2YWZA

Structure of new antigen receptor variable domain from sharks
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
AWVDQTPRTITKETGESLTIKCVLKDHSCGLSSTTWYRTQLGSTNEKTISIGGRYDETVDKGSKSFSLRISDLRVEDSGTYKCQADYSPSCYSYPSLESAVEGAGTVLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shark IgNAR antibody mimotopes target a murine immunoglobulin through extended CDR3 loop structures
pubmed doi rcsb
source organism Orectolobus maculatus
molecule tags Immune system
molecule keywords new antigen receptor variable domain
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ywzA00
3GMOB 1YPZE 2HTKD 2DQTH 3T77A 4J3WA 3WFCH 1T20A 1JNHB 4I1NB 3QUMH 2R1WB 5CUSH 4NM8H 3W39B 1N2RB 2J88H 2WLYA 3GGWB 4XP1H 5HYJE 1GC1L 1ZSDB 3U7YL 1GSMA 5C07A 4LQFH 1MELA 1CTNA 3VG0H 1KN4H 3CUPB 1X5JA 3QAZB 2XKNB 3QXAB 3PHSA 4LHJB 5FEBA 2VMFA 4TRPH 1NLBH 5FGSA 1BIIA 3QISA 3ULSA 5JLZB 3EZJB 4G43A 5D1QD 3UTPE 1Z9OA 2GK2A 5T1MB 2BNRA 5IEHB 2FH6A 3WLBB 3L3GA 5SWSE 1HQRB 3GJEA 15C8L 3T2NL 4U33A 2R0WL 4PJIF 4ZOEA 3IXAA 4PB0H 1JV5B 1IGCH 1V3KA 4QKXB 5T1KA 1AGFA 2OTPA 2R0LL 2YD9A 3G08B 2OCFD 3O8XB 1IEHA 5DQJA 4U3XA 5BV7H 3UTPD 4GAFB 1SMAA 3ZT5A 1DQMH 5IVXB 1LMKA 1FNSH 4XBGA 3PWLA 3VE0B 1H8SA 4C54A 4JRYA 1IM9D 4NO0D 1SY6A 2C1OA 4PRDB 5IQ7L 4M62L 4GBXA 1KJ2B 4HIXH 4Y2DA 1OGAA 5DURB 5CINL 4F33B 3LPGA 4OZ4B 4YPJA 3O4LB 1ZLUH 1NGXA 5IFAH 4IOFC 2XICA 4LSUL 1TZHB 3F58H 3ECBA 43C9A 3I02B 3PXHA 2APFA 4KI1A 5DZNA 1P4IL 3T0EA 4ODTH 2VXUL 3K81A 3W9DA 4QRQA 2BNQD 5BQ7A 2X4QB 3AREC 3ARVA 2F54D 1INQA 5F1KC 4P5TD 1BFTA 3KPQA 1HWGB 4XWOD 3BEVB 1WZ1H 1KYOJ 5EORH 5TDNA 3MXWL 4Y1AE 5BS0B 2AGJL 2VQTA 1CLYL 4M4PA 4OIIL 4PJHB 3VFWB 4WGWB 4PJBA 2BFVL 5JPNB 1YMME 4U6YA 4YWGH 4LLUA 3S35X 3G5XA 5A2LH 3UPRB 4XCEB 3SEPA 1CZ8L 3MLRL 3MUJA 1BGXH 1IAIM 1FVDA 3HMWH 5HHMB 1G7HA 3QXDB 4HKZB 2YC1A 1I8LC 3RWHB 4U1MB 2CIKB 1UG9A 3QEQE 1QEWB 2CK0L 3O3AB 4XTRD 1S9WB 2VITA 4GMSL 4OCRL 2DLEA 4P2QB 5F1NA 3P4MB 1WVZA 5D6CB 1X3DA 2X4RA 1L7TL 4H5SB 4CNIA 5GSRA 2QL1A 3X3FL 3ULUE 2BK8A 1OTTC 2VSDA 2BY0A 2EEAA 3BW9B 2EDHA 4LCWA 4HLJA 2W0KA 3V0WL 2RCSL 3EO1A 3TO4C 2VC2L 3HNVL 4PREA 1KEMH 3DBXB 2LU7A 1YYMH 5C08E 5EUKA 3S34L 2DLIA 3M8OL 4IDLA 4XP5L 1KGCE 5CEZE 4FFVD 3VXSE 4W4OA 5CSGA 4HIHB 1MPAH 3O3UN 3D18A 1S5IL 4PFEA 4JKKA 4J23A 4WTZA 1S7XB 3TJHD 1PKOA 4DOHB 4NHUA 1NGQL 1BZ9A 1QFOA 1NCDH 3BFOA 4ORZC 4N90D 5BS0E 1DN0B 4EXPX 1MHPH 5TDOB 4AT6B 3SE4A 1C5DB 5TFSH 4ZS7L 3VWJD 1JGEB 3QFJD 3G6JE 3RKDD 3BDYL 4PGDB 5C8JA 3TCLA 3RUGA 1RUAH 4ZS6D 3SE4C 1K6QL 5GSVA 4IIQC 1I3GL 5DJYA 4NUGL 5E2UH 2FJFB 5C0GA 3DIFB 1G9MH 2D7PA 2X4TA 5TE7L 2ZZUT 4M43L 4BQCA 2GJZA 1G84A 4AEHH 1FFRA 5KJRH 1EUTA 3P4NA 1L0QA 4Z77A 4HIJA 3VG9B 1AO7B 1A6UL 3IDUA 4JFOA 4MCYA 3CAFA 3CFDB 3OB8A 4G6JH 5ECJE 5EU6B 2DQDH 3T3ME 2E7MA 5D2LF 4QHUA 1LVEA 1FP5A 5GQBA 3ISWA 4KKAC 4EDXA 2AJSL 2EC9T 4NO2A 3RWEA 2NW2B 2FDBP 1IMHC 4J4PD 2ID5A 2EE9A 5EUOE 2JIXB 2Z4QB 4XCYA 3O6LH 5BZWB 4S1SH 2H32H 2J8UE 4IM8A 4EIGB 3WHE1 1MQKH 1N4XL 5GS0C 1NAMB 5JPMA 1A14H 3KYNB 4ZFGH 5HDLA 3T2QA 1J8HA 3MLZL 5E99L 4OIAA 1MJUH 1RUKH 3VXUD 5DJXB 1OTSD 1L7IL 1NSNL 3CK0L 4IOIA 3WIIL 1X5GA 2DQHL 1HXMB 4PRIA 2FEEI 4LHUA 1ZAGA 2E3VA 1OAUL 2XZQH 5LQBL 3DSFH 2OJEB 1LGVA 4O9HH 3LVEA 1G7PA 3QUMB 2R9HC 2W0LA 2EH8L 2HMID 1VFBA 2P42B 5CEYB 4PY7A 3VU2A 3B5GA 5J7CC 1RK0A 4HUUB 5HYJB 4S1DC 1NBVL 4UT7H 4RAVA 1HDMA 3EYUH 3VXUE 4GAJL 2Y1VA 5JO5B 1FL6B 1IT9H 2VLJB 32C2A 4YDJA 2JB5L 1R3KA 3G5ZA 1UM5H 3NN8A 1TETL 4YHYC 5DK2A 2Q3AA 2VLJE 2VN4A 1MCHA 4ONOA 5I1CL 3HZKA 3VXMA 2UZIH 3ZKQD 4MA7L 1FN4B 5TQ2H 1FORH 4UOJA 1MVUB 1A7PH 1RI8A 4P5TC 5I8OH 4S0TD 4EUPG 5C92A 1BEYH 1XIWB 2F9BT 3FCTA 2DLHA 4H0GA 1YC8A 4P3CH 3CFJA 4FTVA 4C4KO 2C7UA 5E1HB 2ZCHH 4JQXC 2CDEA 3GBNH 4P9HH 1HEZA 4RBPH 4DVRH 3ALXA 4HZAA 2BNRD 4QXWA 2BX5A 2ZSWA 1U8QA 2BHUA 4OFVA 1CDIA 5DJ0A 1QBML 4J3OC 5GGUA 3Q5YA 1I3VA 1Y6KR 2IBZX 3QXUA 2FIRT 2FYYB 1FO0B 4OZHE 4YC2B 3OX8A 2IFFL 4N1HB 4QXGH 5CCKH 1IQWL 1X7QB 5IESL 3VFPB 2K7QA 4GLRH 5F1SA 4Z7NE 1I9IL 1JWMA 3HA0A 3RVWD 4L4VA 3EIFA 5HVFB 1KPRB 4IRJA 5EUOF 4HKJB 3H3BC 3V7AE 1OAZL 2VXVL 1LO5B 4NJ9L 3RX5A 5FUOL 2R2EA 5HGHB 3KLSA 1EAPB 5MENA 3MLUH 5HJ3A 4O58H 3OKKB 2W60A 4RGNC 1R3HA 4X9BA 3S36X 4HT1L 5ICZB 4XBEH 4DKFL 4JANB 1C08B 4PTTA 3FOLA 3QO0A 5FDWB 1H8OA 1I1CA 4FP8H 1ZGLP 4DQOL 3VFUA 2GT9A 3O6FA 3BD3A 5B8CC 4BSVA 4WHCA 5JQ6L 4LCIL 1RURH 4UINH 2A2QT 2P5WA 5EWIH 1D7FA 1PZ5B 3RPIA 4HHAB 2DIJA 4E42B 4P0DA 4AY0A 2OTWB 3QIWC 4PTUB 3FFDB 1ZLUK 1SYVA 3MBEC 1Y18B 4GQ9L 4HJJH 4RNRA 3OAYH 4UNUA 1HH9B 5CD3B 4PYHA 3PWPB 4LIQE 5IK3B 1I8MB 5KSVA 3KLHC 4YO0B 4L3CA 5M95B 4L8DA 5IBTH 1RIUH 1YDPB 3CXDL 4F15C 5ANMB 1A7NL 1TPXC 2P8PB 1S7RB 1IBGH 4C83A 3T0BA 2VOTA 5J1AA 5HY9B 4Y19D 1AD0B 3WMSA 3RGVD 3REVA 4X5XB 2FR4B 2DKSA 1CXIA 1KTRL 3SY0B 3VFOA 4HAFA 1V05A 3P9WB 4JFQA 1SHMA 1HZHH 4ISVB 1A1OB 4MJIB 2APVA 5DK0B 5AUMA 1B4JH 1M4KA 4LKCA 1IM3A 1UC6A 3GJFB 1MCWW 1CD8A 2AP2A 1UWEL 4OM0L 4C55A 1IKFL 4L4VD 3G6DH 5AZEL 4NPYA 4R26L 2VXTL 3QIUC 1R5WB 1FNEB 4U6XB 3DROA 4L8SA 1BBJB 2W65B 1ZOXA 4FZEH 3PHQA 1JUFA 1OARH 2VLME 1DL7H 2Q8BL 1KBGH 