2YWZA

Structure of new antigen receptor variable domain from sharks
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
AWVDQTPRTITKETGESLTIKCVLKDHSCGLSSTTWYRTQLGSTNEKTISIGGRYDETVDKGSKSFSLRISDLRVEDSGTYKCQADYSPSCYSYPSLESAVEGAGTVLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords new antigen receptor variable domain
publication title Shark IgNAR antibody mimotopes target a murine immunoglobulin through extended CDR3 loop structures
pubmed doi rcsb
source organism Orectolobus maculatus
molecule tags Immune system
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ywzA00
2WUCH 4Y16C 5JIHA 4OIBA 3SGEI 1T1WA 3VH8G 3MA7B 1HYSC 1E0OB 2QHRL 2R29L 4WRLA 5FCSH 1BIHA 4L4TE 5TF0A 5HYEA 4PJXF 5I19H 3D0VB 3DI2B 3TBYB 5J89A 3D0LA 2O5ZL 4RAVB 3GMQA 3ILPA 3IFOB 1I1CA 2PKDA 5FHBL 3DX7A 2DLHA 3JWOL 2CR3A 3MX0A 3U4BL 2ZCHH 4RFOL 1JGUL 3AAZB 3HCVA 5HDBF 4GRWB 2AEPH 1GAFL 3GJEB 3VWJD 4M8QB 1YJDC 4GW1A 3RUGB 1LP9E 1X44A 3MNZA 3AS1A 1KJ2A 3T1FA 2MTPA 3EYSL 5FO9B 1YNKL 3IS1X 5F1IB 2FNBA 1S7SB 4JO2H 7CGTA 3QEHB 3UMTA 4O5LL 3VMPA 3WN5C 1MUJA 4QRRB 3EO9L 3V79C 4O4YL 4KI5D 2D7TL 2H8PA 4CU6A 1H3XA 1LD9A 2A2QT 1Z5LB 1ZVSA 4LARL 3P9MB 3VCLA 3V0AC 4R3SB 1P2CB 4LEXL 3MRIA 4TNWF 4JVPA 1MPAH 3OKNB 4TYUA 4BK4A 4IHOB 4EUPG 3VMOA 1RUAL 2I07B 4KQ4L 1L9MA 3QO1A 2BY1A 4UBDD 1A2YA 5EDXA 3GHBH 3E8UL 4LLWB 3VGBA 3X14A 5GGSB 5KS9E 4GRMB 3QEQB 3QWRA 5BVPL 4YBQD 3O2DH 4JGJA 4M6ML 3WUWA 4PPTA 3T08A 3L6FA 3O45A 1G7QA 4P2RE 2ADJA 4CU8A 3OMZA 5C0FB 2B4CL 4KMTH 1JF1B 4KHXH 2BERA 3VGAB 4CDGC 1QPXA 3VXRD 1EH9A 1T0MB 3S35H 2MQCA 4HGWA 4QOKB 3SPVB 1BFTA 1TZHB 1VPOL 3UAJD 1WBZA 3DROB 5AZEL 3W0WE 3LH2L 5ITBH 2ERJC 4RSVA 2ESVE 3RL1B 3C5ZD 1QBAA 3RI5K 4JQXC 5JLZB 4PRPE 4YDLB 3C8KA 3TLRA 2VLKB 3U0WL 4JPIA 1TTFA 1RZIB 3IJHA 3QUKB 3I2CH 5JPNB 3FQUB 3VXMD 1HK6A 4I13B 5HD8C 3G5XB 1FIEA 5IOPB 5F7EH 4F8QA 1C12A 3F62A 5AD0A 3ARTA 4X4YA 3EO0A 1H5BB 2Y36H 5JPMB 5I16B 2BVPA 5TDOB 3LKNA 4KHTL 5CZKA 3MUGB 4XNZB 4MHHI 5C0EB 1CD9B 1B4JL 3F7QA 4XX1G 3V4UL 1OAKL 5D1XA 3CFKB 5J57B 1JPTL 3HG1D 2JJSA 4LDLB 4OF3A 1QNZL 2LTQC 3G9AB 3FB6B 1KIPA 4GLRI 3HNVL 2QSCL 2HVKB 1SY6A 5FYLD 5EORH 3GNMH 5FM8A 4C59B 4EIGB 4PUBL 1XAUA 3OR6B 2R1XA 4NQVA 2D9CA 5E70A 1TCRA 4ZNEE 2C26A 2HT3D 4LAQH 3HUJA 3RGHA 3VXUA 3G08B 2Z4QA 4Y7MA 4Z8FH 1LGVA 3VFOB 4YHIB 3MV9D 5D93C 2J1KA 4IRSC 3BYTA 4ONGL 3RWGB 3GBNH 2DLEA 1C5DB 3MV11 3PF2A 2DICA 2QTEA 1E6JL 4JFYA 1IQWH 1U58B 3EOBA 1KTLB 2NY6C 4OLYL 1SEBA 4HIJA 2G9HA 5CJBA 4E0RB 4P9ML 1XR9B 2QEJA 3E2HC 4OI9A 1X6NA 1S7WA 5AUMA 3K2UL 4NOFA 1K8DB 4GJTB 1Q9LA 5IBUB 3O8XC 3S7GA 4RCAA 5JW5A 3BRFA 5IHUL 1MCOH 5DWUL 1X4ZA 2JB6B 2VXVL 3GMPB 3FO2B 4AH2A 1WWBX 4TOYL 5CJXC 5GRVL 3TNMB 4BUGA 1AY1H 1PQZA 4I77L 3HNSH 4NKMA 2EH8L 3HNTL 3QFJB 4Q6YA 5HGDB 5BS0E 3VXNB 5JQ6H 4OZFG 2FJGB 3KPLA 4KK8D 4HUUA 4X6BB 4OZIE 1LDPH 3V7AG 4N9GA 4ODSH 2V2WA 5FGBA 3DV4B 3TCXA 2PO6A 3BN9D 1TFHA 4XAKD 1RMFH 2DJ4A 1MQKH 1IGIL 1JFQL 3DUUA 4QTIL 1IT9H 3BH8A 4ERSL 1WFTA 4J3XA 5SX4I 4OGYL 3SE4A 3H9HB 1BQLL 1ORQB 3NH7L 5F7DB 1PDKA 2PW2B 1IAMA 3PNWA 2APWA 3IFLH 3NABL 4NRZB 2G60H 5DI8A 3FOMB 5ELIA 2B2XH 2P5WB 1HI6B 1MI5A 3X13B 1P4LA 2JJUA 5JXED 4ODWA 1EHAA 3PE9A 2WQRA 3PHQA 4N0FB 2FIKA 3QCTH 4P5MB 5BVJA 3NN8A 3BWAA 1MRDL 1MH5A 5KS9B 4PP2A 4HH9A 5CCKH 3ZE2F 1G7JA 1T2JA 5CILH 5DRXB 3WFCH 2XNAB 2CDGA 3P73B 4MSWA 5C09B 3IRZA 1ZMYA 4F9PC 5F71A 4GXUM 1WWAX 3VFWA 2HRLA 5I1LA 4YE4H 1YEJH 4KC3B 4ZS7L 1KJVA 1A47A 2NW2A 1M7DB 4EVNB 2I9TA 3R4DA 3CSYA 3UTSA 4DN4L 5GGUB 4U0RC 3VXSE 3DIFA 1C16B 4AEHH 1AKJD 1ZVHA 3GRWA 2JLLA 3UJTH 2ESVB 1RK0A 3MTRA 4OLWL 3I75B 1YYML 4MYWB 3IFPB 4XWOC 1VADB 4GG6E 4FFWC 2NPLX 4R26L 2CGRL 5TH2A 1EAPA 3GJFA 4QT5B 3DMMD 2AVGA 2IBBA 1IZJA 1FP5A 3JWOC 3CUPB 1U8IA 3GSOA 1Q38A 1A4JB 4OQTL 1A6UL 1MRCL 3ZTJG 4X7CC 5ACMA 3VFTA 3NFPB 3LS5L 4NFBA 5KANI 1JNHA 3M17A 1ZHKA 4M4PA 5B4MC 1S7QA 4KZEH 1CICD 4AY0A 4OFYA 4PRHB 3MOAL 4WV1C 5F89B 1XH3A 3BP5A 5IB5B 5DJDA 2Z0BA 3KXFD 5J6GA 4ZXBD 4FMFA 5C07A 3KYMB 4UT9L 4XPTH 4RBPH 3UC0H 1XGTB 2NY4C 4TPRH 4OIAA 4TTDD 3EDFA 4GO6B 1JIBA 4ONHA 4OF6A 3MRNB 2IH3A 3H9SE 4X0KB 2QQQA 2A9NL 5DUMH 1MCRA 4JVWA 5L8JB 2VDLH 1WTGT 2R56L 2DQEL 2VN7A 3WUWG 3LEVH 4N0CD 1CR9L 3I50L 5DUBA 1A7PL 3T1WA 4OZHE 4HX1B 1YQVH 3B9KD 4M7LT 1QR1A 2E9WA 3LQMA 5DC4B 1M71B 1IKNA 1XGRA 2NY2C 4LPXA 3VWKB 1S5HB 4LSSH 4WI4A 3ZDZE 3ILQD 1CFSB 2XFXB 3T0ED 3WE6A 5I8OL 3GSNH 1AIFA 1ULVA 2NXYC 5GZOC 1BJMA 2B4CC 3SDYL 1BP3B 2EC9T 1T20B 5JHDD 4K94H 5F9WC 4PP1C 5FOBB 4JRXD 5HHOB 1I8LC 3INUH 1WUNT 3D85B 1IAOA 3I6KB 4N5UA 3HB3C 5C0IB 5JDSA 4MAYB 2OL3B 2P47B 1F11B 1LO3H 4KK5D 3T8XB 1UJ3C 1WK0A 1JN6A 1EJOL 3S6CA 3GI9L 3K1DA 4M61B 2GJ6E 4O9HL 1AXSA 3PJSA 2VQ1A 3L7FB 4KKAC 3GKZA 4D9LH 4JFEE 4XP1L 4LPVA 4MA8H 2VITB 4DK6A 2EEAA 4P23D 3FQTA 5MI0B 3KYKL 1XIWC 2ZKHL 3UYRL 4OZIB 3K2MC 4EI5C 1B88A 2B1AH 4PRIE 3O4LE 1A1NB 2V2XB 3DX6A 3L5XL 3EOTL 2XKUA 1R3JB 2ZG1A 4P3DB 5DYOA 5GSRA 4DGVL 4RZCB 5JTWA 3ARDA 3EJZC 3HC4L 3MRMB 3H3BC 4LLAA 4Z0BH 3SE9H 5IFAH 1AH1A 4LKXA 4PJBA 1NFDE 4WWKD 2E27H 3R1GL 1W2KT 1KLUA 1WT5A 5EOCL 4Z7VA 5F9OL 5ID1A 3RVVD 5I1KL 