3QOUA 2O85A 4J56E 2KP1A 4IS0A 2LUSA 5LCZA 1GUMA 1LBKA 1XW9A 4ZB9A 3CRTA 2REMA 5IMDA 1YZXA 1F9MA 3D4TA 3HXSA 3GN3A 4BL7A 5D93A 1KNGA 1HNAA 1V98A 2O87A 2TRCP 1VF2A 4ML1A 3I69A 3L4NA 1EGRA 3EU4A 4PNFA 4MK3A 3F9UA 3TB2A 2ZUPA 3W8JA 2VOCA 4HQZA 3ZFLA 2YZUA 4OCEA 5E4WA 1M2DA 1SYRA 2C0EA 5KEJA 5GZZB 2MBSA 2B1KA 2YWMA 1OE8A 1TRWA 2L5LA 1NSWA 2VLVA 3CSJA 1UC7A 1TDIA 1K0NA 3LWAA 4ZBDA 2KLXA 3TUEA 3FHKA 2YPMA 1G0TA 3FK8A 5AN1A 4ISDA 1ON4A 4GSTA 3EINA 1SK2A 1WP0A 2H75A 1PX7A 5HR2A 1NHYA 3IE3A 2EIRA 3RDWA 4MLYA 4XS1A 4I6XA 4OWYA 2DMMA 2LSTA 4AGSA 3TKPA 3D5JA 2IN3A 2E2MA 4EF0A 4KDXA 2HSHA 5HQPA 1GUHA 1XWBA 5ECLB 4FIWA 2BMXA 4KH7A 4NWYA 4EVMA 2X8CA 3D0ZA 1EEMA 2GQLA 2C3QA 3APOA 2KHPA 1M9BA 4X0XA 2C3NA 1JFUA 4O32A 3ERWA 3UARA 3IOSA 1ST9A 1PKWA 4I2UA 2VD1A 4BWQA 4ID0A 1WJKA 2JL4A 4TR1A 1JLWA 3GIXA 1F3AA 4POBA 3US3A 2ZNMA 2A2SA 4WKWA 3U5RE 4YQVA 4MDCA 1KEBA 1GH2A 1ML6A 3Q18A 3HDCA 4WR5A 4OD7A 1TI3A 4MJEA 3EWLA 2E0QA 1UA5A 3FYGA 3UOMA 2OBKA 3Q19A 2PWJA 2VL2C 4K0GA 2PUKC 5IQYA 2VUPA 1EP7A 1PN9A 2LJKA 1QK8A 4QQ7A 2H19A 4FH8A 5CREA 1AUCA 1K0AA 2MMZA 2M46A 4KAEA 3IBHA 1VF3A 4PX1A 5FT3A 5ECPB 1BEDA 2PVOC 3L9VA 3DRNA 2PMTA 2VD0A 2NVLA 2CZ2A 2K8VA 2AB6A 3KEBA 2B7KA 2DIZA 3TKSC 5FWGA 3L9UA 4MJBA 3JCML 2FLSA 3LFLA 1GTBA 1PA3A 1EV9A 2HYXA 1PL1A 4PQHA 2DJ1A 2WS2A 7GSSA 3A5WA 4K7IA 1GP1A 4NV2A 2H71A 4LA1A 3WGXA 5G30A 3HVXA 2DJ3A 1K3LA 3DIEA 5AGYA 3VURA 5D9XA 2YWOA 3VLNA 1XCCA 5LNKe 4KE3A 4Q5FA 2IIYA 4N0ZA 4KSOA 1GSEA 3M0FA 1K0MA 1PGTA 2XPEA 5H5SA 1EZKA 1T7PB 3HA9A 4JRRA 4K9ZA 1T8EB 2C0FA 5GSTA 5D9TA 4HEA2 3FRCA 4WETA 1AAZA 1XBSA 3SWLA 2OKAA 3GNJA 2MMAA 5DDLA 4BPYA 4HOJA 5IM9A 13GSA 1YF0A 4TXVA 3KTBA 3IPZA 4XRAA 4MF5A 3GX0A 1AQVA 2YJ7A 5F05A 1X5DA 1A23A 4CDOA 4G10A 3C71A 3CBUA 4HQSA 5ECNB 2IMFA 3QD9A 4ACSA 3HVVA 1EP8A 4GRFA 3F0IA 4LLRA 4XRDA 2LQQA 3ME8A 2H8LA 1RQMA 3F3QA 3TDGA 1Y25A 4OFMA 5KN3A 4IP1A 3CSHA 1GTUA 3KMOA 3A2XA 4L0UA 3ZREA 3ME7A 5D8IA 2LJAA 1M9AA 4F9ZA 4ZBBA 2FWFA 4K0NA 2MZCA 2F3MA 4L8EA 1QGVA 4JZQA 2H30A 2TRXA 1FG4A 3PINA 5DVBA 1Z7RA 4ECJA 2LTKA 2B3SA 1C72A 2FD3A 2HZEA 4GF0A 1O8WA 2K9FA 1T3BA 1K3YA 2CX4A 3UBLA 2HZEB 2A4VA 2H72A 1WPIA 2VCWA 4JEDA 2JSZA 2NTOA 5B8AA 1ZZYA 2L57A 5J9CA 1SD8A 3UL3A 3MSZA 2P0GA 3GHAA 4XTSA 2PGTA 3D21A 4WBRD 2AJQB 4HU9A 3IA1A 2H6XA 4BVYA 4MH2A 2O7KA 1BX9A 3HJPA 2VLUA 1O7UA 3QAGA 2GQKA 4EC0A 3H93A 1G6WA 2F51A 5ABRA 1LJRA 2AUVA 2WJUA 3HKRA 1M2BA 5HR0A 3FZ9A 3LQ7A 1FW1A 4HJMA 5H5QA 4PUFC 3MNGA 1YEXA 2I1UA 3RPPA 1MDKA 2CVKA 1O8XA 1X9WB 3VWWA 1YKCA 1CQGA 1Z7PA 1ERUA 4YAVA 2KP2A 4FYUA 4IQ1A 1UVZA 3UBKA 2VCVA 1SU9A 4I8BA 1U87A 4TR4A 4GWRA 4AJ6A 6GSYA 4J2FA 18GSA 1G7EA 3G9BA 2I4AA 5E59A 4AF2A 1F6MC 2GLRA 1BG5A 2B5EA 4GCIA 3VPQA 2M72A 1WRYA 2IMDA 4DEJA 1R4WA 4IELA 3ZVJD 5EPFA 3HD5A 2X64A 2H73A 8GSSA 3GURA 5L71A 3LXZA 1TU7A 2VM1A 1X5CA 3KP9A 1PRXA 2MMNA 2V2GA 1U88A 2YV7A 3QR6A 3LEFA 3A3TA 2CAIA 1B9YC 2LEGA 3P7XA 2YANA 2I9HA 4MCUA 2C0DA 5GSSA 1R5AA 1EEJA 2C4JA 2HLSA 4I2TA 2YCDA 2LS5A 5IMCA 5J41A 4NV5A 2F8FA 3O6TA 2KOKA 1GTAA 2LRCA 3HVSA 1NHOA 1MD3A 2DLXA 2HI7A 3M9KA 2HE3A 2LKUA 4QL9A 1K0OA 4ZIJA 2I81A 2RM6A 1SKSB 3DEXA 3WT2A 2HRFA 3GL3A 3D6IA 4YAPA 6GSUA 2F9SA 4JBBA 1G6YA 3TJFA 3RHCA 5D9VA 1SL2B 1F37A 2IMKA 1J9BA 6GSXA 2BJXA 2H1GA 4KCAA 5G31A 5B6MA 4MMMA 4HJ2A 2H1DA 2DJ2A 3WYWA 1R7HA 3RPNA 1T4YA 4GQCA 1M7TA 1VF4A 4TKYA 3FY7A 10GSA 4NMUA 2R37A 5CRGA 2GZZA 16GSA 4BA7A 5ECIB 2PBJA 3M8NA 3IR4A 1KTEA 2AAWA 3TRXA 1R26A 2WB9A 1AXDA 4ZILA 4I97A 1M2AA 2R3XA 2YNXA 3ZLPA 2DMLA 3EVIA 5B8BA 5H5RA 1ZYEA 2H0IA 4DSRA 4POMA 4MJAA 1B4PA 4ZB6A 1TU8A 3VI5A 1SENA 3L0HA 1K0DA 4OMVA 4OFTA 1SL1B 3APQA 4F0CA 4EDYA 1GUKA 3C7MA 1AQXA 3TRPA 4EE0A 4LL4B 3SBCA 1XOBA 3GSSA 1GRXA 5AISA 1XW6A 5IO0A 3BCKA 4KA0A 3QFBC 5DCGA 2JZTA 2H1BA 3RAZA 2BTOT 1ZYQB 3FKFA 3IAM2 1XWCA 4ILFA 4WF5A 2A2RA 3FR3A 2JACA 2LNSA 3GMFA 4KDYA 1SJIA 2DJKA 2VCXA 3KD0A 1JZDA 1XWAA 2LRNA 3ERFA 5CRHA 1N2AA 1WWJA 2VL2A 4ZL9A 3DWVA 4MZCA 3IAS2 1YY7A 3TGZA 4JR6A 4Z7XA 2Z9SA 5G1LA 5DJMA 2TIRA 1I5GA 1DBYA 3KH9A 4GLTA 5B7CA 4ULXA 3GV1A 5KN0A 2LRTA 1TXXA 4HU7A 1Z6NA 4CHSA 2NDOA 2IMIA 3TKSA 3ZTLA 4IGJA 1Y6EA 3F4SA 2H0GA 4XIHA 4TW5A 3QCPA 2N5AA 3GH6A 1MD4A 5JWQB 2H74A 2YWIA 3TJGA 4NXIA 4IP6A 1U3IA 3EMPA 4V1Ap 4AJ8A 3TJJA 5F0GA 3ZMLA 5CAXA 4TR1B 3PH9A 2GQMA 4DSQA 1Z3EA 1XPVA 4KX4A 4NHWA 3GFKA 4G2EA 5JCGA 1OC3A 2C0GA 2K18A 2OA7A 2DBCA 12GSA 4LL1B 5IOXA 3IHQA 5ECSA 3ZMKA 1TI1A 4K6XA 4OCFA 3F4TA 1XWGA 2L6CA 2RIIA 3TKSE 3J7Yk 3QFAC 1W4VA 5EVOA 3TRQA 1SK1A 4H86A 3WGDA 3PR8A 1QQ2A 1GL8A 1OC8A 4HI7A 2WDUA 1OC9A 4OO4A 3AY8A 3F6DA 3PGTA 2H66A 4FYBA 2HSYA 5DQYA 2XC2A 1GSUA 1S3CA 2CT6A 1OC9B 1K0CA 6GSTA 1PL2A 1GSDA 3ED3A 2R4VA 2V32A 4DSSA 4MF6A 3U6VA 1FB6A 2ALBA 1SJZA 2QGVA 3FR6A 2YN1A 3TOTA 4K7NA 3UIWA 2I3YA 2JSYA 2X8HA 4G19A 2C8UA 3KH7A 1XOAA 2V6KA 5A5KA 4F03A 3S9FA 4I5QA 5G5FA 5CYYA 5J5NA 2GSRA 3NZNA 2PVQA 1ZMAA 1XZOA 3TJBA 5AIVA 4V2LA 3A2VA 1JZOA 20GSA 5J4UA 5CRDA 1GSQA 1YQ1A 2FGXA 2YWNA 3P8WA 3CTGA 4RQXA 4K2DA 1BQ7A 1B48A 1YEPA 3QMXA 5INYA 4WXTA 5J3RA 5HR3A 5G5EA 3DD3A 2IPAA 4KGIA 3HZ4A 1XVWA 2M80A 5ELAA 2H0HA 5IMAA 1SL0B 3N9JA 4E8EA 4G9HA 3GKMA 4N11A 2HZFA 1OAZA 1J08A 3GKNA 4L5LA 1VRSD 1TRSA 1FOVA 3NOFA 3KMNA 3BOAA 2RUFA 3CMIA 3C1RA 2OADA 3LXTA 19GSA 4NAXA 2AYTA 2D2ZA 1JZWA 5F07A 3GKKA 2O89A 5EY6A 3ZRDA 1V57A 2GGTA 1TP9A 4AJ7A 1NM3A 2R2JA 1I9DA 6GSVA 3KP8A 2QKEA 4HUAA 5DAKA 1GULA 1M0UA 2OE0A 1A0RP 1PD21 4O5RA 1U6TA 1EOHA 3RHBA 2FWEA 1ACVA 3R2QA 1PQNA 2GSSA 3IK7A 5ELGA 3KZQA 3EC3A 3UVHA 1A2JA 1YDKA 5J9BA 4IKHA 4HDEA 1PKZA 2VIMA 2HRNA 2P5RA 5DJLA 1SD9A 2N5FA 2JADA 2OACA 3BD2A 1BAYA 4WBJA 5CRWA 9GSSA 3HHVA 2CAQA 2OE3A 1GSSA 2CVDA 2GDRA 2VO4A 4KNDA 2X99A 14GSA 3A2WA 1A0FA 3G7JA 4TRXA 5ID2A 2LNTA 3LYKA 1SJ6A 4OO5A 1XWKA 3CXGA 1A2LA 4PXOA 5IMVA 3D22A 5COHA 3IRAA 1SKRB 3GUSA 3CSIA 2GVPA 3GTUA 5HFGA 1Z9HA 4TXOA 3FR9A 4YQMA 3GTUB 1N8JA 4P3YB 3WGEA 4POLA 1TJDA 2IJYA 4MPGA 1YF1A 1MEKA 5IMZA 1O6JA 3G7IA 1A8YA 2IMEA 4MZBA 4EO3A 5DQSA 1OKTA 4IN0A 2L4QA 3KCMA 3WD6A 1ERTA 2WULA 5JWRB 1MDJA 3DYRA 2YJHA 2IFQA 4D73A 1F2EA 2H6YA 3VPTA 5DALA 2LV3A 1X5EA 4ZB8A 3DKSA 1XVQA 2RUEA 4MA9A 5DALB 1WOUA 3NIVA 2EC4A 1OKDA 1TRUA 4X43A 2VCQA 5GAND 1Q98A 3LGCA 4JE1A 4O92A 2JU5A 3VI7A 3F63A 3QDNA 2MBTA 1JLVA 2FA8A 4ZXGA 5IMFA 4Q5QA 5JWOB 1IYHA 2XBIA 2VCTA 4Q5NA 3M9JA 2NBSA 4N10A 5ECRB 1HQOA 6GSWA 1THXA 3HCZA 4NPBA 3CRUA 2OJLA 1V40A 4XHMA 3ZFBA 4V2MA 3FEUA 1MTCA 3O3TA 3F4RA 3ZZXA 4WF4A 5ENUA 3E9JB 2J23A 2EIOA 2H01A 4RUVA 4ECCA 2L59A 4IQAA 1PX6A 3GSTA 3HY2A 2GT6A 4L0WA 1SK0A 5KN2A 2VL3A 1DE1A 4IHUA 5EL8A 3I9V2 3F3RA 3Q6OA 1YJ6A 2L4CA 4LMWA 1OE7A 4LMVA 3O76A 4PUAA 4MP4A 4GSSA 1X0RA 1HYUA 3HJMA 1V2AA 2E7PA 3G7YA 5ECHB 3E0UA 2CQ9A 3IV4A 3VWVA 3D4MA 3HZ8A 2LJRA 2FCHA 1JZRA 1PSQA 2DJJA
chains in the Genus database with same CATH superfamily
3LG6A 2VL9A 2XPDA 3ZL5A 2GSQA 5F06A 2WRTA 1HD2A 2CV4A 1X9SB 1TOFA 5B6NA 4EXJA 5D73A 3GRXA 1TTZA 2PPTA 3IDVA 1URMA 2P31A 1EOGA 4BVXA 3DGQA 4EL1A 1TW9A 1GTIA 2AV4A 1GSYA 4BVXB 2CX3A 2V41A 3L9SA 1Z5YE 3KJYA 3ZIJA 2ES7A 5AIXA 3DVWA 4EUYA 2DC5A 1LU4A 2R5GA 3HJOA 4TR3A 1JHBA 1T1VA 3LORA 1O85A 5ECQB 1ILOA 2OBIA 4JU5A 3DXBA 3TOUA 3H1NA 17GSA 1WE0A 4HS1A 1AC1A 1HNBA 2AHEA 1FOHA 1G7OA 3C73A 2LQOA 1ABAA 2B5XA 5FHIA 1USBA 1QXHA 1XW5A 1GNWA 5HFIA 1OVNA 1S3RA 2L5OA 3BJ5A 3TCOA 2DSAA 3FZ4A 3MAKA 1M99A 4XS6A 1GWCA 2DJ0A 3DMLA 4IBPA 3CTFA 3VWUA 3I43A 4MJCA 1FAAA 3KTLA 1PMTA 3C1SA 2GZYA 5CP1A 2R0CA 4GQFA 4K1FA 5JCUA 5A4UA 1A2MA 3ZVJA 1H75A 2FHEA 2PERA 4RQRA 1EV4A 2QC7A 5F8BA 4ECIA 4HZ2A 1XG8A 3LJRA 1QFNA 1U3AA 2H1AA 6GSSA 3UVTA 3TJKA 1DSBA 4KDUA 3QPMA 2K8SA 3M1GA 1ZL9A 2YOIA 3LSZA 5C04A 1FVJA 1E6BA 1XIYA 2H76A 4IVFA 1XFLA 3GA4A 4KSMA 2B7JA 2WFCA 3VWXA 1O73A 1AQWA 2VAFA 2E2GA 4TVEA 3RBTA 4KUNA 1FB0A 3P2AA 3W8SA 2ON5A 3QAVA 5HFKA 4ZL7A 4JR4A 3KM6A 1S3AA 3EE2A 1TRVA 2G2QA 4F2IA 2WCIA 1NW2A 3DVXA 5DBQA 2HT9A 1H4OA 2MMOA 1ZGNA 4DSSB 4PGTA 2FA4A 2PU9C 1ZCPA 2ON7A 4RI7A 2C1YA 2CZ3A 4IJIA 4CY6A 4E8HA 2A4HA 4FO5A 1R5PA 4N0VA 1TK8B 2RLIA 3UMAA 3GX8A 2DIYA 5JCWA 5LD0A 1FHEA 1RK4A 1E2YA 2G0FA 3OR5A 2WGRA 1SKWB 4EDZA 1DE2A 2VCZA 1QMVA 4XS4A 3C8EA 1W89A 3F6FA 5ECKB 5KN1A 4TN8A 1FVKA 1RW1A 2VLTA 1GLQA 5CNWA 4GTUA 4XS4B 1XXUA 4MZWA 1M3JA 1ERWA 2JZSA 3BCIA 3MDKA 3QAWA 2N5BA 3UAPA 1TK5B 4N30A 1J0FA 2H6ZA 1WIKA 3EYTA 1MDIA 5C00A 4OFNA 4RI6A 22GSA 1A8LA 2XHFA 4V2NA 2J9HA 1YKAA 2WZ9A 4KB3A 3H8QA 3KIJA 5IPHA 3MWHA 11GSA 2R6KA 3KGKA 4YQUA 1K0BA 4Q5RA 4F0BA 2O8VB 4L5OA 4V1Ag 4CW9A 1EWXA 1GLPA 4MH3A 3WT1A 1FO5A 3P90A 1B9XC 1SYXA 2F8AA 3M3MA 2ZCTA 1UN2A 1Q4JA 3F8UA 1V9WA 3IXRA 3IHGA 1BYEA 4NHZA 4USSA 4O7HA 3FZ5A 4ZL8A 5D9WA 3J7Yb 2IL3A 4GXZA 5DAKB 2HFDA 2B5YA 3APSA 5G1KA 4WR4A 1AW9A 1ERVA 4YH2A 2YZHA 3GL5A 2B1LA 2PN8A 2V1MA 2K6VA 5IIZA 3GKXA 4PQIA 3UEMA 3ZITA 2OE1A 2X49A 1VF1A 3FZAA 1V58A 4HZ4A 2C80A 2L6DA 4PNGA 3CQFA 4XCSA 5KOWA 2GT5A 1F3BA 3K8NA 5D96A 3Q74A 3BBYA 2FNOA 5ECMB 2C3TA 3E3EA 1GSFA 1IYIA 