2NY1D 3ZSSA 1BP3B 2P7TA 5I0ZA 4BQ6A 3BGFC 1B88A 3VD5A 1QSFE 2ZOLB 4PJGB 3NCJL 4CADB 2YPLA 5I9QB 3KJ4C 4GRMB 1DQLH 3B43A 3SDAB 4XP9H 5E2TL 5CGYD 1IILE 2BVPA 1A9BB 4F8QA 2PXYA 2DWEB 2Y06H 3WL9B 4IRJC 1CFQB 1G0DA 3FO0H 2VLMD 6CGTA 3P40A 4AH2B 3PGDB 1QKZL 4JREC 4UV7H 3D2UD 1FZOA 3ULVD 1RZJL 3CFKB 3DMMD 3OL2A 1LD9A 5J11B 2QQKH 3KPRE 4F58L 4U7SA 3BMWA 1NEZB 2E6JA 4P59H 3GHBL 3GKWL 4U1KA 1KT2B 5T3ZL 2AK1H 4FABL 4OF8A 3UXFA 3ZTNH 5I1AB 1ZVSA 1FVEB 1CDYA 2XXCB 3MJ9H 3D39B 2Q1EA 3V6ZA 3MA7A 1JF6A 2X40A 3LH2L 3GRWL 5J13C 3VCLA 5L2KA 4FQLH 1CGSH 1KIRB 1PKQE 3VH8G 4JRXA 3UTTD 3CFIC 1WC7A 1JYXA 5BJTA 3N9GL 1BECA 5FA4A 1F4YH 4K07A 4OI7A 5D2LE 1T4KA 3CVHA 1K8IA 5FHAL 1EEZB 4Y4KD 3TF7C 3SBWA 1UVQA 2AV7B 1KCVL 5IB2A 3CH8A 2FX9H 5CEXB 3JV0A 1MCSA 2G60H 3O45B 1FNHA 2NTFA 5A2IH 2QSTA 1KJ2L 1T21B 2AEPH 5JUEH 2FATH 2YHGA 2H32B 1B90A 1YA5A 3WHXB 3PP3H 2NY4B 1C1EL 4FG6C 3NGBC 4QRRE 5D96C 1U8OA 5E6ZA 5E6IB 4YDIH 2ZPKL 1AXTL 4NZRH 4PRIE 4L29B 5KSAA 3O6KL 2NPLX 4LOUD 3KLDA 1FYTD 2MFNA 4ODBD 4LSVH 5AG8A 2HRPH 4W4NA 3HI5H 1DBBL 3P77A 4PB9L 1QFUH 3BJ91 2O5ZL 3IDMA 2B2XH 3KPPA 4JM2C 4TVSa 4M6NL 5JW4M 2GTZA 5CJQL 4MMXC 3MLTB 5DD1L 3FQWB 1EFQA 3RBGA 2A6KB 4N0CC 3VFVA 2E8YA 2J1KA 4IJ3B 3BH8A 4JFDA 1F2XK 4UDTB 4HLZH 1CCZA 4Z78B 2YRZA 4NGHH 3VGAC 1KPVA 4GH7B 2DMBA 2NY7L 1A9EB 4BJLA 4Z7QF 1KIPB 3W11C 8FABA 3PIQB 5JHDA 4OLVL 3VI3E 1E4XI 5D8JH 4IRZL 1WZMA 2NX5E 2XG5A 3MV8E 3RJDA 1NC4D 1ZLSL 4I9WD 1D6VH 4WO4B 5EIIA 5F7FA 3GMOA 1ZT1A 4WWKA 1MHEB 5FV1L 5J0BA 4BUHA 2FGWL 4Y4FD 1G7QA 5IBUB 4O51A 4DGIH 3QJHA 3SPVB 2H45A 4CVZB 4AG4H 5E94B 4YHOH 3ZTJH 5IB5A 5I18L 3PJSA 4LLUB 4Y4HC 4OKVB 3C8HA 2YXMA 4KI5E 1BM3H 4B5EA 3CUPA 4CU8A 1FVDB 4I9WE 3QFDB 1S9VB 4LPWA 4XP4L 4ZQKA 1BIIB 3T0EC 4GG8A 1FO0H 4XZUB 4E41E 4BH8B 2ORBH 4RMTA 3ZHKA 5KSBA 5GHWH 1XH3B 3JVGA 3G5VA 3GJEB 4OF6A 4FFWD 3GZKA 2XTJB 3P4MA 1ZEAL 3QJFA 4LSQL 2B0SL 1NJ9A 1CFVH 5GSRB 1JYNA 1T7WA 2MQCA 1LEGB 3HTLX 3EDFA 1VKXA 5IT2H 4Y5YB 5DTFA 2ZSVA 3RVTD 4TQEH 5DMKA 4OLWL 4KZEH 5I71B 4ODUA 2JCCF 3S4SG 1UADC 3MRJA 5EUKB 4UBDC 2DBLH 3DRQA 1CLOH 5T3XE 12E8L 2JKXA 3BZEB 4PRDA 3OJVC 4Z7UA 4OFKA 1Z9LA 4YDLB 2P5WD 2A83A 1QSFA 4WI4A 4GRLB 3D3VB 4P9MH 3O4LA 1WWBX 2AQ3A 5D1ZA 5FV2A 1I9JL 3BRDA 4X98B 3WIFA 4H25B 3O2VL 2VNCA 4KPHL 2X4SA 2VLRE 4BZ1L 2WINB 4NQUA 4I5BA 1AGCB 4YPGA 3W9DB 5C09B 3GMNA 2Z35B 5HHOB 4U6VL 2XN9A 2X1XR 1G7MA 1A6AB 4GO6B 4TVPE 4QYOA 3GMRA 2GEEA 4X7TA 2EKSB 5E2WH 3HZYA 2EH7H 1RUML 2VDML 2DBJA 5TDNB 3FT3A 2D31A 3U2SB 2BSSA 3KPSD 4DZBB 3KHQA 1YEGH 4TUJB 5D93C 4OQ1A 3QZWA 3P4NB 2QEJA 4WFFE 4Y4KA 4HIJB 4XCFL 4JQIH 3K46A 1GHFL 3PL6D 4P2OC 3CSYA 3UX9B 3TVMC 1MLBA 3ZDYE 2VAAA 3L6FA 1IGFH 7CGTA 2V6HA 3OKMA 4FMFA 4NO2B 4QXTA 5SWSA 5IVZA 4N0YH 3CX2A 3RKDC 1T1YB 3QULB 4N90E 5C7XL 3TEUA 5E9DD 4ELME 3B9KC 1OM3L 3RQ3A 2ZNXA 3MBED 4M7LT 4JVWA 1YJDL 1NGWA 3S97C 5F7EL 5EU5A 5EZLA 5EUOA 4L9DA 1VEOA 5D6DC 1UEYA 1WIOA 3MROA 2KBGA 1D9KD 4GKNB 2YUWA 3NTCH 3TYGH 4EN3D 2AXHA 1NC2B 2EXWC 3FN3A 4GT7A 4Y2DC 5HGDB 5MP6L 2VE6B 5DMIL 3DYMA 1BFVL 4GG6A 3F12A 4KXZI 5IMMB 4OCWL 4HKXA 5K9JL 3QRGL 1NUDA 5I1IL 1QFWH 3V5KB 3D85B 3MNWA 2QHRH 3C2SA 4P48A 1UACH 2GTWB 3CU1A 4ZUTB 3ARFB 3BKJL 3CVHH 4QHKI 5DEFA 4MDIB 5D7IE 4L3AA 5D7KE 3BH9A 3T0AA 1FL6A 1WEJL 5CJBA 3KXFD 2CO7B 1KTDB 5C07D 5FIEA 4D8PA 4OCSH 3U4BH 2PYFA 4KTEH 3L7EB 4NCC1 3B8SA 5F7NC 5SX5K 3DVGA 3ZSTA 5F9WC 3VXUA 3MUGA 5MEOA 1XF4A 2G9HA 5T3ZD 2EDJA 2XQYK 1ZWIA 1FV1B 4LNRB 2B1HH 3QHZL 5GGRA 4H8WC 3L7FB 4CGTA 3U0WH 2Y4SA 2DQIL 2ZP0T 4P3DB 2QJDA 5ERWA 1FPTH 2X70B 1CLCA 5KVGH 1ADQA 1KULA 4WHYH 1IEAB 3RUGB 4YHLL 4HPOH 4X4XB 1FG2B 5TDPA 3VMPA 2XPGB 1S78D 3GSUA 4TVPL 4X99B 4MB3A 1UH2A 4OD3L 5D1ZD 1JF1B 2I07B 3V0VA 1WCQA 5H94A 2XNAA 2Q7NA 2QQLL 4KMLB 4KVNH 4MX7B 3OAUH 1T20B 3UTTB 2AJUH 3D9AH 2MQ3A 1JZ4A 3U7WH 1IKNA 4AEFA 3WFEH 5LGHL 4OZGA 1RJLA 4NT6A 2XN9D 1B4RA 3HE7C 5IJKA 2P43B 4LVNB 4FQCL 3QXAA 4NCC2 4HKJA 3BMVA 2HLFC 2A6IB 3TBTB 5IVOA 3IFLL 4KTDL 3KPOB 1E4XH 2J8UF 1D6EB 4ONHA 1JGLL 2OL3H 2ADFL 3VDCA 3VXTB 4PRAB 1ACYH 1T6WA 4OZFA 4X9FA 4PJXE 2YN5A 3GI9L 3AXLA 2D03L 3VFUB 4QT5B 1H9VA 2EIZA 4P4RA 1JV5A 4WUKH 4OF7A 3DHJA 4WI6A 1HXMA 4NYLA 3L3HA 4QRPD 2FCBA 5L0QB 3O8XA 5B3JF 1MFDL 2Z91A 4QWWC 3NMEA 2R4RL 2WNGA 3TH3T 4X7SL 1TJGL 1MFNA 5IFHL 1A1NA 1RZIB 1D5IL 3O11B 1YEJH 5C0FB 4LLQB 1HH9A 4P4KC 3C6LB 4V1DA 4WFED 3W2DH 2DQJL 3SE9L 1DDHB 5CD5C 2V2XB 1NBZB 2VR5A 4X6CF 5ETUB 5HHME 3IDYB 1F90L 5INDA 1S7RA 1JVKA 3QAZC 4OAWA 4Y4FA 1A5FH 1J5OH 3D0VB 5KSBE 3C2AH 1TVDA 5HY9A 5DK2B 3SGKA 1AD0A 1NL0L 1OGAB 3RVXC 1NC2D 4X5XA 2R2HA 3JWDC 1XGPA 5HHVL 4TTGA 4UIKH 1RU9H 1TZGL 1P9MC 3MBXH 4OCYL 3GIZH 1KC5L 2NQCA 4XHQA 1F3JA 4NJAL 3IFPB 2MCPL 2BOCA 1AI1L 3U0PB 5HHMD 2NYYD 3OXSB 3I75B 4JY6B 5I6XC 4QRQB 2CIIB 4R0LC 4TYUA 4RGMC 4MLIA 5MEQB 4FNLH 1C5CH 1FNEA 3E3QC 2FSEA 4Q74A 4LDOB 4YNYA 4X0KB 1IRAY 5FYKE 3QUML 3V6FB 5LXGL 3FB6B 4I3SL 3HB3D 5KTEL 4WUUB 2J88L 4UI2A 2HWZL 1U3HC 4MQ7A 3NAAH 2Z92B 4WEBH 2Y5EA 4RRPA 1I7TB 2Z93A 1F4HA 4E0RA 4P2OD 1BZ7A 3OF6D 4NQSB 3BP7B 4YX2L 5FO8A 1P5VA 5E8DH 2UYLA 2COQA 2DWDB 2CQVA 3ALWA 1EFXD 3S8WA 1OLZA 