2D03L 1KLGB 1A7NL 3P4MA 5E9DD 3K4AA 4R7DB 4UQ3B 1NMCC 3RKPA 3ULVE 2IBZX 3ZT6A 4L4VA 4NM8L 2EO9A 1ZA3B 1U8HA 5JW3H 1KPVB 1C5CL 3QDGD 5IW6A 2Q86A 2VN4A 4M1CC 4P48A 5FA3A 4D8PB 1C8PA 3N50A 2YUVA 4QHNB 2X6MA 3SDDC 3WLWC 5T1DH 5HHPA 4YBHA 3NAAL 1FO0L 5L2KD 4HV8A 1W0VB 2EXYD 1IFHH 3SCMD 1E4XL 3BDBA 3OG4B 3FFCE 1T2XA 3MMEB 3O6KL 1TNMA 3ZYZA 5FM5O 2H1PL 4MNGA 2W0FB 3TPUB 5IESL 4KRNA 3JXAA 5FUCC 3TN0B 1YPZF 5JORB 1DVFB 5KG9B 4P2OC 3CVIH 3FB8A 4UQ2B 3GIVA 1RIUH 4NN7B 5LAXA 1F4AA 4JN1L 2HT4C 1CDCA 2XA8H 1L7TL 2ICWB 1KXQE 1ZHBA 1I1YB 3B8SA 3ARUA 4JJHA 4R0LA 4WHDA 1KTDA 4HKJA 5HTSA 1JMZA 1A7RL 5D70H 5ANMB 3IXAA 4PYGA 1VERA 4PB0H 1Q9OA 3ARBD 4IMKC 2B0SL 1TQCC 4H0HB 4J7RA 5I15H 3MODH 4GQ9H 4EN3B 4XCFH 1I3GL 2A74A 3DRQA 1AGDB 2GCYB 2V9TA 3QCVL 3SJVA 3MYJB 4HDIA 3QA3B 1OW0A 5JZ7C 3BUYB 1EUUA 2RJMA 2ZJSH 1HWHB 4R4FH 5BO1L 3R0MA 4BZ2L 5HGBB 1JMXA 5D5MB 3G04B 4CAGA 3OJVC 4KV5E 2VO5A 1D5MA 1CF8H 1OAUH 4NZDA 3WDIA 2FWOB 4DN3H 3LKOB 4M6NH 3B2VL 1QFUL 4UIMA 4YBLC 4LCWA 1DLFH 1ZVYA 4ZUWB 3RWHB 1I7ZA 4ELKB 2C1PA 3V6FB 1LEIB 2VQUA 3OAYH 3VFUB 5E2UL 5A2JH 2DWEB 3N1MC 2W0KA 1T7XA 3QUZC 4PJIF 3ZKXB 2JIXD 3FN0H 3QUXB 4LLQB 2XIDA 4O58H 3ZYOA 4RWYH 4M5YL 1YN7A 1CD1B 4WDIB 3U7WL 15C8H 1BQHA 3MRLB 4S10A 1JYXA 2CLZA 3CFEA 3REWB 1QFOA 1BEYL 2F8OA 4RFNC 1T21A 2E7CA 3KPRA 4LBEA 5D7IE 1OY3B 1IGML 2ICWJ 3STZA 3VFMA 5DJAB 3MRQA 3WHE0 2J8UF 4ZFZB 5BV7C 2YEZA 4I18C 4WHYG 1PW3A 1W8OA 5C3LD 2CMRH 2OMNA 3FO1A 5F3HB 2GJ6B 5ILTH 1HIMH 1J0KA 1CDJA 3HMWL 2NR6C 3TNNA 3O6LH 2KQNA 5EU4A 5IP4A 1DE4A 1IJ9A 1OPGH 5HI4C 1GZPA 1I1AD 1UADC 2P44B 4JPWL 1AGFA 1MAKA 1B2WH 1OSZB 3BRGC 1CDBA 4I8DA 3RY6A 1KGCD 5C6TL 4ETQA 5ISZE 4ZUTA 1JZ6A 1RIVH 3REVA 1PYWA 5DS8A 3WO3B 3O4LB 4APQB 4U1IB 4WW2A 3C87A 2DLTA 1ORSB 2OJZL 3BD5A 1QSFD 2APFA 5BOPA 4GAJL 3CC5B 3SDAC 2LVCA 3CFCL 4HUWA 4XX1E 3TO4C 3T2OA 2VLRA 4EXPX 3D48R 4F7TB 2FL5A 1Z3GH 4KROB 3OF6A 4KU1A 5LXGH 1KBGH 2YA0A 3QUYA 3EYUL 3FT2B 3KPOA 3QI9B 3RNKB 5EU3A 5IEKB 4PJ9C 2W9LA 1BREA 2VXQH 4MWFB 2HTLD 2JK5A 2VDKL 3UYPA 5T33L 4M3JA 5J3HC 4XWGH 4QRPA 2YD2A 4JFDD 5DQDL 4MNQA 5J0BA 3BE1H 3ULUH 4J3OC 5F9JB 5C0AD 2ENSA 4V1DB 2P4AB 4JZNA 5F1NB 4S1DC 4BQCA 2BNQE 5GSVA 3EFDH 4HULB 1KN4L 5C0CA 3MROA 4FS0A 2X1WL 1Q94B 3FFCB 2GITA 3WNOA 1NFDF 2XWTB 4YGAB 1CL7I 4LQFH 4LPTA 4E41E 3VH8B 3QCUL 3RTQB 4JFPB 4PLKD 4GBXA 3OV6A 2DQIH 3D3VD 1AJ7L 1I8KA 1CG9A 3BQUC 4OCXL 1E27B 2Y7QA 2OYPA 4PJCA 2YSSA 1HHIA 5SWZD 2ORBH 3MO1A 3TZVC 4GRLA 4N1EA 4PJ8C 1XCQA 3V0WL 2M2DA 1IGFH 3OX8A 5BZDB 4WTWA 2VL4A 4JG0L 2EYRA 1TQBB 1J0IA 1K6QL 2ADIA 5HHXH 1I1FB 1O0VA 5DC0A 4XP5H 5ACLA 1EEZB 2HG5B 3QXUA 1HXYA 2PETA 4UDTB 3MRGB 3NZ8A 3VI4F 2J5LC 1IM3B 3VFPB 1G7MA 2BSRA 1TPXC 3V7AE 1CS6A 4OV5B 5EFIA 3IDNB 3L3DB 1CXKA 2X4UA 3S36H 2BCKB 1GGYA 4HWBA 4P3CL 2VIRA 1ZGLA 2ZCKH 3VE0A 3W9EA 2YD3A 2VL5A 5F88A 3DBXB 5TE6H 3TFKD 4M7LH 3I3EA 4MNHA 3I9GL 4JY5H 1MCQA 1CTNA 1WVZA 4ELME 4PTTA 3KR3H 2R2BA 4JDVA 4Y4FC 1R0AL 4EUPB 3QDJA 2BK8A 4PJGA 5C2UB 3PG2A 1YJDH 1D5XB 1UWEH 1MFDH 1FAIH 4FOMA 5KVEH 4Y19E 3F7VB 4L8BA 5DJ6B 3ZKSD 3FTGB 5DURD 4Y4KB 3W11D 3V4PL 2FDBP 5C9KA 5B3NA 5EU6A 1DTUA 3PGFH 4WGVB 3EOAA 3G5VB 5HHQA 5DUPH 3HS0A 4LSVL 4KTEL 3QRGH 2IAMB 5CEXA 3DURA 4ZAKD 3TVMC 1CD0A 1FRGL 3MOQA 3GSRB 1MWAB 3SKJL 5INCA 1W72L 4K7PX 3QPQD 4HJJL 2YPLA 4KKNA 4D9QD 1HNFA 1RUPL 3D39B 4MZ2A 1EX0A 4PJHE 3P4OB 5IB4A 4Z7NE 1VGEL 2K7QA 2F5AH 4HBCH 4ZD3L 5CP7A 4HK3N 4CMMB 4B0MM 2E6JA 1CLCA 1XCTA 4XPHH 3S37X 3I6LE 4TULH 1NBZA 2MKLC 4BQ8A 1UM5H 1K3ZA 4FQ2L 4LHQB 3C8HA 5ALBL 3RP1A 5GRJH 2H41A 1AXTH 2EYSA 3HZYA 3NCJH 4PRDB 1E28A 1WWWX 2VR4A 5ISZB 4GQPH 1R6VA 4QXTB 5E8DH 1DZBA 3QJHA 3MBXL 4N5EC 1OAZH 3LHPL 4OQTA 2BSED 2ICCA 3ES6B 2XZQH 3L3HA 4R97B 3MGOB 2R0LL 3FRUB 1MFAH 2YUWA 4MB4A 5CSZB 1KTKE 1UH2A 2I5YL 4XP4L 4PJAA 1VACA 4JY6B 5D7IF 5JOFB 2C9AA 3VWJA 1J1OL 1AGEB 3PIQB 5DVMA 3HE7D 1I8IB 3L9RA 3LAFA 1I1RA 4S1QH 4MGXA 2RCSH 2AJZB 3FN9A 4L9DA 2G5BA 3B6SA 2J3SA 3JUYA 5FGSA 4BK5A 5I66A 2VLJE 5EUOF 4J6RH 2V7NA 2W9EL 1CBVH 3P0VL 3OAZK 3JBG7 2IALA 4XBPA 3PL6C 4XVUC 3BXNA 4GUPA 5DVLA 3D2UD 4ZOBA 2QKIB 4PJ5B 5IVNA 3WS6A 3ZKNC 1NCAH 4U6VL 2Z31C 1BQHG 2EE9A 1QKZL 2HJLA 4BH7A 4FFVD 4CVXA 1BECA 2XRAL 1UACH 2BNQB 5DXWA 3FT3B 43C9A 3FQNB 3QUML 5FUOL 5E7FA 2J7LA 3WIFA 4FQLH 3QEQD 5HI5D 1S78C 5L7XL 4M9OA 1R5VB 4JKLA 2ARJB 4U1KA 3N85L 4J8RA 3HE6C 4PJFF 5E1AB 2VAAA 2AV1B 4L3CA 1OCWL 1F3DJ 4JHZA 4AQOA 3V52L 4MB5A 3SKNB 4EBQL 3CU1A 4XNUL 5DK2B 1H3UA 3O6MH 3FO0H 4NUJA 2F53A 5HBBA 1KCRH 4QOKD 3U83A 2WWMD 1D5IL 3WNPA 3VD7A 4G8GE 3GIZL 4ZOEA 3IDXL 3P9WB 1RUMH 4GS7C 1JGEB 2PW1A 4G6KH 4F33B 5D7LE 1QVOA 2XQBL 2Z92A 2R4RL 3RIFF 4KDVA 3BEVB 4OTXH 2P43B 4OM0L 1NMBH 2EDLA 4KDWA 3IU4H 2JB5L 2VLKD 4JQIH 2VLLA 4WW1B 4FQXD 3VXMA 3C08L 1U91A 5CGTA 4YR6B 3X17A 4OUUB 2VDPL 1D9KC 2ZUTA 1JJUA 4ZUVB 4M7JH 1A0QH 4UTBL 1NBYB 3C6SB 4HIHA 4ELMB 5IHZA 4X9GA 1LO4L 3NA9L 1YYLH 2AQ1A 2P5EA 3C2AH 3EDDA 3H42H 3QAZC 3HUJE 4JKPH 1F4YH 4HQQL 3VXUE 1JK8B 3WHE1 4F2MB 5FYJD 1RK1A 1CIDA 4YHKH 4HWEL 4JDZB 1FFOB 4K23H 4JRYA 4Y19B 4RIRB 1ITCA 3MLZL 1OTSD 5D96B 1DN0B 1AQDB 2XV6B 5E8NB 5JUEH 