2YXEA

Crystal structure of l-isoaspartyl protein carboxyl methyltranferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
DLEEQKKAVIEKLIREGYIKSKRVIDALLKVPREEFLPEHLKEYAYVDTPLEIGYGQTISAIHMVGMMCELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKAERTLRKLGYDNVIVIVGDGTLGYEPLAPYDRIYTTAAGPKIPEPLIRQLKDGGKLLMPVGRYLQRLVLAEKRGDEIIIKDCGPVAFVPLVGKEGFQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L-isoaspartyl protein carboxyl methyltranferase
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Protein-L-isoaspartate O-methyltransferase
total genus 73
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2007-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yxeA00
1Z3CA 4ISCA 3FRIA 1WY7A 1JQEA 2AOUA 5HIMA 3T7RA 4LECA 5CVJA 3KQTA 5JR3A 2AN4A 1PJZA 1N7JA 3EGVA 2VDUE 3KPWA 3GO4A 4L7VA 2IP2A 2B9EA 3MCTA 3OU7A 4XCXA 4PCAA 1QANA 3L8DA 5LQAA 3GNLA 1N2XA 2PWPA 3PLAE 1P91A 2H1RA 4RTNA 3NJRA 4O29A 2ZFUA 3E23A 3Q87B 4GC5A 2G71A 4E33A 4YV2A 5LQRA 2I6GA 3LGAA 5GIOE 2NYUA 3MAGA 4OA5A 1INLA 5K01A 4RTJA 3D2LA 3SXJA 3HCCA 1YF3A 3HTXA 5K0NA 3A27A 4UOEA 3CC8A 5ICEA 5KVAA 3DULA 3TKYA 3MTIA 5DXJA 3FPFA 4AZSA 1ZGAA 3FRHA 3HCBA 5DRYA 3TOSA 3CJRA 4FR0A 3LDUA 8MHTA 5FTWA 2C7OA 2YXLA 1R74A 3HVJA 1SUSA 3I9FA 3LL7A 3REOA 4F86A 1O54A 5DM0A 1TW3A 2HMYB 5CUQA 3FPHA 4G56A 3LPMA 4WVLA 1P1CA 2F8LA 2OB1A 2PBFA 1R18A 2PXAA 3KHKA 3P9NA 5E8JA 3TRKA 5E2BA 1RI1A 4P7FA 2IFTA 1T43A 2PX5A 3M6WA 2GPYA 4NECA 4MQ4A 1ZKDA 2P7HA 3DLCA 4LWOA 5E9WA 4EKIA 3ER8A 2Y1WA 3M33A 3T7SA 4ER7A 1VP3A 2OB2A 4ZTBA 4GBED 1EIZA 3EVBA 3BXOA 2ZWAA 3AJDA 3IV6A 5LR6A 3NVMB 4CKCA 1DL5A 4RTPA 2XVAA 3AXSA 3M6XA 4HGZA 5B1SA 2OZVA 3KQVA 3NWBA 4RVFA 3X0DA 3EVZA 3SX0A 2AZTA 2EJUA 1WZNA 3DOUA 3GRUA 5EMJA 1BHJA 2DULA 5E1MA 1VL5A 3DMHA 3HP7A 3OE4A 3SSNA 7MHTA 5ERGB 5BXYA 3ELYA 4GF5A 5EIWA 2B78A 5K0JA 1KHHA 2G72A 3CBGA 4IV8A 2XYVA 5EGSA 2ZTHA 4OA8A 4PGGA 5DX8A 3R3HA 2G8NA 5DTRA 4R05A 3OCJA 3KQPA 1MHTA 2Y1XA 3HCDA 5EMKA 1TW2A 2GA9A 4KIGA 3UWPA 3G2OA 5HFJA 2ZULA 5C1IA 2JH8A 4P58A 2CMGA 2HR1A 2KW5A 1DCTA 3TKAA 2EJTA 3KPVA 1SKMA 1YFLA 4P7GA 5FHQA 3GXOA 3A25A 3DMFA 2ZBRA 2ZZKA 3EEYA 2OPBA 3M6UA 1KPHA 2YX1A 4RTRA 1L3BA 1FJXA 4GUAA 4QDKA 5CD1A 3G8BA 5K0BA 5KQRA 4U7TB 2O07A 2GLUA 2V7EA 5DLYA 5DM4A 1FP1D 4PNEA 5EHIA 4X41A 2CMHA 2NNWB 3F4KA 3GRZA 4BP1A 1SVUA 1ORHA 3KQQA 2BM9A 2NXNA 2PT9A 2I62A 3AXTA 3HA3A 3OZSA 4PINA 2OXTA 4RTSA 2XYQA 4PYJA 5E9QA 2ZVJA 1EQAA 1Y8CA 5K0FA 3I64A 4GEKA 2AS0A 5K09A 4OX9Y 3A7DA 1WS6A 3EVGA 4RWZA 4CKBA 4KDRA 2HNKA 4HC4A 3KQMA 5DX1A 5GM2A 2IBSA 4E2XA 4HRAA 2HTEA 2O05A 2PY6A 2ZBPA 1UWVA 3FTEA 4BLVA 3KR1A 3OFKA 5LQUA 4YUVA 2QM3A 1NE2A 4AX8A 3B7PA 3EVFA 2I7CA 4KIFA 3SR4A 2C7RA 3B5IA 3SSOA 4C4AA 1ZGJA 1QAMA 5EEGA 3EMBA 5E1OA 2AOTB 1EG2A 4AUKA 1FPQA 2YTZA 3FTFA 5FQNA 3HCEA 2YVLA 4QQKA 4DCGA 3UJCA 5DSTA 4CKEA 1XTPA 3ORHA 3FYCA 2DPMA 2CL5A 3PS9A 4CXMA 4BY9E 