1H3WM 1GGCH 4R7DA 4NZJA 3THMH 5F89B 4A6YL 5DO2D 3MLSH 3VRIA 2VDQH 3L5IA 3R1GL 4P5TA 4GMTH 2XTJE 3F62A 1A7OH 1CGXA 2R2EB 3PGDA 2OR8A 1FAKT 5HYSG 5DJAB 4AZ8A 4G7YL 4Z0BL 2DYPA 4X9HA 2ADGB 5A40E 4UQ2B 1TJHL 3B3IB 2CPCA 4EOWH 2XRAL 1EEUA 3PWVA 3A6BL 4IDJL 1AHWC 1TQBC 1DANT 3LIZH 2AKRA 1JHKH 4HULB 1FJ1A 3KHOA 1Q38A 5I1KH 4MNGA 2CXGA 4LASH 1ZVSB 4OQTH 1H3GA 3VE0A 4J3TA 1X6NA 3OWEA 5SX4I 4NZTL 3MA7B 4GKZA 4UTAL 1G0XA 3P73B 5CMAA 4YHIA 5DD3H 2I9LA 1J86A 1MRDH 1SVCP 4G9FE 3S3JA 2P44B 4JY4A 3D69B 1C16A 5KOVC 3PQYD 2DI7A 3QRFM 5MHSD 1NCNA 4ZSOE 3EGSB 5EZJA 4WU7A 3RY6A 4KMQA 3U0TA 1T3FB 5C0CB 1MIEH 2O26U 4P5MB 1SY6L 5BXFB 1GGIH 3V6BR 3TO4D 4F7CB 1PVHA 5IOPB 2GCYB 3GSXB 4G6AD 1JZ3A 2Z31C 3GSNB 4UTBL 5KZCB 4NHUB 1BZ9B 5T1KD 1Y0LB 4ISVA 3EFDH 1NAML 1E6OL 4LLWB 1BWMA 2FJGB 1QSEE 3QG6A 1RZFH 3HE6A 1LO3H 4AT6A 5DFWH 2NNAA 2YD6A 3P9MA 4PJ5A 1OD9A 4XX1G 3T77B 4D0DB 2XI9A 2Y07H 2AJYL 1UXWA 3NPZB 2R1WA 1BBJA 2W65A 3PHQB 4OIIH 1QFWI 2A9NH 1DFBL 4XPFH 5C2UB 2EDKA 1OTUD 3RAJH 3HZVB 1MREL 2EYTA 5D5MF 5FYKL 5I8EB 5EC2B 3DPBA 3BESR 2CKBH 4D3CH 5FO7B 3RVTC 3VW3H 1ZANH 5DZLA 2B1AL 3DYOA 3EYFB 2HVJB 4XPBH 4PG2C 3PV6A 3RL1B 3DX9A 1QEWA 3WLBA 4X7FC 3LZFL 4G8FB 1RJCA 5D2NB 5IF0A 2QADC 3T2PA 1IZKA 1F6LL 1YYLH 4KJPC 5DUPH 3PWUA 1A3LL 3OKNB 4OV6F 3QCUH 3DURA 1UWXH 3C5ZD 1MHHA 2K9UA 3QEUB 1MI5A 1VFAA 2GAZB 3HC3H 3KWWA 4FQPA 2E9IA 4Z8FH 3RTQA 1CBVH 3AS3A 5F96L 4P4KA 2AAVA 2VDPL 3FQUB 3PF2A 4R8WH 1J1XL 2NW3B 2NZIA 1KEML 4MJ4A 1KB5H 1MWAL 1YYML 3D39A 4QWWD 2EEDA 1S9VA 1WBYB 3S3SA 5SWZB 3S34H 5L2KB 4LHUB 2W9EL 3LEYH 4WI3A 4GG8B 4RFOL 2ZKHL 1N0LA 1X9QA 1T03L 1K5NB 4LIQL 1NDGA 4AMKH 2YD4A 3VXRA 1FDLL 4PY7B 3KLHD 2HH0H 2MTPA 3IU4L 4XC3L 2DQGL 1CFSB 3KJ6L 4FFZL 4P9HC 1W8OA 2Y7QB 5J3HC 3L1OH 5ACMA 4Y16C 2WSKA 3ULUD 32C2B 4QRTB 5AAMA 3T8XB 5L9DL 2NY2C 1SJEA 5C08A 5J1TC 3WHXA 3TCLB 1EO8L 3EFFA 3FRUA 3SKOB 4H88L 5E6IA 1GGBL 1A6ZA 4BFIA 2Q86B 3ARZA 1IARB 5ID0B 4D9LH 5HHXH 5F21B 1XIWA 1AGEB 1KOAA 1P4LA 3GSWB 1UYWL 1N7ML 1S8DA 4YDKL 4M7KL 4I3RL 4HC1H 2GTZB 3FB7B 3LQAH 2A6KA 4XGZB 4Z7UE 4JPKL 3HUJE 1IC7H 4ONFH 2X4SB 3QCVL 5CWSB 4KK9D 4LLMA 1OPGH 4GG6F 1HIML 3RWHA 3TIEB 3VRLF 1OAXH 2R1XB 4K7PY 1KIPA 5MERA 3WXWL 4HK0B 3TBYB 1T2QL 2YPLE 5F1NB 5C6WH 2Q76B 2NCMA 3VXMD 2XZAL 3QEHB 2D31B 1A14L 1HHGB 5F7UA 1CF8H 5CZVL 1ITBB 3U2SA 3F65A 2LQRA 3S9DB 2HLFD 5J89A 4MXQC 5ACZB 2Q87A 4KKCD 1L7IH 1NSNH 3CK0H 1QTYT 3DGCR 4Y4KB 1AGDB 3G6AA 1G7PB 5FYLL 2WIIA 5I1EL 4KRLB 4UB0H 2V5RA 1VFBB 1PSKH 1IFHL 2ZCLH 4XVJH 3DETD 3L6FB 3WJLA 5DVLA 3VXME 4BSVB 5C09E 5BZDB 3VXOB 2V5YA 1UJ3A 5F72S 5IVZB 4DFHA 3GK8H 4BK5A 2DI8A 2OZ4A 4JHAL 2CLRB 4BH8A 4HFWA 4L5FL 4NNPL 3G9VA 3WEXB 5IK3A 1RIVH 3IGAB 4YXKL 4YO0A 3M1BB 4HJGB 4LEOB 3NH7L 5DJ8B 4Y2OA 2FECI 3UDWC 2R4SH 5B4MD 3QCTL 4O5LL 1JGEA 4IOFD 4KRNA 2XT1B 5SWSD 3EO9H 4HLZG 4KY1H 3T65A 3VGFA 3UJJL 5J1AB 1A7PL 1J8HE 3HPLB 1G6RA 5B38A 2AJXH 2OTUB 3FJTA 1JGUH 2O93L 1EJOH 5IMMA 3PL6A 3MRJB 3AREA 4P2OA 1JHLH 2BSRA 4NKMB 4DKEL 4M6MH 4OLUL 5DJ0B 4DVRL 2GJZB 4LSTL 3O6FC 1OGAE 2CKNA 3RRQA 3TBSB 3P4OB 4KWUA 2XACC 4F57H 5EO9B 1EGJA 5HHQB 4NQXB 5F88B 5IM7A 2A83B 4BZ2L 3OX8B 3V2AR 4ZYKB 3FFCD 1KTDA 4XX1E 3B9KD 1J8HD 2JJTC 2Z8SA 3L7EA 1L0XA 4X98A 1W0WB 3WIFB 4EI5D 5CFHA 1AKJB 2JCCA 4OCNC 5JHLH 2FJHB 4E41A 4RMUA 4KRMB 4YPGB 3HCVB 5GRVK 2DM2A 5IHLB 5JOEA 3QQ3B 4X8JA 5KW9L 3QNXA 4G8GD 1EGJL 5BZWA 1EEQA 2YPLB 1MFCH 4QOKA 3IJYA 5MENB 5H37G 3RWJB 3DGGB 5HYEA 4G9DA 4RDQF 5I30H 4LGSB 2YUVA 2BNQE 2PXYB 3CZJA 1A0QH 4NM4L 1UKSA 5T3XH 1U8KA 2BSSB 4WTXA 3L3KA 4LRNL 3MRMB 3V0VB 4Q0XL 1BHGA 2IG2H 4MA3B 1K2DB 2ADIB 4JFPA 4KMTL 6FABH 4LBEB 3CSBA 1PZ5A 3RZWA 4Y1AD 1JNNL 2FNBA 5CILL 3OJDA 1TJIH 1RVFL 4U1JB 4G3YL 4GXVH 2NYYC 3OKMB 4L8BB 3M45A 4HWNA 4M7JL 5GRZA 1YDPA 3X11A 5EBLB 3JSSA 4PJDA 4WRLA 4JDTH 4TTDD 1R3KB 4YHKH 4M1DH 2H26A 3JV6A 4PD4J 3VFGL 2VKWA 3IF1B 4DCQB 4OCLC 4XCCH 5HI4C 1UQSB 1E4WL 3QZWG 4QOKD 2R0ZL 1FNFA 4JFQB 3HMXH 2YA0A 5DT1L 2E5EA 4MSWA 4G8GA 2PW2A 3MLWH 3ZT7A 4N8VG 4NRZB 4X4ME 2D7TL 4XXCA 4JCLA 3EDEA 2CDEB 1FIGH 1PX4A 3Q1SH 4MD4A 3QI9A 3MPCA 4WJ5B 1U95B 3MCLH 4L8CB 3S5LG 3QUYD 1U91B 1KFAH 2R29H 2D0FA 1ND0A 5CUSL 3C6LA 5GGUB 4CDHA 1U8OB 5D1QB 1JIBA 5DLMH 5BS0A 5CHNB 4MS8D 4BQ8A 4EDWH 3LKQB 4PJHA 2OSLB 4LAQH 3RWGA 3NIDF 2PYFB 2Q3ZA 3D0VA 4XBPA 2Y23A 2PYEE 2HKFL 2OI9C 1CU4H 3B2VL 1EERB 4PJ7E 1F6AB 1K8DA 3MGOB 1WBXB 1FGVH 3ZE2F 3WS6C 4Y5XB 4GXUM 15C8H 5I8KL 4XPGH 3O2WL 2VDOL 2ATPA 4GRWB 4FN0A 1YEFH 1FIEA 2NLJA 1OF2A 4LLDA 1KJMA 5HJ3B 5IFJB 4PB0L 4LHQB 1EUUA 4M61A 2FB4H 1VB9A 4JO4L 5I76A 1G9MC 4X4XA 5TDPB 4DKDC 3GUTB 4MA1B 3HFMH 2X4RB 4TNWK 1C5BH 2GT9B 4HH8A 4YBQD 1NEZA 4CNIB 3FB6A 3LD8C 4XPAH 2I07A 4R4NC 3SOBL 3R0NA 3ARBC 5I1HH 5D96B 3CJJA 4MX7A 5KSAD 4NQVA 1ADQH 3VFSB 5E70A 2FBJL 4JM4H 5TH2A 5JXAL 3EO1B 1PW3A 4ETYA 4E42A 4MNHB 1IGIH 3FMGH 1NANH 4WI2A 4O51B 3QSKB 4JRXB 1Q94B 2OYPA 3H7BA 5KS9A 1WC7B 3K3QA 1I8MA 3BJLA 2NY6B 1T4KB 3D48R 5CINH 1KJVB 2NY4D 1UVQB 3RGVC 3WN5C 1NUFA 3TBTA 1WQVT 4Z95L 4BH7A 2DRUA 3KPOA 1MCNA 2V2TB 3DMMA 4JRXE 1FRGL 1T21A 2X1OA 4OUUB 3TN0D 3F6IA 1B0RA 3ZYZA 3V95A 