2FBOJ 4PD4K 2QADD 5I71B 2H2PC 4F57H 4HEME 2MSPA 5GGQL 1DQMH 1INQA 1FZMA 1T1WB 1CLZL 5J12C 1DJSA 2XN9A 2X5PA 1FSKC 2F54D 2IQ9L 5FM4A 5IG7A 4N68A 1GOGA 3HC0A 1ZT4A 4NKIL 1FO0A 3D0LB 1L0XA 3GMQB 4AL8L 3RY4A 2JELH 4F9LC 2V6HA 3GSVA 3VDBA 1HH9A 3C6LC 3G6JA 3MNVA 1FDLH 4RA0C 5DR5L 1BM3L 1UM4H 5T5FH 1CDYA 5L8LB 1MCFA 3HCVB 4LP4A 4P46A 5EC1A 1U8NA 4GW1B 4OCSH 5CINH 3MNZB 1KJ2B 4L4TD 3T1FB 3ZE0F 5D2NC 3BUTA 4UNUA 3BFOA 4J4PC 3SEPA 5J06A 4FP8L 2X4TA 3OWEA 2EZ0D 5ALCH 4DEPC 5L0QB 1Z9SA 1YEKL 1MUJB 2H8PB 2MCPH 3MJ9A 1ZGLP 1LD9B 4RWHA 3C60A 4YHZH 4JM4H 4XTRD 1ZVSB 3WFEH 3VCLB 5LQBL 3VW3H 1HQ4A 3UP1A 3MRIB 2YA2A 5C0NC 3BZDA 2DMCA 4GT7A 4HK0B 5H35A 4G80A 1PG7W 3QXWA 1GRWA 3BJ91 1N5AA 3QO1B 3HR6A 4HLJA 1S9WA 4ZOAA 1A2YB 3SDCD 2P45B 2VLJB 2O5ZH 1JNNL 3X14B 5GISH 4UINH 5FHBH 3JWOH 1HILA 1MREH 2QR0A 5C08E 2X2YA 3WUWB 3L6FB 1ZV5A 4Q6IC 2WNGA 3O45B 2EDJA 1FL3A 4ISVA 2ADJB 4RX4D 2PXYD 4WENB 3W2DH 5I2IA 3MXVH 5IBTH 1JWUA 4WFHE 1YEHL 3BPCA 2P5WD 4KKBD 5JXEA 1B3JA 1P4IL 1Z6JT 3VXTA 1NKRA 4U1GB 4HGWB 1YNKH 2EIDA 1WBZB 2BY2A 3EO9H 4O4YH 2D7TH 4NN5B 4UOW0 2I26N 2HKHL 1KUMA 2GK0A 4JO3H 1SJEA 2W1NA 4LARH 1VEPA 4P2RD 3P40A 5C0DA 3C8KB 5JOEA 3GEWB 3OZ9L 1WBYA 4JPIB 3IJHB 4CNIA 2DQJH 2VDMH 4YHYC 3NIGF 1FHGA 1L6XA 3E8UH 1C12B 1A7QH 5AD0B 5I30L 4Z78A 3SBWC 3W0WD 4X4YB 3EO0B 4PREA 3P11L 1JTOA 4YZFF 1GGBH 2DAVA 5KSAC 1MJ7L 4HF5L 3LKNB 1CGWA 5ADPH 2ESVD 1YNLL 4PRPD 3M1BA 5DK0A 1FN4B 3EO1A 3U1SL 1QLFA 5D1XB 2WWKO 2B4CH 2FJHA 3O6FC 4JANA 1OAYH 1CGXA 2VXSL 1UYWL 3C09C 1KIPB 1RU9L 4I2XA 1VPOH 4CVZA 3M45A 2R1XB 5EUKA 4NC1C 3UJJL 5E2VH 3LH2H 1CXLA 3D9AL 2YRLA 3HUJB 4U49A 2WIIA 4K3DH 3VXUB 2CH8A 4JCMA 4MD0A 2Z4QB 3KXFA 3EW3B 4D9RE 3U0WH 3ULUF 3ZZ1A 1MJ8H 4ZYKA 4L3EE 4NKDA 4KZDH 4XHJC 4MA1C 1HEZA 2BSSA 2IPKB 5GJSH 1YUHB 5DJCA 3B3IA 4PLJD 2BXYA 4JFYB 2QLVB 4FQ1L 3NIFE 3EOBB 3AMKA 1WV7T 2Q8BL 2XG5A 4HIJB 2G9HB 4GAYA 2FZ3A 1GXEA 5HYFA 3U79A 1UQSA 1B4JH 3B9KA 1QSZA 4NWTL 1LK3L 1U8JA 1D5ZA 1G6VK 1S7WB 2XZCH 5AUMB 1JPTH 4FNLL 2UYLA 2IG2L 2AEQH 3LQZA 1XGQA 1HYRC 2R0ZL 1KB9K 4RGNB 5DHVA 3HI1A 1DSFH 2DN7A 5EN2A 3T0EA 4ODHL 5HHMB 1MOEA 4JVUA 4KVNH 4NCC2 4PGBA 3BP4A 3RX5A 5A3ID 3MACL 1PQZB 4CVWA 3ISWA 1BIIB 5JHDA 4JO1H 5J1TC 3SQOL 4L8CA 3CLFH 4JRXA 5HHOD 1M05A 3KPLB 1CT8A 2CO6B 3D85D 4HUUB 3QDAA 3T65A 1QLRA 3ELAT 4MAYD 2V2WB 2PO6B 2WBJC 4M1GH 3DUUB 1OLLA 3BZ4B 1QA9B 3HPJA 4RMUA 3MRBA 2NXZC 2XTJE 3BH8B 5HVWA 2W9DL 4YHOH 4PG2C 4G3YL 1H3VA 3VI3E 4U05A 5EWIH 4L8DA 5C6WH 3PNWB 5JHLH 1QUNA 4OLYH 4HUXA 5GS1C 5BS0D 2UWEE 8FABA 5F7WC 1P4LB 3VFGL 2R15A 4Z7VE 4ODWB 1TCMA 4HH8A 3K2UH 4LVOC 2VERN 2VH5H 4U1SA 4UNTA 4I3GA 1XMWA 3PHQB 2FIKB 2AJVL 5K9OA 5BVJB 3NN8B 3LEYL 3BWAB 3SE3C 2VXTL 4PP2B 2VXVH 4ZTPH 4HH9B 4LAJH 3ARWA 1WFUA 2HLFC 1G7JB 1SMAA 2IANE 3ZHKA 1A6TA 2CDGB 4YDKH 1IC4L 4MSWB 1ZT1A 2FD6L 2OS7A 1URLA 2WIMA 2FIRT 4AIXA 1A64A 2HYMA 4JFXB 4O02L 4WWKA 4AM0A 5BW7C 1G9MC 4YFLF 5D2LA 2W0PA 2XKSA 4L1DA 1KV3A 4R8WL 5I1LB 1NL0H 1KJVB 1QO3A 3IDYB 2NW2B 2GEEA 2DI9A 3GUTA 2YZ8A 4LVNB 3GMLA 1LDSA 1L7IH 1JFQH 3CSYB 3UTSB 4NZTL 3DIFB 1JPSL 2DLIA 5BMFL 1YY9D 4CADA 1XGYL 1RK0B 2HH0L 3QDGA 4JFFE 1QFWM 4KRMB 3NABH 1OQXA 1W72A 5CGMA 1MLBB 5TH2B 1EAPB 4XB7A 1KB5A 1EK3A 3SCMA 4KQ3L 2AAVA 3JWDL 5FV2A 2Y6SC 1U8IB 3GSOB 1MJUH 5E5RB 4OZGE 1NLDH 2YKLL 3VXSD 4U3CA 3VFTB 4HXAL 2J6EL 1JNHB 3T2PA 3M17B 1ZHKB 3TN0D 1DVFD 2ID5A 3F58L 1HNGA 5ICZA 3GJFK 4X7EC 5CSGA 4UILL 3SJVE 4K7FA 1JWMA 3BP5B 2NY7H 5DJDB 4IDJH 5J6GB 1DQTA 5C07B 3GSUA 2Z8RA 2AJYH 4XVTL 4M62L 1P9MC 4X6CF 4KMQA 1PX3A 4M1DL 4ONHB 2IH3B 3CVHL 1HKLL 1FGNL 4KVCL 3TC9A 1AP2A 3EKCA 3U30B 1B0RA 4LSDA 3MXWH 5E6IC 5BV7H 2B7DT 5DUBB 5ICYA 4LCWE 3OJDA 2ZNWA 4QY8A 1QR1B 1M1SA 3QDHA 4GKZA 3G5ZA 1S5IL 1XGRB 4YFDB 1OM3H 4N0RA 1MCBA 2OQJA 5DEFA 3F12A 3BIAX 3SDXE 1WEJL 5CFHA 4MLSA 5F1KC 1OARH 2D4FA 2YBRA 3WE6B 4YXKL 1AIFB 3D18A 3RA7L 5BRZE 4YPJA 1A6AA 3QG7L 5IB1A 2V5YA 2BJML 2X4RA 1IAOB 1NGYA 2DTSA 1RFDL 1BZ9A 4JO4L 5JDSB 3T04D 3CXDL 5CSBA 3JWNC 3T0BA 3CX2A 3QUXD 3EHBD 1JN6B 4NPYA 1WAAA 2A9NH 4X7FC 4RA3A 2D0FA 1AXSB 3PJSB 1X5AA 1XGUA 2VQ1B 1N6QL 5K9QI 4JFQA 1EBPA 4XNXL 3GB7B 3SGDH 1CR9H 3I50H 1A7PH 1B0GA 2VR5A 1UEYA 4P59L 4LNRA 1JZ5A 5D7JC 5BCAA 2D7MA 3F8UB 4KFZC 2GSGA 4NRXA 4EZMA 4HMCA 3S88L 3DX6B 4MCZA 4LMQI 2NZIA 1V8HA 5DYOB 2BVTA 5GSRB 5EC2B 2XTJB 4HLZH 4FQIH 4I5BA 5LBSH 4N8CL 2GJ6D 2AGJH 3BKMH 1TIUA 5I8OH 2I24N 4JFED 5I1HH 4LKXB 3SDYH 3PHSA 2IGFL 4K8RL 4UOW1 1RZKL 2BFVH 1LEKA 4Z7VB 5ID1B 1EPFA 4LVHB 4R90H 2BP3A 5CAYB 2J4WL 2OR9L 1T03H 3O4LD 4YXHH 1AE6H 4Y5VA 4APQD 3O9WC 3P4MB 1HSAA 5HDQL 1RIHL 2C3HA 1QSFA 5FYKL 4MS8D 3MLWL 2IANB 1NMAH 2CKBL 4HUMB 1GIGH 2E7LA 3NZHL 4G6JH 5C0BA 1U8HB 1WZLA 5IW6B 2Q86B 4KROD 4XP1H 5FA3B 4JM2C 4XCCL 2OM5A 4OV6F 4Y4HC 3SO3B 4AZ8A 1HZHL 3QI9D 4HV8B 4XZUA 2FEDC 3ECBA 1GGTA 3BAEL 2WQ8A 3OKKA 3P30H 4WEBL 5CP3A 5TGBB 3IXTA 3Q6FB 1AFVL 2UWEF 1FL6A 3ETBF 3ET9F 4MNGB 2OXHA 4U0RB 5C8JA 3ULVD 1EFQA 1BAFH 2BRQA 3MFFA 4PBVC 5C0AA 3RBSA 2OI9C 1PZ5A 3VRLE 4V1DD 3FB8B 3Q5OA 3GIVB 3BDYH 2Q3ZA 5LAXB 1K4CB 2PF6A 3WO4C 2NYYD 4OFVA 4I0PC 5DSCA 2DBLL 3R1GH 3QZWA 