3PVCA 3EVAA 2PX4A 4GOND 3U81A 3PFGA 1P1BA 5ICFA 3EGEA 3EVDA 1KPGA 1O9GA 5DTQA 5EPEA 3R6TA 5GWXA 3TR6A 5HZMA 4E2YA 3MQ2A 1RI4A 2AVNA 1FBNA 1NW7A 1V39A 3THRA 4M38A 2IDJA 3IEIA 1G8SA 2XYRA 2ZIEA 3LDFA 5FA8A 5U4XA 2IBTA 3MTEA 3NDJA 3HVKA 2ZIGA 4PGHA 4POOA 1NW6A 2YQZA 5FUBA 2P40A 2BM8A 3BKXA 3A26A 3ELDA 3UJBA 2ESRA 4C05A 5EC8A 2IGTA 4QQNA 2AOTA 4HH4A 2AR0A 2FK8A 3G5TA 4PYLA 2QRVB 4ER3A 2UZ4A 3FUVA 1ZG3A 3LCCA 4E2WA 3HM2A 3P9CA 4X60A 4HG2A 5DT2A 4HSGA 5LQJA 2P7IA 2YR0A 3A7EA 1WXXA 5K0LA 3KQYA 3C6MA 5CCXA 2UYHA 2Z6QA 2ZIFA 4PWYA 2EG5A 1JR4A 2O06A 5MHTA 4MTLA 1VQ1A 3MCZA 5T64A 3SVZA 3EGIA 3DLIA 3RODA 5KYGA 3DXYA 3KPYA 4OBXA 5EZQA 3TMAA 1NKVA 3P2KA 1F38A 1NW8A 1XDSA 2PSSA 3BWCA 4PYIA 4CWAA 4DCMA 4E32A 3WSTA 2OO3A 3BUSA 3LDGA 3LKZA 5EHGA 5GP1A 3PX3A 3RW9A 5LQNA 4YUWA 2A14A 3PX2A 4Y2HA 4FGZA 2PVCA 2CWWA 2ZWVA 4OBWA 2B3TA 5T6BA 4YUYA 2FHPA 3TLJA 3HVIA 1NBIA 3LECA 2O57A 1DUSA 3VC2A 4FT2A 3DUWA 3SGLA 2CKDA 1BKYA 3B3JA 3GU3A 3I58A 3O31A 3JWJA 4FT4A 5FWDA 5G02A 3CGGA 5T67A 1NW3A 3HCAA 2ONYA 3FPJA 3GWZA 4RTOA 3QOXA 1F3LA 1ZQ9A 1Q0SA 5H02A 2FYTA 4OQEA 4Z2YA 3S68A 1N7IA 2LD4A 5EZSA 3AWIA 4YMGA 2AOUB 2FK7A 3BWBA 3G8AA 1QAQA 4PYQA 3NVKI 4DKJA 4PCLA 2AOWA 5DXAA 3JWGA 5GOZA 3EMDA 5K0GA 1WG8A 1IM8A 5FADA 4Y30A 3E7PA 5EIFA 2NP6A 3KQWA 4YV1A 3DP7A 1R00A 2NXJA 3SMQA 1VE3A 1RI3A 3UA4A 5IH3A 3FPEA 3HA5A 4QPPA 4RYLA 4RTKA 4GC9A 3G5LA 3B89A 2P3QA 2WA1A 1X1BA 2QE6A 5EEHA 1QAOA 5CM2Z 4ER6A 3DXXA 5IKMA 5LSAA 1WXWA 3UA3A 3G7UA 3MHTA 4F84A 1SQGA 2FRXA 3JWHA 3KQOA 1HNNA 4GOOD 4K6MA 2BR4A 2ORED 1IXKA 1H1DA 1OR8A 3DXZA 2BR3A 2JH9A 1NV9A 3TFWA 3P9KA 5HOQA 5E2AA 4GOLD 5EMLA 5P8WA 2Z6UA 1I1NA 2HWKA 3FZGA 3JWIA 2Z6AA 2FPOA 2ONZA 2WK1A 3C3YA 1RJDA 4DA4A 1YFJA 4YUZA 3ERCA 3BGVA 1UIRA 1KXZA 1XCJA 2BR5A 5CVEA 4X63A 5ICCA 4IWNA 4FS8A 3FYDA 2BZGA 2H11A 1PRYA 5CVDA 1IY9A 1XXLA 3FUUA 1BC5A 3DTNA 1KYWA 2PXXA 3GDHA 5EQJB 9MHTA 4GQBA 1SUIA 2PX2A 5CCBA 4EVIA 2P35A 2P3LA 3M4XA 3V8VA 1AQIA 2PT6A 3KR2A 1JG4A 2EFJA 3UJ6A 1QZZA 1VPTA 5HIIA 1AQJA 2QYOA 1HMYA 2JHPA 4FZVA 4XUDA 5DRTA 1JSXA 3KR9A 1RJGA 5DX0A 3UJ7A 3GCZA 4ER0A 2QRVA 4YMHA 4RTQA 2ZZMA 3BT7A 3K6RA 2NXEA 4HTFB 1VP9A 1JTFA 1KP9A 3ELWA 2PV0A 2GS9A 1L1EA 5E1BA 3FUWA 4P7KA 2XBMA 3LHDA 1SG9A 1YUBA 3I53A 1AF7A 3OZTA 4KVZA 4EKGA 3ID6C 2P8JA 1JQDA 3P2EA 5BW5A 4DZRA 4CTKA 3EEOA 1D2HA 2YXDA 2P1DA 3MERA 4QTUB 4RVHA 4X61A 4C04A 4DM3A 4C07A 2ZW9A 4PONA 4C08A 3LCVB 4KW7A 3C3PA 4BLUA 4DMGA 2VP3A 3BKWA 3LCUA 4M36A 4R8RA 3PB3A 5C0OE 4FSXA 1YZ3A 3KPJA 4RTLA 2JHCA 1RJEA 4H0NA 1P39A 3Q7EA 1SQFA 5FULA 3O4FA 4MHTA 3BZBA 1KPIA 4E31A 5HIKA 5D1HA 2XVMA 2PGXA 4XUEA 4MIKA 3GRVA 2FCAA 1VLMA 2I9KA 1G60A 2JG3A 2GAFA 1KR5A 2OBFA 4V0QA 3BGIA 4C03A 1M0EA 4F85A 3P71T 4RVGA 1L9KA 3DR5A 3OPNA 1VIDA 3K0BA 2PLWA 4M7RA 2PKWA 3KPUA 5GIPE 1QYRA 1EJ6A 2IH5A 1NBHA 3M70A 5JUWA 3B3GA 3PT9A 4YUXA 2HV9A 3GRRA 1D2CA 1D2GA 4QVKA 3FTDA 