4X1UA 4J57E 2QSIA 2FUG2 4ZBAA 2FWGA 3MIXA 3ERGA 1A24A 2YP6A 4EKZA 1CQHA 5ECOB 1EGOA 3ZYWA 3VK9A 5A4WA 1GNEA 4FYCA 2HNLA 1Z6MA 2GSTA 1B8XA 3N5OA 4KW6A 2FWHA 1TK0B 3H4KA 5ID2B 3FW2A 3V1WA 3EU3A 4WEYA 2VM2A 2XBQA 4PURA 3FMWA 3H79A 2P5QA 2EIQA 2H70A 5IPGA 3ISOA 4K8MA 4BIKA 1VGLA 1ZOFA 5DCHA 4O5UA 4TOPA 5GAPD 3TKRA 3LYPA 4KCEA 1HNCA 4PQ1A 4MPFA 1BJXA 4IJ3A 4TXOB 4X4JA 2V6OA 3HYPA 1THOA 1DUGA 4MABA 4GSNA 3L78A 3VFIA 4K7OA 3GYKA 3GH9A 2FY6A 3IC4A 1TKDB 2IFQB 1AIUA 3I6AA 3UJ1A 4D73B 1PN0A 1OYJA 1B4QA 1T00A 2CVBA 1X9MB 1K3OA 1S3DA 2JZRA 3KXOA 5CO3A 3EURA 2YV9A 1O81A 1T4ZA 1QUWA 3IK9A 3W6GA 4POKA 4QL7A 4DVCA 5G2ZA 4IW9A 4ML6A 2CA8A 2IWTA 4ECBA 2GTUA 3EMXA 2GS3A 4MF7A 2RM5A 5A4VA 5HR1A 2B6MA 2KUCA 4F82A 2MYGA 1WMJA 2HXKA 2GZPA 3CYNA 4TR0A 1KBNA 3ZIVA 5IOWA 3TKQA 2X8GA 5IO2A 4BWSA 2NPBA 3QOUA 2O85A 4J56E 2KP1A 4IS0A 2LUSA 5LCZA 1GUMA 1LBKA 4EIPA 1XW9A 4ZB9A 3CRTA 5BRTA 2REMA 5IMDA 1YZXA 1F9MA 3D4TA 3HXSA 3GN3A 4BL7A 5D93A 1KNGA 1HNAA 1V98A 2O87A 2TRCP 1VF2A 4ML1A 3I69A 3L4NA 1EGRA 3EU4A 4BL7B 4PNFA 4MK3A 3F9UA 3TB2A 2ZUPA 3W8JA 2VOCA 4HQZA 3ZFLA 4MNNA 2YZUA 4OCEA 5E4WA 4K5RA 1M2DA 1SYRA 2C0EA 5KEJA 5GZZB 2MBSA 2B1KA 2YWMA 1OE8A 1TRWA 2L5LA 1NSWA 2DKIA 2VLVA 3CSJA 1UC7A 1TDIA 1K0NA 4EIQA 3LWAA 4ZBDA 2KLXA 3TUEA 3FHKA 2YPMA 1G0TA 2X4AA 3FK8A 5AN1A 4ISDA 1ON4A 4GSTA 2DKHA 3EINA 1SK2A 1WP0A 2H75A 3HVNA 1PX7A 5HR2A 1NHYA 3IE3A 2EIRA 3RDWA 4K2XA 4MLYA 4XS1A 4I6XA 4OWYA 2DMMA 2LSTA 4AGSA 3TKPA 3D5JA 2IN3A 2E2MA 4EF0A 4KDXA 2HSHA 5HQPA 1GUHA 1XWBA 5ECLB 4FIWA 2BMXA 4KH7A 4NWYA 4EVMA 2X8CA 3D0ZA 1EEMA 2GQLA 2C3QA 3APOA 2KHPA 1M9BA 4X0XA 2C3NA 4A5PA 1JFUA 4O32A 3ERWA 3UARA 3IOSA 1ST9A 1PKWA 4I2UA 2VD1A 4BWQA 4ID0A 1WJKA 2JL4A 4TR1A 1JLWA 3GIXA 1F3AA 4POBA 3US3A 2ZNMA 2A2SA 4WKWA 3U5RE 4YQVA 4MDCA 1KEBA 1GH2A 1ML6A 3Q18A 3HDCA 4WR5A 4OD7A 1TI3A 4MJEA 3EWLA 2E0QA 1UA5A 3FYGA 3UOMA 2OBKA 3Q19A 2PWJA 2VL2C 4K0GA 2PUKC 3R3EA 5IQYA 2VUPA 1EP7A 1PN9A 2LJKA 1QK8A 4QQ7A 2H19A 4FH8A 5CREA 1AUCA 1K0AA 2MMZA 2M46A 4KAEA 3IBHA 1VF3A 4PX1A 5FT3A 5ECPB 1BEDA 2PVOC 3L9VA 3DRNA 2PMTA 2VD0A 2NVLA 2CZ2A 3LW9A 2K8VA 2AB6A 3KEBA 2B7KA 2DIZA 3TKSC 5FWGA 3L9UA 4MJBA 3JCML 2FLSA 3LFLA 1GTBA 1PA3A 1EV9A 2HYXA 1PL1A 4PQHA 2DJ1A 2WS2A 7GSSA 3A5WA 4K7IA 1GP1A 4NV2A 2H71A 4LA1A 3WGXA 2QA1A 5G30A 3HVXA 2DJ3A 1K3LA 3DIEA 5AGYA 3VURA 5D9XA 1ZYPA 2YWOA 3VLNA 1XCCA 5LNKe 4KE3A 4CY8A 4Q5FA 2IIYA 4N0ZA 4KSOA 1GSEA 4G0IA 3M0FA 1K0MA 1PGTA 2XPEA 5H5SA 1EZKA 1T7PB 3HA9A 4JRRA 4K9ZA 1T8EB 2C0FA 5GSTA 4HEA2 3FRCA 3EPTA 4WETA 5D9TA 1AAZA 1XBSA 3SWLA 2OKAA 3GNJA 2MMAA 5DDLA 4BPYA 4HOJA 5IM9A 13GSA 1YF0A 4TXVA 3KTBA 4PTSA 3IPZA 4XRAA 4MF5A 3GX0A 1AQVA 2YJ7A 5F05A 1X5DA 1A23A 4CDOA 4G10A 3C71A 3CBUA 4HQSA 2HRAA 2IMFA 5ECNB 3QD9A 4ACSA 3HVVA 1EP8A 4GRFA 3F0IA 4LLRA 4XRDA 2LQQA 3ME8A 2H8LA 1RQMA 3F3QA 3TDGA 1Y25A 4OFMA 5KN3A 4IP1A 3CSHA 1GTUA 3KMOA 3A2XA 4L0UA 3ZREA 3ME7A 5D8IA 2LJAA 1M9AA 4F9ZA 4ZBBA 2FWFA 4K0NA 2MZCA 2F3MA 4L8EA 1QGVA 4JZQA 2H30A 2TRXA 1FG4A 4YKGA 3PINA 5DVBA 1Z7RA 4ECJA 2LTKA 2B3SA 1C72A 2FD3A 2HZEA 4GF0A 1O8WA 2K9FA 1T3BA 1K3YA 2CX4A 3UBLA 2HZEB 2A4VA 2H72A 1WPIA 2VCWA 4JEDA 2JSZA 2NTOA 5B8AA 1ZZYA 2L57A 5J9CA 1SD8A 3UL3A 3MSZA 2P0GA 3GHAA 4XTSA 2PGTA 3D21A 4WBRD 2AJQB 4HU9A 3IA1A 2H6XA 4BVYA 4MH2A 2O7KA 1BX9A 3HJPA 2VLUA 1O7UA 3QAGA 2GQKA 4EC0A 3H93A 1G6WA 2F51A 5ABRA 1LJRA 2AUVA 2WJUA 4BVYB 3HKRA 1M2BA 5HR0A 3FZ9A 3LQ7A 1FW1A 4HJMA 5H5QA 4PUFC 3MNGA 1YEXA 2I1UA 3RPPA 1MDKA 2CVKA 1O8XA 1X9WB 3VWWA 3A5IA 1YKCA 1CQGA 1Z7PA 1ERUA 4YAVA 2KP2A 4FQUA 4FYUA 4IQ1A 1PFOA 1UVZA 3UBKA 2VCVA 1SU9A 4I8BA 1U87A 4TR4A 4GWRA 4AJ6A 6GSYA 4J2FA 18GSA 1G7EA 3G9BA 2I4AA 5E59A 4AF2A 1F6MC 2GLRA 1BG5A 2B5EA 4GCIA 3VPQA 2M72A 1WRYA 2IMDA 4DEJA 1R4WA 4IELA 3ZVJD 5EPFA 3HD5A 2X64A 2H73A 8GSSA 1M3IA 3GURA 5L71A 3LXZA 1TU7A 2VM1A 1X5CA 3KP9A 1PRXA 2MMNA 2V2GA 1U88A 2YV7A 3QR6A 3LEFA 3A3TA 2CAIA 1B9YC 2LEGA 3P7XA 2YANA 2I9HA 4MCUA 2C0DA 5GSSA 1R5AA 1EEJA 2C4JA 2HLSA 4I2TA 2YCDA 2LS5A 5IMCA 5J41A 2R0PA 4NV5A 2F8FA 3O6TA 2KOKA 1GTAA 2LRCA 3HVSA 1NHOA 1MD3A 2DLXA 2HI7A 3M9KA 2HE3A 5KOXA 2LKUA 4QL9A 1K0OA 4ZIJA 2I81A 2RM6A 1SKSB 3DEXA 2QA2A 3WT2A 2HRFA 3GL3A 3D6IA 4YAPA 6GSUA 2F9SA 4JBBA 1G6YA 3TJFA 3RHCA 5D9VA 3MYDA 1SL2B 1F37A 2IMKA 1J9BA 6GSXA 2BJXA 2H1GA 4KCAA 5G31A 4Z2TA 5B6MA 4MMMA 4HJ2A 2H1DA 2DJ2A 3WYWA 1R7HA 3RPNA 1T4YA 4GQCA 1M7TA 1VF4A 4TKYA 3FY7A 10GSA 4NMUA 2R37A 5CRGA 2GZZA 16GSA 4G0LA 4BA7A 5ECIB 2PBJA 3M8NA 3IR4A 4K5SA 1KTEA 2AAWA 3TRXA 1R26A 2WB9A 1AXDA 4ZILA 4I97A 1M2AA 2R3XA 2YNXA 3ZLPA 2DMLA 3EVIA 5B8BA 5H5RA 1ZYEA 2H0IA 4DSRA 4POMA 4MJAA 1B4PA 4ZB6A 1TU8A 3VI5A 1SENA 3L0HA 1K0DA 4OMVA 4OFTA 1SL1B 3APQA 4F0CA 4EDYA 1GUKA 3C7MA 1AQXA 3TRPA 4EE0A 4LL4B 3SBCA 1XOBA 3GSSA 1GRXA 5AISA 1XW6A 5IO0A 3BCKA 4KA0A 3QFBC 2JZTA 2H1BA 5DCGA 3RAZA 2BTOT 1ZYQB 3FKFA 3IAM2 1XWCA 4ILFA 4WF5A 2A2RA 3FR3A 2JACA 2LNSA 3GMFA 4KDYA 1SJIA 2DJKA 2VCXA 3KD0A 1JZDA 1XWAA 2LRNA 3ERFA 5CRHA 1N2AA 1WWJA 2VL2A 4ZL9A 3DWVA 4MZCA 3IAS2 1YY7A 3TGZA 4JR6A 4Z7XA 2Z9SA 5G1LA 5DJMA 2TIRA 1I5GA 1DBYA 3KH9A 4GLTA 5B7CA 4ULXA 3GV1A 5KN0A 2LRTA 1TXXA 4HU7A 1Z6NA 4CHSA 2NDOA 2IMIA 3TKSA 3ZTLA 4IGJA 1Y6EA 3F4SA 2H0GA 4XIHA 4ICYA 4TW5A 3QCPA 2N5AA 3GH6A 1MD4A 5JWQB 2H74A 2YWIA 3TJGA 4NXIA 4IP6A 1U3IA 3EMPA 4V1Ap 4AJ8A 3TJJA 5F0GA 3ZMLA 5CAXA 4TR1B 3PH9A 4YKFA 2GQMA 4DSQA 1Z3EA 1XPVA 4KX4A 4NHWA 3GFKA 4G2EA 5JCGA 1OC3A 2C0GA 2K18A 2OA7A 2DBCA 12GSA 4LL1B 5IOXA 3IHQA 5ECSA 3ZMKA 1TI1A 4K6XA 4OCFA 3F4TA 1XWGA 2L6CA 2RIIA 3TKSE 3J7Yk 3QFAC 1ZYNA 1W4VA 5EVOA 3TRQA 1SK1A 4H86A 3WGDA 3PR8A 1QQ2A 1GL8A 1OC8A 4HI7A 2WDUA 1OC9A 4OO4A 3AY8A 2A2PA 3F6DA 3PGTA 2R0GA 2H66A 4FYBA 2HSYA 5DQYA 2XC2A 1GSUA 2HRKA 1S3CA 2CT6A 1OC9B 1K0CA 6GSTA 4G0KA 1PL2A 1GSDA 3ED3A 2R4VA 2V32A 4DSSA 4MF6A 3U6VA 1FB6A 2ALBA 1SJZA 2QGVA 3FR6A 2YN1A 3TOTA 4K7NA 3UIWA 2I3YA 2JSYA 2X8HA 4G19A 2C8UA 4Z2RA 3KH7A 1XOAA 2V6KA 5A5KA 4F03A 3S9FA 4I5QA 5G5FA 5CYYA 5J5NA 2GSRA 3NZNA 2PVQA 1ZMAA 1XZOA 3TJBA 5AIVA 4V2LA 3A2VA 1JZOA 20GSA 5J4UA 5CRDA 1GSQA 1YQ1A 2FGXA 2YWNA 3P8WA 3CTGA 4RQXA 4K2DA 1BQ7A 1B48A 1YEPA 3QMXA 5INYA 4WXTA 2UZ8A 5J3RA 5HR3A 5G5EA 3DD3A 2IPAA 4KGIA 3HZ4A 1XVWA 2M80A 5ELAA 2H0HA 5IMAA 1SL0B 3N9JA 4E8EA 4G9HA 3GKMA 4N11A 2HZFA 1OAZA 1J08A 3GKNA 4L5LA 1VRSD 1TRSA 1FOVA 3NOFA 3KMNA 3BOAA 2RUFA 3CMIA 3C1RA 2OADA 3LXTA 19GSA 4NAXA 2AYTA 2D2ZA 1JZWA 5F07A 3GKKA 2O89A 5EY6A 3ZRDA 1V57A 2GGTA 1TP9A 4AJ7A 1NM3A 2R2JA 1I9DA 6GSVA 3KP8A 2QKEA 4HUAA 5DAKA 1GULA 1M0UA 2OE0A 1A0RP 1PD21 4O5RA 1U6TA 1EOHA 3RHBA 2FWEA 1ACVA 3R2QA 1PQNA 2GSSA 3IK7A 5ELGA 3KZQA 3EC3A 3UVHA 1A2JA 1YDKA 5J9BA 4IKHA 4HDEA 1PKZA 2VIMA 2HRNA 2P5RA 5DJLA 1SD9A 2N5FA 2JADA 2OACA 3BD2A 1BAYA 4WBJA 5CRWA 9GSSA 3HHVA 2CAQA 2OE3A 1GSSA 2CVDA 2GDRA 2VO4A 4KNDA 2X99A 14GSA 3A2WA 1A0FA 3G7JA 4TRXA 5ID2A 2LNTA 2HSMA 3LYKA 1SJ6A 4HSCX 4OO5A 1XWKA 3CXGA 1A2LA 4PXOA 5IMVA 3D22A 3PPUA 5COHA 3IRAA 1SKRB 3GUSA 3CSIA 2GVPA 3GTUA 5HFGA 1Z9HA 4TXOA 3FR9A 4YQMA 3GTUB 1N8JA 4P3YB 3WGEA 4POLA 1TJDA 2IJYA 4MPGA 1YF1A 1MEKA 5IMZA 1O6JA 3G7IA 1A8YA 2IMEA 4MZBA 4EO3A 5DQSA 4KF9A 1OKTA 4IN0A 2L4QA 3KCMA 3WD6A 1ERTA 2WULA 5JWRB 1MDJA 3DYRA 2YJHA 2IFQA 4D73A 1F2EA 2H6YA 3VPTA 5DALA 2LV3A 1X5EA 4Z2UA 4ZB8A 3DKSA 1XVQA 2RUEA 4MA9A 5DALB 1WOUA 3NIVA 2EC4A 1OKDA 1TRUA 4X43A 2VCQA 5GAND 1Q98A 3LGCA 4JE1A 4O92A 2JU5A 3VI7A 3F63A 3QDNA 2MBTA 1JLVA 2FA8A 4ZXGA 5IMFA 4Q5QA 5JWOB 1IYHA 2XBIA 2VCTA 4Q5NA 3M9JA 2NBSA 4N10A 5ECRB 1HQOA 6GSWA 1THXA 3HCZA 4NPBA 3IC8A 3CRUA 2OJLA 1V40A 4XHMA 3ZFBA 4V2MA 3FEUA 1MTCA 4O5QA 3O3TA 3F4RA 3ZZXA 4WF4A 5ENUA 3E9JB 2J23A 2EIOA 2H01A 4RUVA 4ECCA 2L59A 4IQAA 1PX6A 3GSTA 3HY2A 2GT6A 4L0WA 1SK0A 5KN2A 2VL3A 1DE1A 4IHUA 5EL8A 3I9V2 3F3RA 3Q6OA 1YJ6A 5BMUA 2L4CA 4LMWA 1OE7A 4LMVA 3O76A 4PUAA 4MP4A 4GSSA 1X0RA 1HYUA 3HJMA 1V2AA 2E7PA 3G7YA 5ECHB 3E0UA 2CQ9A 3IV4A 3VWVA 3D4MA 3HZ8A 2LJRA 2FCHA 1JZRA 1PSQA 2DJJA
chains in the Genus database with same CATH topology