1U58A 3ULVE 3F5WB 5CEZL 3O9WD 4MNGE 3DVNA 1A1OA 5AUMB 4GG6E 2M26A 4WNQA 3ZL4L 5EZOH 3VFMA 3UO1H 1QBAA 2XZZA 5DVOA 4IS6A 2ED7A 4QEGA 4OKDA 1VKXB 1Z3GL 3GNML 2XFXA 2VDNL 2QQQA 1WV7T 2NY0C 1XGTB 3ULUF 2PCPB 1ZHLA 3LRHA 3O6KH 5C0FA 4WCYL 1JRHL 5ISZD 3WNPA 1VENA 3FB8A 3D69A 1K3ZA 4KJYB 2WWKT 1X5YA 5E5MB 3K4DA 1CQYA 3BKCH 2V2XA 4OZHA 4NHCL 4YWGL 5T33L 2J2ZA 4R4BB 4M6NH 5F9AC 4O2FB 4PBXA 4PJGA 5AZ2L 3NIGF 3LDBB 1CFTA 2R39A 1AR2A 1FZJB 3WD5H 3T1WA 4KJQD 2DQTL 4F7CA 4FQJL 3HMXA 3GSXA 1U6AH 4GRLA 4TUOA 3IDJA 2J4WH 4H8WL 5D1ZB 1F11A 1KXTB 5FB8A 4M7ZB 4Z7VF 1JZ6A 1FGNH 2VABB 1K4CB 2AERT 3NIGE 4OCRH 1WICA 5EIIB 4AH2A 2X4PB 4JFYA 1QRNA 4XXDB 2H3NB 1P84K 2CIIA 5FFLA 4NWTL 2JIXA 4TRPL 2E6QA 1YEHL 1HYSD 4PPTA 2JB6B 3SDXA 4X80H 5F8QC 3QH3A 4N0UB 1G7MB 3TH2T 1NAMA 1UEMA 4H1LH 5JPMB 4JN1L 2RCSH 3QR2A 3EJJX 4EKXA 4X7TB 5E2VH 2IALA 3HZVA 1UXSB 3DSNA 3V6ZB 5EC2A 2X2YA 4XNYH 5C3TA 3PQYB 4K71B 4KAQH 1KCSH 1BM3L 2BHYA 4E0RB 3GI8H 4XP5H 3V9FA 4NQSA 3V5DA 3KVQA 2Y36L 3AUVA 2OJEA 1M7DB 2YZ8A 2ZUXA 3C09C 1A4JA 2ED8A 3PP4H 5BJTB 5I1JL 5BV7L 2AK4B 5ADOL 5I2IA 2XA8L 5LCVH 2YXFA 3CVHB 5KSUA 2B7DT 5F6HJ 1OAYH 4PLOB 3QUZD 1LEIB 1S7QA 3QQNA 3O45A 3ZYJA 4M6OH 3O81A 1KIQB 4LKXA 1HDMB 5SWSB 4RAHA 1INEH 1MF2L 4UQ2A 3ARGB 4LMQI 4B7LA 1M7XA 4AEEA 3WJLC 4AM0B 3Q6GH 1NEZG 5DMKB 1KV3A 4JDZB 1QP1A 3ARDB 4IRJD 5EZLB 4EI5A 4GRLD 4ODUB 2JJUA 4ELMB 4PJ8C 4U1NB 4EXKA 4NNXA 1B2WH 4L29A 2QR0A 1DEEB 4Y5VB 3GMMA 1DLFH 3BN3B 4M3KB 1ZTXL 2ERJC 5FGRA 5FK9A 3TT1L 2YD3A 1CXFA 2ENYA 4JN2B 3VXRE 3CFJB 2HAZA 4TUKH 2JIXD 5TQ0H 4K9EL 4RMRA 2EE2A 1A1MA 1OGTB 2WBWB 2IC2A 5C0AD 3MQIA 1I7UA 3SJVA 1KELL 1T3FA 5EOQL 5EN2A 2GTWA 1QBBA 4WWKD 1KEGL 5AEAA 1XEDA 4XB8A 3RUGF 3O9WB 2OR9L 2OL3B 4JFDB 2WINA 4Z76A 2PUQT 2AGJH 5DMYA 3C5SA 3MXVH 1Z5LB 8FABB 1MH5A 1Y0LA 3TN0C 2C4XA 3O6LL 4LLWA 4W6YB 3RWFB 4K8RD 4N0UE 3IDGB 3BIBX 2LTQB 3VFRA 1YMMB 2EXYC 5SWZE 5L2KE 4PJ9A 4N8CH 3AM8A 5F7LB 4PJHE 1RFDH 4TUJA 1G7QB 3OV6A 2BRRH 3RKPA 5E56A 2IMMA 1X44A 5LWYL 1H15B 4CMHB 4BSWA 4GMSH 2XZQL 5LQBH 5F9JA 5E4IA 2GIYA 4X99A 3RBSA 5J3HD 1EHNA 2DD8H 4O2CA 3T4YA 1F4XH 2FD6H 4XP6H 4Z7OF 3S88L 4ODVH 3D3VD 1PKQB 1BFOA 3QDJB 2CSPA 4RMSA 1FBIH 2CMRL 1ZA3A 3L5XH 3DX9B 2N1KA 3EYUL 3G5VB 4PTUA 2VZ1A 3UEZA 4GXUN 2C3WA 4UQ3B 2IH3A 1QYGH 4GSDL 1IKNC 1OM3H 3L95B 4C58B 3AY4C 3OKNA 1MSPA 2X1WL 3MLVH 3OB0K 2PO6D 1HHGA 1XCQB 1JK8B 1PLGH 4DEPC 5GS0D 2ITDB 4QTIH 4PJCF 1CL7I 1MPAL 1VFAB 4LQ1A 1FLRH 4K3EH 5JIKA 3LKPA 3LKNB 4BFEA 4GG6B 2HFFB 2PTVA 5GPRA 3SY0A 3K2UH 1H3UA 4WFFD 5C0EA 3VI3F 4JY5H 3VGBA 4RCAA 3V5KA 3OGCB 3D85A 3MNWB 4GS7B 4JFZL 4R4ND 1L0YA 4QT5A 1HH6A 3IDXH 3IRZA 1QFWL 1YMHB 3ZKXC 1NANI 3VG9C 4KJWD 5CZXD 5CJOH 1UM6H 4P23C 4JKPL 1I85C 5J9PB 1K5NA 1P69B 4OFPA 1RZIA 3TPKA 5KS9E 1RHHB 4WHTA 4L8SB 1XGYH 3VXUB 1K6QH 2F53A 3KNBB 4JPIB 1ZWIB 1NBZA 1CE6A 5AWNH 5DJ8A 1T66D 3GMNB 4KJQC 4OB5H 1RK1A 4DN4L 5IP4A 3SDYL 4BKLA 1A3RH 4OAWB 4Y4FB 2YUXA 3JUZA 2X70A 2R56L 1SJEB 2X89A 3EFFB 2VXVH 5F3HB 2L7JA 3WNOA 1UFUA 2BVPB 2IPTH 3VD3A 1T5WB 4Q2ZB 1RQ5A 2Q86A 4X6CB 5BVJA 5D7SH 1CK0H 3C60C 1II4E 2B5IC 4Z7QE 1BREA 2GSIA 4Z7UF 5DGQA 3MR9A 1HCVA 3FZUC 1MUJB 5FKPB 3VH8A 4ZPTA 2IBGA 4QHNA 2XWJB 1ED3B 1AKJA 2JCCB 4LLMB 1TCRA 4ODWB 5D71H 1R3IH 2P49B 5LGHH 4LCYB 1WAAF 2Z92A 4NNYA 1NKOA 1DBKH 1F58H 3AAZB 3HNSH 4N68A 4HEPG 4RZCA 4J3SA 3U9PL 2VO5A 1VEMA 3O4OB 1NGWB 4OM1L 2VH5L 1Q9LB 3OG6B 1D6EA 3RWJA 3PDDA 2HFGH 2VRAA 2WWMD 3AXLB 3VRIB 5EBGA 4KJWC 5CZXC 3MRMA 3N1MC 4OZGF 1NBVH 3NACL 5C9JB 1RJZA 3X3GL 1K2DA 1GRWA 1U8NB 2DYPB 5HTSA 3F12B 3IRPX 4LBEA 5I6XB 2LVCA 1FFQA 5CP7B 4OJFL 4OV5A 2NZ9D 1A7QL 4WWID 3B9KA 4K3DL 3O11A 3OPZL 3BVNB 3OAZK 3QPQC 4V1DB 1BVKB 3IETB 3BZDA 3QHFL 1TTFA 4O02L 1BBDL 5LKNA 5TQ2L 3DXAA 2GJJA 3WXVH 3FO1B 3BH9B 4J3UA 4PS4H 1MCFA 5A2FA 3C5JB 4X9IA 5IR1A 1NCCH 4KI5D 4YHIB 3BYTA 4BA8A 2E27L 4P9HL 4PJ7A 1HHHA 5ITBH 3KPSB 4G80A 4YHPA 5EIQA 2R23B 4KTYA 1MNUL 4XAKE 4E41D 1RUPH 5DJ6B 3L7FA 1GOGA 5C0CA 3W0WB 4S1QH 3S5LB 1T7YA 4YHZL 1KC5H 5BXFA 1BVLB 1KN2H 1W72A 4LPCA 4Z78A 4HKBA 3FO0L 2GFBB 1IAII 3ILPB 1IEAA 5DWUH 1YY9C 4HWZB 3IJSB 4HUKB 3FZUD 1CXHA 3C08H 3AREB 4NKMA 3LKRB 4F9LA 4LAJH 2BDNL 2V5SA 4ZUUB 4RISL 5GJTH 1MIML 4EBQH 4K3GA 1QSEB 1I7RA 3MOBL 2WAHA 5I66A 2EDNA 5BMFL 4MXWH 4PJ5B 4Y2DD 3V79C 3H9YA 4I3SH 3O0RH 3UTTA 1OAZH 4KDVA 4KQ4H 5FDYA 3SGDH 1TITA 4RAUB 5ICXA 1NFKA 3ZO0A 2A6DB 1FNGA 3TYFA 3VWJB 5EIVA 4CN6A 3DYPA 4XBEL 4DKFH 1UM4H 3DX8B 3KPMA 4X8JB 2DS4A 3D1MC 3DX7A 1XT5A 5I8EA 3GBLA 4DQOH 2KPNA 5D9SB 1K8DB 3MGOA 4JVUA 5FO7A 2ENSA 4P5TB 1S7UB 3QIBB 3HRZA 3DO7B 2HJKB 3D0LB 4QOKB 4LF3B 1OF2B 2VLRD 5GJSL 4ONHB 1DBJL 4U05A 5KVDL 1IC4L 4HZLA 4TN9A 5D2NA 2AEPL 2V7HA 4ZUWB 3QJFB 5HD8C 3DI3B 2J6EL 2NR6D 4TVPD 1RIUL 3CXDH 5E8EA 4P5KB 4KU1A 4HUMB 4WENB 1UENA 2YRLA 4K7PX 1MHHB 3VRJA 2HT3C 1VESA 5ACLA 1MJ7H 4DGVL 3LQAC 2YUZA 3LB6C 4PJ9D 1C16B 1ZHNA 2VERN 3U0TB 3LCYA 4K7PH 2F8VA 4M62H 5TE6H 1WBYA 1J0ZA 5GS0L 3IDNA 5FUCE 3MACH 2DI9A 1VGEH 3RVXD 2VXTH 2JTDA 3QHTC 1NDGB 3BE1L 4TSAH 3KYOA 5DRWA 5GXBB 5JHDE 4FA8A 4LGRB 4OLVH 1BFSA 4JREB 4I5BB 4LSPH 5D2LB 2JJSC 2PETA 