5HEKA 5FWAA 3DH0A 3NMUF 2PJDA 1XJ5A 4RSRA 3E8SA 5FCDA 4PYMA 3O7WA 1XDZA 3NWEA 5DM2A 1AV6A 1BOOA 2OYRA 4OQDA 2NP7A 5KS2A 2YUIA 3VSEA 2ERCA 3G2QA 3GIWA 3IYLW 3IHTA 2O0LA 3R0QA 4E30A 2N47A 2E5WA 4EK9A 5GINE 4RV9A 3G89A 5EKXA 1YZHA 4ATNA 3LKDA 4BLWA 4BP3A 2AN3A 5CVUA 3THSA 4LWPA 4GOMD 3PTAA 2C7QA 3C6KA 1G55A 1UFKA 3VC1A 1X19A 5K0CA 3LSTA 4HGYA 3T7TA 5CIYA 4PIPA 4KDCA 3P9IA 4E70A 2VZ9A 4LG1A 1Q0TA 4HTFA 4FSDA 1NV8A 1TPYA 1I9GA 1G38A 1M6EX 3QV2A 5HILA 2AOVA 3TPZA 4PYKA 3BWYA 4AZWA 3ANXA 3R9XB 1O9HA 1KYZA 2IPXA 2OKCA 4P7JA 5E1DA 1L3IA 3FUXA 1G8AA 3G88A 3RIEA 2ZLBA 5EMMA 3CVOA 1FP2A 2JJQA 5FA5A 5BP7A 4R8SA 3PFHA 3TQSA 5F2OA 3HVHA 5DM1A 2EX4A 3FPGA 5DSXA 5DWQA 4RX1A 3UJ9A 4AZTA 2G1PA 1R8XA 2VS1A 5EOVA 4CTJA 4DQ0A 1I4WA 5K8VA 3T0IA 3CKKA 2ZZNA 4XUCA 5E8RA 5FHRA 2K4MA 5KQSA 1R8YA 2GB4A 4IKPA 1XVAA 4X1OA 3M6VA 5EVJA 2IH2A 1RI2A 5FQOA 2AN5A 2QY6A 4V0RA 4QVGA 3P97A 4AZVA 3ER9A 2B2CA 3GRYA 4DF3A 3OZRA 2YXEA 4MWZA 4R6XA 3SSMA 3LX6A 3KQSA 1KIAA 1JG3A 5HIJA 4RVDA 3TM4A 3TM5A 4C06A 1L3CA 3UZUA 1EJ0A 3UJ8A 2P3OA 2ZBQA 2PX8A 2GH1A 4WXHA 3ELUA 2AOXA 4QPNA 2IDKA 5LQKA 4U7PB 3OU2A 5CVVA 4R6WA 5BW4A 3P8ZA 3NW9A 5F2KA 3OU6A 3FTCA 2C7PA 2Q41A 4IV0A 3EPPA 3BWMA 3P2IA 3HA7A 5K05A 4RTMA 3H2BA 3B3FA 3DMGA 2R3SA 4JXJA 3VYWA 3BGDA 3UJDA 4FP9A 4PYNA 5DTMA 3C0KA 3G2PA 3UFBA 2H00A 2JHAA 3LBFA 2V74B 3V97A 1G6Q1 1XCLA 1R6AA 2IIPA 2ZSUA 2VDWA 2BH2A 1B42A 2WA2A 5M5BA 2IH4A 5EG5A 4EQZA 5EKUA 4E2ZA 1X1DA 2OY0A 3HNRA 5D1NA 1VBFA 1X1CA 4ER5A 2UYOA 3CCFA 4KRGA 3CJTA 5GM1A 2R6ZA 4PYOA 1MJFA 3A4TA 5K0EA 3G2MA 3SM3A 3ME5A 4A6EA 3UBTA 1RJFA 3I5UA 4PIMA 2UYQA 3EVEA 5K03A 5E9JA 3LBYA 3HEMA 3AY0A 3KR0A 5C9ZA 1JQ3A 3MGGA 2ZCJA 2NXCA 2ADMA 1RI5A 2P41A 3NDIA 1NW5A 3QOWA 3E05A 5F2NA 1ORIA 4KWCA 5LQCA 2G70A 1XDUA 2PWYA 4A6DA 1X1AA 3EVCA 3FUTA 1NT2A 4QDJA 4YV0A 3GGDA 5DPMA 1U2ZA 1YB2A 2VDVE 5ICGA 4B17A 3GJYA 2UYCA 3OE5A 3CJQA 2PXCA 4EMSA 3HCFA 1EAMA 1ZHFA 2B25A 4QTTB 1JTEA 3KU1A 10MHA 1JSZA 1M6YA 1JG1A 3MB5A 2AVDA 3NTVA 3R24A 3KKZA 3OFJA 4M37A 3UJAA 1JG2A
chains in the Genus database with same CATH superfamily
4ZAGA 1I7LA 1L8OA 1QQAA 5F76A 3CB4A 4ZPJA 4WLNA 3TIVA 1XR3A 3LHKA 3RS0A 1XIVA 4RF2A 5DKFA 3L1JA 1V3VA 4NYJR 1GT6A 2P5SA 5MN5A 1A9TA 2CFTA 1XRSB 2JD2A 4RLFA 4BRWA 3BD8A 4DV6B 1Y6FA 5LQRA 5C18A 1TFUA 2DETA 4KN8A 1N5KA 4OAPA 4RKRA 3PUYA 4Z9BA 1F1BA 3PDWA 2X7HA 1C3VA 2YJ6A 1KR2A 4A2WA 3ZQJA 5K0NA 1GFZA 2QT9A 1F1JA 3B8HA 5BPFA 5ICEA 1TT5B 1WM1A 1MIOB 3OOSA 4LOJA 3FRHA 3WWYA 4BDTA 4DIFA 1OH8A 3BSWA 3P0IA 1L5LA 2N46A 1O6ZA 4MUMA 1J5XA 3KQHA 1NX6A 1YGYA 4IVNA 2FSSA 4GYKA 1NUAA 4F4HA 2I80A 2F8LA 3T5GA 4BNXA 2EFHB 1SULA 3QHQA 3ZZNA 5DULA 4Z4FA 1ZA1A 1MLDA 1SRRA 2P9ZA 3SC4A 2Q9BA 3WNCA 2VVTA 4MKHA 1IIBA 4YMSA 1N0VC 2ZSDA 1Z6AA 1XD2A 2D06A 3I28A 3LXUX 4PX5A 3KB2A 4MKGA 3A10A 1O03A 4ZVTA 4JLAA 3PGA1 4UHBA 1IJBA 2JVIA 5MDHA 2COEA 1P72A 3BSSA 3GNSA 3HGMA 