3LG6A 2VL9A 2XPDA 3ZL5A 2GSQA 5F06A 2WRTA 1HD2A 2CV4A 1X9SB 1TOFA 5B6NA 4EXJA 5D73A 3GRXA 1TTZA 2PPTA 3IDVA 1URMA 2P31A 1EOGA 4BVXA 3DGQA 4EL1A 1TW9A 1GTIA 2AV4A 1GSYA 4BVXB 2CX3A 2V41A 3L9SA 1Z5YE 3KJYA 3ZIJA 2ES7A 5AIXA 3DVWA 4EUYA 2DC5A 1LU4A 2R5GA 3HJOA 4TR3A 1JHBA 1T1VA 3LORA 1O85A 5ECQB 1ILOA 2OBIA 4JU5A 3DXBA 3TOUA 3H1NA 17GSA 1WE0A 4HS1A 1AC1A 1HNBA 2AHEA 1FOHA 1G7OA 3C73A 2LQOA 1ABAA 2B5XA 5FHIA 1USBA 1QXHA 1XW5A 1GNWA 5HFIA 1OVNA 2L5OA 3BJ5A 3TCOA 2DSAA 3FZ4A 3MAKA 1M99A 4XS6A 1GWCA 2DJ0A 3DMLA 4IBPA 3CTFA 3VWUA 3I43A 4MJCA 1FAAA 3KTLA 1PMTA 3C1SA 2GZYA 5CP1A 2R0CA 4GQFA 4K1FA 5JCUA 5A4UA 1A2MA 3ZVJA 1H75A 2FHEA 2PERA 4RQRA 1EV4A 2QC7A 5F8BA 4ECIA 4HZ2A 3LJRA 1QFNA 1U3AA 2H1AA 6GSSA 3UVTA 3TJKA 1DSBA 4KDUA 3QPMA 2K8SA 3M1GA 1ZL9A 2YOIA 3LSZA 5C04A 1FVJA 1E6BA 1XIYA 2H76A 4IVFA 1XFLA 3GA4A 4KSMA 2B7JA 2WFCA 3VWXA 1O73A 1AQWA 2VAFA 2E2GA 4TVEA 3RBTA 4KUNA 1FB0A 3P2AA 3W8SA 2ON5A 3QAVA 5HFKA 4ZL7A 4JR4A 3KM6A 1S3AA 3EE2A 1TRVA 2G2QA 4F2IA 2WCIA 1NW2A 3DVXA 5DBQA 2HT9A 1H4OA 2MMOA 1ZGNA 4DSSB 4PGTA 2FA4A 2PU9C 1ZCPA 2ON7A 4RI7A 2C1YA 2CZ3A 4IJIA 4CY6A 4E8HA 2A4HA 4FO5A 1R5PA 4N0VA 1TK8B 2RLIA 3UMAA 3GX8A 2DIYA 5JCWA 5LD0A 1FHEA 1RK4A 1E2YA 2G0FA 3OR5A 2WGRA 1SKWB 4EDZA 1DE2A 2VCZA 1QMVA 4XS4A 3C8EA 1W89A 3F6FA 5ECKB 5KN1A 4TN8A 1FVKA 1RW1A 2VLTA 1GLQA 5CNWA 4GTUA 4XS4B 1XXUA 4MZWA 1ERWA 2JZSA 3BCIA 3MDKA 3QAWA 2N5BA 3UAPA 1TK5B 4N30A 1J0FA 2H6ZA 1WIKA 3EYTA 1MDIA 5C00A 4OFNA 4RI6A 22GSA 1A8LA 2XHFA 4V2NA 2J9HA 1YKAA 2WZ9A 4KB3A 3H8QA 3KIJA 5IPHA 3MWHA 11GSA 2R6KA 3KGKA 4YQUA 1K0BA 4Q5RA 4F0BA 2O8VB 4L5OA 4V1Ag 4CW9A 1EWXA 1GLPA 4MH3A 3WT1A 1FO5A 3P90A 1B9XC 1SYXA 2F8AA 3M3MA 2ZCTA 1UN2A 1Q4JA 3F8UA 1V9WA 3IXRA 3IHGA 1BYEA 4NHZA 4USSA 4O7HA 3FZ5A 4ZL8A 5D9WA 3J7Yb 2IL3A 4GXZA 5DAKB 2HFDA 2B5YA 3APSA 5G1KA 4WR4A 1AW9A 1ERVA 4YH2A 2YZHA 3GL5A 2B1LA 2PN8A 2V1MA 2K6VA 5IIZA 3GKXA 4PQIA 3UEMA 3ZITA 2OE1A 2X49A 1VF1A 3FZAA 1V58A 4HZ4A 2C80A 2L6DA 4PNGA 4XCSA 5KOWA 2GT5A 1F3BA 3K8NA 5D96A 3Q74A 3BBYA 2FNOA 5ECMB 2C3TA 3E3EA 1GSFA 1IYIA 4X1UA 4J57E 2QSIA 2FUG2 4ZBAA 2FWGA 3MIXA 3ERGA 1A24A 2YP6A 4EKZA 1CQHA 5ECOB 1EGOA 3ZYWA 3VK9A 5A4WA 1GNEA 4FYCA 2HNLA 1Z6MA 2GSTA 1B8XA 3N5OA 4KW6A 2FWHA 1TK0B 3H4KA 5ID2B 3FW2A 3V1WA 3EU3A 4WEYA 2VM2A 2XBQA 4PURA 3FMWA 3H79A 2P5QA 2EIQA 2H70A 5IPGA 3ISOA 4K8MA 1VGLA 1ZOFA 5DCHA 4O5UA 4TOPA 5GAPD 3TKRA 3LYPA 4KCEA 1HNCA 4PQ1A 4MPFA 1BJXA 4IJ3A 4TXOB 4X4JA 2V6OA 3HYPA 1THOA 1DUGA 4MABA 4GSNA 3L78A 3VFIA 4K7OA 3GYKA 3GH9A 2FY6A 3IC4A 1TKDB 2IFQB 1AIUA 3I6AA 3UJ1A 4D73B 1PN0A 1OYJA 1B4QA 1T00A 2CVBA 1X9MB 1K3OA 1S3DA 2JZRA 3KXOA 5CO3A 3EURA 2YV9A 1O81A 1T4ZA 1QUWA 3IK9A 3W6GA 4POKA 4QL7A 4DVCA 5G2ZA 4IW9A 4ML6A 2CA8A 2IWTA 4ECBA 2GTUA 3EMXA 2GS3A 4MF7A 2RM5A 5A4VA 5HR1A 2B6MA 2KUCA 4F82A 2MYGA 1WMJA 2HXKA 2GZPA 3CYNA 4TR0A 1KBNA 3ZIVA 5IOWA 3TKQA 2X8GA 5IO2A 4BWSA 2NPBA 3QOUA 2O85A 4J56E 2KP1A 4IS0A 2LUSA 5LCZA 1GUMA 1LBKA 4EIPA 1XW9A 4ZB9A 3CRTA 5BRTA 2REMA 5IMDA 1YZXA 1F9MA 3D4TA 3HXSA 3GN3A 4BL7A 5D93A 1KNGA 1HNAA 1V98A 2O87A 2TRCP 1VF2A 4ML1A 3I69A 3L4NA 1EGRA 3EU4A 4BL7B 4PNFA 4MK3A 3F9UA 3TB2A 2ZUPA 3W8JA 2VOCA 4HQZA 3ZFLA 4MNNA 2YZUA 4OCEA 5E4WA 4K5RA 1M2DA 1SYRA 2C0EA 5KEJA 5GZZB 2MBSA 2B1KA 2YWMA 1OE8A 1TRWA 2L5LA 1NSWA 2DKIA 2VLVA 3CSJA 1UC7A 1TDIA 1K0NA 4EIQA 3LWAA 4ZBDA 2KLXA 3TUEA 3FHKA 2YPMA 1G0TA 2X4AA 3FK8A 5AN1A 4ISDA 1ON4A 4GSTA 2DKHA 3EINA 1SK2A 1WP0A 2H75A 1PX7A 5HR2A 1NHYA 3IE3A 2EIRA 3RDWA 4K2XA 4MLYA 4XS1A 4I6XA 4OWYA 2DMMA 2LSTA 4AGSA 3TKPA 3D5JA 2IN3A 2E2MA 4EF0A 4KDXA 2HSHA 5HQPA 1GUHA 1XWBA 5ECLB 4FIWA 2BMXA 4KH7A 4NWYA 4EVMA 2X8CA 3D0ZA 1EEMA 2GQLA 2C3QA 3APOA 2KHPA 1M9BA 4X0XA 2C3NA 4A5PA 1JFUA 4O32A 3ERWA 3UARA 3IOSA 1ST9A 1PKWA 4I2UA 2VD1A 4BWQA 4ID0A 1WJKA 2JL4A 4TR1A 1JLWA 3GIXA 1F3AA 4POBA 3US3A 2ZNMA 2A2SA 4WKWA 3U5RE 4YQVA 4MDCA 1KEBA 1GH2A 1ML6A 3Q18A 3HDCA 4WR5A 4OD7A 1TI3A 4MJEA 3EWLA 2E0QA 1UA5A 3FYGA 3UOMA 2OBKA 3Q19A 2PWJA 2VL2C 4K0GA 2PUKC 3R3EA 5IQYA 2VUPA 1EP7A 1PN9A 2LJKA 1QK8A 4QQ7A 2H19A 4FH8A 5CREA 1AUCA 1K0AA 2MMZA 2M46A 4KAEA 3IBHA 1VF3A 4PX1A 5FT3A 5ECPB 1BEDA 2PVOC 3L9VA 3DRNA 2PMTA 2VD0A 2NVLA 2CZ2A 3LW9A 2K8VA 2AB6A 3KEBA 2B7KA 2DIZA 3TKSC 5FWGA 3L9UA 4MJBA 3JCML 2FLSA 3LFLA 1GTBA 1PA3A 1EV9A 2HYXA 1PL1A 4PQHA 2DJ1A 2WS2A 7GSSA 3A5WA 4K7IA 1GP1A 4NV2A 2H71A 4LA1A 3WGXA 2QA1A 5G30A 3HVXA 2DJ3A 1K3LA 3DIEA 5AGYA 3VURA 5D9XA 1ZYPA 2YWOA 3VLNA 1XCCA 5LNKe 4KE3A 4CY8A 4Q5FA 2IIYA 4N0ZA 4KSOA 1GSEA 4G0IA 3M0FA 1K0MA 1PGTA 2XPEA 5H5SA 1EZKA 1T7PB 3HA9A 4JRRA 4K9ZA 1T8EB 2C0FA 5GSTA 4HEA2 3FRCA 3EPTA 4WETA 5D9TA 1AAZA 1XBSA 3SWLA 2OKAA 3GNJA 2MMAA 5DDLA 4BPYA 4HOJA 5IM9A 13GSA 1YF0A 4TXVA 3KTBA 4PTSA 3IPZA 4XRAA 4MF5A 3GX0A 1AQVA 2YJ7A 5F05A 1X5DA 1A23A 4CDOA 4G10A 3C71A 3CBUA 4HQSA 2HRAA 2IMFA 5ECNB 3QD9A 4ACSA 3HVVA 1EP8A 4GRFA 3F0IA 4LLRA 4XRDA 2LQQA 3ME8A 2H8LA 1RQMA 3F3QA 3TDGA 1Y25A 4OFMA 5KN3A 4IP1A 3CSHA 1GTUA 3KMOA 3A2XA 4L0UA 3ZREA 3ME7A 5D8IA 2LJAA 1M9AA 4F9ZA 4ZBBA 2FWFA 4K0NA 2MZCA 2F3MA 4L8EA 1QGVA 4JZQA 2H30A 2TRXA 1FG4A 4YKGA 3PINA 5DVBA 1Z7RA 4ECJA 2LTKA 2B3SA 1C72A 2FD3A 2HZEA 4GF0A 1O8WA 2K9FA 1T3BA 1K3YA 2CX4A 3UBLA 2HZEB 2A4VA 2H72A 1WPIA 2VCWA 4JEDA 2JSZA 2NTOA 5B8AA 1ZZYA 2L57A 5J9CA 1SD8A 3UL3A 3MSZA 2P0GA 3GHAA 4XTSA 2PGTA 3D21A 4WBRD 2AJQB 4HU9A 3IA1A 2H6XA 4BVYA 4MH2A 2O7KA 1BX9A 3HJPA 2VLUA 1O7UA 3QAGA 2GQKA 4EC0A 3H93A 1G6WA 2F51A 5ABRA 1LJRA 2AUVA 2WJUA 4BVYB 3HKRA 1M2BA 5HR0A 3FZ9A 3LQ7A 1FW1A 4HJMA 5H5QA 4PUFC 3MNGA 1YEXA 2I1UA 3RPPA 1MDKA 2CVKA 1O8XA 1X9WB 3VWWA 3A5IA 1YKCA 1CQGA 1Z7PA 1ERUA 4YAVA 2KP2A 4FQUA 4FYUA 4IQ1A 1UVZA 3UBKA 2VCVA 1SU9A 4I8BA 1U87A 4TR4A 4GWRA 4AJ6A 6GSYA 4J2FA 18GSA 1G7EA 3G9BA 2I4AA 5E59A 4AF2A 1F6MC 2GLRA 1BG5A 2B5EA 4GCIA 3VPQA 2M72A 1WRYA 2IMDA 4DEJA 1R4WA 4IELA 3ZVJD 5EPFA 3HD5A 2X64A 2H73A 8GSSA 3GURA 5L71A 3LXZA 1TU7A 2VM1A 1X5CA 3KP9A 1PRXA 2MMNA 2V2GA 1U88A 2YV7A 3QR6A 3LEFA 3A3TA 2CAIA 1B9YC 2LEGA 3P7XA 2YANA 2I9HA 4MCUA 2C0DA 5GSSA 1R5AA 1EEJA 2C4JA 2HLSA 4I2TA 2YCDA 2LS5A 5IMCA 5J41A 2R0PA 4NV5A 2F8FA 3O6TA 2KOKA 1GTAA 2LRCA 3HVSA 1NHOA 1MD3A 2DLXA 2HI7A 3M9KA 2HE3A 5KOXA 2LKUA 4QL9A 1K0OA 4ZIJA 2I81A 2RM6A 1SKSB 3DEXA 2QA2A 3WT2A 2HRFA 3GL3A 3D6IA 4YAPA 6GSUA 2F9SA 4JBBA 1G6YA 3TJFA 3RHCA 5D9VA 3MYDA 1SL2B 1F37A 2IMKA 1J9BA 6GSXA 2BJXA 2H1GA 4KCAA 5G31A 4Z2TA 5B6MA 4MMMA 4HJ2A 2H1DA 2DJ2A 3WYWA 1R7HA 3RPNA 1T4YA 4GQCA 1M7TA 1VF4A 4TKYA 3FY7A 10GSA 4NMUA 2R37A 5CRGA 2GZZA 16GSA 4G0LA 4BA7A 5ECIB 2PBJA 3M8NA 3IR4A 4K5SA 1KTEA 2AAWA 3TRXA 1R26A 2WB9A 1AXDA 4ZILA 4I97A 1M2AA 2R3XA 2YNXA 3ZLPA 2DMLA 3EVIA 5B8BA 5H5RA 1ZYEA 2H0IA 4DSRA 4POMA 4MJAA 1B4PA 4ZB6A 1TU8A 3VI5A 1SENA 3L0HA 1K0DA 4OMVA 4OFTA 1SL1B 3APQA 4F0CA 4EDYA 1GUKA 3C7MA 1AQXA 3TRPA 4EE0A 4LL4B 3SBCA 1XOBA 3GSSA 1GRXA 5AISA 1XW6A 5IO0A 3BCKA 4KA0A 3QFBC 2JZTA 2H1BA 5DCGA 3RAZA 2BTOT 1ZYQB 3FKFA 3IAM2 1XWCA 4ILFA 4WF5A 2A2RA 3FR3A 2JACA 2LNSA 3GMFA 4KDYA 1SJIA 2DJKA 2VCXA 3KD0A 1JZDA 1XWAA 2LRNA 3ERFA 5CRHA 1N2AA 1WWJA 2VL2A 4ZL9A 3DWVA 4MZCA 3IAS2 1YY7A 3TGZA 4JR6A 4Z7XA 2Z9SA 5G1LA 5DJMA 2TIRA 1I5GA 1DBYA 3KH9A 4GLTA 5B7CA 4ULXA 3GV1A 5KN0A 2LRTA 1TXXA 4HU7A 1Z6NA 4CHSA 2NDOA 2IMIA 3TKSA 3ZTLA 4IGJA 1Y6EA 3F4SA 2H0GA 4XIHA 4ICYA 4TW5A 3QCPA 2N5AA 3GH6A 1MD4A 5JWQB 2H74A 2YWIA 3TJGA 4NXIA 4IP6A 1U3IA 3EMPA 4V1Ap 4AJ8A 3TJJA 5F0GA 3ZMLA 5CAXA 4TR1B 3PH9A 4YKFA 2GQMA 4DSQA 1Z3EA 1XPVA 4KX4A 4NHWA 3GFKA 4G2EA 5JCGA 1OC3A 2C0GA 2K18A 2OA7A 2DBCA 12GSA 4LL1B 5IOXA 3IHQA 5ECSA 3ZMKA 1TI1A 4K6XA 4OCFA 3F4TA 1XWGA 2L6CA 2RIIA 3TKSE 3J7Yk 3QFAC 1ZYNA 1W4VA 5EVOA 3TRQA 1SK1A 4H86A 3WGDA 3PR8A 1QQ2A 1GL8A 1OC8A 4HI7A 2WDUA 1OC9A 4OO4A 3AY8A 2A2PA 3F6DA 3PGTA 2R0GA 2H66A 4FYBA 2HSYA 5DQYA 2XC2A 1GSUA 2HRKA 1S3CA 2CT6A 1OC9B 1K0CA 6GSTA 4G0KA 1PL2A 1GSDA 3ED3A 2R4VA 2V32A 4DSSA 4MF6A 3U6VA 1FB6A 2ALBA 1SJZA 2QGVA 3FR6A 2YN1A 3TOTA 4K7NA 3UIWA 2I3YA 2JSYA 2X8HA 4G19A 2C8UA 4Z2RA 3KH7A 1XOAA 2V6KA 5A5KA 4F03A 3S9FA 4I5QA 5G5FA 5CYYA 5J5NA 2GSRA 3NZNA 2PVQA 1ZMAA 1XZOA 3TJBA 5AIVA 4V2LA 3A2VA 1JZOA 20GSA 5J4UA 5CRDA 1GSQA 1YQ1A 2FGXA 2YWNA 3P8WA 3CTGA 4RQXA 4K2DA 1BQ7A 1B48A 1YEPA 3QMXA 5INYA 4WXTA 2UZ8A 5J3RA 5HR3A 5G5EA 3DD3A 2IPAA 4KGIA 3HZ4A 1XVWA 2M80A 5ELAA 2H0HA 5IMAA 1SL0B 3N9JA 4E8EA 4G9HA 3GKMA 4N11A 2HZFA 1OAZA 1J08A 3GKNA 4L5LA 1VRSD 1TRSA 1FOVA 3NOFA 3KMNA 3BOAA 2RUFA 3CMIA 3C1RA 2OADA 3LXTA 19GSA 4NAXA 2AYTA 2D2ZA 1JZWA 5F07A 3GKKA 2O89A 5EY6A 3ZRDA 1V57A 2GGTA 1TP9A 4AJ7A 1NM3A 2R2JA 1I9DA 6GSVA 3KP8A 2QKEA 4HUAA 5DAKA 1GULA 1M0UA 2OE0A 1A0RP 1PD21 4O5RA 1U6TA 1EOHA 3RHBA 2FWEA 1ACVA 3R2QA 1PQNA 2GSSA 3IK7A 5ELGA 3KZQA 3EC3A 3UVHA 1A2JA 1YDKA 5J9BA 4IKHA 4HDEA 1PKZA 2VIMA 2HRNA 2P5RA 5DJLA 1SD9A 2N5FA 2JADA 2OACA 3BD2A 1BAYA 4WBJA 5CRWA 9GSSA 3HHVA 2CAQA 2OE3A 1GSSA 2CVDA 2GDRA 2VO4A 4KNDA 2X99A 14GSA 3A2WA 1A0FA 3G7JA 4TRXA 5ID2A 2LNTA 2HSMA 3LYKA 1SJ6A 4OO5A 1XWKA 3CXGA 1A2LA 4PXOA 5IMVA 3D22A 3PPUA 5COHA 3IRAA 1SKRB 3GUSA 3CSIA 2GVPA 3GTUA 5HFGA 1Z9HA 4TXOA 3FR9A 4YQMA 3GTUB 1N8JA 4P3YB 3WGEA 4POLA 1TJDA 2IJYA 4MPGA 1YF1A 1MEKA 5IMZA 1O6JA 3G7IA 1A8YA 2IMEA 4MZBA 4EO3A 5DQSA 4KF9A 1OKTA 4IN0A 2L4QA 3KCMA 3WD6A 1ERTA 2WULA 5JWRB 1MDJA 3DYRA 2YJHA 2IFQA 4D73A 1F2EA 2H6YA 3VPTA 5DALA 2LV3A 1X5EA 4Z2UA 4ZB8A 3DKSA 1XVQA 2RUEA 4MA9A 5DALB 1WOUA 3NIVA 2EC4A 1OKDA 1TRUA 4X43A 2VCQA 5GAND 1Q98A 3LGCA 4JE1A 4O92A 2JU5A 3VI7A 3F63A 3QDNA 2MBTA 1JLVA 2FA8A 4ZXGA 5IMFA 4Q5QA 5JWOB 1IYHA 2XBIA 2VCTA 4Q5NA 3M9JA 2NBSA 4N10A 5ECRB 1HQOA 6GSWA 1THXA 3HCZA 4NPBA 3IC8A 3CRUA 2OJLA 1V40A 4XHMA 3ZFBA 4V2MA 3FEUA 1MTCA 4O5QA 3O3TA 3F4RA 3ZZXA 4WF4A 5ENUA 3E9JB 2J23A 2EIOA 2H01A 4RUVA 4ECCA 2L59A 4IQAA 1PX6A 3GSTA 3HY2A 2GT6A 4L0WA 1SK0A 5KN2A 2VL3A 1DE1A 4IHUA 5EL8A 3I9V2 3F3RA 3Q6OA 1YJ6A 5BMUA 2L4CA 4LMWA 1OE7A 4LMVA 3O76A 4PUAA 4MP4A 4GSSA 1X0RA 1HYUA 3HJMA 1V2AA 2E7PA 3G7YA 