1ZHBB 1NCNA 4CMHB 4R0LB 4XAWL 3FFCD 4YFLI 3IXAB 1W0YT 1Q9OB 3F6IA 1K2DA 4A6YL 3NCYP 3PDOA 2ZUQB 4H1LA 4OZFH 4U7MA 3RTQD 5DD0H 3AB0B 3MV01 5GS0D 1JHLL 2Z35A 2A74B 4NM8H 5DJ8A 5B21A 3DRQB 4H8WL 5J11C 4M9PA 3SJVB 3ARYA 3QIUC 3WJJA 5FECA 4Z95H 4QHLA 4HIIA 3LKRA 3QIBC 3NAAH 1VESA 3AY4A 5FO7A 4TVPL 2RGSA 1AI1L 1C08A 3KPQA 2CK2A 3O6KH 1D5MB 5DO2D 5FHAH 4WO4D 4XMKL 3JV5A 1UB5A 1DUYA 1PX4A 4EDWL 1CL7L 1CE1L 4XBEL 3VFRA 3TH2T 5IVXA 1VFUA 4OZGF 5BZWA 4PJGE 4UIMB 1T66D 1NCDH 2NZ9D 2IADA 4LCWB 3W5MA 2YMXH 2C1PB 1N4XH 4P5KA 2AJSL 1NGQL 1X5IA 4K3EL 5HHVL 3QULA 4QXGH 5F7MC 4F37K 3CU7A 1QFHA 2WUCL 5EU6E 5IJKA 3ZYJA 1TETL 4IJ3B 2MJWA 1J11A 5D1ZC 6CGTA 1YN7B 4FG6C 4KJQD 3PHOA 5IMOB 3Q1SL 1BQHB 5M94B 3AU1A 1JP5A 2YPLE 5D6DC 2EH7L 5DD1L 4LOUD 5F7FA 1T21B 1CFNA 1W8NA 3KPRB 2FGWH 4LBEB 3H9YA 4Y4KD 4XPFH 3STZB 5MHSE 3VFMB 3MRQB 5CIPA 2ZCHL 2YR3A 5HYJA 4NO0A 4AMKH 4P5TC 2FECI 2YEZB 3OKEA 2AEPL 3FO1B 2IAMD 3FCTA 3CDCA 5KTEL 5HHNA 5DD3L 3TNNB 1M6OA 5EU4B 3UZQA 3V7MA 1DE4B 1QFUH 4DZ8A 3ROLA 3TWCL 5J13B 4J23A 1GZPB 4WFFE 1AGFB 3I6GB 4OD1H 5HVGB 4ETQB 4ZUTB 5HGHA 3REVB 1PYWB 5DS8B 1T0NA 5E2UH 4LHUA 4I48A 3PGCA 3JUZA 4WW2B 1KIRA 4MQXD 2APVA 3MBEC 4LKCA 4PJAE 4PGZA 1GGUA 3QXDA 4HUWB 1MPAL 2VLRB 1MNUH 2FL5B 1TVDA 4KUCF 1JTPA 4PYHA 5T1KA 5KAQG 1FZKA 3GHBL 4U1NB 2YD1A 4R4BB 1BEYH 2XWJA 5IWLC 4LPUA 5ISZD 5EU3B 3TV3H 5DRWB 1T1XB 2JK5B 4GG8A 1IL1A 2AK1H 3AREA 3G6DH 4URTB 3ZKMD 5K59E 1FIGH 4QRPB 2X10A 4MNQB 1FLRH 2NX5E 5IROA 3RUGA 4KHXL 4Y1AA 3E3QC 3HE7A 4JZNB 3HMWH 4F7EA 4HCRH 5J1SC 3S35L 4ZPVA 1MHEA 5FO9A 4OLXH 5GSVB 1H15A 4XGZB 5DJXA 4JPWH 5IK3A 5TQ2H 5C0CB 4YHMH 1SEQL 3RPIA 2BVOA 5KVFH 1QFPA 2GITB 3QHZH 5ITBL 3K80A 5DMGD 3D2UA 3NCMA 4PJ5D 2OJZH 2OTWA 4GBXB 5K9KA 2X9YA 1P7KA 1GOHA 1I8KB 4KI5C 1ZLWK 3ZDYF 1CG9B 4GW4A 2I07A 4XH2A 3F6LA 5TDNA 2Y7QB 4PJCB 2BNQD 2YSSB 1HHIB 2F53E 3U2SA 4BELD 3WHXA 3B9AA 3MO1B 3U9PH 1U93A 4GRLB 2PNDA 1ONQA 3OX8B 2Y36L 32C2A 4M03A 5ECJE 2EYRB 2ADIB 4E41D 4HS8L 1QBML 1HXYB 4Q9BA 3NZ8B 4NQCE 2B39A 1G7MB 2LVEA 5DJZA 2BSRB 3MCG1 2CO7B 3AVEA 5EFIB 1J5OL 4TUJA 3BH9A 2X4UB 3OJMB 4QOKA 5B8CA 1ZGLB 2VIRB 2HJFA 1KN4H 2DDQL 5E8EA 5EORL 3GNML 5I73B 3VE0B 3W9EB 2VL5B 4MZ3A 5F88B 3VU2A 4U7KA 4MNHB 1RJCA 1NFIA 5KOVC 4PTTB 2HRPL 2R2BB 4JDVB 3HI6H 4R4ND 4Y2DA 4UT6L 1KCVH 5DFWH 2VLKA 1AJ7H 4JAMA 3QDJB 4LRNH 4FQXA 4PJGB 1RZIA 5KSVB 4ODBD 4WFGE 3FQUA 4OCXH 1Q0YH 3CMOH 3C5ZC 3GBNL 5C9JA 3L3KB 5MP6L 3CFJA 1A4KA 2ZSWA 1P84J 1J0YA 5EU6B 5I16A 3EOAB 4DGYH 5HHQB 2X89D 3TGXA 3HS0B 5HPMA 4RRPA 5D8JH 1WIOA 4NOBA 5CEXB 1CI5A 3UDWC 3DURB 2XN9E 1A7OH 1TZGL 1TENA 3KLAA 1J9CT 5E5MA 5INCB 1G6RA 2DRUA 4MHHG 4HZLB 2YPLB 2V2TA 1MCOL 5E99H 4Y19D 1U95A 3WLBA 3QPXL 3QZWG 5IB4B 4HKBA 5T3XL 5CP7B 1O7SA 3B43A 1AY1L 1XCTB 1A9BB 3I9GH 3HNSL 3UJIH 4H1LG 1NBZB 4ESKA 3GSQA 1UCBH 3QEGH 5JQ6L 3RDTC 2F54A 1LDPL 2YA1A 3ZHLA 5E08H 4ODSL 1JE6A 2EYSB 2JF1A 3HZYB 1E28B 1RMFL 1MQKL 4Z6AT 5A16A 5TF1H 1ADQL 1IAIH 3CX5K 1IT9L 2HT3C 4HJ0C 3QJHB 3V4PH 2J6EA 3I6LD 3IFLL 2Z8WC 4PJAB 2HAZA 1VACB 4R7NA 1DBAL 4H8WC 1MVFA 2B2XL 2I27N 4TUKL 1C7TA 2WSKA 3L9RB 4L4TA 5EZLA 3SKJH 4X9FA 35C8H 5ESVA 2RFXA 4HJJH 2G5BB 2QQLH 3B6SB 5I66B 1P6AB 1J8HE 5BXFB 1A3RH 4TSBL 2XXCB 2V7NB 1R3LA 4PJEF 5CCKL 1VGEH 1JI2A 1II4E 5HDOA 2IALB 3CVHA 4RMTA 4XBPB 3WFCL 3PWPE 3OB0K 4JJ5A 3BXNB 4GUPB 3RFZC 2ZUWA 2ZG2A 1X5HA 4Y5YA 2XKNA 1BZ7A 2YWYA 1OAQL 5D6CA 1GPOL 3WNNA 4JN2A 1LP9A 4YE4L 2HJLB 4BH7B 1YEJL 4FQ2H 4CVXB 5ALBH 3I84A 4C58B 4Z76B 4RDQG 3SDCA 5M95B 2VLJD 43C9B 4ENEC 5GHWL 1FPTL 4JY4A 4G8IA 1F00I 3VMNA 4AEHL 2A38A 5F8RC 3CMGA 4O00A 5JW4N 3LHPH 3BRDA 3UJTL 5DTFA 4QWWD 3P0YL 3QEUA 1X5JA 4U1KB 4CU7A 5L2JA 4J8RB 5EZIL 4U1HA 5MERA 3BN9C 2BNUA 2H9GA 2PXYA 3CX5J 4RAUA 2VAAB 3GJFH 3A6CL 4L3CB 1F5WA 3SGEH 2CSPA 1EVUA 5CKGA 2XWBA 1CVRA 4NUJB 4RMVA 1PLGH 2F53B 4N0FA 1YY8A 4M7ZC 2GYSA 5KS9A 2W9EH 4LHUG 4RMWA 5JO5B 2PW1B 1MCJA 2C3XA 3A67L 3GMOA 1KYOJ 2XNAA 4ZO7A 1QVOB 2Z92B 4X9BA 3EYFA 2COQA 3GK8L 1CQKA 4KZEL 4P2RA 3NIDE 2J5LB 4F7MA 4NQCB 1FFPA 2VLLB 4U6VH 3RIAK 3BWUC 1IVLA 4XPTL 3VXMB 3MV8A 3UC0L 4NQUA 1M7DA 1MAMH 3TPKA 3PDGA 2ZUXA 1U91B 3UTZB 1NAMH 1QRNE 3CGTA 5DUML 3QUMH 3L5WA 3L7EA 3W0WA 2VDLL 2NQCA 2EIBA 2GAZA 5SX5K 5D7LD 2ARWA 4HIHB 3DYMA 5IHZB 3DV6A 1M7XA 1OTTD 2ZUYA 3W82A 2OK0H 2P5EB 2RBLA 3N85H 4PRPA 4EKXA 1YQVL 2R1YA 1M4KA 4G6MH 3UCRA 4IOSD 2FHCA 1FNHA 1RK1B 3V52H 4HS6A 2VQTA 2H6PA 2JCCE 2NY3B 3KPMA 4XNUH 3QYCA 4JRYB 3SN6N 3VA6A 2P1YA 3C8DA 5L88H 3NGBC 4XXDA 2HLAA 1A6VH 5CBEA 3IDXH 2L0DA 5D7SH 3IRPX 2P8PA 4LSQH 1FZMB 2XQBH 1JTTA 3BOVA 4K94L 1VFBA 4OM0H 2XN9B 3TVMB 1RQ5A 3INUL 3VXUD 1LE9A 1CFTA 2KL6A 5IG7B 4P4KA 1ZT4B 1FO0B 1LO3L 1S7UB 2MQ0A 1CQYA 3HHRB 2HJKA 3KPTA 3PWNA 3CD4A 1ZAGA 1CICC 4X0KA 3GSVB 1HH9B 4OI8A 3G6JB 4OQ1A 4XP9L 3BW9A 3DARA 5SWSA 3F65A 2WINA 3P4LA 4ZXBC 4Y16D 3OAUH 4D9LL 4IRJC 4LRIC 1TTGA 4ZNEA 4P46B 1JGDB 4MA8L 1X5YA 4I0KA 5EC1B 3IJSB 3NA9H 1OT1A 2Q6WA 3JV0A 1U8NB 4TTDC 1MCCA 4HQQH 1K4DB 1QOKA 3ARGC 5D2NE 5F3BA 2B1AL 2X4TB 1G9MH 5F7YC 4HWEH 1JZ2A 4N0CC 5KSBF 2QSVA 3T3ME 5DVOA 1RHFA 3MLZH 4HFUL 2FX9L 4A6YA 5H37H 3UROR 