3WL7A 2EX0A 4NG4A 2XVAA 3FVVA 2DKFA 5C8ZA 2LNDA 2X41A 3U7HB 3B1XA 4M8SA 3AVUA 1U1FA 2OLJA 3DFIA 5G41A 4FGSA 2AZTA 3C70A 1QGZA 2WT9A 2JI9A 1LH0A 4AMYA 4E4YA 4H3HB 7MHTA 3R7NA 1Z4OA 1LK7A 5CX4A 2AV6A 3CUVA 3ESDA 5CMLA 5C51B 3H84A 1CG6A 2D6FA 2QPLA 3CZ4A 2PS1A 3DHEA 4XGKA 4IFTA 3ZY4A 4C4PA 4XRGA 1V5IA 1I6LA 5C34B 4WL0A 1R15A 5AXCA 2ZULA 5CGZA 3L4KA 1Y3BE 3OSZA 4D9GA 1VJ5A 3IQIX 4EW6A 2ZJ6A 3TKAA 3WDKA 4F4FA 1OY1A 2EJTA 1RCTE 2H2DA 2VF7A 2R2GA 1QP0A 1Z2NX 1JG6A 1FMCA 2YJNA 4NARA 1IY8A 1TO2E 4PPYA 2JLUA 3RWOA 3EW9A 3C8ZA 3K4PA 4GIBA 2WVGA 4MUGA 4O4JB 1OSNA 2CE2X 3EBOA 1C8VB 1VGVA 3R5JA 4QXAA 4FNOA 5LZ8A 2EFDB 3QTTA 3CRW1 5C3UA 3VU3A 3OLQA 3GZNA 2NXNA 3A1CA 4FB5A 2PPVA 4RTSA 5IHXA 4FX5A 5IT4A 1Q57A 1ZH6A 1VCOA 7MDHA 4BRZA 2OL4A 4NZZA 4UUPA 3G1WA 2VYND 3DL7A 3I64A 3I8SA 3PC4A 1Z7BA 3VU1A 3FSJX 1LU9A 3L3BA 4HWRA 3W9SA 3WK6A 1U0FA 3MINA 1V0JA 2YMQA 4NHEA 3TEJA 4D8WA 4JITA 4EFLA 5I51A 1T36B 1R27A 4LXHA 5C53B 2D5CA 1TAQA 2YIMA 2P6OA 4TWBA 5LQUA 2W70A 3B7PA 2C7RA 3IBFA 3SHVA 1KDRA 3ZEIA 1KJNA 3O38A 1QAMA 2EWVA 5KJEA 4ZAZA 4AQDA 4WK0B 5TF0A 4EYSA 4NV3A 3MMNA 2X2PA 2PSHA 1UBHS 4BMSA 2A8YA 3ZJYA 4X00A 4BKMA 3KYJB 1GPLA 2DPMA 5CJPA 4F8YA 2IOHA 1GL7A 1XMXA 1NQOA 2FZCA 2VJYA 3TECE 1WPXA 1GPAA 4L07A 2EVWX 2IWHA 1O9GA 1UK9A 1TOAA 1ST3A 2L17A 4K5QA 4UEWA 4G4SO 3WSVA 2RJNA 3DHYA 1BFUA 1E58A 1FBNA 2X5XA 3G49A 4BO1A 4EBBA 4OXYA 2WQ6A 4OXIA 3QK7A 3MK31 2G76A 2H0QA 1Y8QA 4DCCA 1G8SA 3OCUA 1LW6E 1O5TA 4GLJA 4Z0HO 4F9GA 3HDTA 3SC6A 4PZAA 3FZEA 4HX9A 3SI7A 1IRXA 1TL7C 2Y4OA 3F5DA 1PHRA 5F73A 4POOA 1BOFA 4R4JA 4NENB 1OIXA 1NULA 4NNPA 4D98A 4W7HA 1T2NA 2ZBDA 2RHTA 5BN1A 2XZLA 2HWYA 4C05A 3GMDA 4BNDA 5BQFA 2PCJA 1W87A 3NHZA 3AEUB 5SYAA 3MMZA 3QVMA 1IEXA 1N57A 1XYGA 2PHZA 4FQ7A 4WCFB 1G6KA 4AYTA 1DS6A 1QIHA 1A04A 3OIFA 4MEBA 4QOGA 2NUPB 3L6BA 2VUTA 5JZ9A 3VUFA 4HSGA 4UBKA 2GAJA 3S1AA 1FDVA 2WD7A 1RWMA 3C6MA 3EXHA 4A0RA 1IAQA 4N7JA 1WV1A 3MTQA 5MHTA 1J42A 4IIJF 5TQJA 1QHSA 3Q0EA 3LFTA 3UJ3X 1K5HA 4Z86A 1D4ZA 3DZBA 3LMKA 4NNJA 1C1HA 1ORTA 4RZ3A 4EHKA 4B5LA 2A1TR 4NH4A 4YRRA 4PYIA 1WDMA 2J08A 1QCZA 5DNVA 4KODA 1BMDA 1ZOSA 3IAUA 3LKZA 2OO5C 4XD7A 1AS3A 2IYWA 3DM9B 3H1BA 1X1SA 3I04A 3JQFA 4KKXB 3T99A 4E5KA 4EUSA 5F7OA 2B5OA 3E27A 1ZRSA 4RVUA 5CK4A 4QASA 4OIFA 1FQKA 5ECYA 1YB4A 3UXYA 2NAFA 4A2QA 3VC2A 4FDLA 2WHQA 2XCSB 1JSCA 1R8QA 3LKBA 4OREX 2R6FA 4BVHA 1PTJA 3NV7A 2ZYDA 5K4AA 3GLIE 2GEJA 4C78A 2ONYA 4RUKA 4J0DA 5H02A 2Q27A 3DV2A 3DVQX 4TVOA 2QRMA 2VZEA 2JIPA 2ZAYA 3KHTA 1KO8A 4DG9A 3QTBA 3BG5A 4G24A 1XJCA 3FWYA 4PAQA 4X8OA 3M6FA 5K0GA 5C46F 5FADA 3HVRA 4B3SB 2WMOB 1OV4A 1VHWA 2PSDA 3K4QA 3OPYB 4NL4H 2NXJA 2OC4A 3FVRA 4FCCA 1P29A 1JVBA 1N3IA 1FP4B 3RS9A 4J8PA 2J9YB 4BV3A 3TLZA 4EHAA 5AXBA 5L3VA 4FC6A 4U7WA 1NC1A 1MHPA 3TLCA 2V7TA 3QY0A 2BGMA 1P2VA 4BB5A 4AUMA 2PTHA 4WDQA 2IV2X 3R7WB 4WW0A 2PWAA 4GI3A 2ZRJA 5ITZB 2BFDA 2CXUA 2NO9A 