5ECHB 3E0UA 2CQ9A 3IV4A 3VWVA 3D4MA 3HZ8A 2LJRA 2FCHA 1JZRA 1PSQA 2DJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LG6 A;  2VL9 A;  2XPD A;  3ZL5 A;  2GSQ A;  5F06 A;  2WRT A;  1HD2 A;  2CV4 A;  1X9S B;  1TOF A;  5B6N A;  4EXJ A;  5D73 A;  3GRX A;  1TTZ A;  2PPT A;  3IDV A;  1URM A;  2P31 A;  1EOG A;  4BVX A;  3DGQ A;  4EL1 A;  1TW9 A;  1GTI A;  2AV4 A;  1GSY A;  2CX3 A;  2V41 A;  3L9S A;  1Z5Y E;  3KJY A;  3ZIJ A;  2ES7 A;  5AIX A;  3DVW A;  4EUY A;  2DC5 A;  1LU4 A;  2R5G A;  3HJO A;  4TR3 A;  1JHB A;  1T1V A;  3LOR A;  1O85 A;  5ECQ B;  1ILO A;  2OBI A;  4JU5 A;  3DXB A;  3TOU A;  3H1N A;  17GS A;  1WE0 A;  4HS1 A;  1AC1 A;  1HNB A;  2AHE A;  1G7O A;  3C73 A;  2LQO A;  1ABA A;  2B5X A;  5FHI A;  1USB A;  1QXH A;  1XW5 A;  1GNW A;  5HFI A;  1OVN A;  2L5O A;  3BJ5 A;  3TCO A;  2DSA A;  3FZ4 A;  3MAK A;  1M99 A;  4XS6 A;  1GWC A;  2DJ0 A;  3DML A;  4IBP A;  3CTF A;  3VWU A;  3I43 A;  4MJC A;  1FAA A;  3KTL A;  1PMT A;  3C1S A;  2GZY A;  5CP1 A;  4GQF A;  4K1F A;  5JCU A;  5A4U A;  1A2M A;  3ZVJ A;  1H75 A;  2FHE A;  2PER A;  4RQR A;  1EV4 A;  2QC7 A;  5F8B A;  4ECI A;  4HZ2 A;  3LJR A;  1QFN A;  1U3A A;  2H1A A;  6GSS A;  3UVT A;  3TJK A;  1DSB A;  4KDU A;  3QPM A;  2K8S A;  3M1G A;  1ZL9 A;  2YOI A;  3LSZ A;  5C04 A;  1FVJ A;  1E6B A;  1XIY A;  2H76 A;  4IVF A;  1XFL A;  3GA4 A;  4KSM A;  2B7J A;  2WFC A;  3VWX A;  1O73 A;  1AQW A;  2VAF A;  2E2G A;  4TVE A;  3RBT A;  4KUN A;  1FB0 A;  3P2A A;  3W8S A;  2ON5 A;  3QAV A;  5HFK A;  4ZL7 A;  4JR4 A;  3KM6 A;  1S3A A;  3EE2 A;  1TRV A;  2G2Q A;  4F2I A;  2WCI A;  1NW2 A;  3DVX A;  5DBQ A;  2HT9 A;  1H4O A;  2MMO A;  1ZGN A;  4DSS B;  4PGT A;  2FA4 A;  2PU9 C;  1ZCP A;  2ON7 A;  4RI7 A;  2C1Y A;  2CZ3 A;  4IJI A;  4E8H A;  4FO5 A;  1R5P A;  4N0V A;  1TK8 B;  2RLI A;  3UMA A;  3GX8 A;  2DIY A;  5JCW A;  5LD0 A;  1FHE A;  1RK4 A;  1E2Y A;  2G0F A;  3OR5 A;  2WGR A;  1SKW B;  4EDZ A;  1DE2 A;  2VCZ A;  1QMV A;  4XS4 A;  3C8E A;  1W89 A;  3F6F A;  5ECK B;  5KN1 A;  4TN8 A;  1FVK A;  1RW1 A;  2VLT A;  1GLQ A;  5CNW A;  4GTU A;  4XS4 B;  1XXU A;  4MZW A;  1ERW A;  2JZS A;  3BCI A;  3MDK A;  3QAW A;  2N5B A;  3UAP A;  1TK5 B;  4N30 A;  1J0F A;  2H6Z A;  1WIK A;  3EYT A;  1MDI A;  5C00 A;  4OFN A;  4RI6 A;  22GS A;  1A8L A;  2XHF A;  4V2N A;  2J9H A;  1YKA A;  2WZ9 A;  4KB3 A;  3H8Q A;  3KIJ A;  5IPH A;  3MWH A;  11GS A;  2R6K A;  3KGK A;  4YQU A;  1K0B A;  4Q5R A;  4F0B A;  2O8V B;  4L5O A;  4V1A g;  4CW9 A;  1EWX A;  1GLP A;  4MH3 A;  3WT1 A;  1FO5 A;  3P90 A;  1B9X C;  1SYX A;  2F8A A;  3M3M A;  2ZCT A;  1UN2 A;  1Q4J A;  3F8U A;  1V9W A;  3IXR A;  1BYE A;  4NHZ A;  4O7H A;  3FZ5 A;  4ZL8 A;  5D9W A;  3J7Y b;  2IL3 A;  4GXZ A;  5DAK B;  2HFD A;  2B5Y A;  3APS A;  5G1K A;  4WR4 A;  1AW9 A;  1ERV A;  4YH2 A;  2YZH A;  3GL5 A;  2B1L A;  2PN8 A;  2V1M A;  2K6V A;  5IIZ A;  3GKX A;  4PQI A;  3UEM A;  3ZIT A;  2OE1 A;  1VF1 A;  3FZA A;  1V58 A;  4HZ4 A;  2C80 A;  2L6D A;  4PNG A;  4XCS A;  2GT5 A;  1F3B A;  3K8N A;  5D96 A;  3Q74 A;  3BBY A;  2FNO A;  5ECM B;  2C3T A;  3E3E A;  1GSF A;  1IYI A;  4X1U A;  4J57 E;  2QSI A;  2FUG 2;  4ZBA A;  2FWG A;  3ERG A;  1A24 A;  2YP6 A;  4EKZ A;  1CQH A;  5ECO B;  1EGO A;  3ZYW A;  3VK9 A;  5A4W A;  1GNE A;  4FYC A;  2HNL A;  1Z6M A;  2GST A;  1B8X A;  3N5O A;  4KW6 A;  2FWH A;  1TK0 B;  3H4K A;  5ID2 B;  3FW2 A;  3V1W A;  3EU3 A;  4WEY A;  2VM2 A;  2XBQ A;  4PUR A;  3H79 A;  2P5Q A;  2EIQ A;  2H70 A;  5IPG A;  3ISO A;  4K8M A;  1VGL A;  1ZOF A;  5DCH A;  4TOP A;  5GAP D;  3TKR A;  3LYP A;  4KCE A;  1HNC A;  4PQ1 A;  4MPF A;  1BJX A;  4IJ3 A;  4TXO B;  2V6O A;  3HYP A;  1THO A;  1DUG A;  4MAB A;  4GSN A;  3L78 A;  3VFI A;  4K7O A;  3GYK A;  3GH9 A;  2FY6 A;  3IC4 A;  1TKD B;  2IFQ B;  1AIU A;  3I6A A;  3UJ1 A;  4D73 B;  1OYJ A;  1B4Q A;  1T00 A;  2CVB A;  1X9M B;  1K3O A;  1S3D A;  2JZR A;  3KXO A;  5CO3 A;  3EUR A;  2YV9 A;  1O81 A;  1T4Z A;  1QUW A;  3IK9 A;  3W6G A;  4POK A;  4QL7 A;  4DVC A;  5G2Z A;  4IW9 A;  4ML6 A;  2CA8 A;  2IWT A;  4ECB A;  2GTU A;  3EMX A;  2GS3 A;  4MF7 A;  2RM5 A;  5A4V A;  5HR1 A;  2B6M A;  2KUC A;  4F82 A;  2MYG A;  1WMJ A;  2HXK A;  2GZP A;  3CYN A;  4TR0 A;  1KBN A;  3ZIV A;  5IOW A;  3TKQ A;  2X8G A;  5IO2 A;  4BWS A;  2NPB A;  3QOU A;  2O85 A;  4J56 E;  2KP1 A;  4IS0 A;  2LUS A;  5LCZ A;  1GUM A;  1LBK A;  1XW9 A;  4ZB9 A;  3CRT A;  2REM A;  5IMD A;  1YZX A;  1F9M A;  3D4T A;  3HXS A;  3GN3 A;  4BL7 A;  5D93 A;  1KNG A;  1HNA A;  1V98 A;  2O87 A;  2TRC P;  1VF2 A;  4ML1 A;  3I69 A;  3L4N A;  1EGR A;  3EU4 A;  4PNF A;  4MK3 A;  3F9U A;  3TB2 A;  2ZUP A;  3W8J A;  2VOC A;  4HQZ A;  3ZFL A;  2YZU A;  4OCE A;  5E4W A;  1M2D A;  1SYR A;  2C0E A;  5KEJ A;  5GZZ B;  2MBS A;  2B1K A;  2YWM A;  1OE8 A;  1TRW A;  2L5L A;  1NSW A;  2VLV A;  3CSJ A;  1UC7 A;  1TDI A;  1K0N A;  3LWA A;  4ZBD A;  2KLX A;  3TUE A;  3FHK A;  2YPM A;  1G0T A;  3FK8 A;  5AN1 A;  4ISD A;  1ON4 A;  4GST A;  3EIN A;  1SK2 A;  1WP0 A;  2H75 A;  1PX7 A;  5HR2 A;  1NHY A;  3IE3 A;  2EIR A;  3RDW A;  4MLY A;  4XS1 A;  4I6X A;  4OWY A;  2DMM A;  2LST A;  4AGS A;  3TKP A;  3D5J A;  2IN3 A;  2E2M A;  4EF0 A;  4KDX A;  2HSH A;  5HQP A;  1GUH A;  1XWB A;  5ECL B;  4FIW A;  2BMX A;  4KH7 A;  4NWY A;  4EVM A;  2X8C A;  3D0Z A;  1EEM A;  2GQL A;  2C3Q A;  3APO A;  2KHP A;  1M9B A;  4X0X A;  2C3N A;  1JFU A;  4O32 A;  3ERW A;  3UAR A;  3IOS A;  1ST9 A;  1PKW A;  4I2U A;  2VD1 A;  4BWQ A;  4ID0 A;  1WJK A;  2JL4 A;  4TR1 A;  1JLW A;  3GIX A;  1F3A A;  4POB A;  3US3 A;  2ZNM A;  2A2S A;  4WKW A;  3U5R E;  4YQV A;  4MDC A;  1KEB A;  1GH2 A;  1ML6 A;  3Q18 A;  3HDC A;  4WR5 A;  4OD7 A;  1TI3 A;  4MJE A;  3EWL A;  2E0Q A;  1UA5 A;  3FYG A;  3UOM A;  2OBK A;  3Q19 A;  2PWJ A;  2VL2 C;  4K0G A;  2PUK C;  5IQY A;  2VUP A;  1EP7 A;  1PN9 A;  2LJK A;  1QK8 A;  4QQ7 A;  2H19 A;  4FH8 A;  5CRE A;  1AUC A;  1K0A A;  2MMZ A;  2M46 A;  4KAE A;  3IBH A;  1VF3 A;  4PX1 A;  5FT3 A;  5ECP B;  1BED A;  2PVO C;  3L9V A;  3DRN A;  2PMT A;  2VD0 A;  2NVL A;  2CZ2 A;  2K8V A;  2AB6 A;  3KEB A;  2B7K A;  2DIZ A;  3TKS C;  5FWG A;  3L9U A;  4MJB A;  3JCM L;  2FLS A;  3LFL A;  1GTB A;  1PA3 A;  1EV9 A;  2HYX A;  1PL1 A;  4PQH A;  2DJ1 A;  2WS2 A;  7GSS A;  3A5W A;  4K7I A;  1GP1 A;  4NV2 A;  2H71 A;  4LA1 A;  3WGX A;  5G30 A;  3HVX A;  2DJ3 A;  1K3L A;  3DIE A;  5AGY A;  3VUR A;  5D9X A;  2YWO A;  3VLN A;  1XCC A;  5LNK e;  4KE3 A;  4Q5F A;  2IIY A;  4N0Z A;  4KSO A;  1GSE A;  3M0F A;  1K0M A;  1PGT A;  2XPE A;  5H5S A;  1EZK A;  1T7P B;  3HA9 A;  4JRR A;  4K9Z A;  1T8E B;  2C0F A;  5GST A;  5D9T A;  4HEA 2;  3FRC A;  4WET A;  1AAZ A;  1XBS A;  3SWL A;  2OKA A;  3GNJ A;  2MMA A;  5DDL A;  4BPY A;  4HOJ A;  5IM9 A;  13GS A;  1YF0 A;  4TXV A;  3KTB A;  3IPZ A;  4XRA A;  4MF5 A;  3GX0 A;  1AQV A;  2YJ7 A;  5F05 A;  1X5D A;  1A23 A;  4CDO A;  4G10 A;  3C71 A;  3CBU A;  4HQS A;  5ECN B;  2IMF A;  3QD9 A;  4ACS A;  3HVV A;  1EP8 A;  4GRF A;  3F0I A;  4LLR A;  4XRD A;  2LQQ A;  3ME8 A;  2H8L A;  1RQM A;  3F3Q A;  3TDG A;  1Y25 A;  4OFM A;  5KN3 A;  4IP1 A;  3CSH A;  1GTU A;  3KMO A;  3A2X A;  4L0U A;  3ZRE A;  3ME7 A;  5D8I A;  2LJA A;  1M9A A;  4F9Z A;  4ZBB A;  2FWF A;  4K0N A;  2MZC A;  2F3M A;  4L8E A;  1QGV A;  4JZQ A;  2H30 A;  2TRX A;  1FG4 A;  3PIN A;  5DVB A;  1Z7R A;  4ECJ A;  2LTK A;  2B3S A;  1C72 A;  2FD3 A;  2HZE A;  4GF0 A;  1O8W A;  2K9F A;  1T3B A;  1K3Y A;  2CX4 A;  3UBL A;  2HZE B;  2A4V A;  2H72 A;  1WPI A;  2VCW A;  4JED A;  2JSZ A;  2NTO A;  5B8A A;  1ZZY A;  2L57 A;  5J9C A;  1SD8 A;  3UL3 A;  3MSZ A;  2P0G A;  3GHA A;  4XTS A;  2PGT A;  3D21 A;  4WBR D;  2AJQ B;  4HU9 A;  3IA1 A;  2H6X A;  4BVY A;  4MH2 A;  2O7K A;  1BX9 A;  3HJP A;  2VLU A;  1O7U A;  3QAG A;  2GQK A;  4EC0 A;  3H93 A;  1G6W A;  2F51 A;  5ABR A;  1LJR A;  2AUV A;  2WJU A;  3HKR A;  1M2B A;  5HR0 A;  3FZ9 A;  3LQ7 A;  1FW1 A;  4HJM A;  5H5Q A;  4PUF C;  3MNG A;  1YEX A;  2I1U A;  3RPP A;  1MDK A;  2CVK A;  1O8X A;  1X9W B;  3VWW A;  1YKC A;  1CQG A;  1Z7P A;  1ERU A;  4YAV A;  2KP2 A;  4FYU A;  4IQ1 A;  1UVZ A;  3UBK A;  2VCV A;  1SU9 A;  4I8B A;  1U87 A;  4TR4 A;  4GWR A;  4AJ6 A;  6GSY A;  4J2F A;  18GS A;  1G7E A;  3G9B A;  2I4A A;  5E59 A;  4AF2 A;  1F6M C;  2GLR A;  1BG5 A;  2B5E A;  4GCI A;  3VPQ A;  2M72 A;  1WRY A;  2IMD A;  4DEJ A;  1R4W A;  4IEL A;  3ZVJ D;  5EPF A;  3HD5 A;  2X64 A;  2H73 A;  8GSS A;  3GUR A;  5L71 A;  3LXZ A;  1TU7 A;  2VM1 A;  1X5C A;  3KP9 A;  1PRX A;  2MMN A;  2V2G A;  1U88 A;  2YV7 A;  3QR6 A;  3LEF A;  3A3T A;  2CAI A;  1B9Y C;  2LEG A;  3P7X A;  2YAN A;  2I9H A;  4MCU A;  2C0D A;  5GSS A;  1R5A A;  1EEJ A;  2C4J A;  2HLS A;  4I2T A;  2YCD A;  2LS5 A;  5IMC A;  5J41 A;  4NV5 A;  2F8F A;  3O6T A;  2KOK A;  1GTA A;  2LRC A;  