3C60B 1X5KA 2L4OA 5HHMD 2CLVA 3TYFA 3SE9L 1N8ZA 5IFAL 5KZCD 1JHTA 5GGQH 5GGTA 1HQ4B 4G7VH 1CLZH 2Y5TA 2E27L 4DQOH 5H35B 3ILQC 4G80B 2DMBA 2AJ3A 3LN4A 2C4XA 1N5AB 4Y5XC 1S9WB 4MAYA 2PO6D 3LRGA 5EOCJ 2A6IA 2XPGA 5CLTA 1ZANH 3CXHJ 4YUEH 4AL8H 1AHWA 1J0JA 1HILB 4GLRH 2EKSA 2QR0B 1CN4A 1BM3H 4X7SH 5JW3L 2EE3A 4WEUD 1U0QA 2PCPA 4ISVB 2NY1B 4RRPG 1OL0A 5HI3D 4POYA 5I2IB 4DFIA 4JHWL 4GKOA 5BS0A 3BPCB 5T1DL 3PQYA 1L0YA 5D2LE 2X4SA 2I60H 1IFHL 4PJ7E 2Q8AL 5JMOC 3VXTB 4RFEA 4FP8H 1UXWA 1YC7A 1Q9WA 4I3RL 3LQAC 1OVZA 4P23C 5C08D 4LIQH 4KKCD 2GK0B 4FZEH 1SJEB 1RIUL 1ZA6A 4GMSH 5C6PB 5C0DB 5GRUH 4BFGA 4WFHD 3HMXL 1S7XB 3ARPA 1WBYB 3V2AR 3GMRA 4CNIB 4M43H 3DWTA 1YPZA 5D70L 1VFAA 3VXQA 2FCBA 1JNNH 5HVHB 4Z78B 1GVIA 5I15L 4PREB 3MODL 2XOTA 2A9ML 3MUHL 1BOGA 4FQHA 1SM3L 4NCDA 4BKLA 4X6EA 2AJXH 3KYNB 3M1BB 3AXLA 5CJOH 5DK0B 4P0DA 3RVXC 4OCNC 2G2RA 3EO1B 1QLFB 1MIML 4UU9A 4R4FL 2FJHB 4JANB 2E8YA 1FLTX 1YNTA 4I2XB 1HHKA 1CF8L 2UVFA 3VXSA 4CVZB 4DN3L 3SGDI 5EUKB 3ARVA 1KIQA 1GC1L 2EXYC 3U0PA 2HKHH 1PBYA 4F3FA 5SX4H 3V6OC 1NUFA 4XNQA 1DLFL 1IEHA 4KTYA 4OCWH 4OFYD 2WIIB 4GG6A 4FABH 3OZ9H 3PABA 4MD0B 5H94A 3KXFB 1J86A 4BQ6A 2UY7A 4ZYKB 5B3JF 1EDQA 1DN2A 4NKDB 1HEZB 2ED9A 2BSSB 3FN0L 3O2DA 2ZUSA 4O58L 4RWYL 3UEZA 5DJCB 1BZQK 3B3IB 5I30H 4X5WB 3QIWC 2WUBH 15C8L 1MJ7H 4HF5H 4GAYB 2FZ3B 2IWGA 1T04A 1UQSB 5CD3A 1JPFA 4PJIA 3B9KB 1U8JB 3U1SH 1D5ZB 1ZLUK 3ARBC 1D3CA 4D9RD 3QNZA 1N64L 2UYLB 4LCIH 4L3ED 1FAKT 4N90E 3LQZB 1XGQB 2Z8SA 3CFIC 1T1ZA 2GJZA 1QP1A 3HKFA 5DHVB 1JGLH 1RU9H 3H9SA 5E8PA 1WAAE 2FWOA 5EN2B 3V4VH 1HIML 2JCCF 2E9JA 1NEZA 3IDJA 4PGBB 3BP4B 3O6LL 1TLKA 1G7LA 2MQ3A 4OZHA 3H7BA 5JHDB 2ATPA 1DL7L 5GIRA 4U1MA 3BPNC 2CIKA 1B2WL 2C3VA 4L8CB 2J8UA 4JRXB 1M05B 2GTZA 3S4SA 1CT8B 3T65B 4A2MA 2M26A 1QLRB 3BX7C 4DUXA 3FFDA 4B53A 1T6VN 2DKMA 3HPJB 4QRSA 3MRBB 3BPLB 4L8DB 2AKRA 3KLHD 1Z3GL 4X80H 1I85C 1NSNL 4HUXB 3ZSSA 5LXGL 1KBGL 1FFQA 2Y4SA 3MLTA 8FABB 5AZ2H 4NWTH 4K7PH 1LK3H 2PR4H 1A9EA 4F15B 1I3UA 2VXQL 2CQVA 4U1SB 2IG2H 4KK9C 3OKOB 2MMXA 5DD5L 5K9OB 2VSCA 4XWGL 1CVSC 1X7QA 2RR3A 2XTJD 4EI6A 3BE1L 3ULUL 4ODHH 4UZGA 1A6TB 5FGRA 4AT6B 5C0BE 2MWCA 5DRZA 4WI2A 1RVFL 1ZT1B 3VD5A 4JFEA 3MACH 1NUNB 2V9QA 5DEGA 1ZLWH 3EFDL 4WWKB 4AM0B 2B1HL 5D2LB 2F15A 3DX9A 1QR4A 3BYYA 5E2WH 1QO3B 1Z0MA 4HMDA 4PRIA 1U8PA 3QH3A 3GUTB 3GMLB 4LQFL 4APQA 1UM6H 1JUFA 4OUOA 1I7RA 3NCEB 2IH1B 4Z18A 1I1AC 4P2YA 2CPCA 3H2WA 4CADB 2IAND 5IM7A 3PP3K 4X6DE 2ZG3A 2E6PA 1F42A 1PJ9A 1BLNA 1NFDA 3HAEH 1W72B 3FT2A 2ORBL 3I3BA 5HHXL 3QWQB 1JL8A 2AJVH 5KVDL 4XP5L 1NC4A 1E4KA 1AD9A 1I7UA 2KQMA 4OCMC 3WNKA 4H20H 1SJXA 4MJ2A 5ICZB 1BF8A 4JFFD 2HTLC 4Y8DC 2PYEE 2VDOL 5T3ZH 4K7FB 1JWMB 3S36L 1S9KC 4O02H 1CE6A 2ZCKL 1T7VA 3U6RA 4OF5A 3BN3B 2YD8A 1XF2A 5TE6L 5CJ5A 3FFCA 4M7LL 4JY5L 4D3CH 1VENA 1MIEL 3KR3L 4LIQE 1KEMH 3GGWA 1U3HA 1JPSH 5E4IA 1AP2B 5BMFH 1B0RB 4W6YB 2HH0H 2YD5A 4IIQA 5ICYB 3CDGA 1YJDL 1UWEL 3SJVD 1ZT7A 3OJDB 1MFDL 1FAIL 1GHFH 4QY8B 5CD5C 5KVEL 1U8MA 2E7HA 5JIKA 4GKZB 3G5ZB 1FZOA 1JNJA 4PLKC 2OQJB 5DEFB 1A1MA 4F7CA 3F12B 5DZOA 3DVFA 4DAGL 4WFEE 4YHNA 1I7TA 4H88H 5DQJA 4NQDE 5DUPL 4WI6A 1N7ML 2NLJA 2YBRB 2YKLH 2SEBA 4WO4A 3QRGL 5DFTA 1BD2E 4HXAH 1NANH 2FLBT 1V3LA 2V5SA 3D18B 3CDYA 3VFPA 1WICA 2EE2A 1YC8A 4CVUA 5EO9B 4LCWD 5IB1B 3OG6B 4UILH 1G84A 4XCNB 2BMKA 2X4RB 1NGYB 2F5AL 1BZ9B 4HBCL 1VKXA 1RD6A 5I74B 1FV1A 1RURH 4XB8A 4Z7QF 2WV3A 3QT2A 4XPHL 5HYJE 4J3VA 2JE8A 4PJXE 4TULL 2X09A 4M1DH 4NPYB 3MREB 3EUUA 1UM5L 1MRFL 1XGUB 3N06B 1Q0XL 5BRZD 2YZ1A 3TFKC 1AXTL 1B0GB 3NCJL 3ARZA 5IB2B 2P24A 1BX2A 5HDBE 5E8DL 4N0UE 1S5IH 2X40A 4LLMB 2ICEA 1OAZL 2GSGB 4NRXB 5EULV 1I4FA 3ARQA 2F8VA 4LSTH 4MCZB 1MFAL 1P4BH 3S98A 4W4OC 4MMXC 3OB0H 4I5BB 4NNXA 5DHYA 3WDHA 1ZTXL 4KKAD 4UDUB 2RCSL 4XXCC 4DCQA 1LEKB 5C2BH 2PTUA 2ZOKA 4P3WA 2BJMH 1EFXA 3J7HA 3SGJC 2MPAL 5D7IA 1CBVL 3KPSA 2VOTA 4ZAKC 2C4FU 2OTUB 4JFHE 4CMMA 3V5HB 1VCAA 4Y5VB 5E95B 3QPQC 3E6HA 5GZNC 4P99A 1GC1C 1QSFB 3EJZD 2FECL 5EUOA 5C0BB 1N6QH 1A3LL 4G43B 4Y1AE 3T0VA 1PG7X 1UACL 4JZJC 1ZHLA 1FZJB 2DQTL 1GGIL 4XZUB 3CFBA 3ECBB 4FQJH 2A83A 3OKKB 2P8MA 4BQBA 2DTML 5EBWA 1RUQH 3IXTB 3GSNA 1UCTA 1A02N 1FL6B 1PEWA 3H0TA 4QRPD 5C8JB 1KFAH 1RUKH 4MNQD 4JCLA 3MLSL 2ZSVB 4N8CH 1NEZG 3MFFB 1AGEA 4NO5A 1PZ5B 2ARJQ 4NJ9H 1VA9A 3KJ4B 3O6ML 3MJ7A 2XI9A 2AJZA 5JA8B 1IC7H 3GM0A 3SDDD 3DO3A 5DSCB 3WLWD 3S4SG 2FLRT 2CLRA 3QZWB 5EPMB 4XCYA 4L8SA 2BVYA 1A6ZA 2OR9H 4G6KL 1RAMA 5EZJA 4DZBA 1K2DB 1JZ3A 4L29A 3PDOB 4TNVK 4OTXL 4H1LB 2CK0H 1RIHH 5HDQH 4PY8I 1N59A 3IU4L 5FYKH 4JQIL 3DI3B 2CKBH 2VZVA 5DJ8B 4P2OD 4HIXH 4PJBF 4HWZA 5FECB 1MFCH 4XCCH 4QHLB 2VABA 2HT4D 4HIIB 3G5YA 5IIEA 4JLRA 3KPPA 3LKRB 3TBTA 4GRLD 4MAUH 3RVUD 5HVFB 3RGVA 4KDTC 3BAEH 1N0XH 5FO7B 5F6HI 1K85A 1C08B 4WEBH 4AIZA 3D69A 3KPQB 2X05A 3O3AB 1YYLL 3KS0H 4E41A 1QG3A 3H42L 4WI7A 1RZFL 1UB5B 1DUYB 4I3SH 5MENE 4JKPL 1F4YL 3DUHA 3T2NH 3VFRB 3MRHA 2ZPKH 5IVXB 4ZQKA 5EH1A 4PLNC 1I9JL 3CIQA 4YHKL 1IAII 4FTVE 1OWWA 5HI5C 4K23L 5JZ7D 5FYLH 3WXVH 4P5KB 3QULB 5LKNA 2HT2C 5JUEL 4Q9CA 4RISH 4XAWH 4F57L 4PB9L 3VGAC 5CEZL 1T5XA 