1AKRA 1JHAA 1Z0KA 4QPDA 3CONA 5AM1A 2XJ9A 2QP4A 3VYVA 1ZISA 3QYFA 3M7IA 4OF4A 3OQOA 1WB9A 3B52X 4U3JA 5CITA 1YWGO 4HVLA 3P9KA 2HBQA 3FTPA 3B1YA 2VXBA 1QHHB 1MH1A 1JLRA 4EHNA 5LZ2A 4MUJA 3PEVA 4FZRA 4TXNA 3GGGA 4QELA 5TJ9A 2B1JA 3PE4A 3T61A 1F17A 3AIKA 1DX4A 4IDDA 1QH1A 3G2NA 2CMFA 1B43A 4NMHA 3SJ7A 2XD9A 1N75A 2BR5A 4YXFA 5ICCA 1XHEA 5C5IA 4IWNA 1QB7A 2RHJA 4C0WA 5HNKA 1K4MA 1D0IA 4PCUA 1M67A 4OJKA 4D44A 1JU4A 3A2MA 3ADCA 4YJ2A 1W0JA 4PVCA 1SUIA 3KHUA 4BFZA 5A5FA 3GZTB 1P1KA 1R12A 2MSDB 3OTIA 2JIDA 4RMHA 3T5MA 4C7BA 5J58A 4KNVA 3K9FC 1BDJA 2II6A 1RIIA 3IUJA 4KHPB 3FMPB 2PZAA 3JYQA 1KJQA 2ISSD 2X9VA 4CN8A 3B5JA 3HZZA 4O2BB 4EKNB 2FSFA 3KR9A 1KH2A 4M1OA 5JVDA 4M87A 3CZAA 2C59A 4N8EA 4OLHA 1T6YA 3F2IA 3CPHA 1VDZA 1F0PA 3MFYA 3VSCA 1O94C 4QX6A 5B4VA 1BX3A 3ILHA 2XTMA 3D5TA 4DQUA 2QR2A 2Q9CA 2G1AA 1YJAA 3HR8A 2BN4A 4O4IA 1PN3A 4QDZA 1NPDA 4X64B 4TMTA 3CXUA 3OZTA 4IDGA 1ENYA 3H2SA 1ZH8A 2YOHA 4OM7A 5M2QA 1YS2X 4HLNA 1PT8A 4XD2A 1E6WA 4AKGA 3WFJA 3EW7A 1YDFA 1BXGB 1AO3A 1BWQA 2FFQA 3P20A 2O8CA 3CT4A 3ZIAA 4BWYA 3TI7A 4COOA 1TT5A 1DU4A 3AVOA 4CDMA 4JIMA 5C4MA 2WMYA 1E2FA 1ESNA 1NBWB 3K5IA 5F33A 1DBIA 4OB6A 3FDIA 5FKJA 5A0FA 1J99A 2Q6OA 3LUKA 5D1HA 4EY4A 2XVMA 4YRDA 3H9BA 4G5FA 5I7OA 3K5WA 2JG3A 5CB8A 1BGVA 3IBSA 1P8AA 1SQ6A 3NPAA 4JEUA 1ENZA 4RANA 1T1IA 4RV4A 1U0JA 1UBTS 3GJ7A 3BE8A 1C3OB 3RYTC 2IHNA 4HGPA 4ZAXA 1V8FA 1MN6A 3TCXB 3W2TA 2W11A 1HURA 1M8JA 1NT4A 3IDAA 1NBHA 3WGKA 2CLSA 5DNYB 2AG1A 2DFNA 5HEKA 3ZHRA 1ZJ6A 1TYEB 2Z09A 4AIIA 5G1NA 4NDZA 4ND6A 5HUQA 5H80A 3F96A 4LNUB 5F52A 3W5AA 3A9SA 3NWEA 4L4ZA 2B34A 3AH8A 3A1TA 3AHJA 4J91A 4NX2A 2ERCA 2C96A 2ZSHA 4ERNA 4K6FA 4QODA 2XNHA 3BFPA 1YD7A 1G8YA 5JS6A 4PN7A 2M6SA 1D1PA 1YZHA 3QENA 4C7JA 1I0ZA 2R5FA 1M76A 1VCHA 4ZVKA 1RZRA 4Y6GB 4HXEB 3IUYA 5FP0A 2CUKA 5FYQA 4QYMA 4MPRA 1Y5MA 2H3EA 2ZAGA 5ISMA 3EIXA 5HZGA 1KMHB 1THZA 2L19A 4DLRA 3LYUA 4PZYA 5A71A 4C1BA 1BS9A 2GZHA 1FZQA 4E15A 1FQOA 1HEIA 4ZQHA 5ALSA 2WJWA 1XWFA 4CPDA 1RPZA 3S2IA 3ZU4A 3QA9A 1O5IA 2ID4A 4GI5A 5AKJA 1ILWA 1DG1G 1KYZA 2H2WA 4DV0B 1H2BA 2GXSA 2YNMC 3FUXA 3HG7A 5AM4A 2X8JA 2ZLBA 4KVAA 2ZSKA 3GUYA 4PXSA 5HIAA 5F1OA 3PFHA 4I6EA 4PR0A 3TD6A 3UQYS 4BFCA 1PJSA 1PJRA 2Z83A 5DYIA 1A9SA 3M1YA 4F7WA 1Q3HA 2EX4A 1F8GA 1U3FA 2IUEA 1XRLA 3MBIA 3Q7QA 3I73A 1RLJA 5EOVA 4JI8B 5DLPA 3DD5A 1DP4A 4KI0A 1WXHA 4GAEA 2HMTA 2DQYA 4KMOA 4BQIA 5MFPA 1RLOA 3KB1A 3OJWA 4NH0A 2OECA 2FQWA 3B1VA 4NFLA 3H2GA 3HE3A 3VO2A 3B1KA 3BILA 4BUZA 4OHYA 2V7UA 4I3FA 1U7WA 4O4JF 4QVGA 5CRIA 4CM8A 5EVCA 4N4AA 3HM9A 1ZVVA 1ZCAA 1R3UA 2X8LA 2WJGA 3KLOA 1RYDA 1P4HA 3V4VB 1L7QA 3VR4A 1II0A 3U13A 4XARA 3RYFA 2FP3A 1WB6A 1VFPA 1Z16A 2RDMA 3COVA 4M1WA 4C06A 3CLRC 3TR5A 2I34A 3U44B 1YR8A 4D42A 1GN8A 4CMGA 3FHJA 4QOSA 5G0VA 3WADA 3ZV7A 3A1WA 3IQFA 3SQDA 4PLFA 3DMTA 3ROKA 1JIQA 3HKDA 2PX3A 2Y1KA 4LKRA 1CHDA 1TYBE 3GLSA 1ZOOA 3BGDA 