3HVS A;  1NHO A;  1MD3 A;  2DLX A;  2HI7 A;  3M9K A;  2HE3 A;  2LKU A;  4QL9 A;  1K0O A;  4ZIJ A;  2I81 A;  2RM6 A;  1SKS B;  3DEX A;  3WT2 A;  2HRF A;  3GL3 A;  3D6I A;  4YAP A;  6GSU A;  2F9S A;  4JBB A;  1G6Y A;  3TJF A;  3RHC A;  5D9V A;  1SL2 B;  1F37 A;  2IMK A;  1J9B A;  6GSX A;  2BJX A;  2H1G A;  4KCA A;  5G31 A;  5B6M A;  4MMM A;  4HJ2 A;  2H1D A;  2DJ2 A;  3WYW A;  1R7H A;  3RPN A;  1T4Y A;  4GQC A;  1M7T A;  1VF4 A;  4TKY A;  3FY7 A;  10GS A;  4NMU A;  2R37 A;  5CRG A;  2GZZ A;  16GS A;  4BA7 A;  5ECI B;  2PBJ A;  3M8N A;  3IR4 A;  1KTE A;  2AAW A;  3TRX A;  1R26 A;  2WB9 A;  1AXD A;  4ZIL A;  4I97 A;  1M2A A;  2R3X A;  2YNX A;  3ZLP A;  2DML A;  3EVI A;  5B8B A;  5H5R A;  1ZYE A;  2H0I A;  4DSR A;  4POM A;  4MJA A;  1B4P A;  4ZB6 A;  1TU8 A;  3VI5 A;  1SEN A;  3L0H A;  1K0D A;  4OMV A;  4OFT A;  1SL1 B;  3APQ A;  4F0C A;  4EDY A;  1GUK A;  3C7M A;  1AQX A;  3TRP A;  4EE0 A;  4LL4 B;  3SBC A;  1XOB A;  3GSS A;  1GRX A;  5AIS A;  1XW6 A;  5IO0 A;  3BCK A;  4KA0 A;  3QFB C;  5DCG A;  2JZT A;  2H1B A;  3RAZ A;  2BTO T;  1ZYQ B;  3FKF A;  3IAM 2;  1XWC A;  4ILF A;  4WF5 A;  2A2R A;  3FR3 A;  2JAC A;  2LNS A;  3GMF A;  4KDY A;  1SJI A;  2DJK A;  2VCX A;  3KD0 A;  1JZD A;  1XWA A;  2LRN A;  3ERF A;  5CRH A;  1N2A A;  1WWJ A;  2VL2 A;  4ZL9 A;  3DWV A;  4MZC A;  3IAS 2;  1YY7 A;  3TGZ A;  4JR6 A;  4Z7X A;  2Z9S A;  5G1L A;  5DJM A;  2TIR A;  1I5G A;  1DBY A;  3KH9 A;  4GLT A;  5B7C A;  4ULX A;  3GV1 A;  5KN0 A;  2LRT A;  1TXX A;  4HU7 A;  1Z6N A;  4CHS A;  2NDO A;  2IMI A;  3TKS A;  3ZTL A;  4IGJ A;  1Y6E A;  3F4S A;  2H0G A;  4XIH A;  4TW5 A;  3QCP A;  2N5A A;  3GH6 A;  1MD4 A;  5JWQ B;  2H74 A;  2YWI A;  3TJG A;  4NXI A;  4IP6 A;  1U3I A;  3EMP A;  4V1A p;  4AJ8 A;  3TJJ A;  5F0G A;  3ZML A;  5CAX A;  4TR1 B;  3PH9 A;  2GQM A;  4DSQ A;  1Z3E A;  1XPV A;  4KX4 A;  4NHW A;  3GFK A;  4G2E A;  5JCG A;  1OC3 A;  2C0G A;  2K18 A;  2OA7 A;  2DBC A;  12GS A;  4LL1 B;  5IOX A;  3IHQ A;  5ECS A;  3ZMK A;  1TI1 A;  4K6X A;  4OCF A;  3F4T A;  1XWG A;  2L6C A;  2RII A;  3TKS E;  3J7Y k;  3QFA C;  1W4V A;  5EVO A;  3TRQ A;  1SK1 A;  4H86 A;  3WGD A;  3PR8 A;  1QQ2 A;  1GL8 A;  1OC8 A;  4HI7 A;  2WDU A;  1OC9 A;  4OO4 A;  3AY8 A;  3F6D A;  3PGT A;  2H66 A;  4FYB A;  2HSY A;  5DQY A;  2XC2 A;  1GSU A;  1S3C A;  2CT6 A;  1OC9 B;  1K0C A;  6GST A;  1PL2 A;  1GSD A;  3ED3 A;  2R4V A;  2V32 A;  4DSS A;  4MF6 A;  3U6V A;  1FB6 A;  2ALB A;  1SJZ A;  2QGV A;  3FR6 A;  2YN1 A;  3TOT A;  4K7N A;  3UIW A;  2I3Y A;  2JSY A;  2X8H A;  4G19 A;  2C8U A;  3KH7 A;  1XOA A;  2V6K A;  5A5K A;  4F03 A;  3S9F A;  4I5Q A;  5G5F A;  5CYY A;  5J5N A;  2GSR A;  3NZN A;  2PVQ A;  1ZMA A;  1XZO A;  3TJB A;  5AIV A;  4V2L A;  3A2V A;  1JZO A;  20GS A;  5J4U A;  5CRD A;  1GSQ A;  1YQ1 A;  2FGX A;  2YWN A;  3P8W A;  3CTG A;  4RQX A;  4K2D A;  1BQ7 A;  1B48 A;  1YEP A;  3QMX A;  5INY A;  4WXT A;  5J3R A;  5HR3 A;  5G5E A;  3DD3 A;  2IPA A;  4KGI A;  3HZ4 A;  1XVW A;  2M80 A;  5ELA A;  2H0H A;  5IMA A;  1SL0 B;  3N9J A;  4E8E A;  4G9H A;  3GKM A;  4N11 A;  2HZF A;  1OAZ A;  1J08 A;  3GKN A;  4L5L A;  1VRS D;  1TRS A;  1FOV A;  3NOF A;  3KMN A;  3BOA A;  2RUF A;  3CMI A;  3C1R A;  2OAD A;  3LXT A;  19GS A;  4NAX A;  2AYT A;  2D2Z A;  1JZW A;  5F07 A;  3GKK A;  2O89 A;  5EY6 A;  3ZRD A;  1V57 A;  2GGT A;  1TP9 A;  4AJ7 A;  1NM3 A;  2R2J A;  1I9D A;  6GSV A;  3KP8 A;  2QKE A;  4HUA A;  5DAK A;  1GUL A;  1M0U A;  2OE0 A;  1A0R P;  1PD2 1;  4O5R A;  1U6T A;  1EOH A;  3RHB A;  2FWE A;  1ACV A;  3R2Q A;  1PQN A;  2GSS A;  3IK7 A;  5ELG A;  3KZQ A;  3EC3 A;  3UVH A;  1A2J A;  1YDK A;  5J9B A;  4IKH A;  4HDE A;  1PKZ A;  2VIM A;  2HRN A;  2P5R A;  5DJL A;  1SD9 A;  2N5F A;  2JAD A;  2OAC A;  3BD2 A;  1BAY A;  4WBJ A;  5CRW A;  9GSS A;  3HHV A;  2CAQ A;  2OE3 A;  1GSS A;  2CVD A;  2GDR A;  2VO4 A;  4KND A;  2X99 A;  14GS A;  3A2W A;  1A0F A;  3G7J A;  4TRX A;  5ID2 A;  2LNT A;  3LYK A;  1SJ6 A;  4OO5 A;  1XWK A;  3CXG A;  1A2L A;  4PXO A;  5IMV A;  3D22 A;  5COH A;  3IRA A;  1SKR B;  3GUS A;  3CSI A;  2GVP A;  3GTU A;  5HFG A;  1Z9H A;  4TXO A;  3FR9 A;  4YQM A;  3GTU B;  1N8J A;  4P3Y B;  3WGE A;  4POL A;  1TJD A;  2IJY A;  4MPG A;  1YF1 A;  1MEK A;  5IMZ A;  1O6J A;  3G7I A;  1A8Y A;  2IME A;  4MZB A;  4EO3 A;  5DQS A;  1OKT A;  4IN0 A;  2L4Q A;  3KCM A;  3WD6 A;  1ERT A;  2WUL A;  5JWR B;  1MDJ A;  3DYR A;  2YJH A;  2IFQ A;  4D73 A;  1F2E A;  2H6Y A;  3VPT A;  5DAL A;  2LV3 A;  1X5E A;  4ZB8 A;  3DKS A;  1XVQ A;  2RUE A;  4MA9 A;  5DAL B;  1WOU A;  3NIV A;  2EC4 A;  1OKD A;  1TRU A;  4X43 A;  2VCQ A;  5GAN D;  1Q98 A;  3LGC A;  4JE1 A;  4O92 A;  2JU5 A;  3VI7 A;  3F63 A;  3QDN A;  2MBT A;  1JLV A;  2FA8 A;  4ZXG A;  5IMF A;  4Q5Q A;  5JWO B;  1IYH A;  2XBI A;  2VCT A;  4Q5N A;  3M9J A;  2NBS A;  4N10 A;  5ECR B;  1HQO A;  6GSW A;  1THX A;  3HCZ A;  4NPB A;  3CRU A;  2OJL A;  1V40 A;  4XHM A;  3ZFB A;  4V2M A;  3FEU A;  1MTC A;  3O3T A;  3F4R A;  3ZZX A;  4WF4 A;  5ENU A;  3E9J B;  2J23 A;  2EIO A;  2H01 A;  4RUV A;  4ECC A;  2L59 A;  4IQA A;  1PX6 A;  3GST A;  3HY2 A;  2GT6 A;  4L0W A;  1SK0 A;  5KN2 A;  2VL3 A;  1DE1 A;  4IHU A;  5EL8 A;  3I9V 2;  3F3R A;  3Q6O A;  1YJ6 A;  2L4C A;  4LMW A;  1OE7 A;  4LMV A;  3O76 A;  4PUA A;  4MP4 A;  4GSS A;  1X0R A;  1HYU A;  3HJM A;  1V2A A;  2E7P A;  3G7Y A;  5ECH B;  3E0U A;  2CQ9 A;  3IV4 A;  3VWV A;  3D4M A;  3HZ8 A;  2LJR A;  2FCH A;  1JZR A;  1PSQ A;  2DJJ A; 
#chains in the Genus database with same CATH topology
 3LG6 A;  2VL9 A;  2XPD A;  3ZL5 A;  2GSQ A;  5F06 A;  2WRT A;  1HD2 A;  2CV4 A;  1X9S B;  1TOF A;  5B6N A;  4EXJ A;  5D73 A;  3GRX A;  1TTZ A;  2PPT A;  3IDV A;  1URM A;  2P31 A;  1EOG A;  4BVX A;  3DGQ A;  4EL1 A;  1TW9 A;  1GTI A;  2AV4 A;  1GSY A;  4BVX B;  2CX3 A;  2V41 A;  3L9S A;  1Z5Y E;  3KJY A;  3ZIJ A;  2ES7 A;  5AIX A;  3DVW A;  4EUY A;  2DC5 A;  1LU4 A;  2R5G A;  3HJO A;  4TR3 A;  1JHB A;  1T1V A;  3LOR A;  1O85 A;  5ECQ B;  1ILO A;  2OBI A;  4JU5 A;  3DXB A;  3TOU A;  3H1N A;  17GS A;  1WE0 A;  4HS1 A;  1AC1 A;  1HNB A;  2AHE A;  1FOH A;  1G7O A;  3C73 A;  2LQO A;  1ABA A;  2B5X A;  5FHI A;  1USB A;  1QXH A;  1XW5 A;  1GNW A;  5HFI A;  1OVN A;  1S3R A;  2L5O A;  3BJ5 A;  3TCO A;  2DSA A;  3FZ4 A;  3MAK A;  1M99 A;  4XS6 A;  1GWC A;  2DJ0 A;  3DML A;  4IBP A;  3CTF A;  3VWU A;  3I43 A;  4MJC A;  1FAA A;  3KTL A;  1PMT A;  3C1S A;  2GZY A;  5CP1 A;  2R0C A;  4GQF A;  4K1F A;  5JCU A;  5A4U A;  1A2M A;  3ZVJ A;  1H75 A;  2FHE A;  2PER A;  4RQR A;  1EV4 A;  2QC7 A;  5F8B A;  4ECI A;  4HZ2 A;  1XG8 A;  3LJR A;  1QFN A;  1U3A A;  2H1A A;  6GSS A;  3UVT A;  3TJK A;  1DSB A;  4KDU A;  3QPM A;  2K8S A;  3M1G A;  1ZL9 A;  2YOI A;  3LSZ A;  5C04 A;  1FVJ A;  1E6B A;  1XIY A;  2H76 A;  4IVF A;  1XFL A;  3GA4 A;  4KSM A;  2B7J A;  2WFC A;  3VWX A;  1O73 A;  1AQW A;  2VAF A;  2E2G A;  4TVE A;  3RBT A;  4KUN A;  1FB0 A;  3P2A A;  3W8S A;  2ON5 A;  3QAV A;  5HFK A;  4ZL7 A;  4JR4 A;  3KM6 A;  1S3A A;  3EE2 A;  1TRV A;  2G2Q A;  4F2I A;  2WCI A;  1NW2 A;  3DVX A;  5DBQ A;  2HT9 A;  1H4O A;  2MMO A;  1ZGN A;  4DSS B;  4PGT A;  2FA4 A;  2PU9 C;  1ZCP A;  2ON7 A;  4RI7 A;  2C1Y A;  2CZ3 A;  4IJI A;  4CY6 A;  4E8H A;  2A4H A;  4FO5 A;  1R5P A;  4N0V A;  1TK8 B;  2RLI A;  3UMA A;  3GX8 A;  2DIY A;  5JCW A;  5LD0 A;  1FHE A;  1RK4 A;  1E2Y A;  2G0F A;  3OR5 A;  2WGR A;  1SKW B;  4EDZ A;  1DE2 A;  2VCZ A;  1QMV A;  4XS4 A;  3C8E A;  1W89 A;  3F6F A;  5ECK B;  5KN1 A;  4TN8 A;  1FVK A;  1RW1 A;  2VLT A;  1GLQ A;  5CNW A;  4GTU A;  4XS4 B;  1XXU A;  4MZW A;  1M3J A;  1ERW A;  2JZS A;  3BCI A;  3MDK A;  3QAW A;  2N5B A;  3UAP A;  1TK5 B;  4N30 A;  1J0F A;  2H6Z A;  1WIK A;  3EYT A;  1MDI A;  5C00 A;  4OFN A;  4RI6 A;  22GS A;  1A8L A;  2XHF A;  4V2N A;  2J9H A;  1YKA A;  2WZ9 A;  4KB3 A;  3H8Q A;  3KIJ A;  5IPH A;  3MWH A;  11GS A;  2R6K A;  3KGK A;  4YQU A;  1K0B A;  4Q5R A;  4F0B A;  2O8V B;  4L5O A;  4V1A g;  4CW9 A;  1EWX A;  1GLP A;  4MH3 A;  3WT1 A;  1FO5 A;  3P90 A;  1B9X C;  1SYX A;  2F8A A;  3M3M A;  2ZCT A;  1UN2 A;  1Q4J A;  3F8U A;  1V9W A;  3IXR A;  3IHG A;  1BYE A;  4NHZ A;  4USS A;  4O7H A;  3FZ5 A;  4ZL8 A;  5D9W A;  3J7Y b;  2IL3 A;  4GXZ A;  5DAK B;  2HFD A;  2B5Y A;  3APS A;  5G1K A;  4WR4 A;  1AW9 A;  1ERV A;  4YH2 A;  2YZH A;  3GL5 A;  2B1L A;  2PN8 A;  2V1M A;  2K6V A;  5IIZ A;  3GKX A;  4PQI A;  3UEM A;  3ZIT A;  2OE1 A;  2X49 A;  1VF1 A;  3FZA A;  1V58 A;  4HZ4 A;  2C80 A;  2L6D A;  4PNG A;  3CQF A;  4XCS A;  5KOW A;  2GT5 A;  1F3B A;  3K8N A;  5D96 A;  3Q74 A;  3BBY A;  2FNO A;  5ECM B;  2C3T A;  3E3E A;  1GSF A;  1IYI A;  4X1U A;  4J57 E;  2QSI A;  2FUG 2;  4ZBA A;  2FWG A;  3MIX A;  3ERG A;  1A24 A;  2YP6 A;  4EKZ A;  1CQH A;  5ECO B;  1EGO A;  3ZYW A;  