1HXYA 4YLQT 4G9FA 1D6VL 1ZLSH 3T8XA 2QSCL 4WI5A 2XN9B 4WJ5A 2VXQH 2I24N 5EB9A 1A7RH 1NCBL 4YNYB 1U93A 1RZKL 3SKOA 3WO4B 1YN6B 5BOZG 5ESQB 4G5ZH 4Z7NF 1MQ8A 4MNQE 3SE3C 5ESVB 1UWGL 2C3GA 2VYRE 3AY4A 4OZHB 2WV3A 1FSKC 1QR1A 1U8LB 2GJ6B 1YECL 5DK3A 3T3PE 3D39D 3HRPA 3TPUB 2A1WL 4TNVF 3DWTA 5FCSH 5CJ8A 4JFEB 1P4LB 1OY3B 4XVSL 2HVJA 4AL8H 4D3CL 2QSVA 1UCBL 3WLWD 3CMGA 4TUOB 2UYLB 1OAKL 2Z31D 3RL1A 4Q9BA 4XPBL 3TIDA 4XI5C 1A2YA 4XGZA 3UTQA 3RGVA 1H5BB 3HNTH 3PHOB 3WN5A 5D1XC 1FNSL 3HAEB 1JGDA 2APTA 4JFDE 1YYLL 2ICWB 1QSFD 3DURB 4QF1B 1U8HB 4JFFE 2GI7A 3GUTA 3S36L 3REWA 4KKNA 2N7BA 2AKRB 3ARBA 2XQBL 3QEHA 2DKMA 2IALB 4KK9C 3U36B 2HT4D 3QUXB 4Y4HA 3CFEA 3W82A 1AJ7L 3IVKA 3L9RB 5KVFH 3ZE2E 2CKBA 1MJJB 3W5NA 4IHOB 4PRHE 5C0ND 4KK8C 3VGGA 3HI6L 1CS6A 2Z9TA 2GUOB 3EJZC 2PR4H 2VISB 2AK4A 3TH4T 3MMEB 3L3JB 2ZNWA 1LEIA 2HKHL 5B3JE 4IJ3C 2G5RA 3MRQA 4NZUL 1A7BA 1YPZF 3VGAB 1AXTH 4KPHH 1EIBA 4YFLF 4I2XE 2RQ8A 4M8QB 4ORGB 1QFHA 1MFBL 3EOBA 2IPUK 4PB9H 3UTTE 5HYQB 3BWAA 1FYHB 5IB1B 4RSVA 1U2HA 4EI5B 5IGXH 2W0FA 3DUUB 1AQDA 4L3EA 3O6MH 5GS1B 5GGRB 2D7NA 1SM3H 1HI6A 1XF3B 3P9MB 1A6ZB 2GK0B 4I4WA 2FZ3B 3W5MA 1L9NA 4Y5VA 1Q9OB 4JKMA 3T65B 4IRSC 1XGTA 1G0YR 5F9WB 2NY7H 1I3GH 2OTUA 4NUGH 3GJFH 5E2UL 5I19L 3E2HC 5E5MA 2X1PA 4B53A 5K9OB 4QXUL 5JIHA 2V17L 1AFVH 2P46B 4KVCH 5KJRL 2VDLL 5EZIH 3O9WA 5CJXC 4U3HA 5H94B 3CFBA 4PGJA 4WIQA 3MJ8B 2DQEH 2J12B 3EOAA 4NQXA 5KN5A 2XYCA 3OKOA 2IEPA 5JMRA 2R1XA 2W9LA 3LMJL 4N0YL 3OG4B 4M7LL 2VC2H 2XTJC 3HNVH 3CD4A 4G8FA 4M5ZL 5DFVC 5DGRA 2MNUA 4CJ0A 2XG4A 5IF0B 2X4OA 4ONGH 1RJLB 1BLNA 2Q76A 4U1GB 4OCXH 3CCHB 4E41B 4JFYB 2L4OA 1NDMB 4U6HB 2AXFB 3TZVB 2GAZA 2NY1B 2A74B 4URTB 3QH3B 2W9DL 4N0UA 3OXRB 3FRPG 3G6AB 1BD2E 3EOYG 4QTHA 5HDQH 2RBLA 3GSVB 4BSWB 2ESVD 4ZD3H 1BFVH 5JW5A 1ULVA 3TFKC 4LCCB 4LSQH 5FCUH 1OW0A 1R5VB 2XWBB 5JTWA 1T0PB 2D2OA 3QRGH 1CLZH 3L3HB 5FYKD 3HAEG 1KCRH 1PKQA 1DR9A 4EUPH 4JFPB 3WKML 3N1GC 3UYPA 4KKLD 4HFWB 2B8OT 5DSCB 3MRLB 4MQSB 5F3BA 3RZCD 5H8DA 1VPOL 4OCSL 3U4BL 1V3LA 5ADPL 1MOEA 2YSSB 1KIQA 4LKXB 2BMKB 1KB9J 3X11B 1KCUL 5INDB 2ITDA 2JJTA 3BQUA 3FN9A 2H2PC 5F97E 4M1GH 1YEIH 1Q9WA 3RU8L 3LKNA 2O5XH 4G6JL 2BNUB 3MRDB 3MLXH 2WMPA 4HCRH 5GZND 5IVNA 1HN1A 2BSRB 5F6HI 3SDDA 4BZYA 1DEEA 2XY1A 2H6PB 3RY5A 3HG1B 4M6ML 1J1PL 4NRZA 1EVTC 1BIHA 5JORA 2C3HA 5EO9A 1S8DB 5HHQA 3X14A 1E6JH 4ZYKA 5E00A 4MD4B 3QI9B 1WZLA 3QO1A 3E1F1 5LG1A 1NKRA 1I7UB 2EYSA 4AJ0A 1LK3L 4JLRA 5AYUH 3VXQB 2AW2A 5CWSA 1XF2B 3O8XC 1R5IB 4WUUA 5E99H 3LPWA 3ZE1E 1MFAL 3HCVA 3QQ3A 2FEDD 5HHPA 4LEXH 5DMGC 2OQJB 1I7TA 2VLKE 4U1LA 3BGFB 4FFVC 1HHKB 4WUUE 1NCAL 4L4VE 1BZ7B 5FO8B 1T7VA 3KJ4B 4LCUB 1IC1A 2LU3A 1U3HB 3VXNB 3VFNA 4HFUL 1T5WA 3GHEH 3T4AA 2UY7A 1WBXA 5FUOH 2BERA 3TCXA 2VIRB 2ATPB 4JHWH 1DLHA 1WGOA 4I0PC 4ALAH 4XHJD 1ORSB 1AGDA 4CMHC 2NX5A 4M61B 1ZXQA 4AENA 1DSFH 1OB1B 1RD6A 2Z8WC 3TA3A 1MFDH 3B9VA 4M93B 4G6FD 4PJDF 1IGYB 4BQ9A 4QRPA 1TENA 5ICYB 3DETC 1S3KL 2D7MA 4ZO6A 3PGFH 4JO2L 5DD5H 1K9TA 1LO2H 3UBXA 1FJ1B 3L5HA 2I26N 3LN4B 2I5YL 3MRGB 3DV6B 4KQ3L 3MNZA 4XNQA 5D1QC 2IF7A 5EPMB 3D25B 4J8RB 4X4MA 4PRHA 2W91A 3Q6FA 3ARED 3S35L 3P9LA 2JCCE 3ARTA 2CGRH 1S7TB 3RTQC 3WEXA 1AR1C 5JOFB 3L95A 1QZ1A 3EGSA 5EZJB 2VJXA 2UWEA 3NFNA 5IG7A 2QBWA 2BC4A 5LAXA 4DEPB 2HFTA 1JK8A 2P45B 4OSUL 4KDWA 4MSWB 1D5ZB 2VZVA 2RAMA 1G6RL 4R2GC 3K4AA 5DF0A 3NFSL 5EC1B 3HAEH 4U6TA 1GAFH 2XOTA 3LKPB 2IFFH 1U8NA 4QXGL 1G6RB 2BNQA 4OUUA 2D7TH 4P2OB 4PP1D 2X10A 1U91A 2F19L 3RA7L 1FAIH 2FJGA 3QG6B 1XFPA 3TBSA 4I13B 1QFWM 5JW4N 3HR6A 4MXQD 4I0CC 5AYQA 2H2SD 5CHNA 1ZLVK 2J3SA 3HKFA 5F7WC 1UXWB 4PJHF 4WEUD 4F7MA 4QHMA 1J0YA 1RHHA 4WHTB 4H26A 4Z7WF 4GW4B 3MUHL 3QWRA 3KDMA 4JM2B 1AQKH 4LRIC 1FNAA 4HS3B 1BJMA 4FQ1H 2EYTB 4I77L 4PG9B 4Q6YA 4OD3H 4XPTH 1DQJB 2W0PA 4UV4L 1S5HB 1Z6JT 1I8KB 35C8H 3F7YB 1FZKA 3G6JA 1FZJA 4KZDL 2NLJB 1BVLA 1NQBA 1HSAB 4RIRA 5F3HA 3MA9L 2A9MH 1A7OL 5C07E 4G9DB 2VWEC 4Z5RA 1JHTA 2FO1A 1JPFA 4XI5D 1IC5H 5H35B 4X6CA 1K4CA 3L3KB 1BQLL 1T1XA 1NMBL 3A6BH 4IDJH 4UU9A 4YIQA 4MA3A 1C5BL 3RIAF 4PG2A 4YEEA 4FQCH 2KUTA 4NQVB 5FXCH 3K8MA 3STLB 5CIPH 5FKPA 2HVKA 1Z2KA 2QADB 5CP3A 4RAUA 4HQQH 4P4KB 4JM4L 3QG7H 4PLJC 2A6DA 2NY3D 4XAWL 1EHAA 2YS4A 4QRUB 2OL3L 1U36A 1UA6L 1ACYL 2V9QA 3MCKB 4X7DC 1WFTA 2WP3T 4L9LC 3ILQD 1OAQL 3WS6A 1RJYA 1N5YL 3C5ZC 2YPVH 3S7GA 1HKLL 2HJKA 3D0LA 3LDBC 1HINH 1JPTH 2V2TA 1UQSA 4MJ6A 1VFOA 4WO4D 1SY6H 2R2BA 5I75B 1OARL 4LSUH 2A73B 1ZV5A 2BSTA 3S37L 3TJEL 5CEZH 1CFSA 2YPLD 1IAIL 4D9QD 2H2PD 3EFDL 1KCKA 3KPRB 4XMKH 3X17A 4ZPVA 5L7XH 1N64L 3VRJB 3C2AL 1GL4B 1PEWA 3O4LD 5I1DB 4TULH 1NL0H 4NQEE 4JDZA 1OVZA 2E9JA 1YNKH 3FRUB 3ES6B 3V4UL 3MXWH 4U1NA 3P0VH 3TZVD 1PGRB 3MBXL 4OCYH 3MOAH 1DFBH 2MKLC 3CDGB 5ID0A 4TPRH 2OSLA 1J12A 5IR1B 1CFTB 3AU1A 5FK9B 5C86A 3GSWA 2GHWB 2NY6D 5H37H 1LP9F 3OHXA 5DD1H 5GS2D 2YPKA 2R1YB 3MO1B 2EDQA 4Z7VA 1BJ8A 4PRNB 5T3ZH 3VI4E 4M9OA 3BKYH 4NM8L 1UKQA 3OR7B 3TIEA 1DP0A 4FFYL 4LLDB 1UB5A 2Z8VC 2IH1A 3MV9E 3LB6D 4H0IA 5MERB 4JHBA 3Q3GA 4BFGA 3WIHL 1O0VA 4Y8DC 2UZXB 2EZ0C 5B38G 1YEHH 3RWFA 2IAMD 2HN7B 1QSEA 5FHAH 3PWNB 