1RVDA 3LBIA 1CJCA 4U2DA 5KYYA 3A9UA 3LF2A 5DTMA 1YDMA 5H3HA 1IPFA 1UBFA 5JECA 1A7JA 1G6Q1 3ZQKA 3D2CA 1B42A 4ZV9A 1SVNA 1WO8A 5EG5A 1FLDA 2N1MA 4L5AA 4W1SA 5FPQA 1Y80A 3OKAA 4NDAA 5EYPB 1JI0A 1GA6A 1S6YA 2XRYA 3OSUA 3ZV3A 1M0TA 3D9QX 5CVTA 4W4TA 4L57A 3GQVA 1X1CA 4WKGA 1Z6PA 4EEKA 1T4CA 1H42A 2QSUA 1B8VA 4RGBA 3L7DA 3N9IA 4HN4B 1D03A 2F3RA 3QXCA 4UU7A 1OAOA 5HMMA 2FMIA 3EDOA 4PHHA 2M6LA 1R0RE 3JQGA 4CL2A 3U56A 2O48X 2VPQA 3I32A 4GG1A 3SE7A 2YJ4A 1QB8A 3CB2A 4HQKA 1LS1A 3K0FA 4NS1A 3VVLA 2RKWA 1V9SA 1HMPA 1UINA 1CP3A 3CEMA 2ZI5A 2GYUA 3KYBA 2NZUG 1E6EA 2AFHE 5AUOB 1RHJA 2PWYA 2PD3A 2PGAA 2YN2A 2TMKA 4KNWA 3P9QA 4BP8A 5A4KA 4LS3A 2IX3A 5E3JA 1VJDA 2BE9A 5DPMA 5DIFA 4CM4A 4FX2A 1XU9A 1U28A 2V03A 3N0TA 4S04A 1WDKA 4I19A 2WU4A 1O8BA 3PPYA 3QMVA 2QUBA 3R24A 2UUBB 5FUXA 4AJ9A 4MAAA 5PGMA 1JE0A 3DR3A 4HXFB 4LHZA 4BBJA 4E5DA 1PUIA 2D1YA 4EITA 4YI5A 2XHEA 4CUZA 5JFTA 1KYIA 3TZEA 3K6JA 1NATA 5A1JA 1DBQA 4JELA 3OCVA 1Z5UA 2VWQA 3R6GA 3RVQA 4J1TC 2J41A 1A5ZA 3L8DA 2EYQA 2IZ6A 2J0UA 4UZSA 5DCUA 1AU9A 1SKQA 2VPWA 3ZHQA 4RTNA 2OQ2A 1KI9A 3HB9A 2WUFA 4O29A 5CDYA 2ZFUA 3IEMA 2QTRA 4GC5A 2CLLB 1KDTA 2I6GA 2VT7A 4JY7A 1XAHA 4HYTA 1V9LA 2PH3A 4YT5A 2A1TS 4KXXA 2ZUTA 2M9MA 4D7AA 1NBME 4ZI7F 1KQPA 3I4FA 3VM6A 4NE2A 3BMNA 4EMUA 1C1DB 1G9SA 1YVUA 4JC8A 1T8SA 3EDCA 1TJ5A 5DXJA 4B3DA 1N25A 1ZGAA 1DAEA 1FCJA 3GA5A 1RCUA 4KN9S 4MZXA 5FTWA 4DBLC 1GPUA 2XCQA 4MNTA 3GG2A 4MR7B 1LFAA 4RS3A 2GD6A 1FLNA 3PNLA 1SEVA 5D51S 1BJTA 4WVLA 1OIWA 1PSZA 3A4IA 3G59A 1MOZA 3P9NA 3EUFA 5IXSA 1RABA 1W5AA 1QRSA 1F7UA 5JE8A 1G38A 1Y6QA 3RRNA 1T2DA 2PX5A 4CW7A 1ZXXA 1E1RD 3IV9A 1CUAA 4MQ4A 4RY9A 3Q8KA 5KDDA 5G0WA 1MB4A 5AKIA 5CT6A 2G8LA 5CDSA 1CQPA 3L0IB 3EDYA 1GZVA 3NGLA 3NJ8A 3TLAA 1H2YA 3PKIA 1G0NA 1WP9A 1F8FA 3M6XA 4MTCA 1A3CA 1VJGA 5LFAA 3X0DA 1ZOIA 3GLQA 1YUMA 2WU1A 4EG4A 1AQNA 3AQ4A 1UIMA 3DOUA 3KKPA 6ADHA 4NTZA 1EVZA 4NULA 2CSUA 4GNKA 4DYDA 3RVDA 5C4IA 1AF4A 3WZ2A 4JYAB 1GR0A 3N2KA 2XR1A 4HD8A 3SOZA 2EP5A 4U63A 3KEFA 1XNRB 2XYVA 1PHPA 2GI4A 2GN9A 3VKFA 5G3YA 2R8YA 3ZV6A 1QPBA 5HJ7A 1C41A 4TLMB 1FRFS 1MAWA 2P9GA 1DKMA 2ZE7A 3MOIA 2P5YA 3O3OB 3PFBA 4GD3Q 1M5UA 1KSHA 2Y1XA 3U2QA 4B74A 2FR8A 2PZFA 2XRMA 1ZI9A 4K6CA 1KEEA 3AIOA 4G4GA 3HGQA 2AIRA 1Y5LA 4I1OA 1P5JA 1OT5A 4L15A 3V80A 4FCVA 4G3XA 3IVRA 3KPVA 3PNYA 4YP5A 3EEFA 1L3BA 3GLFB 4WY2A 5KQRA 4JQYA 4WKNA 3RVJA 4C3VA 4TYNA 3VJMA 4QU0A 4B3BA 2D7JA 3WBBA 3RKUA 4X41A 4PS1A 3B9PA 2RGNA 2ZWIA 3ENKA 4Z6KA 4MB2A 4RABA 4BNNA 2ZR7A 4MAMA 4PINA 3BWVA 2BGKA 2XQGA 1K98A 4IIFA 4ZYTA 5EJ7A 1EQAA 5FV4A 2UVQA 3G9ZA 1E79A 1IHOA 3T9CA 4Q05A 5JJCA 2E5LB 4TMFA 5GM2A 3EXEA 3B51X 4MS1A 3B38A 4LX0A 3RUDA 1KA9H 1TIKA 4Q24A 4LCEA 4YMUA 2J48A 3QE9Y 3V7UA 1J39A 4MR8A 1QSGA 2G4CA 2QMOA 4P3NA 1VIMA 4LSGA 2H5JA 4V39A 3SBEA 5IWAB 4B83A 1YR6A 4ND8A 2E3JA 2GPJA 1OTHA 4KE8A 3H5IA 2PN1A 5F4ZA 2Q3HA 5DCLA 1LPBB 1DHTA 1XTPA 