3VK9 A;  5A4W A;  1GNE A;  4FYC A;  2HNL A;  1Z6M A;  2GST A;  1B8X A;  3N5O A;  4KW6 A;  2FWH A;  1TK0 B;  3H4K A;  5ID2 B;  3FW2 A;  3V1W A;  3EU3 A;  4WEY A;  2VM2 A;  2XBQ A;  4PUR A;  3FMW A;  3H79 A;  2P5Q A;  2EIQ A;  2H70 A;  5IPG A;  3ISO A;  4K8M A;  4BIK A;  1VGL A;  1ZOF A;  5DCH A;  4O5U A;  4TOP A;  5GAP D;  3TKR A;  3LYP A;  4KCE A;  1HNC A;  4PQ1 A;  4MPF A;  1BJX A;  4IJ3 A;  4TXO B;  4X4J A;  2V6O A;  3HYP A;  1THO A;  1DUG A;  4MAB A;  4GSN A;  3L78 A;  3VFI A;  4K7O A;  3GYK A;  3GH9 A;  2FY6 A;  3IC4 A;  1TKD B;  2IFQ B;  1AIU A;  3I6A A;  3UJ1 A;  4D73 B;  1PN0 A;  1OYJ A;  1B4Q A;  1T00 A;  2CVB A;  1X9M B;  1K3O A;  1S3D A;  2JZR A;  3KXO A;  5CO3 A;  3EUR A;  2YV9 A;  1O81 A;  1T4Z A;  1QUW A;  3IK9 A;  3W6G A;  4POK A;  4QL7 A;  4DVC A;  5G2Z A;  4IW9 A;  4ML6 A;  2CA8 A;  2IWT A;  4ECB A;  2GTU A;  3EMX A;  2GS3 A;  4MF7 A;  2RM5 A;  5A4V A;  5HR1 A;  2B6M A;  2KUC A;  4F82 A;  2MYG A;  1WMJ A;  2HXK A;  2GZP A;  3CYN A;  4TR0 A;  1KBN A;  3ZIV A;  5IOW A;  3TKQ A;  2X8G A;  5IO2 A;  4BWS A;  2NPB A;  3QOU A;  2O85 A;  4J56 E;  2KP1 A;  4IS0 A;  2LUS A;  5LCZ A;  1GUM A;  1LBK A;  4EIP A;  1XW9 A;  4ZB9 A;  3CRT A;  5BRT A;  2REM A;  5IMD A;  1YZX A;  1F9M A;  3D4T A;  3HXS A;  3GN3 A;  4BL7 A;  5D93 A;  1KNG A;  1HNA A;  1V98 A;  2O87 A;  2TRC P;  1VF2 A;  4ML1 A;  3I69 A;  3L4N A;  1EGR A;  3EU4 A;  4BL7 B;  4PNF A;  4MK3 A;  3F9U A;  3TB2 A;  2ZUP A;  3W8J A;  2VOC A;  4HQZ A;  3ZFL A;  4MNN A;  2YZU A;  4OCE A;  5E4W A;  4K5R A;  1M2D A;  1SYR A;  2C0E A;  5KEJ A;  5GZZ B;  2MBS A;  2B1K A;  2YWM A;  1OE8 A;  1TRW A;  2L5L A;  1NSW A;  2DKI A;  2VLV A;  3CSJ A;  1UC7 A;  1TDI A;  1K0N A;  4EIQ A;  3LWA A;  4ZBD A;  2KLX A;  3TUE A;  3FHK A;  2YPM A;  1G0T A;  2X4A A;  3FK8 A;  5AN1 A;  4ISD A;  1ON4 A;  4GST A;  2DKH A;  3EIN A;  1SK2 A;  1WP0 A;  2H75 A;  3HVN A;  1PX7 A;  5HR2 A;  1NHY A;  3IE3 A;  2EIR A;  3RDW A;  4K2X A;  4MLY A;  4XS1 A;  4I6X A;  4OWY A;  2DMM A;  2LST A;  4AGS A;  3TKP A;  3D5J A;  2IN3 A;  2E2M A;  4EF0 A;  4KDX A;  2HSH A;  5HQP A;  1GUH A;  1XWB A;  5ECL B;  4FIW A;  2BMX A;  4KH7 A;  4NWY A;  4EVM A;  2X8C A;  3D0Z A;  1EEM A;  2GQL A;  2C3Q A;  3APO A;  2KHP A;  1M9B A;  4X0X A;  2C3N A;  4A5P A;  1JFU A;  4O32 A;  3ERW A;  3UAR A;  3IOS A;  1ST9 A;  1PKW A;  4I2U A;  2VD1 A;  4BWQ A;  4ID0 A;  1WJK A;  2JL4 A;  4TR1 A;  1JLW A;  3GIX A;  1F3A A;  4POB A;  3US3 A;  2ZNM A;  2A2S A;  4WKW A;  3U5R E;  4YQV A;  4MDC A;  1KEB A;  1GH2 A;  1ML6 A;  3Q18 A;  3HDC A;  4WR5 A;  4OD7 A;  1TI3 A;  4MJE A;  3EWL A;  2E0Q A;  1UA5 A;  3FYG A;  3UOM A;  2OBK A;  3Q19 A;  2PWJ A;  2VL2 C;  4K0G A;  2PUK C;  3R3E A;  5IQY A;  2VUP A;  1EP7 A;  1PN9 A;  2LJK A;  1QK8 A;  4QQ7 A;  2H19 A;  4FH8 A;  5CRE A;  1AUC A;  1K0A A;  2MMZ A;  2M46 A;  4KAE A;  3IBH A;  1VF3 A;  4PX1 A;  5FT3 A;  5ECP B;  1BED A;  2PVO C;  3L9V A;  3DRN A;  2PMT A;  2VD0 A;  2NVL A;  2CZ2 A;  3LW9 A;  2K8V A;  2AB6 A;  3KEB A;  2B7K A;  2DIZ A;  3TKS C;  5FWG A;  3L9U A;  4MJB A;  3JCM L;  2FLS A;  3LFL A;  1GTB A;  1PA3 A;  1EV9 A;  2HYX A;  1PL1 A;  4PQH A;  2DJ1 A;  2WS2 A;  7GSS A;  3A5W A;  4K7I A;  1GP1 A;  4NV2 A;  2H71 A;  4LA1 A;  3WGX A;  2QA1 A;  5G30 A;  3HVX A;  2DJ3 A;  1K3L A;  3DIE A;  5AGY A;  3VUR A;  5D9X A;  1ZYP A;  2YWO A;  3VLN A;  1XCC A;  5LNK e;  4KE3 A;  4CY8 A;  4Q5F A;  2IIY A;  4N0Z A;  4KSO A;  1GSE A;  4G0I A;  3M0F A;  1K0M A;  1PGT A;  2XPE A;  5H5S A;  1EZK A;  1T7P B;  3HA9 A;  4JRR A;  4K9Z A;  1T8E B;  2C0F A;  5GST A;  4HEA 2;  3FRC A;  3EPT A;  4WET A;  5D9T A;  1AAZ A;  1XBS A;  3SWL A;  2OKA A;  3GNJ A;  2MMA A;  5DDL A;  4BPY A;  4HOJ A;  5IM9 A;  13GS A;  1YF0 A;  4TXV A;  3KTB A;  4PTS A;  3IPZ A;  4XRA A;  4MF5 A;  3GX0 A;  1AQV A;  2YJ7 A;  5F05 A;  1X5D A;  1A23 A;  4CDO A;  4G10 A;  3C71 A;  3CBU A;  4HQS A;  2HRA A;  2IMF A;  5ECN B;  3QD9 A;  4ACS A;  3HVV A;  1EP8 A;  4GRF A;  3F0I A;  4LLR A;  4XRD A;  2LQQ A;  3ME8 A;  2H8L A;  1RQM A;  3F3Q A;  3TDG A;  1Y25 A;  4OFM A;  5KN3 A;  4IP1 A;  3CSH A;  1GTU A;  3KMO A;  3A2X A;  4L0U A;  3ZRE A;  3ME7 A;  5D8I A;  2LJA A;  1M9A A;  4F9Z A;  4ZBB A;  2FWF A;  4K0N A;  2MZC A;  2F3M A;  4L8E A;  1QGV A;  4JZQ A;  2H30 A;  2TRX A;  1FG4 A;  4YKG A;  3PIN A;  5DVB A;  1Z7R A;  4ECJ A;  2LTK A;  2B3S A;  1C72 A;  2FD3 A;  2HZE A;  4GF0 A;  1O8W A;  2K9F A;  1T3B A;  1K3Y A;  2CX4 A;  3UBL A;  2HZE B;  2A4V A;  2H72 A;  1WPI A;  2VCW A;  4JED A;  2JSZ A;  2NTO A;  5B8A A;  1ZZY A;  2L57 A;  5J9C A;  1SD8 A;  3UL3 A;  3MSZ A;  2P0G A;  3GHA A;  4XTS A;  2PGT A;  3D21 A;  4WBR D;  2AJQ B;  4HU9 A;  3IA1 A;  2H6X A;  4BVY A;  4MH2 A;  2O7K A;  1BX9 A;  3HJP A;  2VLU A;  1O7U A;  3QAG A;  2GQK A;  4EC0 A;  3H93 A;  1G6W A;  2F51 A;  5ABR A;  1LJR A;  2AUV A;  2WJU A;  4BVY B;  3HKR A;  1M2B A;  5HR0 A;  3FZ9 A;  3LQ7 A;  1FW1 A;  4HJM A;  5H5Q A;  4PUF C;  3MNG A;  1YEX A;  2I1U A;  3RPP A;  1MDK A;  2CVK A;  1O8X A;  1X9W B;  3VWW A;  3A5I A;  1YKC A;  1CQG A;  1Z7P A;  1ERU A;  4YAV A;  2KP2 A;  4FQU A;  4FYU A;  4IQ1 A;  1PFO A;  1UVZ A;  3UBK A;  2VCV A;  1SU9 A;  4I8B A;  1U87 A;  4TR4 A;  4GWR A;  4AJ6 A;  6GSY A;  4J2F A;  18GS A;  1G7E A;  3G9B A;  2I4A A;  5E59 A;  4AF2 A;  1F6M C;  2GLR A;  1BG5 A;  2B5E A;  4GCI A;  3VPQ A;  2M72 A;  1WRY A;  2IMD A;  4DEJ A;  1R4W A;  4IEL A;  3ZVJ D;  5EPF A;  3HD5 A;  2X64 A;  2H73 A;  8GSS A;  1M3I A;  3GUR A;  5L71 A;  3LXZ A;  1TU7 A;  2VM1 A;  1X5C A;  3KP9 A;  1PRX A;  2MMN A;  2V2G A;  1U88 A;  2YV7 A;  3QR6 A;  3LEF A;  3A3T A;  2CAI A;  1B9Y C;  2LEG A;  3P7X A;  2YAN A;  2I9H A;  4MCU A;  2C0D A;  5GSS A;  1R5A A;  1EEJ A;  2C4J A;  2HLS A;  4I2T A;  2YCD A;  2LS5 A;  5IMC A;  5J41 A;  2R0P A;  4NV5 A;  2F8F A;  3O6T A;  2KOK A;  1GTA A;  2LRC A;  3HVS A;  1NHO A;  1MD3 A;  2DLX A;  2HI7 A;  3M9K A;  2HE3 A;  5KOX A;  2LKU A;  4QL9 A;  1K0O A;  4ZIJ A;  2I81 A;  2RM6 A;  1SKS B;  3DEX A;  2QA2 A;  3WT2 A;  2HRF A;  3GL3 A;  3D6I A;  4YAP A;  6GSU A;  2F9S A;  4JBB A;  1G6Y A;  3TJF A;  3RHC A;  5D9V A;  3MYD A;  1SL2 B;  1F37 A;  2IMK A;  1J9B A;  6GSX A;  2BJX A;  2H1G A;  4KCA A;  5G31 A;  4Z2T A;  5B6M A;  4MMM A;  4HJ2 A;  2H1D A;  2DJ2 A;  3WYW A;  1R7H A;  3RPN A;  1T4Y A;  4GQC A;  1M7T A;  1VF4 A;  4TKY A;  3FY7 A;  10GS A;  4NMU A;  2R37 A;  5CRG A;  2GZZ A;  16GS A;  4G0L A;  4BA7 A;  5ECI B;  2PBJ A;  3M8N A;  3IR4 A;  4K5S A;  1KTE A;  2AAW A;  3TRX A;  1R26 A;  2WB9 A;  1AXD A;  4ZIL A;  4I97 A;  1M2A A;  2R3X A;  2YNX A;  3ZLP A;  2DML A;  3EVI A;  5B8B A;  5H5R A;  1ZYE A;  2H0I A;  4DSR A;  4POM A;  4MJA A;  1B4P A;  4ZB6 A;  1TU8 A;  3VI5 A;  1SEN A;  3L0H A;  1K0D A;  4OMV A;  4OFT A;  1SL1 B;  3APQ A;  4F0C A;  4EDY A;  1GUK A;  3C7M A;  1AQX A;  3TRP A;  4EE0 A;  4LL4 B;  3SBC A;  1XOB A;  3GSS A;  1GRX A;  5AIS A;  1XW6 A;  5IO0 A;  3BCK A;  4KA0 A;  3QFB C;  2JZT A;  2H1B A;  5DCG A;  3RAZ A;  2BTO T;  1ZYQ B;  3FKF A;  3IAM 2;  1XWC A;  4ILF A;  4WF5 A;  2A2R A;  3FR3 A;  2JAC A;  2LNS A;  3GMF A;  4KDY A;  1SJI A;  2DJK A;  2VCX A;  3KD0 A;  1JZD A;  1XWA A;  2LRN A;  3ERF A;  5CRH A;  1N2A A;  1WWJ A;  2VL2 A;  4ZL9 A;  3DWV A;  4MZC A;  3IAS 2;  1YY7 A;  3TGZ A;  4JR6 A;  4Z7X A;  2Z9S A;  5G1L A;  5DJM A;  2TIR A;  1I5G A;  1DBY A;  3KH9 A;  4GLT A;  5B7C A;  4ULX A;  3GV1 A;  5KN0 A;  2LRT A;  1TXX A;  4HU7 A;  1Z6N A;  4CHS A;  2NDO A;  2IMI A;  3TKS A;  3ZTL A;  4IGJ A;  1Y6E A;  3F4S A;  2H0G A;  4XIH A;  4ICY A;  4TW5 A;  3QCP A;  2N5A A;  3GH6 A;  1MD4 A;  5JWQ B;  2H74 A;  2YWI A;  3TJG A;  4NXI A;  4IP6 A;  1U3I A;  3EMP A;  4V1A p;  4AJ8 A;  3TJJ A;  5F0G A;  3ZML A;  5CAX A;  4TR1 B;  3PH9 A;  4YKF A;  2GQM A;  4DSQ A;  1Z3E A;  1XPV A;  4KX4 A;  4NHW A;  3GFK A;  4G2E A;  5JCG A;  1OC3 A;  2C0G A;  2K18 A;  2OA7 A;  2DBC A;  12GS A;  4LL1 B;  5IOX A;  3IHQ A;  5ECS A;  3ZMK A;  1TI1 A;  4K6X A;  4OCF A;  3F4T A;  1XWG A;  2L6C A;  2RII A;  3TKS E;  3J7Y k;  3QFA C;  1ZYN A;  1W4V A;  5EVO A;  3TRQ A;  1SK1 A;  4H86 A;  3WGD A;  3PR8 A;  1QQ2 A;  1GL8 A;  1OC8 A;  4HI7 A;  2WDU A;  1OC9 A;  4OO4 A;  3AY8 A;  2A2P A;  3F6D A;  3PGT A;  2R0G A;  2H66 A;  4FYB A;  2HSY A;  5DQY A;  2XC2 A;  1GSU A;  2HRK A;  1S3C A;  2CT6 A;  1OC9 B;  1K0C A;  6GST A;  4G0K A;  1PL2 A;  1GSD A;  3ED3 A;  2R4V A;  2V32 A;  4DSS A;  4MF6 A;  3U6V A;  1FB6 A;  2ALB A;  1SJZ A;  2QGV A;  3FR6 A;  2YN1 A;  3TOT A;  4K7N A;  3UIW A;  2I3Y A;  2JSY A;  2X8H A;  4G19 A;  2C8U A;  4Z2R A;  3KH7 A;  1XOA A;  2V6K A;  5A5K A;  4F03 A;  3S9F A;  4I5Q A;  5G5F A;  5CYY A;  5J5N A;  2GSR A;  3NZN A;  2PVQ A;  1ZMA A;  1XZO A;  3TJB A;  5AIV A;  4V2L A;  3A2V A;  1JZO A;  20GS A;  5J4U A;  5CRD A;  1GSQ A;  