1YMMA 3ROLB 4A6YH 1Z0MA 3V0WH 1QR1B 2VDPH 3P30H 2FGWH 2G60L 4P99A 5HI5D 3WKNA 5ACZA 3T2NH 3GDBA 1OWRM 2BCKA 4YHOL 3H7BB 4GAGH 1A4JB 4NC1E 3VWJA 5I73C 1EMTL 5KS9B 2WIIB 2EE6A 2ZKHH 3H9SE 3O3EA 4N1EA 1SJXA 2BJMH 3T4YB 1CE1H 2YKLH 5MEPB 4M03A 3P0GB 3D5OF 4DUWA 3HAEA 3LN9A 3OKDA 1R3JA 4Y4KC 3UYRL 4CMMB 3O9WC 2ORBL 1NCUA 5GHWL 4APQC 4NZTH 2OLDA 5F7DA 5I1LA 4M6OL 1Q0XL 1CGUA 3CIQA 3ARGA 1DQML 3O3AA 5JHDD 4AM0A 3SKJL 4B41A 1CFVL 3ARDA 4WNQB 5I16A 3UMTA 3R0MA 1M71B 1A6WH 1AO7E 5E8EB 5MI0B 1IVLA 5GZOC 1NGPH 4YC2C 4KRPC 3C87A 2QTEA 2YEZA 1T04A 1KYOK 2MSPA 4ZFOL 1XGUB 4QRSA 4HBCH 5I1GL 3QXWA 3KYMA 3CU7A 1OTUC 1P4IH 3Q48A 4BSJA 2V9RA 3JUYA 2ZUYA 1U8IA 4HUVA 4FOMA 4YZFF 2DTML 1WAAE 1CLOL 1MFEL 3NCYS 4JGMA 5JNYA 3EYQD 1K4DB 5D1XD 3UZQA 2E9BA 4GKSB 1T1WA 4MAUL 1U8MA 1TNNA 1EHLH 3C5SB 3ILQC 1U8JA 1YEEL 1KEGH 3F7RA 3O2DA 3H9SB 4ZDHB 2R69L 3GSRB 3RI5K 3CXHK 5DRXB 5J9PA 5EORL 2OK0H 2WBKA 3WBDA 3FTGB 1XCTB 1UT9A 1ROWA 4JB9L 1N3NA 4AEIH 5L2JB 4LPYA 1UZ8B 1I3UA 4NQDA 1T1ZA 3RAJL 1ZLWH 5C70A 1J05B 1MAMH 1F3DH 4JFFD 4XP4H 3QIWB 1MRCL 2B1AH 4L3EE 3VGHA 1RMFL 3KXFE 3MV8B 4CN4A 4F15B 4CBPA 1T0NB 4PV8B 1UXSA 2M8XA 2E8ZA 3MGAA 5IVXF 1YEGL 5T3ZE 5BVJB 2Y25A 4Q9QL 5E4EB 1BAFL 1BX2B 3PNWB 5A43C 3CFBB 3BGMB 3NABH 5FM8A 3QDJA 3EOAB 1M7DA 2AJZB 5DVMA 4ZTPL 3QQ9D 4JRYE 1BQHA 5DDHA 1E4KC 3L5XL 4R90H 2XWJA 5KAQF 3SQOL 1X5LA 1S7QB 2X7LB 4JM2D 5GIRB 1MWAA 3A67H 3RWEB 4YXKH 4NNYB 4ZFOA 3OKEB 2I60L 2X44D 4ZUSB 5KG9B 4LLAA 5IBUG 1T03H 5HVGB 1GPOH 4N9OB 4QTHB 4ELMA 4LIQH 4JJHA 5JW5B 2I25N 2NR6C 1N6QL 1R5VA 4IOIB 3GMMB 2PW2B 4KHXL 4R3SB 5C9JA 1CTOA 4ZS6C 2V5TA 1I1RA 1BWWA 1G9NH 3O3DB 5DYOA 1PDKA 3TVMA 3D3VE 5L9DH 5HGAB 4NUJB 4P23A 3L3JA 1EO8H 1Y6MR 4D0CB 5EN2B 5T1DH 1ND0B 3BN9C 1TQCB 2XTLA 4CRPA 2PXYD 1GZPA 2Q6WA 4Z76B 1CE6B 4ZFFA 2VLJA 1MCKA 2D3VA 3IDYC 5K9KA 3C5JA 4ZTOH 3RWGB 4C56E 3BQUB 2P5EB 3ARXA 4NN7B 4XBPB 4JPVH 5EA0L 1QOKA 3BKML 2D4FA 1HHHB 2W0FB 1MFCL 1AQDB 1NCTA 2B1HL 3QHZH 3QNZA 3WUWG 3E6FB 1KENL 3VXMB 1FN4A 4ONFL 5JR1H 4IRSB 3GM8A 1HIMH 3MV01 4LSRL 4C56B 3IXTB 4RA0C 4M48H 3P11L 1AR1D 2GFBA 4FZ8L 3DX6A 5IFJA 1CFNB 2Q20A 3MR9B 2AVGA 1SEQL 4P57B 4EI6A 2EDYA 4MGXA 5K9OA 4HXAH 3N1FC 5F7EH 3SO5A 4X6DE 4HWEL 4KK5C 2XWTB 2YD5A 4KVNL 2AEQL 2O5YL 3QA3B 1FO0A 4G6MH 5DJZA 5FOBA 3T0EE 4YXLL 5HDBF 2KQMA 3TLRA 5E8NA 2H1PH 4MNHA 2JJWA 1GIGH 2UUDK 5HVHB 4WFGE 1JFQL 5DQDL 3UZVB 1Q94A 5DD0H 5FYLH 1I1AD 4PUBL 5IBTL 4CU7A 1U3HA 4OFYD 1GYAA 4DTGH 3T4AB 4O9HL 3UBXG 5FUZH 4RGOL 1OT1A 1Y6NR 3RVWC 25C8H 3MLYH 3ME0A 2APWA 4R97C 2ICEB 3LQZA 4BH7B 1H0DB 3PGCB 1CGWA 5I17B 4OI8A 4PGEA 4GQPH 1JGLH 4AENB 4KKAD 5CP7A 5ELIA 4QCIB 1U58B 4HG4K 3WFBH 2D03H 2YA1A 3RPKA 3O6FB 1HH6B 2XWBA 5MENE 1NLDL 1AHWB 2H8PB 5C0DA 2PN5A 1IAKA 5EFIA 4P5KA 3D2UB 3RWIB 1QRND 2R4RH 1OT2A 3DV6A 4R26H 2F58H 1S7WA 3EO9L 4KY1L 5EPMA 3H9HB 3NZHL 4YXHH 4FZEL 3QWQB 2QHLA 2IAMB 2GW5A 1HQ4A 3C8KB 2PCPA 5JDSB 4PS4L 1F42A 1KB5B 3BRFA 5I8OL 2BXYA 4YHLH 1BEYL 5EOCJ 2DIBA 5DUBA 1JHLL 3UAJD 4DN3H 3U48A 4PGZA 1F90H 4WWKC 1H8NA 1JRHI 4Z18A 1RK1B 4LSTH 4X6BA 1J5OL 3H7LA 4HC1A 3DVFA 3W0WA 5C2BL 4UNTA 3WHE0 1JPSH 1A6TA 4HKBB 1FGVL 3BDBA 3MV7E 4GBXC 2DQFA 3H3KA 3QXVA 4S1RL 1BMGA 3H8NA 1AY1H 1C8PA 3VFOB 5DHVA 2HYMA 3KYOB 1SEBA 2FO4A 4YGAB 1INDL 2A77L 2MCPH 4MJIA 4MWFA 5DK0A 3M17B 5GGSY 2DLTA 3AC0A 3ZYOA 2X4PA 3TV3H 2H3NA 4K23H 3RDTA 1JPST 1C12B 5FYJL 5I1HL 1TXKA 3QO1B 1EK3A 4GW5A 3CLEL 4WFHD 5GRUL 4CAGA 2FBJH 4KQ4L 5KVMC 3DI2B 4LLVA 1YN6A 4Y16A 1WBZA 5DD6A 3NAAL 2J6EA 1KACB 4Y19B 3HE7A 4ZNCD 3WFDH 3CMOH 4WUKL 3WIHA 1CGSL 2ZOLA 2AJ3A 3G5YB 1HHKA 3QIBA 3HRZB 1BQSA 5E8DL 3T1FB 3V5DB 4F8TA 3N1PC 1UCTA 2CH8A 4M5YL 1F4YL 4KROB 4PJFA 4L4TE 4RGNB 1JPFB 2MQ0A 3ZKNC 1XAUA 1TJIL 4PJIB 1JWUB 1DVFA 1HQRA 4XMLH 1CFQA 2V7HB 4ZUWA 3PWJA 3BX7C 2X5PA 2K3TA 3IXAB 2EDXA 3LV3B 3BAEL 3ARPA 5T1KB 3SDCD 4YIQB 3H6JA 1KJ2H 1JGDB 3C60A 3MGTA 1X5IA 1FZOB 3BHBB 43CAA 1MCPH 4H1LG 1N0XH 1JYVA 1MHCB 4F37F 2Q8AH 3NFPA 4NZDA 3BVNA 1J0IA 4I18B 1N5AA 4U1KB 1BVKA 3UBXB 4OQTL 4NNXB 4WCYH 2ZPKH 4R96A 5KBNC 4XBGB 3L9RA 5DI8A 3TJHC 1TPXB 5FAAA 5K9QG 1DBBH 4XMPL 2QV2A 3ARDC 4M3JA 3IDNB 1D3CA 4X8XA 7FABL 2MKWA 3F7QA 2UV3A 3RZCC 3PABA 5FKAB 1LDPL 3QDAA 1OL0A 1HNGA 3ECBB 3S5LA 4P2RB 1CXLA 3E8UH 2AABL 1FGNL 3OJ2C 5D2LA 1X5XA 4OZFH 4EDWL 4MDJB 2BNQB 4ZPVB 5I0DA 4UILH 5HI3D 3EOBB 4OD2A 4MD5B 3KR3H 3QIUB 4PBVC 4UMGA 3WV0A 4MA1C 3TC9A 1UH4A 4K8RL 3J8F7 1WUNT 5D5MA 1IM9B 4NO0B 4ZODA 3V6OE 3NCJH 3SGEH 1TTGA 4JM2F 4JO3L 3DHMA 4NFBA 5FHBL 5D6DA 5IHBA 4Z7WB 2Y5TB 4K55A 2PW1B 3WUWB 5KSAB 1KG0A 5D7LE 1VACA 5I8KH 4XPGL 3TN0B 3PWPE 2PTTA 4H26B 2NZ9C 1XF5A 3P77B 5I9QC 3WNNA 4XNYL 5K93A 2A1WH 2IQ9L 5JA9A 1P1ZB 4GW4A 2YK1L 2FB4L 1NGYB 4QHKJ 1H15A 2OMNA 5IBLD 3SDAC 4XVUC 4QRRB 3U1SL 3WDJA 4YAQB 2RFXA 2X9WA 4U2ZA 3RGVB 4HMCA 3WN5B 1ZANL 3RY6C 3ZHDA 2AK4D 5T5NG 3QEQD 2QQKL 1OP3K 2ZUTA 3DO7A 5TE4H 5IMKA 1ADQL 2D7OA 2CJUH 2MWCA 2CIKA 2FL5A 1CVRA 1FFPA 2VDRH 4Z5RB 4FABH 5J11C 3ROOA 1ORQB 1BLNB 1KTLB 2EE3A 3DXAE 4POZC 3QCUL 2VR9A 4J7RA 3F7VB 5E8PA 3U36A 3IT8D 5LBSL 5GS1C 2XQBH 5BW7C 4PJ9C 5KSBF 4Z95H 3S4SA 