4BLOA 5K5EA 2ZT8A 3PS9A 5I8WA 1JFVA 3PVCA 5IW8A 2BTOA 4MW1A 1VGRA 3GT7A 1E9VA 1X2EA 3F7OA 3T0GA 8GPBA 3TSCA 5ICMA 2IW1A 1ABFA 1G4UR 4MKZA 2CLOB 2PZLA 3OX3A 1I6WA 2FX2A 4H6PA 4L73A 4TTSA 3ZNQA 5IAAA 4DSOA 4LJAA 1JFRA 4KQ9A 5U9CA 1X8XA 4BGEA 2WKSA 3WMWA 1X1EA 3A6GA 3UMMA 4M88A 4WUVA 4C7XA 2H16A 2GZ2A 5ESWA 3AU9A 3PWSA 4HNUA 2JJ8A 3TG8A 1IZ9A 2CLCX 1G2PA 4XCVA 4E1VA 4K26A 3RHZA 4ROTA 2F7SA 3G2LA 4JOQA 2IU4A 1VDMA 1Z4QA 2W71A 4G23A 2FW0A 2NV2B 2XT9A 2ZRNA 2BTEA 4OJNA 2XRFA 4URHA 3C7CB 3A26A 1T3GA 1Y48E 3GP5A 4LXYA 2P6NA 1JLKA 4JC4A 4JJ4A 3RDPA 3WIDA 3BQMB 3A9VA 4AO7A 3DWFA 1LBEA 3B6IA 2JKYA 3IUMA 2ZATA 4RA9A 1QCYA 4EHLA 3ZKAA 4LYEA 4YRGA 3ABOB 3CCCA 1UDXA 1DG3A 1SO8A 2PH1A 3CZ5A 3ZU2A 1Z8DA 4A8TA 2OBLA 2RH9B 4XB6B 3O6VA 3NATA 4MUBA 3NIWA 3PNPA 5CCXA 2Z6QA 3VPAA 5CEJA 2HLPA 4D0SA 1BHSA 1D6MA 3I1FA 1DAGA 4R41A 2K6GA 3TSZA 1X3LA 3PQ5A 1KKUA 2Q9UA 4ZPXA 1IAVA 1PV2A 3PSHA 5B2EA 2DE0X 4OBXA 3EFBA 3WLSA 3MLAA 3NBAA 3GFFA 4O4LB 1P5HA 5JAUA 2M2IA 1HDGO 1ISRA 3E18A 3U7JA 2QBYA 1PG5A 2OHVA 2OO3A 4HWOA 4QLBA 4CEJA 3HV0A 1E2KA 2GZ3A 3WLOA 3ZKWB 1NJFA 1NXQA 3DTVD 4Q3DA 4RHEA 1SCAA 4IGKA 2C82A 4YUYA 1N34B 1QNLA 3I37X 3TQQA 1BGXT 2CL6X 3JPYA 4I81A 4ZI7A 3V7WA 2P68A 3PE6A 5EHNA 4B3HA 3I58A 3A28A 1L5HA 1J8FA 2JFHA 2XGOA 3TZCA 1TUEA 3UUGA 3WZMA 3AM1A 2OD7A 5ALPA 4N47A 2P2SA 2RHRA 1K7EB 2WYIA 4AY3A 3KTAB 5JC1A 1ZBDA 3SSAA 2BBOA 3W3AH 1ENOA 5EFOA 3ECCA 3STVA 4DABA 1IZ0A 2O4CA 1I7NA 1WULS 1ZD2P 1U94A 5DXAA 3WICA 4OHOA 3MMXA 2CLMB 3BH0A 4QGBA 3ROMA 2O23A 3NYWA 2CCGA 4RDIA 5LP6A 2I4OA 4JKOA 4WA8A 3WLEA 4U2BA 2I5PO 5DASA 4ARZB 5AJHA 1EP9A 5BSGA 1DKUA 3T12A 1IXYA 3WYNA 2GEUA 4J2HA 2VF2A 1GPYA 3SS8A 1QKKA 4Q4HA 3HA5A 4AZ0B 1UDWA 2GSDA 1FJHA 2P9BA 1DQSA 3N3AC 5F78A 3S5UA 1C3JA 1LY1A 2B94A 1WSAA 1GLNA 2A67A 5ALEA 1ZK3A 2V54A 1RCFA 2R97A 1WXWA 3NWJA 4RELA 1YULA 4F84A 3T7IA 3JRWA 2DECA 1J8YF 4I6GA 1W36C 3C7TA 5I7UA 3RYHB 2E55A 1PR9A 1BA3A 3R3UA 5IBQA 2AHOA 2B0JA 3PCRB 3VNUA 2AQKA 3LJKA 3A9CA 5JDCC 2QLTA 2W2MA 1MQAA 16PKA 2DX7A 3HMQA 3INNA 4INJA 4Z0TA 1KY4A 4S24A 3O8QA 1N4AA 1UMBB 1VIVA 2D59A 2V3VA 2X4LA 1EWTA 2ID7A 2QPOA 5JWOA 2DB3A 2HBRA 1L7AA 1OYYA 1Z7GA 1N2ZA 2XOKA 3KRTA 1LSSA 3QHPA 3HB4X 4FDUA 1KGSA 1UIRA 3AFGA 3DAPA 3DFKA 3V32A 3VU8A 1MD9A 5CVEA 1WNFA 3CFYA 3WR5A 1ZM7A 4X71A 1XXLA 4GWLA 5C52B 3AVYA 4EVQA 4R2JA 2X0EA 4A16A 3EQ9A 4L7QA 3VFDA 1PDOA 1L0BA 4GQBA 2QM0A 2F9LA 4F2DA 1SD5A 2P35A 1JJIA 2VQDA 3IIKA 1CR4A 4GVXA 1YB6A 2E1RA 3IALA 4UUOA 2Y0BA 1OF1A 3D8UA 4LDAA 3KWJA 4YP0A 3VA7A 1H2WA 3EWAA 3KKNA 2BGRA 4LVOA 5L4SA 1A76A 3OX2A 4H7PA 2HGSA 4Y6LA 4ZYWA 4RTQA 4KMMA 5FNZA 2V45A 1VP9A 3FYTA 4Q01A 4WPGA 4Y0AA 4CQLB 3HXQA 3RTCA 1B23P 3AY6A 3MM4A 4N3AA 4UAVA 3TLKA 4MWBA 1EK5A 2C42A 4DCJA 1AJEA 1JDJA 3U7EB 3EEOA 4DIBA 4FHDA 2XV1A 2W6CX 2CB9A 1PL0A 1Q0TA 3TQRA 4B6FA 1ZW1A 2VP3A 3BKWA 5F5XA 3K94A 3T1YB 1UBOS 2GVNA 4DNQA 4O4JA 