1YQ1 A;  2FGX A;  2YWN A;  3P8W A;  3CTG A;  4RQX A;  4K2D A;  1BQ7 A;  1B48 A;  1YEP A;  3QMX A;  5INY A;  4WXT A;  2UZ8 A;  5J3R A;  5HR3 A;  5G5E A;  3DD3 A;  2IPA A;  4KGI A;  3HZ4 A;  1XVW A;  2M80 A;  5ELA A;  2H0H A;  5IMA A;  1SL0 B;  3N9J A;  4E8E A;  4G9H A;  3GKM A;  4N11 A;  2HZF A;  1OAZ A;  1J08 A;  3GKN A;  4L5L A;  1VRS D;  1TRS A;  1FOV A;  3NOF A;  3KMN A;  3BOA A;  2RUF A;  3CMI A;  3C1R A;  2OAD A;  3LXT A;  19GS A;  4NAX A;  2AYT A;  2D2Z A;  1JZW A;  5F07 A;  3GKK A;  2O89 A;  5EY6 A;  3ZRD A;  1V57 A;  2GGT A;  1TP9 A;  4AJ7 A;  1NM3 A;  2R2J A;  1I9D A;  6GSV A;  3KP8 A;  2QKE A;  4HUA A;  5DAK A;  1GUL A;  1M0U A;  2OE0 A;  1A0R P;  1PD2 1;  4O5R A;  1U6T A;  1EOH A;  3RHB A;  2FWE A;  1ACV A;  3R2Q A;  1PQN A;  2GSS A;  3IK7 A;  5ELG A;  3KZQ A;  3EC3 A;  3UVH A;  1A2J A;  1YDK A;  5J9B A;  4IKH A;  4HDE A;  1PKZ A;  2VIM A;  2HRN A;  2P5R A;  5DJL A;  1SD9 A;  2N5F A;  2JAD A;  2OAC A;  3BD2 A;  1BAY A;  4WBJ A;  5CRW A;  9GSS A;  3HHV A;  2CAQ A;  2OE3 A;  1GSS A;  2CVD A;  2GDR A;  2VO4 A;  4KND A;  2X99 A;  14GS A;  3A2W A;  1A0F A;  3G7J A;  4TRX A;  5ID2 A;  2LNT A;  2HSM A;  3LYK A;  1SJ6 A;  4HSC X;  4OO5 A;  1XWK A;  3CXG A;  1A2L A;  4PXO A;  5IMV A;  3D22 A;  3PPU A;  5COH A;  3IRA A;  1SKR B;  3GUS A;  3CSI A;  2GVP A;  3GTU A;  5HFG A;  1Z9H A;  4TXO A;  3FR9 A;  4YQM A;  3GTU B;  1N8J A;  4P3Y B;  3WGE A;  4POL A;  1TJD A;  2IJY A;  4MPG A;  1YF1 A;  1MEK A;  5IMZ A;  1O6J A;  3G7I A;  1A8Y A;  2IME A;  4MZB A;  4EO3 A;  5DQS A;  4KF9 A;  1OKT A;  4IN0 A;  2L4Q A;  3KCM A;  3WD6 A;  1ERT A;  2WUL A;  5JWR B;  1MDJ A;  3DYR A;  2YJH A;  2IFQ A;  4D73 A;  1F2E A;  2H6Y A;  3VPT A;  5DAL A;  2LV3 A;  1X5E A;  4Z2U A;  4ZB8 A;  3DKS A;  1XVQ A;  2RUE A;  4MA9 A;  5DAL B;  1WOU A;  3NIV A;  2EC4 A;  1OKD A;  1TRU A;  4X43 A;  2VCQ A;  5GAN D;  1Q98 A;  3LGC A;  4JE1 A;  4O92 A;  2JU5 A;  3VI7 A;  3F63 A;  3QDN A;  2MBT A;  1JLV A;  2FA8 A;  4ZXG A;  5IMF A;  4Q5Q A;  5JWO B;  1IYH A;  2XBI A;  2VCT A;  4Q5N A;  3M9J A;  2NBS A;  4N10 A;  5ECR B;  1HQO A;  6GSW A;  1THX A;  3HCZ A;  4NPB A;  3IC8 A;  3CRU A;  2OJL A;  1V40 A;  4XHM A;  3ZFB A;  4V2M A;  3FEU A;  1MTC A;  4O5Q A;  3O3T A;  3F4R A;  3ZZX A;  4WF4 A;  5ENU A;  3E9J B;  2J23 A;  2EIO A;  2H01 A;  4RUV A;  4ECC A;  2L59 A;  4IQA A;  1PX6 A;  3GST A;  3HY2 A;  2GT6 A;  4L0W A;  1SK0 A;  5KN2 A;  2VL3 A;  1DE1 A;  4IHU A;  5EL8 A;  3I9V 2;  3F3R A;  3Q6O A;  1YJ6 A;  5BMU A;  2L4C A;  4LMW A;  1OE7 A;  4LMV A;  3O76 A;  4PUA A;  4MP4 A;  4GSS A;  1X0R A;  1HYU A;  3HJM A;  1V2A A;  2E7P A;  3G7Y A;  5ECH B;  3E0U A;  2CQ9 A;  3IV4 A;  3VWV A;  3D4M A;  3HZ8 A;  2LJR A;  2FCH A;  1JZR A;  1PSQ A;  2DJJ A; 
#chains in the Genus database with same CATH homology
 3LG6 A;  2VL9 A;  2XPD A;  3ZL5 A;  2GSQ A;  5F06 A;  2WRT A;  1HD2 A;  2CV4 A;  1X9S B;  1TOF A;  5B6N A;  4EXJ A;  5D73 A;  3GRX A;  1TTZ A;  2PPT A;  3IDV A;  1URM A;  2P31 A;  1EOG A;  4BVX A;  3DGQ A;  4EL1 A;  1TW9 A;  1GTI A;  2AV4 A;  1GSY A;  4BVX B;  2CX3 A;  2V41 A;  3L9S A;  1Z5Y E;  3KJY A;  3ZIJ A;  2ES7 A;  5AIX A;  3DVW A;  4EUY A;  2DC5 A;  1LU4 A;  2R5G A;  3HJO A;  4TR3 A;  1JHB A;  1T1V A;  3LOR A;  1O85 A;  5ECQ B;  1ILO A;  2OBI A;  4JU5 A;  3DXB A;  3TOU A;  3H1N A;  17GS A;  1WE0 A;  4HS1 A;  1AC1 A;  1HNB A;  2AHE A;  1FOH A;  1G7O A;  3C73 A;  2LQO A;  1ABA A;  2B5X A;  5FHI A;  1USB A;  1QXH A;  1XW5 A;  1GNW A;  5HFI A;  1OVN A;  2L5O A;  3BJ5 A;  3TCO A;  2DSA A;  3FZ4 A;  3MAK A;  1M99 A;  4XS6 A;  1GWC A;  2DJ0 A;  3DML A;  4IBP A;  3CTF A;  3VWU A;  3I43 A;  4MJC A;  1FAA A;  3KTL A;  1PMT A;  3C1S A;  2GZY A;  5CP1 A;  2R0C A;  4GQF A;  4K1F A;  5JCU A;  5A4U A;  1A2M A;  3ZVJ A;  1H75 A;  2FHE A;  2PER A;  4RQR A;  1EV4 A;  2QC7 A;  5F8B A;  4ECI A;  4HZ2 A;  3LJR A;  1QFN A;  1U3A A;  2H1A A;  6GSS A;  3UVT A;  3TJK A;  1DSB A;  4KDU A;  3QPM A;  2K8S A;  3M1G A;  1ZL9 A;  2YOI A;  3LSZ A;  5C04 A;  1FVJ A;  1E6B A;  1XIY A;  2H76 A;  4IVF A;  1XFL A;  3GA4 A;  4KSM A;  2B7J A;  2WFC A;  3VWX A;  1O73 A;  1AQW A;  2VAF A;  2E2G A;  4TVE A;  3RBT A;  4KUN A;  1FB0 A;  3P2A A;  3W8S A;  2ON5 A;  3QAV A;  5HFK A;  4ZL7 A;  4JR4 A;  3KM6 A;  1S3A A;  3EE2 A;  1TRV A;  2G2Q A;  4F2I A;  2WCI A;  1NW2 A;  3DVX A;  5DBQ A;  2HT9 A;  1H4O A;  2MMO A;  1ZGN A;  4DSS B;  4PGT A;  2FA4 A;  2PU9 C;  1ZCP A;  2ON7 A;  4RI7 A;  2C1Y A;  2CZ3 A;  4IJI A;  4CY6 A;  4E8H A;  2A4H A;  4FO5 A;  1R5P A;  4N0V A;  1TK8 B;  2RLI A;  3UMA A;  3GX8 A;  2DIY A;  5JCW A;  5LD0 A;  1FHE A;  1RK4 A;  1E2Y A;  2G0F A;  3OR5 A;  2WGR A;  1SKW B;  4EDZ A;  1DE2 A;  2VCZ A;  1QMV A;  4XS4 A;  3C8E A;  1W89 A;  3F6F A;  5ECK B;  5KN1 A;  4TN8 A;  1FVK A;  1RW1 A;  2VLT A;  1GLQ A;  5CNW A;  4GTU A;  4XS4 B;  1XXU A;  4MZW A;  1ERW A;  2JZS A;  3BCI A;  3MDK A;  3QAW A;  2N5B A;  3UAP A;  1TK5 B;  4N30 A;  1J0F A;  2H6Z A;  1WIK A;  3EYT A;  1MDI A;  5C00 A;  4OFN A;  4RI6 A;  22GS A;  1A8L A;  2XHF A;  4V2N A;  2J9H A;  1YKA A;  2WZ9 A;  4KB3 A;  3H8Q A;  3KIJ A;  5IPH A;  3MWH A;  11GS A;  2R6K A;  3KGK A;  4YQU A;  1K0B A;  4Q5R A;  4F0B A;  2O8V B;  4L5O A;  4V1A g;  4CW9 A;  1EWX A;  1GLP A;  4MH3 A;  3WT1 A;  1FO5 A;  3P90 A;  1B9X C;  1SYX A;  2F8A A;  3M3M A;  2ZCT A;  1UN2 A;  1Q4J A;  3F8U A;  1V9W A;  3IXR A;  3IHG A;  1BYE A;  4NHZ A;  4USS A;  4O7H A;  3FZ5 A;  4ZL8 A;  5D9W A;  3J7Y b;  2IL3 A;  4GXZ A;  5DAK B;  2HFD A;  2B5Y A;  3APS A;  5G1K A;  4WR4 A;  1AW9 A;  1ERV A;  4YH2 A;  2YZH A;  3GL5 A;  2B1L A;  2PN8 A;  2V1M A;  2K6V A;  5IIZ A;  3GKX A;  4PQI A;  3UEM A;  3ZIT A;  2OE1 A;  2X49 A;  1VF1 A;  3FZA A;  1V58 A;  4HZ4 A;  2C80 A;  2L6D A;  4PNG A;  4XCS A;  5KOW A;  2GT5 A;  1F3B A;  3K8N A;  5D96 A;  3Q74 A;  3BBY A;  2FNO A;  5ECM B;  2C3T A;  3E3E A;  1GSF A;  1IYI A;  4X1U A;  4J57 E;  2QSI A;  2FUG 2;  4ZBA A;  2FWG A;  3MIX A;  3ERG A;  1A24 A;  2YP6 A;  4EKZ A;  1CQH A;  5ECO B;  1EGO A;  3ZYW A;  3VK9 A;  5A4W A;  1GNE A;  4FYC A;  2HNL A;  1Z6M A;  2GST A;  1B8X A;  3N5O A;  4KW6 A;  2FWH A;  1TK0 B;  3H4K A;  5ID2 B;  3FW2 A;  3V1W A;  3EU3 A;  4WEY A;  2VM2 A;  2XBQ A;  4PUR A;  3FMW A;  3H79 A;  2P5Q A;  2EIQ A;  2H70 A;  5IPG A;  3ISO A;  4K8M A;  1VGL A;  1ZOF A;  5DCH A;  4O5U A;  4TOP A;  5GAP D;  3TKR A;  3LYP A;  4KCE A;  1HNC A;  4PQ1 A;  4MPF A;  1BJX A;  4IJ3 A;  4TXO B;  4X4J A;  2V6O A;  3HYP A;  1THO A;  1DUG A;  4MAB A;  4GSN A;  3L78 A;  3VFI A;  4K7O A;  3GYK A;  3GH9 A;  2FY6 A;  3IC4 A;  1TKD B;  2IFQ B;  1AIU A;  3I6A A;  3UJ1 A;  4D73 B;  1PN0 A;  1OYJ A;  1B4Q A;  1T00 A;  2CVB A;  1X9M B;  1K3O A;  1S3D A;  2JZR A;  3KXO A;  5CO3 A;  3EUR A;  2YV9 A;  1O81 A;  1T4Z A;  1QUW A;  3IK9 A;  3W6G A;  4POK A;  4QL7 A;  4DVC A;  5G2Z A;  4IW9 A;  4ML6 A;  2CA8 A;  2IWT A;  4ECB A;  2GTU A;  3EMX A;  2GS3 A;  4MF7 A;  2RM5 A;  5A4V A;  5HR1 A;  2B6M A;  2KUC A;  4F82 A;  2MYG A;  1WMJ A;  2HXK A;  2GZP A;  3CYN A;  4TR0 A;  1KBN A;  3ZIV A;  5IOW A;  3TKQ A;  2X8G A;  5IO2 A;  4BWS A;  2NPB A;  3QOU A;  2O85 A;  4J56 E;  2KP1 A;  4IS0 A;  2LUS A;  5LCZ A;  1GUM A;  1LBK A;  4EIP A;  1XW9 A;  4ZB9 A;  3CRT A;  5BRT A;  2REM A;  5IMD A;  1YZX A;  1F9M A;  3D4T A;  3HXS A;  3GN3 A;  4BL7 A;  5D93 A;  1KNG A;  1HNA A;  1V98 A;  2O87 A;  2TRC P;  1VF2 A;  4ML1 A;  3I69 A;  3L4N A;  1EGR A;  3EU4 A;  4BL7 B;  4PNF A;  4MK3 A;  3F9U A;  3TB2 A;  2ZUP A;  3W8J A;  2VOC A;  4HQZ A;  3ZFL A;  4MNN A;  2YZU A;  4OCE A;  5E4W A;  4K5R A;  1M2D A;  1SYR A;  2C0E A;  5KEJ A;  5GZZ B;  2MBS A;  2B1K A;  2YWM A;  1OE8 A;  1TRW A;  2L5L A;  1NSW A;  2DKI A;  2VLV A;  3CSJ A;  1UC7 A;  1TDI A;  1K0N A;  4EIQ A;  3LWA A;  4ZBD A;  2KLX A;  3TUE A;  3FHK A;  2YPM A;  1G0T A;  2X4A A;  3FK8 A;  5AN1 A;  4ISD A;  1ON4 A;  4GST A;  2DKH A;  3EIN A;  1SK2 A;  1WP0 A;  2H75 A;  1PX7 A;  5HR2 A;  1NHY A;  3IE3 A;  2EIR A;  3RDW A;  4K2X A;  4MLY A;  4XS1 A;  4I6X A;  4OWY A;  2DMM A;  2LST A;  4AGS A;  3TKP A;  3D5J A;  2IN3 A;  2E2M A;  4EF0 A;  4KDX A;  2HSH A;  5HQP A;  1GUH A;  1XWB A;  5ECL B;  4FIW A;  2BMX A;  4KH7 A;  4NWY A;  4EVM A;  2X8C A;  3D0Z A;  1EEM A;  2GQL A;  2C3Q A;  3APO A;  2KHP A;  1M9B A;  4X0X A;  2C3N A;  4A5P A;  1JFU A;  4O32 A;  3ERW A;  3UAR A;  3IOS A;  1ST9 A;  1PKW A;  4I2U A;  2VD1 A;  4BWQ A;  4ID0 A;  1WJK A;  2JL4 A;  4TR1 A;  1JLW A;  3GIX A;  1F3A A;  4POB A;  3US3 A;  2ZNM A;  2A2S A;  4WKW A;  3U5R E;  4YQV A;  4MDC A;  1KEB A;  1GH2 A;  1ML6 A;  3Q18 A;  3HDC A;  4WR5 A;  4OD7 A;  1TI3 A;  4MJE A;  3EWL A;  2E0Q A;  1UA5 A;  3FYG A;  3UOM A;  2OBK A;  3Q19 A;  2PWJ A;  2VL2 C;  4K0G A;  2PUK C;  3R3E A;  5IQY A;  2VUP A;  1EP7 A;  1PN9 A;  2LJK A;  1QK8 A;  4QQ7 