2DQFA 3BEVA 2WWMC 3PHOB 2OL3L 3QXAA 4GKSA 5EBMB 2ADGA 3QDJD 5DF0A 1UWXK 1T6WA 4WW1A 3AU1B 5J8OA 4H8WH 2J8HA 5D71L 1FJ1A 3JV4A 1CFNB 1LHZA 1IM9A 2JELL 1P5VA 1QTYT 4YDLC 1FDLL 4J3TA 1UM4L 5CIPB 1RJYA 5EU6D 3MQIA 5T5FL 5HYJB 4TVPH 4NO0B 1AI1H 2X89A 3OKEB 4YLQT 4XNMA 2FEEI 3FCTB 3L3JA 5CINL 4XBEH 5HHNB 3DVIA 2VLME 1HN1A 1M6OB 4MVBD 1H5BC 2YPLD 4DZ8B 3ROLB 5ALCL 3GZKA 1AXIB 5JXAH 5IFJA 4XNZC 1AGCA 5HGHB 1FH5H 3T0WA 2MCPL 1T0NB 4K3EH 5HHVH 5E8NA 4LHUB 5MHSD 4YHZL 3LDBB 4I48B 3PGCB 3WFEL 1KIRB 1TETH 3VW3L 4LKCB 3T0DA 3LSOA 4F37F 3QXDB 5E2JA 3BMVA 1U9KA 3Q1SH 3BGFB 2R2EA 5T1KB 3KAAA 2X42A 1FZKB 5HI4D 4WFFD 5D1QA 1T5WA 4PJHA 1MHHA 1LO5A 2EH7H 5DD1H 2XWJB 3EYOA 3KLDA 3LOWA 4UINL 5GISL 1LE5A 2VZ1A 1MREL 4OIIL 2Y23A 1SJVA 1KEGH 4GG8B 1QZ1A 1IL1B 1ZE3C 3AREB 3MCKA 2IC2A 2QL1A 4ODXA 3W2DL 3MXVL 5IBTL 3ROOA 5CS7A 1QACA 4HXBH 5GRZA 1U6AH 1OHQA 3SDAD 4L5FH 4JEGB 5KTEH 4Y1AB 4OSUH 3HE7B 4F7EB 3E3QE 3OJ2C 5DD3H 1MCSA 4KAQL 3ZE2E 4ZPVB 4FZ8H 1MHEB 1MFBH 3TWCH 1H15B 1RSFA 1LO0H 4IOFC 2DQGL 1KCLA 4K3HA 5DJXB 2EDKA 5IK3B 4L9LA 2L7JA 3RPIB 2R0WH 4PJ9D 2BVOB 5I8CA 2IPUG 4JO3L 2QJDA 5E0QA 3D2UB 1YDPA 2OTWB 4G6AD 2NW3A 5K9KB 2NX5D 1P7KB 4Q9RH 1ZLVK 4HK0A 2FH8A 2OI9B 3MJGX 4GW4B 4ZUUB 4XH2B 2DQJL 2VDML 1A1OA 5TDNB 4S1DD 3MC0A 5FKPA 2APBA 4XTRC 1D5BA 3U2SB 3MR9A 1RPQA 5DA0B 3C9NB 5JW4M 2VLJA 3WHXB 3O3DA 1A7QL 1U93B 5IFHL 3L3GA 2BDNH 2YS4A 1ONQB 32C2B 1GGBL 3FL7A 1HHGA 4JM2F 1QBLH 4NWUH 5ADPL 2OP4H 3BJLA 5IF0A 4ONFL 2JKXA 3C5SA 2HFFA 1C5BH 3QQ4A 5K33A 4JFOA 3I85A 1EBAA 5DJZB 1OAYL 5GS2D 4DW2H 3QISA 4TUJB 3BH9B 3MV8E 2F53D 1OTUC 5HYQA 5B8CB 2HJFB 5E8EB 1NKOA 3RKDD 5KW9H 1KF9B 3KHOA 3TZVD 4PJ8D 4NDMA 2MHAA 3OTTA 1SEQH 3RZCA 4WJ5B 4KKBC 5E2VL 4G8EA 5IT2H 1NFIB 3WJLA 1NC2D 2FBJL 4Y2DB 3B2UC 4IMLA 4K3DL 4NQCD 1C7SA 4JAMB 2ZNXA 2ZUUA 3TA3A 1MJ8L 4FQXB 2X70A 4KZDL 1CDHA 3VGHA 4LK4A 5C9JB 5JIIA 5GJSL 3CFJB 1FBIL 4IOIA 1A4KB 2D31A 2ZSWB 4G8GA 3IAQA 3MRDA 3X3GL 3ZKQD 1UKQA 1U8OA 3PWLB 3A6BH 1U3YA 5D7LA 5FYKE 1NFKA 2FX7H 2DQCL 4KXZH 4HS8H 5HPMB 1WZ1H 2P5ED 1S9YA 1QBMH 1FN4A 4HKZA 2XZCL 3KLAB 5E5MB 1JBJA 1ODAA 1G6RB 3DGGA 2AEQL 2LAGB 2NY3D 5CZVH 3F7YA 1KELL 4WFGD 2V2TB 1NEUA 4PJCF 1J5OH 3QDMA 4JRYD 1RULH 4I9WE 1U95B 3WLBB 2DDQH 3CZJA 4HKBB 1DSFL 4WUKH 5EU7C 5T1MA 3EJJX 4YEFA 5SWSE 1FC2D 5HGAA 2QADB 4KVNL 4F80A 1C1EH 3HG1E 4LF3A 2YC1A 5TDPB 3TESA 2PN5A 2HRPH 4JO1L 3GSQB 1YN6A 3DHJA 2XN9D 3CLFL 4UT6H 3TVMD 2O5XL 3BIBX 2F54B 1J1XH 4TSCH 5FYLE 4PJDE 4POZD 4M1GL 5A16B 1KCSH 5D9SA 3UTPE 2IPKA 1LWRA 3MZTA 4OB5H 4PFEA 5MP6H 4YHOL 1YUHA 5DFVD 3OKDA 5EWIL 3AS3A 4KKLC 4Z7UF 5FUZH 4CRPA 2EYTA 2X4QA 2AP2A 3LQAH 4Y16A 5JHLL 4Z77A 3ARFC 1KTRL 4MX7A 4P46D 3MLXH 2EDBA 1LILA 3M07A 3O3EA 3MV9E 4R7NB 5C7XH 4W4NA 5JR1H 1DANU 2QV2A 1J12A 2BSTA 4X99A 1TZGH 3WIHH 3NPSB 4L4TB 2VR9A 1GH7A 3JVGC 5EZLB 2VH5L 4PLJC 3O2WH 4DTGH 5ESVB 3RBGA 2RFXB 4AIOA 4JQVC 1ZEAH 5I18H 3MLYL 1INDL 1A8JH 4QRTA 4TVPE 4YIQA 1R3LB 2DQUH 3QPXH 4ZTPL 2V9RA 5H2BA 4N5ED 5C0GA 4QCIA 3CVHB 4JE4B 3C60D 5T3XH 4JJ5B 4YDKL 4GMTH 3T77A 3EBAA 4O2CA 1XGPA 1I8MA 5J9PA 2D7QA 4Y5YB 4HKXA 2XKNB 3LN5A 1BZ7B 3VWKC 3QBTB 1BIIA 2H32H 1IAKA 4Z7WF 2OZ4H 3PQYE 5D6CB 1PG7L 4JN2B 1LP9B 1NL0L 1T22A 1T3FA 3PP4H 3O2VH 4BSVA 4QF1A 3SDCB 3QQ3A 1L7IL 4JY4B 1K8IA 3WN5A 3BZ4A 3DPBA 4G8IB 1ADQH 1QA9A 4ZTOH 1FCGA 4R6UA 1U92A 4EJ1C 5JOPE 1CCZA 1KCUH 5DTFB 4XVUD 1V7MH 3QEUB 5L2JB 5TJWK 4MXQD 4U1HB 2NY1D 5MERB 4ZSOE 2BNUB 2H9GB 2PXYB 4RAUB 1R24A 4NP4H 1AD0A 2DQDH 3ZKND 2VJXA 1DBAH 3LKQA 1KB5H 4TUKH 3TJEH 4ZODA 3N9GH 3SKMA 2XWBB 1YPZE 1YY8B 1MJUL 4FQCH 4OCLC 4N1CA 1N3NA 4M93B 1NLDL 4JREB 4TSBH 5FB8A 1P7HL 5DEZA 5MI0C 2JJTC 3GMOB 4FQPA 3FHAA 5C08A 3X3FH 3EYFB 4D2NA 3HR5A 5FF6A 1H8NA 4NJAH 4P2RB 3HE6D 3JTTA 1ZOXA 4JFXA 1HHHA 2NY7L 4F7MB 5IW3A 1FFPB 2LE9A 4IDJL 3BD4A 1Z9MA 1OAQH 2VNCA 1REIA 3BZFA 1GPOH 2AJYL 4DKEL 3MV8B 1T83C 1RZ7H 3OKYA 5GHWH 1FPTH 4KI5F 3L5WB 5LG1A 4RGOL 1EEUA 3L7EB 1EO8H 3W0WB 2CUMA 3MXWL 5BV7L 2GAZB 3OB8A 5IHLB 3DV6B 3VGEA 3P0YH 1CYGA 4XI5D 3RJQB 4X6CA 4PRPB 2Z8VC 4JQXA 4XC1L 5EZIH 4MA3A 2R1YB 1BPVA 1QQDA 1WZMA 3A6CH 1EV2E 1OM3L 4K71B 1MLBA 3ZL4H 3JTSA 4HS6B 4LSPH 2H6PB 2GUOA 3KPMB 3UYOD 5ENWA 4Q9QH 1OARL 4WI8A 1QRND 3GHEH 4LCCC 4XXDB 2HLAB 5CBEB 5C0RH 4RMRA 4LLVA 2P8PB 1U42A 2CRZA 3A67H 1WCQA 3CSBA 4NKOA 2E9IA 3GK8H 1LO2L 1VFBB 1KSRA 3LCYA 1EO7A 4PJIE 1LE9B 1CFTB 5E2TH 4LL9A 4S1RL 4P4KB 2C4FT 3MCLL 3ESVF 3TN0C 1DVFC 5DVKA 5DMYA 1L6ZA 2HJKB 3PWNB 4U6XA 4S0TD 2FGZA 4NN6C 4NN7C 4N8VG 2CRIA 3H9ZA 4Y2OA 1SYVA 3SO5A 3BW9B 5SWSB 1LNUA 2WINB 2H2PD 5CJ8A 5LGHH 1P7QD 2Q6WB 3BMWA 1HHJA 1N6UA 5INDA 2J8UE 1S9XA 5F3BB 4L3EA 4EN3C 1TZIB 2D7NA 3BGAA 4YDIH 4B50A 4I1NB 4IRSA 4DKAA 4U3XA 2OJEA 4FQIL 5LBSL 2W60A 3C6LD 4A6YB 2AGJL 3BKML 1FFRA 3V0VA 5FEBA 3FJTA 2DJSA 2CLVB 4LNVA 3TYFB 1N8ZB 3V5DA 5I1HL 1JHTB 3QQ9C 5F1SA 3HZMA 2Y5TB 1JI1A 2BFVL 3CH1A 5E4EB 4MB3A 4QHKI 4J3SA 1RHHA 4R90L 2AJ3B 3LN4B 5L8KB 3MA9L 1N26A 4J4PD 1T03L 3O8XA 1HOCA 4YXHL 1AE6L 1J0ZA 2A6IB 2XPGB 3DETD 3IFNL 4PRBB 4OBSA 1IKFH 1AHWB 3HZVA 4PJDF 2GY7B 1NMAL 2EKSB 3U46A 1GIGL 4XP9H 4G6JL 5C92A 