3RDTD 4J6RH 5DRNA 3D39E 2NXYD 2FGZA 2HFFA 2DDQL 1ZHNB 4YEFA 1I8IB 4G6FB 3PJSB 1R0AH 4ODTL 5CS7A 2D4DA 1WWAX 3CLFL 3UC0L 1REIA 3OGCA 1NAMH 4H1LA 1LO0L 2IANE 2I27N 2ZOKA 2W9EH 4Q9RL 3WO3B 3MYJB 2AJVH 1LILA 1R3JB 1TDQA 5SX5H 2Y07L 2YMXL 5KSBB 4GOSA 2H9GB 2MPAH 3I9GL 3IU3B 4PLNC 2OXGA 4JFDD 1DN0A 2BZDA 2X9XA 5IHZB 1W72H 1TIUA 4XC3H 2A73A 2DTSA 3B8YA 4PJXF 3BPCA 3WDIA 4PJDE 5TDOA 4JPIA 5T33H 3LD8B 2B4CC 3I50L 5DUML 5GGRY 2OXHA 4I4WB 5JXEA 4ELKA 1HXYB 3VW3L 4L8SC 5T5FH 1U92B 3EW3B 3X12A 3SGJA 4H88H 3NIDE 1J0KA 5EG6C 1RZ8A 1H3PH 4Q7DA 1H3TA 5C0GB 4Q2ZA 4HGKC 3BSZH 3TGXA 2NY6C 5I19H 2GJ6A 5CBEA 4DW2H 2FX8H 3HG1A 2I9TA 4X6FA 4YDVA 5CSZA 5CSBA 1T1WB 1X4YA 4GKSA 4Z7UB 5FA3A 3C09B 2GSIB 1WTGT 3HUJA 1T89C 1U8JB 4G6KH 4TOYH 3S88H 2DYPD 2VLLA 4X6EA 5DRXA 2YPKB 2XQYG 5EO1B 3FQRA 5ISZE 3PG2A 4HDIB 3MREB 4F7EA 3VXQA 1N3NB 3QDME 1UZ8A 5E2VL 2XXMB 3WFHA 1T1ZB 1QUNA 2IH1B 1OP9A 3FHAA 1OGAD 2EO9A 4OCXL 1U8HA 3QIWA 1ZA6B 3AAZA 5LGJA 4GBXD 1CR9L 1B9ZA 4K8RC 1YPZA 3I3DA 3OXRA 4DK6A 1NMCB 3SGJC 3GSVA 4K9EC 4AMKL 1KJ3H 5D70L 2E7LA 5F7MC 1T0NA 3QUXA 4Y4HB 5CZVH 2UWEF 3UTSD 5CD5D 1TZIA 2BNRE 5C0NC 1MLCA 3MRFA 4NQCB 4PRIB 3ZZ1A 1RJZB 3RUGE 1CDBA 4NKQB 3AROA 2OZ4H 4Y88A 5I1IH 1KCRL 4ZG1A 3P3YA 5TFSL 3P2TA 1MLBB 2UY6A 3E0GA 4GKOA 2ZUQC 3UPAA 1T80A 1MWAB 3U30B 1RK0B 1XGYL 5HYJA 3LN4A 4ZO8A 1JF5A 4JHAH 2VAJA 1VFUA 4EJ1C 4HS8H 4ZFOB 4KDTA 4IMLB 4PJCB 2VLJD 3JBG7 3STZA 1S7SB 1DQTA 4M43H 3MRIA 1T0MB 3DUUA 3QEGL 2EDEA 1M71A 5GGQH 3BGAA 1HSBB 2R23A 2WANA 4M1CD 4V2BA 4RA3A 3H42L 2BNUA 3MRDA 2R4SL 3MROB 1IGTB 3FB5A 2O5XL 2GK0A 5J6GA 1IC7L 5J8OA 2FZ3A 2P48B 5A3ID 1XGUA 3G04A 5EC1A 1RZGA 3GMQB 4P46B 4BK4A 5JW4Q 1E4JA 1D9KB 5EOCL 1JGUL 5DC9B 3KYMB 1FG9C 4NC0B 4BZ1H 5B3NA 2EDOA 2ZSWB 3E6HB 1EBPA 3ZDXF 3QUXD 1IGML 3JWDL 2E7BA 1J11A 4XPHH 5E9DB 1UJ3C 2FBOJ 3SBWC 4QOKE 1N4XH 3I6KA 4UZGA 1FE8L 5CKGA 4UT6H 4OTXH 1Q8MA 3OKOB 1UH3A 3MC0A 3GSRA 4ZNEA 4PJEA 1AC0A 3VXRD 3VFPA 1AE6H 2XZCL 1S9YB 5D7IA 2CRIA 4LCUA 3UZEA 3GIVA 2DQHH 1NCAH 3KDMB 4JM2A 4MLSA 2RB8A 1SVZA 4OM1H 3RZCA 4JQIL 1FH5L 1AXIB 3FL7A 2AXFA 3QUZC 1ZVHA 4PJ5E 5KANG 3T04D 5J56B 4I3GA 5E24E 5AAWA 2EH8H 1FZKB 3CFCL 5J6HB 3EYOA 1ORSA 3OKKA 5DEGB 3DARA 3O41B 4P57A 3UJTL 4EI6B 3UCRA 3ULUC 4UT7L 1JZ7A 4HZLB 4N5UA 3VI4F 1A3QA 4K2UH 3QXTA 1QYGL 5H35A 3DVIA 1RIVL 5IB4B 5BO1L 3BN9D 2LFGA 1KNOB 3EKCA 3MLVL 1I3RA 4NDMA 1GC1C 3MRGA 3PGFL 3AS0A 1YNTB 1WK0A 3B9DA 2UZIL 1BQHB 1X4XA 2OTWA 4MA7H 4GXVL 3CH1B 1S7TA 3GSOA 4Y8AA 4WUUD 3GB7B 5C0AB 1H3XA 5IG7B 4OLUH 1LHZA 5ITBL 2ZCHL 4JZJA 3KYAA 2WUCL 5GISL 1NCWL 3KYKH 2ICWJ 1QBMH 4MJ6B 1G6RH 2XA3A 3WFCL 3C6SA 1KN2L 3SKMA 3VXTA 5DS8B 3SQBA 1FCGA 5ITFB 2Z0BA 4ODSH 2BSTB 4WDIB 1WSST 3GJFA 4XP1L 4Z7WE 4XXCC 2EECA 5EFIB 2F19H 1EGJH 3B9AA 5IV2A 3O3DA 4PJBF 3HLAB 4EBQL 1C5CL 1UZ6F 4ZXBA 4DAGH 4G42B 3MCLL 3QUYC 2GYSA 1NGZA 5C0BE 1IGJA 1U93B 1JJUA 2EYSB 1HQ4B 3C8KA 3KPLA 3QB7C 5HI3C 1JYWA 2RR3A 1MCDA 4U7MA 3LEXA 5FGCB 3NBNA 2CD0A 4N1CA 3BI9X 4NM4H 4LHUD 4NO5A 4P2RE 1V7ML 4G8EB 4LRNH 3QYCA 1CK0L 4U1LB 1MCIA 4NIKB 3MBEA 4JFEA 4NN7C 3G6JB 1CU4L 4FQIH 4KGLA 5FOJA 2RJMA 2R0LH 1VCAA 3GJFK 4K94H 4OGXH 1GGCL 3VXNA 3E6FA 4JFEE 4G3YH 1MAKA 5CGYC 5DURD 1FC1A 5DEZA 1NPUA 2VZOA 2GJ6E 4D2NA 4XCNA 5EBWB 2NY5H 4YQXL 4I0PD 4ZXBC 4B7IA 3KPRD 4PRBB 5FYLD 4B50A 5BW7A 5MEQA 5A1AA 1HCFX 3NA4A 3NZ8B 2V2WB 4PRID 3REWB 4HIXL 1FYTE 3QDGD 4NQDD 4Y16B 4G8IA 1KT2A 2XWTA 4PJAF 4QRUA 1FL5B 4APQA 4W6XB 4IBLT 1FVEA 4LVOC 3HE7B 2HG5A 3ALPA 1IZJA 3TM6A 5DHXB 2ZJSH 4PR5A 2Z93B 4PRHB 3CPLB 3Q6FB 3SN6N 4NKIH 3N0PB 1JNLL 1B4JL 2ATKB 2GUOA 3V5HB 1FIGL 5ALCH 1I1FB 1W0VB 4X7CC 1HINL 1JPTL 2UWEB 3NFNB 1F8TH 4OT1H 4PJIA 3O3EB 3U4EB 4BM7A 1OSPL 3PWJB 1A22B 4UDUA 1CQKA 5HXMA 5IHUL 2B39A 1YEJL 3OKDB 4CMMA 4M6AA 2DQUL 3C60B 3MGTB 4LSSL 4LU5H 3U9UB 3V8OA 4HG4J 2D0GA 3KLAA 2D9CA 4L1HA 1M1SA 4ZFZA 4M1CC 4DKAA 4F37K 5IB1A 4PJEE 2C4FT 1FFOB 2OR7A 1N5AB 4ZO7A 4L3EB 2OP4H 2CDFB 3VD4A 3BOVA 3D2UA 5E8OB 1QVOB 1X5KA 2HT3D 1BD2D 2BOBA 3WNMA 1J18A 1OCWL 2AV1B 2ESVE 2IPKB 2VKXA 5FYJU 4F7MB 4UIKL 3O2WH 2N4IA 5KZCD 3HMWL 4Y5VC 2A9NL 2I9LB 4C57C 2ERJB 1RSFA 1NBYA 1KLUB 2KDGA 4JY4B 4FXKA 3BD4A 2BVQA 5I73B 3PABB 1MREH 5JW3L 5JXEC 1DVFD 1MCOL 1I9RH 2NY2D 5GJTL 5AZ2H 4QY8B 5JNYB 4X6BB 3DUHA 4FNLL 1MVFA 1L7TH 5HYJD 3SOBH 3BPOC 1BJ1J 2WBJC 3OR7A 3SE8H 4GBXB 2BVYA 2NXZB 4GRWF 4RIRB 3OMZA 3GKWH 3UTZB 3ZTNL 2HWZH 4OZ4A 5DHVB 3PIQA 5JHDB 4ZUVB 2GITB 2WZPD 4LSDA 1NGXB 1KLFA 4NQED 1VADB 5MI0C 1A47A 3LQMA 3STLA 2X4UA 4JZJC 5D5ME 5GRJL 3VMOA 1CBVL 4R4FH 2N56A 1QLRB 2C3VA 4AQ1B 1W8NA 4U1SA 2NXZD 1KCVH 4KH2A 5T3XD 3MV8A 4LCWD 1NGYA 5KVDH 5C6TL 3TBVB 1L6ZA 2GKIA 4OKVA 2P5WE 4LARH 3RL2B 3LRSB 3ZL4H 3NPSB 3UO1L 3I6LE 5ALBL 4NQEB 3T1FA 3GNMH 1CE1L 1OP5K 4WTWA 2HA1A 4NZUH 4HIEA 2YBRB 3UYRH 2R2BB 3JZ7A 4LCCC 4YDIL 2F5AH 5DDHB 4Y89A 2P47B 3UROR 5HPMA 1IAOA 1NJ9B 1TQBB 1JWSB 4XTRC 1WT5A 1CIDA 4NKOA 1X5ZA 1QSVA 4HKZA 2O5ZH 3F7VA 5E8PB 1MF2H 3ARUA 4U7KA 4CKVX 3QQ4B 3I6LD 4V1DE 43CAB 4OGAC 2YD1A 3VXSB 1NGPL 4YZFE 3TT3L 1MHCA 1DTUA 3H9ZA 2W38A 4JO1H 3F6LA 5I1DA 4N0RA 1DEDA 4ZOAA 4I18C 1Q9WB 5I74B 