A;  2H19 A;  4FH8 A;  5CRE A;  1AUC A;  1K0A A;  2MMZ A;  2M46 A;  4KAE A;  3IBH A;  1VF3 A;  4PX1 A;  5FT3 A;  5ECP B;  1BED A;  2PVO C;  3L9V A;  3DRN A;  2PMT A;  2VD0 A;  2NVL A;  2CZ2 A;  3LW9 A;  2K8V A;  2AB6 A;  3KEB A;  2B7K A;  2DIZ A;  3TKS C;  5FWG A;  3L9U A;  4MJB A;  3JCM L;  2FLS A;  3LFL A;  1GTB A;  1PA3 A;  1EV9 A;  2HYX A;  1PL1 A;  4PQH A;  2DJ1 A;  2WS2 A;  7GSS A;  3A5W A;  4K7I A;  1GP1 A;  4NV2 A;  2H71 A;  4LA1 A;  3WGX A;  2QA1 A;  5G30 A;  3HVX A;  2DJ3 A;  1K3L A;  3DIE A;  5AGY A;  3VUR A;  5D9X A;  1ZYP A;  2YWO A;  3VLN A;  1XCC A;  5LNK e;  4KE3 A;  4CY8 A;  4Q5F A;  2IIY A;  4N0Z A;  4KSO A;  1GSE A;  4G0I A;  3M0F A;  1K0M A;  1PGT A;  2XPE A;  5H5S A;  1EZK A;  1T7P B;  3HA9 A;  4JRR A;  4K9Z A;  1T8E B;  2C0F A;  5GST A;  4HEA 2;  3FRC A;  3EPT A;  4WET A;  5D9T A;  1AAZ A;  1XBS A;  3SWL A;  2OKA A;  3GNJ A;  2MMA A;  5DDL A;  4BPY A;  4HOJ A;  5IM9 A;  13GS A;  1YF0 A;  4TXV A;  3KTB A;  4PTS A;  3IPZ A;  4XRA A;  4MF5 A;  3GX0 A;  1AQV A;  2YJ7 A;  5F05 A;  1X5D A;  1A23 A;  4CDO A;  4G10 A;  3C71 A;  3CBU A;  4HQS A;  2HRA A;  2IMF A;  5ECN B;  3QD9 A;  4ACS A;  3HVV A;  1EP8 A;  4GRF A;  3F0I A;  4LLR A;  4XRD A;  2LQQ A;  3ME8 A;  2H8L A;  1RQM A;  3F3Q A;  3TDG A;  1Y25 A;  4OFM A;  5KN3 A;  4IP1 A;  3CSH A;  1GTU A;  3KMO A;  3A2X A;  4L0U A;  3ZRE A;  3ME7 A;  5D8I A;  2LJA A;  1M9A A;  4F9Z A;  4ZBB A;  2FWF A;  4K0N A;  2MZC A;  2F3M A;  4L8E A;  1QGV A;  4JZQ A;  2H30 A;  2TRX A;  1FG4 A;  4YKG A;  3PIN A;  5DVB A;  1Z7R A;  4ECJ A;  2LTK A;  2B3S A;  1C72 A;  2FD3 A;  2HZE A;  4GF0 A;  1O8W A;  2K9F A;  1T3B A;  1K3Y A;  2CX4 A;  3UBL A;  2HZE B;  2A4V A;  2H72 A;  1WPI A;  2VCW A;  4JED A;  2JSZ A;  2NTO A;  5B8A A;  1ZZY A;  2L57 A;  5J9C A;  1SD8 A;  3UL3 A;  3MSZ A;  2P0G A;  3GHA A;  4XTS A;  2PGT A;  3D21 A;  4WBR D;  2AJQ B;  4HU9 A;  3IA1 A;  2H6X A;  4BVY A;  4MH2 A;  2O7K A;  1BX9 A;  3HJP A;  2VLU A;  1O7U A;  3QAG A;  2GQK A;  4EC0 A;  3H93 A;  1G6W A;  2F51 A;  5ABR A;  1LJR A;  2AUV A;  2WJU A;  4BVY B;  3HKR A;  1M2B A;  5HR0 A;  3FZ9 A;  3LQ7 A;  1FW1 A;  4HJM A;  5H5Q A;  4PUF C;  3MNG A;  1YEX A;  2I1U A;  3RPP A;  1MDK A;  2CVK A;  1O8X A;  1X9W B;  3VWW A;  3A5I A;  1YKC A;  1CQG A;  1Z7P A;  1ERU A;  4YAV A;  2KP2 A;  4FQU A;  4FYU A;  4IQ1 A;  1UVZ A;  3UBK A;  2VCV A;  1SU9 A;  4I8B A;  1U87 A;  4TR4 A;  4GWR A;  4AJ6 A;  6GSY A;  4J2F A;  18GS A;  1G7E A;  3G9B A;  2I4A A;  5E59 A;  4AF2 A;  1F6M C;  2GLR A;  1BG5 A;  2B5E A;  4GCI A;  3VPQ A;  2M72 A;  1WRY A;  2IMD A;  4DEJ A;  1R4W A;  4IEL A;  3ZVJ D;  5EPF A;  3HD5 A;  2X64 A;  2H73 A;  8GSS A;  3GUR A;  5L71 A;  3LXZ A;  1TU7 A;  2VM1 A;  1X5C A;  3KP9 A;  1PRX A;  2MMN A;  2V2G A;  1U88 A;  2YV7 A;  3QR6 A;  3LEF A;  3A3T A;  2CAI A;  1B9Y C;  2LEG A;  3P7X A;  2YAN A;  2I9H A;  4MCU A;  2C0D A;  5GSS A;  1R5A A;  1EEJ A;  2C4J A;  2HLS A;  4I2T A;  2YCD A;  2LS5 A;  5IMC A;  5J41 A;  2R0P A;  4NV5 A;  2F8F A;  3O6T A;  2KOK A;  1GTA A;  2LRC A;  3HVS A;  1NHO A;  1MD3 A;  2DLX A;  2HI7 A;  3M9K A;  2HE3 A;  5KOX A;  2LKU A;  4QL9 A;  1K0O A;  4ZIJ A;  2I81 A;  2RM6 A;  1SKS B;  3DEX A;  2QA2 A;  3WT2 A;  2HRF A;  3GL3 A;  3D6I A;  4YAP A;  6GSU A;  2F9S A;  4JBB A;  1G6Y A;  3TJF A;  3RHC A;  5D9V A;  3MYD A;  1SL2 B;  1F37 A;  2IMK A;  1J9B A;  6GSX A;  2BJX A;  2H1G A;  4KCA A;  5G31 A;  4Z2T A;  5B6M A;  4MMM A;  4HJ2 A;  2H1D A;  2DJ2 A;  3WYW A;  1R7H A;  3RPN A;  1T4Y A;  4GQC A;  1M7T A;  1VF4 A;  4TKY A;  3FY7 A;  10GS A;  4NMU A;  2R37 A;  5CRG A;  2GZZ A;  16GS A;  4G0L A;  4BA7 A;  5ECI B;  2PBJ A;  3M8N A;  3IR4 A;  4K5S A;  1KTE A;  2AAW A;  3TRX A;  1R26 A;  2WB9 A;  1AXD A;  4ZIL A;  4I97 A;  1M2A A;  2R3X A;  2YNX A;  3ZLP A;  2DML A;  3EVI A;  5B8B A;  5H5R A;  1ZYE A;  2H0I A;  4DSR A;  4POM A;  4MJA A;  1B4P A;  4ZB6 A;  1TU8 A;  3VI5 A;  1SEN A;  3L0H A;  1K0D A;  4OMV A;  4OFT A;  1SL1 B;  3APQ A;  4F0C A;  4EDY A;  1GUK A;  3C7M A;  1AQX A;  3TRP A;  4EE0 A;  4LL4 B;  3SBC A;  1XOB A;  3GSS A;  1GRX A;  5AIS A;  1XW6 A;  5IO0 A;  3BCK A;  4KA0 A;  3QFB C;  2JZT A;  2H1B A;  5DCG A;  3RAZ A;  2BTO T;  1ZYQ B;  3FKF A;  3IAM 2;  1XWC A;  4ILF A;  4WF5 A;  2A2R A;  3FR3 A;  2JAC A;  2LNS A;  3GMF A;  4KDY A;  1SJI A;  2DJK A;  2VCX A;  3KD0 A;  1JZD A;  1XWA A;  2LRN A;  3ERF A;  5CRH A;  1N2A A;  1WWJ A;  2VL2 A;  4ZL9 A;  3DWV A;  4MZC A;  3IAS 2;  1YY7 A;  3TGZ A;  4JR6 A;  4Z7X A;  2Z9S A;  5G1L A;  5DJM A;  2TIR A;  1I5G A;  1DBY A;  3KH9 A;  4GLT A;  5B7C A;  4ULX A;  3GV1 A;  5KN0 A;  2LRT A;  1TXX A;  4HU7 A;  1Z6N A;  4CHS A;  2NDO A;  2IMI A;  3TKS A;  3ZTL A;  4IGJ A;  1Y6E A;  3F4S A;  2H0G A;  4XIH A;  4ICY A;  4TW5 A;  3QCP A;  2N5A A;  3GH6 A;  1MD4 A;  5JWQ B;  2H74 A;  2YWI A;  3TJG A;  4NXI A;  4IP6 A;  1U3I A;  3EMP A;  4V1A p;  4AJ8 A;  3TJJ A;  5F0G A;  3ZML A;  5CAX A;  4TR1 B;  3PH9 A;  4YKF A;  2GQM A;  4DSQ A;  1Z3E A;  1XPV A;  4KX4 A;  4NHW A;  3GFK A;  4G2E A;  5JCG A;  1OC3 A;  2C0G A;  2K18 A;  2OA7 A;  2DBC A;  12GS A;  4LL1 B;  5IOX A;  3IHQ A;  5ECS A;  3ZMK A;  1TI1 A;  4K6X A;  4OCF A;  3F4T A;  1XWG A;  2L6C A;  2RII A;  3TKS E;  3J7Y k;  3QFA C;  1ZYN A;  1W4V A;  5EVO A;  3TRQ A;  1SK1 A;  4H86 A;  3WGD A;  3PR8 A;  1QQ2 A;  1GL8 A;  1OC8 A;  4HI7 A;  2WDU A;  1OC9 A;  4OO4 A;  3AY8 A;  2A2P A;  3F6D A;  3PGT A;  2R0G A;  2H66 A;  4FYB A;  2HSY A;  5DQY A;  2XC2 A;  1GSU A;  2HRK A;  1S3C A;  2CT6 A;  1OC9 B;  1K0C A;  6GST A;  4G0K A;  1PL2 A;  1GSD A;  3ED3 A;  2R4V A;  2V32 A;  4DSS A;  4MF6 A;  3U6V A;  1FB6 A;  2ALB A;  1SJZ A;  2QGV A;  3FR6 A;  2YN1 A;  3TOT A;  4K7N A;  3UIW A;  2I3Y A;  2JSY A;  2X8H A;  4G19 A;  2C8U A;  4Z2R A;  3KH7 A;  1XOA A;  2V6K A;  5A5K A;  4F03 A;  3S9F A;  4I5Q A;  5G5F A;  5CYY A;  5J5N A;  2GSR A;  3NZN A;  2PVQ A;  1ZMA A;  1XZO A;  3TJB A;  5AIV A;  4V2L A;  3A2V A;  1JZO A;  20GS A;  5J4U A;  5CRD A;  1GSQ A;  1YQ1 A;  2FGX A;  2YWN A;  3P8W A;  3CTG A;  4RQX A;  4K2D A;  1BQ7 A;  1B48 A;  1YEP A;  3QMX A;  5INY A;  4WXT A;  2UZ8 A;  5J3R A;  5HR3 A;  5G5E A;  3DD3 A;  2IPA A;  4KGI A;  3HZ4 A;  1XVW A;  2M80 A;  5ELA A;  2H0H A;  5IMA A;  1SL0 B;  3N9J A;  4E8E A;  4G9H A;  3GKM A;  4N11 A;  2HZF A;  1OAZ A;  1J08 A;  3GKN A;  4L5L A;  1VRS D;  1TRS A;  1FOV A;  3NOF A;  3KMN A;  3BOA A;  2RUF A;  3CMI A;  3C1R A;  2OAD A;  3LXT A;  19GS A;  4NAX A;  2AYT A;  2D2Z A;  1JZW A;  5F07 A;  3GKK A;  2O89 A;  5EY6 A;  3ZRD A;  1V57 A;  2GGT A;  1TP9 A;  4AJ7 A;  1NM3 A;  2R2J A;  1I9D A;  6GSV A;  3KP8 A;  2QKE A;  4HUA A;  5DAK A;  1GUL A;  1M0U A;  2OE0 A;  1A0R P;  1PD2 1;  4O5R A;  1U6T A;  1EOH A;  3RHB A;  2FWE A;  1ACV A;  3R2Q A;  1PQN A;  2GSS A;  3IK7 A;  5ELG A;  3KZQ A;  3EC3 A;  3UVH A;  1A2J A;  1YDK A;  5J9B A;  4IKH A;  4HDE A;  1PKZ A;  2VIM A;  2HRN A;  2P5R A;  5DJL A;  1SD9 A;  2N5F A;  2JAD A;  2OAC A;  3BD2 A;  1BAY A;  4WBJ A;  5CRW A;  9GSS A;  3HHV A;  2CAQ A;  2OE3 A;  1GSS A;  2CVD A;  2GDR A;  2VO4 A;  4KND A;  2X99 A;  14GS A;  3A2W A;  1A0F A;  3G7J A;  4TRX A;  5ID2 A;  2LNT A;  2HSM A;  3LYK A;  1SJ6 A;  4OO5 A;  1XWK A;  3CXG A;  1A2L A;  4PXO A;  5IMV A;  3D22 A;  3PPU A;  5COH A;  3IRA A;  1SKR B;  3GUS A;  3CSI A;  2GVP A;  3GTU A;  5HFG A;  1Z9H A;  4TXO A;  3FR9 A;  4YQM A;  3GTU B;  1N8J A;  4P3Y B;  3WGE A;  4POL A;  1TJD A;  2IJY A;  4MPG A;  1YF1 A;  1MEK A;  5IMZ A;  1O6J A;  3G7I A;  1A8Y A;  2IME A;  4MZB A;  4EO3 A;  5DQS A;  4KF9 A;  1OKT A;  4IN0 A;  2L4Q A;  3KCM A;  3WD6 A;  1ERT A;  2WUL A;  5JWR B;  1MDJ A;  3DYR A;  2YJH A;  2IFQ A;  4D73 A;  1F2E A;  2H6Y A;  3VPT A;  5DAL A;  2LV3 A;  1X5E A;  4Z2U A;  4ZB8 A;  3DKS A;  1XVQ A;  2RUE A;  4MA9 A;  5DAL B;  1WOU A;  3NIV A;  2EC4 A;  1OKD A;  1TRU A;  4X43 A;  2VCQ A;  5GAN D;  1Q98 A;  3LGC A;  4JE1 A;  4O92 A;  2JU5 A;  3VI7 A;  3F63 A;  3QDN A;  2MBT A;  1JLV A;  2FA8 A;  4ZXG A;  5IMF A;  4Q5Q A;  5JWO B;  1IYH A;  2XBI A;  2VCT A;  4Q5N A;  3M9J A;  2NBS A;  4N10 A;  5ECR B;  1HQO A;  6GSW A;  1THX A;  3HCZ A;  4NPB A;  3IC8 A;  3CRU A;  2OJL A;  1V40 A;  4XHM A;  3ZFB A;  4V2M A;  3FEU A;  1MTC A;  4O5Q A;  3O3T A;  3F4R A;  3ZZX A;  4WF4 A;  5ENU A;  3E9J B;  2J23 A;  2EIO A;  2H01 A;  4RUV A;  4ECC A;  2L59 A;  4IQA A;  1PX6 A;  3GST A;  3HY2 A;  2GT6 A;  4L0W A;  1SK0 A;  5KN2 A;  2VL3 A;  1DE1 A;  4IHU A;  5EL8 A;  3I9V 2;  3F3R A;  3Q6O A;  1YJ6 A;  5BMU A;  2L4C A;  4LMW A;  1OE7 A;  4LMV A;  3O76 A;  4PUA A;  4MP4 A;  4GSS A;  1X0R A;  1HYU A;  3HJM A;  1V2A A;  2E7P A;  3G7Y A;  5ECH B;  3E0U A;  2CQ9 A;  3IV4 A;  3VWV A;  3D4M A;  3HZ8 A;  2LJR A;  2FCH A;  1JZR A;  1PSQ A;  2DJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...