5CJXA 1H9VA 1EZVY 3NCBB 2PCPB 3GB7A 4HC1H 4WU7A 1F4WH 5C0ND 3ZKXC 5BS0B 3PQYB 3EHBC 3QUXC 5K9QG 2RAMA 1F3JA 2X4SB 3RNQA 4HAFA 3FZUD 3P30L 4RFEB 5E6YA 1B4RA 1UXWB 1Q9WB 5JW4R 4E5XA 5EC2A 1BAFL 4HFUH 3G6JF 5J6HA 2FX9H 4YH6A 2DQHH 3ZTNH 1PSKL 1T89C 1OD9A 4JGUA 3BDYL 4LFHD 1ZA6B 4LLUA 2BNRE 1T2QH 2UWEA 2H26A 2LU7A 3GMRB 5KVGL 3KYAA 5CWSB 1YPZB 2ITCA 5LGJA 2NNAA 1VFAB 4WI5A 5T3XE 3VXQB 1NANI 2ATKA 5DD0L 2IANA 1BOGB 4FQHB 2FO1A 1DR9A 1ZS8A 4BKLB 4X6EB 4TQEH 3S3PA 5FA4A 3AXLB 4Z95L 6FABH 2MCG1 1UZ6F 1TITA 4F9PA 2G2RB 4JHWH 4UU9B 1MSPA 4OLZH 3T3PF 1MCWW 3SGKC 5KN5A 3VI4E 4MJ6A 2Q8AH 1YNTB 5KSUA 5TGBA 3Q6FA 3NTCH 4KROC 1HHKB 5FHAL 1JZ4A 4I3RH 3VXSB 4ZUSA 1EO5A 1EMTH 5A40E 1KIQB 3QI9C 5L2KE 1F58H 4HGKC 3U0PB 3UZEA 2XA3A 2UZIH 4GXUN 4NFCA 4F3FB 4JFFA 1SQ2N 1NCDL 4XNQB 3V6OE 1K4CA 2DB8A 3MRRB 2YMXL 4GG6B 1D6VH 2RHEA 1N4XL 5IHBA 5ERWA 3PABB 5H94B 3HMXH 1ITBB 2H2SD 4Q2ZA 4CN6A 3ULVC 4QXGL 1FYTE 4LGPB 1CLYL 1ETZB 2FR4A 4OZGA 4FXGA 2K3TA 3V95A 5IVOA 3SHSA 2NYYC 3TBSA 2UVEA 1Z9OA 2YK1L 2A9MH 1KOAA 2X7LA 1SM3H 1UB6A 1MCLA 3TT1H 1T04B 5CD3B 1JPFB 4PJIB 4UV4H 4WV1A 1JV5A 3WFDH 1XFPA 3WKNA 1MIMH 1QPPA 2FGWL 5DDHA 1DP0A 3QNZB 5AG9A 3RTQC 3RU8L 4XPFL 4JR9H 5GS0C 4YHLH 1T1ZB 2NY5L 2GJZB 3G6AA 4AMKL 3LB6C 2VMFA 3H9SB 4ORGA 5E8PB 1KJ2L 1YMMA 3LD8B 1NEZB 3ZDXF 4J2XA 3IDJB 1GC1H 2DS4A 2Q7YB 3SQBA 1G7LB 4OZHB 4XNYH 3H7BB 2ATPB 5GIRB 4U1MB 1TQBC 1IE5A 2CIKB 4NSKA 2C3VB 2J8UB 2GTZB 4OD1L 5F97E 3S4SB 5JDJA 1VFMA 4K9EH 4X4ZA 2YPVH 4OKVA 4WVRA 2A6KA 1INEL 4N90D 4QO1A 1YEFH 3AM8C 4NHUA 3SDXA 3FFDB 1Y0LA 1TJHH 4DK3A 1T66C 4QRSB 2NZ9C 4G7YH 2DLFL 3Q5YA 4XRCA 1UT9A 1LVEA 4ALAL 1MNUL 4G6FD 2AKRB 4H0GA 5IMOA 2BOCA 4UIKH 3J8F7 5FV1L 5BRZA 2PTVA 4UAOB 4HMEA 3MLTB 1I8LA 4ZO8A 5IKCA 1A9EB 3TV3L 4OD2A 5FGCE 1N64H 3KPSE 3FB5A 4KJQC 5TFSH 3HPLA 2WMPA 2WBJD 4GRWH 1ZHNA 2AK1L 1RJZA 3G6DL 1XF4A 1FIGL 1UJ3A 1X7QB 4EI6B 1FLRL 4X7DC 4LOUC 1BGXH 2A1WL 3MJ8A 5EUOE 3UXFA 1GL4B 3NCFB 4P9HL 5DRZB 2Y9RT 4Y4KC 1DDHA 4HCRL 4NKQB 4JFEB 5JIPA 5IMLA 5FK9A 5DEGB 5F21B 2DLGA 2VZSA 2WAHA 1L0QA 4OLXL 2LU4A 1DL7H 3X11B 5TQ2L 1S7RA 1XIWA 3DX9B 3I6GA 4YHML 1CDUA 2IAMC 5KVFL 1ZWIA 4EI5A 3QHZL 4PRIB 1U8PB 3WFBH 3QH3B 5K93A 4KGLA 3BP7A 1JUFB 3MV7E 1I7RB 3DTXB 2PYFA 3PDDA 2EDYA 5IM7B 3E6FB 3R0NA 4WNQA 4X5XA 5C0BD 5BJTA 3B83A 2VZ3A 1NGWA 1QSVA 1J87A 1W0WA 1BLNB 1NFDB 1NSNH 4GW5B 4R2GB 4BH8A 4U1NA 4R4BA 4MQXC 3O3BB 3U9PL 4QGYA 4HUKB 5GJTH 4PJFE 1B6UA 5DRWA 1T1XA 2K7PA 4JZOA 1G7IA 5DD5H 1I9IH 1BFOA 5GGVH 1NC4B 4CBPA 4ZMAT 3KNBA 1AD9B 1I7UB 3I02A 2N7AA 1LMKA 4X6FA 1HQRA 3T0XA 4JKWA 1RVFH 1SY6L 4R97C 2FB4L 4M8VA 3SDDA 4XGZA 2B1HH 4JGMA 1CE6B 3U6RB 4E9LA 1XF2B 4BZ1L 3GMMB 3QP3A 4XHQA 3HI6L 2YD6A 3MUY1 3GGWB 4C56E 1IQDA 1I9RH 1U3HB 4KGJA 1F4XH 5C86A 1KCVL 3BKJL 3LV3A 4YGVA 4LRNL 4IIQB 4P2OA 2WK2A 3CDGB 2PYED 1Q0YL 1ZT7B 5CZXD 3CMOL 4ZO6A 1U8MB 4Q7DA 4NQEA 5CUSL 1FZOB 3A6OA 4F7CB 1A1MB 4EOWL 4YHNB 1I7TB 4DGYL 5DQJB 1AC0A 3V8CA 5KVDH 2NLJB 2SEBB 4WO4B 5D8JL 1DANT 4IMKA 4MDIA 5FYJH 1P53A 1A7OL 4KJPC 1IEBA 1GCFA 1R5IA 4NBZB 4I4WA 4ODVL 3AS0A 5EBGA 2VDOH 5E99L 1S7VA 3U0TA 2BMKB 1FGVL 2APTA 4QNPE 1VKXB 4I0CC 4CW1A 1FV1B 4WFED 1G7PA 3MLVL 1OB1A 4NQDD 3UJIL 1MIEH 2YD7A 4C4KO 1QLEL 1BD2D 4GAGH 1UCBL 3QEGL 3DSFH 5E8OA 2VTFA 1BBJA 4NC2B 1T80A 3DX8B 4U4BA 1F4HA 5E08L 3O0RL 3TBVA 4OGXH 4FFZL 5KSVA 4JPVH 5I1AB 2IPUK 1F13A 3BPNB 2P24B 5TF1L 1BX2B 1IAIL 3L3KA 9CGTA 2VZOA 3IAGC 2ICEB 1VSCA 4DAGH 1I4FB 2P49B 3QUZA 4M6OH 5HYJD 4NO0D 3ZE0E 3S9DB 1N7MH 5AWNH 4NNXB 1A6WH 4YX2H 3O4OB 5DHYB 2ZCLH 3K7UA 5IMMA 2EEBA 5CGYD 4NM4H 3H8NA 1SHMA 1CXEA 3OL2A 1JGVH 35C8L 4HZLA 4DCQB 2QQLL 2R8SL 1V5JA 1A3RL 2ZOKB 5D7JD 1EFXB 5FGCB 4P49A 5D7IB 3KPSB 2CRMA 4LHUD 5F7KC 1Q8MA 4H26A 1OT2A 1A9BA 3Q6GL 3E6HB 3RWDA 4I18A 1R5WA 4X83A 3BGMA 4RMSA 5EUOB 1R3IL 4RBPK 5F1OB 1NGXA 1MRFH 2FEEL 4PJEA 4RMQA 1FNLA 5T1KD 1Q0XH 5IR1A 1NCTA 1WCBA 5I71C 4ZO9A 1WISA 3P4NA 1ZHLB 1CGSH 5CJQH 2B5IB 3GRWL 3CFBB 2A83B 2P8MB 4JFHD 5EBWB 3PWVA 3VRJA 1TTUA 3ARED 3GSNB 3OKLA 3H0TB 3CLEH 3NMEA 5HYSB 1MJJA 1MFEH 3DVGA 1AO7A 3SDAA 3TO4A 3UPCA 4NO5B 2DM2A 1ZTXH 4O51A 4Y1AD 4Q0XH 2AI0H 3MJ7B 1PLGL 1U8LA 5T1LD 3HZKA 4KI1A 1FNEA 2CLRB 3X12A 4HT1L 5BXFA 2NY5C 3QXTA 1V7NL 1JRHH 4PJFB 4XCYB 4AK1A 3P9LB 4MXWH 4PJ9A 4L8SB 1UZ8A 2MPAH 3EYVA 2X1PA 3B9EA 4KXZI 1A6ZB 4KUZL 1RZGA 4QHUA 2H3NA 4B7LA 5EZJB 5KJRL 5LCVH 3B9VA 4DZBB 4L29B 3RWCA 1EXUA 1N59B 3NIGE 5L0QC 1XF3A 2NX5A 4QRRE 1DQDL 4HFWA 5JW4Q 1A3LH 1I3RA 4HWZB 4YZFE 1CGYA 1KLFA 1MAML 3OSKA 4Z76A 2VABB 4ZS6D 3G5YB 5IIEB 4JLRB 3LZFL 4NHCH 3KPPB 1NAML 1TVHB 3TBTB 2DQTH 4U31A 1GGIH 1FYHB 4NNYA 3RGVB 4OCRH 2DTMH 4AIZB 3D69B 2OK0L 3MLRH 4E41B 1MCPL 2HFEA 4AG4H 4DKDC 3MLSH 4NGHH 3VXOA 4G6ML 3MRHB 3RIFK 1P69B 4ZQKB 3WS3A 3BQUA 2D3VA 3QIUD 4JPKH 4QWWC 3IB4A 5LWYH 1MCWM 1J10A 3LPFA 5L88L 1EHLH 3TZVA 1A6VL 2P8LA 5J1AA 4PJ8A 5F6IB 4EDXA 1PY4A 5DMKA 5D7SL 4ZOCA 5JO5A 2VWEC 4LSQL 5E6ZA 1DQJA 3ULUE 1T5XB 1NC2A 1BQUA 5EBLA 2DQFB 4HK3J 1UVQA 4P9HC 4U1GC 4Y2DD 4IS6A 3QXAB 4GKSB 4NQCA 4LGRB 2ADGB 5I1JH 2VDQH 1NAKH 4TNVF 2CXKA 4NN5C 3U7YH 5F72S 4UV7H 3ME0A 2XZAH 