3ES6A 1NC4B 5BRZB 2OBGA 1ONQA 1GGBH 3BE1H 3ARWA 2F54E 1FQ9C 3CZFA 4N5EC 3SDDB 4OLYH 3BW9A 3LS4L 1JZ8A 4PLJD 4QXUH 1WJ3A 2LABA 2UUDH 3IDIB 2VL5B 4NWTH 5D7JB 3S98A 5GRVL 3H9SA 4KUZL 2FX7L 4ZDHA 4P23B 5HDOA 2P5EE 2AK4E 4IEFB 4UAOB 3MODL 4JLRB 1T5XB 4PRNA 2B4CH 1XF2A 1OOAA 1I1AA 1R5IA 4NQDB 1Q0YL 4Y16D 2Y7QA 2J5LC 1GZPB 3MLZH 2Q6WB 3D18B 2F8XC 4JVPA 1ZLVH 1J05A 4XPFL 5GGSB 3QI9C 3RNKB 4ZFFB 4QRTA 3GO1L 3GSNL 3GI8L 3V4PH 3QIUA 1VDGA 3B2UC 4JR9L 3W0WE 3DXAD 3EUUA 3GMRB 1IM9A 4NO0A 3VD9A 1YN7B 5E95B 5GGVL 1SBSL 2EKSA 3VFNB 3KPSE 3BP5A 4HXBH 1RUQL 2MMXA 1FO0L 4Z7WA 2EXWD 3LZFH 3TN0A 1BX2A 1JCKA 3PNWA 1AGEA 4YUEH 1DLHB 1LP9A 2D7QA 3LSOB 1INEL 1PFCA 4PRPA 3IFNH 5DUPL 2VLLB 4X6EB 3W0WD 5GSVB 3TA3B 4PGBA 5EO1A 3Q6GL 2DD8L 4YAQA 1MJ8L 3DIFA 1B6DA 5D2NC 1A6PA 3AVEA 3ORJA 1E28A 4PJFE 1FL3A 1RULH 3JV5A 4XVTL 4NOFA 4I0PB 3LHPH 5DR5L 1TQCC 1UZ6E 3L5WB 5DJZB 3A67L 1FFPB 2RHEA 2VQUA 5KG9A 2OX5A 1LQSR 3ROOB 2I60H 3FKUS 3ELAT 3JWNC 3A6OA 1LP9E 4MQXD 4PGCA 5TQ0L 2VTFA 1I7ZB 1ACZA 4PJ8A 4FXLA 2NW2A 4A6YA 3BISA 1GPOL 2YEZB 1SJVA 1ZT4A 2Z4QA 4XCYB 5JZ7C 3MRFB 4NQCA 3TP4A 5HGDA 1N6QH 5BVPH 3VDBA 4HW6A 5K33A 4NUJA 4HKXB 3MRHA 2EDBA 3RX7A 3BPLB 3ULVL 3MSPA 1K4DA 2ZOKB 2YD7A 3FQNA 3EHBD 5IWLC 3GRWA 4BELD 3ARFD 4NFCA 3MUY1 1VGKA 3QPXL 1CI5A 4PRHD 3LS5L 1MFAH 2FHCA 3JWOC 3FTGA 5FYKU 3VD7A 2Y72A 5CEYA 1S9XB 3Q5OA 4HBQA 3MUGB 3MRIB 4U1GC 5H2BA 3SKNA 3M1BA 4HJGA 3WE6A 3GKZA 1TVBB 1UYWH 2DOCA 2YOCA 4HS3A 4XCFH 4YDKH 2P1YA 4QNPE 3KS0J 2VDLH 4HFUH 4A2MA 1S5HA 3F7YA 4C56A 2ARWA 5DFTA 2ZG1A 1A6TB 4POZD 5JR1L 1CFNA 4E5XA 5BV7C 4OLXL 1A0QL 4M7LH 1IE5A 2IFGA 1GGUA 4M5ZH 3HZKB 1FG2A 4MWFB 4HJJL 3C60D 3O6FD 3C5ZA 1JF1A 4JPWL 4LP5A 1J1OH 4UU9B 4XNXH 3QA3A 1X5FA 3S3PA 1XMWA 1N26A 1QBLL 2DM4A 2LE9A 5ANME 4WW1B 2AEQH 2O5YH 2W9DH 4PJEB 4G6ML 1JGVH 3ULVF 2HMIC 2H1PL 4LLVB 3GIVB 3NCEB 4EI5C 4KHTH 4ZD3L 1FVCA 5MP6H 1JMZA 2ED9A 5CBAB 3QNXB 5EU6E 3BYYA 4YHKL 3WDHA 4ZUSA 4HAGA 2R8SL 1F6FB 2A6IA 4FTVE 1DQDH 3TVMD 1PSKL 3LQZB 4YBLB 3IJYB 5FECB 3DTXA 2AQ2A 2R0ZH 2BXZA 4X6DA 3BO8A 3GBML 4UT9L 4QRPE 3GK8L 4OZFB 1GJIA 3FO2B 3NACH 2EIZB 1UJTA 3QFJB 1MLCB 4NNPH 1AHWA 2H8PA 5C0DB 1MCRA 4KTEL 1LEKA 1MRFL 1QNZL 4XNZB 1I3RB 4JKWA 3FONB 4NDMB 5HGHA 5CGMA 1EAPA 2X89D 5DYOB 4DN4H 2IWGA 2ZCKH 1OD7A 4FTVD 5D1ZC 3H9HA 5HGAA 4D94A 3ESVF 4K3DH 3VJ6A 4M1GL 3QO0B 3OTTA 5D7JD 5DMGD 4J1UA 2IPTL 4YFDB 4L8BA 3WXVL 4OD1H 2Y06L 5D7SL 4IMLA 2ICWI 3FFCA 5DJCB 3PDOB 3QWRD 4I77H 3AU1B 5F9OL 1IGCL 4TVPH 3QDJD 1SYVB 1F02I 1E6JL 3MJ9A 4FXGA 4GW1A 4GAYA 1AP2A 3QNZB 5IW6A 2P8LB 1BF8A 3H0TA 1SEBB 2FO4B 4NCDA 4S1RH 4OGYL 3SCMB 4Z7VB 1XR9A 3T3MF 3M17A 4JRWA 4IRSA 4FQHA 1G7IB 5E2JA 5D71L 3IXTA 1RZGB 1TCMA 4WW2F 1UB5B 4OLZH 3IKCA 5DA0B 2CLZB 3RDTB 1AO7D 3BIKB 3OZ9H 1C12A 4G42A 4POUB 2FSEB 1U95A 4L8CA 3GRWH 3AGVA 4X0KA 4Y4HD 2PO6A 3SHSA 1PAMA 5D5MB 4D0BA 4XPAL 2CLVA 2PTUA 1F13A 4XNUL 4UIMA 3O0RL 4MQ7B 2DQCH 1KLGA 4XAWH 3ARGC 3ETBF 5MHSE 1B6UA 1UA6H 1FSKB 3G5YA 4JHWL 4W70A 3SGEI 4Z6AT 1XF5B 5IW3A 4PY8J 1G1YA 1P1ZA 4N0FB 3X13A 2DWDA 5F7KC 4PJFB 2EZ0D 3OKYA 1N5YH 5JUEL 5GGTA 4Q0XH 4W68A 3HC4H 3RZCB 2P7TB 5HI4D 2PXYC 3WYRA 4JO2H 4ZSOB 1YQ2A 4NN6B 4XC1H 4Y5XA 3LV3A 5CILH 3ZE1F 5D1XB 3JWOH 1H0DA 3PGCA 5DJAA 1YY8A 4G43B 1R24B 1DBJH 5F7DB 3S37X 3BHBA 4PGEB 2VLKD 1IAIH 3B3IA 3V7AG 5IEHA 1T7ZA 4FQ2L 5HD8D 5F71A 4XMKL 2JE8A 5F70A 2E27H 2QSQA 3EYSH 3ZTJG 5I16B 1CN4A 2PNDA 3VMNA 4M1DL 4L3ED 2CRMA 4APQB 4XWOC 2A0LC 1MAJA 5CJQH 4XCCL 2BY2A 2HG5B 1T22A 2DMKA 4G9FD 1A6VL 5TH2B 3N1QC 1JRHH 3UAJC 5JDSA 2R0KH 4QRSB 3B9EA 5C3LD 2BVOB 4RBPK 3VWKB 4FS0A 1U8IB 4HUVB 4IIQA 4L4TD 2G2RB 4IRZH 4MJ2A 3GMLB 1K85A 1CD9B 1KIRA 1KFAL 5IOPA 3U9UA 2DQFB 2WK2A 4CVUA 2FLRT 3OR6A 4FRWA 4P2CG 1BQHG 4JJ5A 2EEBA 3EZ8A 3DVNB 3FT4A 4DVBB 2HTLC 1FFOA 1KTKE 2AV7A 4JG0L 5IB2B 3HZMB 1TZHA 4LSPL 5FYLE 1QLFB 2J8HA 3UTSA 4FG6D 5DVNA 4ELKB 1VACB 4UV4H 5FGBA 4KI5F 1DBMH 1HOCB 1P6FA 2DMCA 2F74A 5B39A 1KLUA 3MV9A 3R1GH 5D72H 1LO4H 4KJYA 1UWGH 1PX3A 4OZIF 1YEFL 4UUJB 1A4KA 1YNLH 4Y19A 3ZKMC 2IQ9H 4G7YH 4Z0BH 3UYOD 1DE4A 1YEKH 4O2FA 1BQLH 2FLBT 1ZEAH 4OZIA 1F3DJ 3SDXE 4JFXA 4AL8L 2H41A 1G7LB 4MXVF 5DJDB 3BGMA 3TO4A 2HJLA 3HUJB 4U6YB 2AJZA 3PV6B 4ZS7H 2XA8H 5LCVL 4GS7C 1JWUA 3MLTA 3FQRB 3P0YH 5GRWA 4XCEA 3FQWA 3CSPA 1Q0XH 1ORQA 5DXWA 2X7LA 5GIRA 4NC2B 1IGIL 3T09A 1CFBA 1CG9A 4X7EC 4U1IA 3F58L 3LKSB 1QRNB 4XXDA 2OJZH 5CLWA 3FAXA 1A6WL 2VXUH 3WS3B 4HF5L 5TE6L 4MJ5B 3NZ8A 1MI5B 3S36H 1QHOA 1ZLWK 1YPZB 1MIEL 5DMJB 1ODAA 4H5SA 4AIZB 1B2WL 1FL5A 1GGIL 1NFDE 1U0QA 4EEEA 1WZ1L 4JFFA 1MCCA 5DI8B 2DQDL 1O7VA 4Y4FC 1MHEA 1EO5A 5KS9F 4JAMA 1LO0H 4QRRD 4X5WA 3FOMB 3VFTA 2GY5A 4HH9A 1F3RB 1PJ9A 2H9GA 4HIEB 5C0CD 5I2IB 4XWGL 3T0ED 2YA2A 4D0CA 2MPAL 5HHNB 2VXSH 2HP4A 5HPMB 4PJAE 2OK0L 1CZ8H 3MLRH 4HGWB 5HGGS 5E2WL 1JN6B 1DN2A 3OF6A 5JIPA 4XZUA 1MJUL 1S7XA 4GRWE 3VXSA 3I50H 4Y1AB 1UGNA 1NUGA 2QQNH 2P5EA 1PBYA 5FYKH 1ZGLB 5ESAA 1RZ8B 3WD5L 4YK4C 3VA2C 1QVOA 3WUZA 2Y5TA 1PG7L 4G7VL 3BKYL 5JIIA 4Y5YA 1IGFL 2NX5D 2I9TB 1WZKA 4LCWE 4D9QE 5TPWL 2AI0L 1D9KA 5IW1B 3U6RB 4JN2A 1NBYB 5D7JA 4GAJH 3FRPA 3HS0B