1FJ1B 3JV4B 3QDME 2ZWLT 1IM9B 1LEGB 3UTZA 3R06A 1RJYB 2W59A 3QNXA 3OAUL 4LMQE 4ACPA 4P2QA 4XNMB 4Y4FA 2UZXB 1RZFH 1MQ8A 3L3JB 5TE7L 3HRZA 1EGJH 2R4SL 2HFTA 3BPOB 1I9JH 1G9ML 4QTHA 1XR8A 4YHPA 3K46A 3L3OA 4XBGA 3IU3A 3VG9B 5FFLA 4HUVA 4TSAH 5IFJB 1OTTC 1AGCB 4MJ5A 3WFZA 3GKWH 5D1XC 2LU3A 2CR6A 4PGJA 5GGTH 2FH6A 4ZFGH 4C54A 5FYJE 5MEPA 2JJSC 1IGYA 4PB9H 5CEZH 3GMNA 4G7VL 4QNPF 3LSOB 2GK2A 3CPLA 3RAJL 5KSBA 4DQOL 1CLOH 3TVMA 5L9DL 2OL3H 1J05A 2VLMD 5IVXF 2R2EB 4U6HA 3RJDA 4NUGL 4TRPL 4X8JA 5I76A 5D71H 5D1QB 1T5WB 4PJHB 1MHHB 4RAHA 1PKQA 1LO5B 1S7UA 5I75B 5EOQH 3EYOB 4LSRL 1ZANL 1LE5B 4YUEL 1NPUA 1PY9A 4X7SL 1L9NA 3S34H 3MCKB 1QRKA 4ODXB 1JGDA 3MBED 4HD9A 3ROOB 3IJSA 2Q3AA 3P77A 3UPAA 2I60L 5F7LB 1K4DA 3FB7A 3K81A 4KRPB 4RDQF 4L9LB 4YC2B 5C0JA 5CHNA 5I8CB 1GOFA 4JDTH 4LIQL 4FZEL 1QBBA 3IJYA 4X98A 1YDPB 4GMSL 3OAYK 3TJHC 3LEXA 2NW3B 5GRUL 2HMIC 4RGNC 4DKFH 5AYUH 1KXVC 3FQWA 2AEIT 1BWWA 1WZKA 1A1OB 3BZEA 4M43L 5FKPB 1D5BB 3MR9B 3PXJA 1J8HA 3QQNA 3O3DB 1WITA 3L3GB 4XCEA 2ZP0T 4N8VB 3QFJE 1HHGB 1RI8A 3PL6A 3VGFA 3PWPA 4OIIH 5IF0B 2AJXL 4MA7L 2NY0B 2EECA 5FGBC 5CJOL 2PO6C 3C5SB 2HFFB 3QQ4B 1J88A 1E4WL 2Z31A 4JFOB 3O3UN 4ZPTA 5I8KL 1BHGA 3SE4C 4KAQH 3UBXA 5HYQB 4AEFA 1R3HB 3RHWK 2DQGH 3VD3A 4GKNA 2GQHA 5HI3C 4OGAC 4NDMB 2MHAB 4MXVE 5FCUH 3RZCB 2P5WE 1YEIH 4G8EB 1QSEA 3P0GB 1Z2KA 1DBJL 4GRWF 4OCWL 1KENL 3HE6A 4X6CE 5DMIL 3ULSA 4CUCA 4IMLB 1PEZA 4FABL 1QFWH 1F90L 3RUGF 1S7XA 3TA3B 3FMGH 4XP6H 5I6XB 1MCHA 2X70B 2C1OA 3MV8D 2AXFA 4KKCC 2IFFL 1A14H 1TVBA 2DWDA 2EDRA 4KRLB 4FFYH 5C09E 3EYQD 1UJTA 4IOIB 2D31B 5IFHH 4G8GB 3MRDB 2VE6A 1HDMA 4PRAA 2FATH 2WUBL 2YD9A 3MPCA 3GI8L 1U8OB 2V5TA 5D7LB 2IJ0C 3IDYC 1RV6X 4ONFH 2W07A 1S9YB 2EEDA 2FSEA 3KYNA 4HCRA 4NQSA 4X4MA 5DK3A 4HAGA 4LVNC 3MRCA 4HKZB 4LDOB 4K8RD 4XMPL 4NFDA 2O93L 3DGGB 4RGMB 2AEWA 4LCIL 3V9FA 3FRPA 3F7YB 3QDMB 1JGLL 4MJIE 1I3VA 2QQKL 1QRNA 1D9KA 1G7HA 2GHWB 3V4VL 5T1MB 5EU7E 4P57A 1OGAA 5HGAB 1G9EA 5FYKD 4LF3B 2YC1B 1AR1C 1SJHA 2FBJH 3BKYH 1YN6B 3TIEA 1BVKA 2ITDA 4YXLH 5TQ0L 2E9BA 3TYGH 4WIQA 5IBLC 4HW6A 4P4KD 2JCCA 3RI5F 5CEYA 1FFNB 2BHYA 3WXWH 4IM8A 4W81A 4I9WD 5D9SB 3IETB 1FBIH 4PRHE 3D25A 3OKDB 4X5WA 3X3GH 1QHPA 4HLZG 5SWSD 2X41A 2EYTB 2X4QB 4Y16B 4X80L 4Z77B 4MX7B 4PG9A 2DQCH 3O3EB 1DQQA 2WP3T 1P7QA 1RJLA 2F58H 2BSTB 5AZ2L 3RDTD 4X99B 5DD6B 4K7PL 2PR4L 2AQ3A 2QHLA 4D0DA 3U30C 3UZVB 1KELH 1TJIL 3UTPD 2NMSA 4QRTB 4YIQB 2HTKD 4HJ0D 4D94A 4F9LA 1HINH 5H2BB 3C6LA 2H45A 4QCIB 5C0GB 1GZQA 5I1GH 3S37L 1F6FB 1J18A 1IKNC 3T77B 4RQQA 4O2CB 1XGPB 1UXSB 5KZCB 1I8MB 5J9PB 4ZFFA 4HKXB 3LN5B 1IAKB 5DLML 2O5XH 5ESQA 2CJUL 3KJ6L 2DM3A 4GFTB 5ICXA 1T22B 5E2WL 1CFVH 1T3FB 5D2NA 2BVQA 4J4PA 4OLUH 2FHBA 1NQBA 4BSVB 2HKFH 4QF1B 3LIZL 1YEEL 4OCYH 2EDOA 1UM6L 3QQ3B 1MEXL 1K8IB 3DJ9A 4TVPD 3WN5B 2J88H 1QD0A 5CEZE 1U92B 4MD5B 5HHOE 1DFBH 3NCCB 5E03A 3FHQA 1NBVL 3FQXA 3Q5TA 1R24B 3HRPA 1AD0B 1HXMA 3LKQB 3PQYD 4WEMB 1S3KH 5ACZA 4U7SA 3SKMB 2QQNH 2CD0A 3H7LA 3OKOA 3KLHC 3ULVH 1YMHA 1N3NB 1GJIA 4ENED 1WQVT 3MLYH 1INDH 1O7VA 5FB8B 3QWOA 2EO1A 5HSFA 1DCLA 4H20L 5JOPD 5C08B 5L6YH 3ZLQC 4AT6A 3HR5B 5FF6B 4Q6IA 4HWBL 3HC3L 1JF5A 3JTTB 4JHAH 5T3ZL 3IDMA 3UTTA 1HHHB 1KIUA 3SOBL 4G5ZH 2XTJC 5A2LH 3BZFB 1NCBH 1PG7H 3ARDC 3WKML 1NGPL 4PJ7A 5IQ7H 3B5HA 1ZKAA 4D3CL 4QEGA 1KEML 3VXPA 3QB7C 5GS0H 2IH1A 4YWGH 1T7ZA 2YOCA 5GQBA 1WT5C 2J8OA 3IKKA 4YDJA 3DYOA 2ERJB 4LVHC 1OSPH 1KC5H 4Q58C 4X6CB 1GHFL 4MA3B 1F8TH 5GRYA 1QQDB 3BT2H 4KK6D 1LP9F 3JTSB 2GUOB 3SY0A 5ESAA 4J1UA 4H88L 5ENWB 5IVZA 4YPGA 4LSUL 4M3KB 1CDIA 3OGCA 3SBWA 3SO3C 1FORH 4D0CA 4LLVB 3LPWA 5KSAA 1YECL 3KDMA 3O41A 5I1DA 4NKOB 1BOYA 2F5BH 3GBML 4X4XB 4LEOA 4MXVF 3QO0A 1NLBH 2UUDK 3O6FA 2DYPA 4W6XB 1RURL 4DKEH 5HY9A 2ADFH 2LTQB 3MZGB 4MJIB 4U6XB 1MELA 2V5RA 2CUHA 4XVSH 4YK4C 5KS9F 4EUPH 3LKPA 1YMME 1SYVB 4RGOH 1OP5K 4NZUL 1LNUB 1UGNA 3HN3A 4G9FA 4CMHC 4HZAA 4R0LC 3OKMB 1NH6A 4BUHA 4FXKA 1S8DA 4XC1H 2AQ2A 1HHJB 5ANME 5INDB 1RY7B 1DUZA 2ZUQC 4EEEA 1S9XB 1PAMA 3AB0C 4L3EB 3UBXG 1S7TA 4LSTL 5D93B 3RWJA 4IRSB 1P4BL 2P7TA 4HPYL 2OJEB 3H9SD 5GRWA 5T5NF 2KBGA 3BEWA 1OW0C 2W60B 1MWAH 3V0VB 3V5DB 4IRJD 2NY6B 1B9ZA 3ARFB 5GXBB 3HZMB 5D5ME 4AEIH 5EO9A 1LO2H 1MVUA 3CH1B 5C2BL 3EJYD 1PD6A 2E6QA 4XCNA 3E2HB 1RHHB 3N1FC 1KN2H 3ARGD 3MFGB 2BXZA 1NAMA 3H3KA 4S1RH 3O8XB 3QUMA 1HOCB 1VDGA 2BRRL 4HIEA 3MCLH 2R9HD 3NFNA 5IJVA 1F3DH 2OXGA 1EEYA 3DXAA 3HZVB 2WW8A 1UFUA 3AMLA 3MREA 3U46B 1YZZA 1HH6A 3FKUS 1P5UA 2HN7A 4WU7B 3SE8H 5IB2A 1J1PH 4IJ3C 2VXUH 5SWQA 1F3JB 3RNQB 3MGTA 4FQJL 3FRPG 1HE7A 4LLMA 4HPOL 1WC7A 4LU5H 1RUQL 2WBJA 3OAZH 3WNLA 3MRPA 1KFAL 1RUKL 2WBWB 4E5XB 5J6HB 4PG2A 4H25A 3THMH 3LRSB 4NJ9L 1JPGA 3UTOA 4G8FA 4UDUA 4LLUB 4OI7A 2J12B 1DQLH 1IC7L 5GS1A 1F6LL 2UWEB 2H26B 3TP4A 1CK0L 4HJGA 3MA9H 4PRID 2OTUA 2ITCB 5LGJB 2NNAB 3V5HA 3ZDYE 2EIZA 1UKTA 3IFNH 2CK0L 2ATKB 3SE3A 5J13C 3VRIA 4ODTH 3RY6C 2O61A 1MCIA 1ZS8B 4HIXL 2IFGA 4G43A 2EDFA 4N8PA 1WSST 5GGRA 5FA4B 1MFCL 3HA0A 4R2GD 2BC4A 2BNRD 4WW2C 1X5GA 5BW7A 2DL9A 1FZJA 5ID0A 4MAUL 5KN5B 1N0XL 4MJ6B 4OJFL 3GSWA 3Q2CA 5KSUB 1DEDA 5T3XD