2OVBA 5H83A 5TQ0B 4K05A 2IEZA 5I4CA 1KXJA 4DANA 3P9ZA 3CH4B 1U8CB 1U3GA 3UC5A 4ZI7B 5AW2A 1BXKA 4FNGA 1K8ZB 1P7WA 4MDYA 1R88A 2HFJA 1OYWA 4DCUA 1LZLA 1N36B 2QX8A 3OCZA 5T4HA 1QUEA 3P0HA 3V7FA 1CKEA 1KEVA 5D7NA 1SCKA 2GEKA 2OXCA 4PRZA 4A6PA 3EDRA 2O3SA 3F8SA 3T35A 3GRRA 1YRYE 4CMJA 2JI7A 1G3RA 5K0SA 4HGQA 3BX1A 3U0VA 5LQSA 1PT6A 1U28C 2AJTA 4L95C 1PAUA 4XDGA 1S1MA 5EJ9A 4HNGA 3GN1A 4WUTA 4GKBA 2OCPA 1CX9B 2XCRB 3IHTA 1J9ZA 1HE2A 1M10A 1QNFA 1W5TA 2Y1GA 1LTHR 1ICEA 2Y9MB 2ZIVB 3HYLA 1CCWA 3I39X 4IGFA 3EEIA 2X8WA 1O9BA 4WQMA 5CVUA 3B7WA 3L79A 3C6KA 3QVVA 1TF7A 1NXXA 5HOEA 4KH0A 3V2IA 1H9BA 3AT1A 1OWOA 3V2HA 2C9ZA 1GCOA 3BORA 3RC8A 2IF0A 3ZCTA 4FSDA 5LYJB 1Q0HA 1S4MA 2FF5A 2H6EA 3QIVA 5FPSA 1C3XA 5LBTA 2EKPA 4JEHA 3NIGB 1FUEA 5ED0A 4YVFA 4DUGA 2DHRA 1OWLA 1XUOA 2VQSA 1CE8B 1MQ9A 4F4UA 1EFVA 3SM9A 5BMVA 2HBYA 1L7XA 3FW1A 5EMHA 5E1DA 1ZK4A 1V4VA 2OCYC 5F5LA 5FIUA 1CK4A 5LA6A 3F7NA 4AJNA 1JN0A 5FA5A 4AM8A 3DCYA 1R6UA 3H9UA 4GU5A 3Q11A 3U61B 2B6HA 1KDZA 4DXDA 1MH9A 5CCDA 1QK4A 1N8SA 2GN8A 1IDN1 3SZMA 4GP6A 3TAHA 3GFVA 4C3ZA 3IL2A 4QU5A 5T4EA 3V55A 1C9NA 3K1AA 1BCSA 3DF9A 3RIGA 6NULA 1ECLA 4J29A 4S35A 2O20A 1EBFA 1DWQA 5SZIA 3W8DA 5KQSA 4KBFA 1H05A 4YCDA 3VYRB 2BEWA 4U9IS 1KOGA 1FF9A 2EP8A 2QP3A 1TC1A 1TCVA 3N75A 3TLGA 1Q91A 2OCLA 2P65A 4BVFA 2VJPA 3AERA 1Q0RA 3PQ6A 3QFTA 3ZE2B 3SBOA 4ZGBA 2C88A 4CLHA 2NZVG 1KDVA 2YY5A 3KXLA 3OZRA 4P3XA 4YR9A 1P18A 1A7UA 2WLTA 4QRIA 4Z9FA 1KMCA 2XF8A 3JYPA 3LX6A 1PD0A 4UCXA 4UHCA 3M6LA 1WXDA 2ZTMA 4PTLA 5DW0A 4QVIA 4OHXA 3Q72A 1PNQA 5AI6A 1OA1A 1QO7A 1RC0A 2OOSA 3ELUA 821PA 4TVBA 5TGTA 3CU5A 1JMYA 2C29D 4EB8A 3QYJA 1YBAA 4BN5A 1THGA 2H0AA 3OPYI 3LQFA 4BXOA 5E7JA 3PDHA 5ALVA 1J9GA 1M2VB 4TT3D 4DYVA 3GJRA 3DWGA 3E5RA 3D1LA 4XVCA 1X0XA 2XOKD 2FGJA 4HLUC 4LE1A 1RT9A 4EP1A 4AI6A 3I1JA 3RRJA 4XWKA 1RAEA 4ZU1X 5B4TA 1H2FA 3OZXA 2GM9A 3M6MD 4IHJF 4L5YA 4AJOA 1QFMA 3RQSA 3GFQA 5HZHA 1PLLA 2B3DA 5KOHB 4QIHA 5K3OA 2IH4A 3W5BA 2J0SA 3S81A 3O8QB 4M86A 2X9NA 4C30A 2FZWA 3ELBA 1ZU4A 2AG0A 5LU8A 4OB8A 5KOHA 1HYEA 2QJRA 1QC5A 3C7AA 3G17A 2VUUA 4L5CA 5CB4A 3MWEA 3L46A 3AVWA 1Z0AA 5EQTA 3RHTA 2BONA 3FYUB 3R3XA 3I5UA 4IQFA 4KVGA 4YAJA 5HJEA 1A9XA 4QNRA 1QHGA 5B2ZA 2O8DB 2QX9A 3TUIC 4QUHA 4U1RA 2E5FA 2J87A 3SJCA 1VOTA 1YR3A 4B46A 4C4ZA 5AHXA 4R8LA 2P41A 1RHRA 2HK9A 2J3KA 1T29A 4POAA 4W1RA 2HPAA 4KWCA 4OFWA 4ZTUB 4UUAA 2G70A 3LY9A 5C8YB 4ZDWA 1DWPA 4RIFA 4QECA 1RQ7A 2GLTA 4YV0A 2WC1A 1R0CA 3TPCA 4KACA 2J6HA 2O2HA 3KSRA 3ECSA 4MUNA 3ABQB 1O77A 3T1TA 3IMEA 2IYAA 1AA9A 2DG2A 4RFSB 4BMVA 1U02A 5JAZA 1WY7A 3EYAA 1MNQA 1ZI8A 1TLLA 5IASA 1N7JA 3Q41A 5BSWA 1XKLA 4GXTA 4U8HA 4UREA 3RBZA 1SKUA 3SHFA 3L92A 5IABA 3PVZA 1HLPA 3C6QA 1DAFA 3CTMA 3H7AA 5LVAA 3G0DA 2UYCA 5F3WB 2ODTX 3X1DA 4EY8A 2QS9A 4E33A 1S01A 3M2PA 3SEZA 2PXHA 3U4HA 1E4EB 1UAYA 3V6MA 1YF3A 1QP4A 4OK6A 2QTCA 1PR1A 3EF0A 1VKRA 4LHVA 4M6WB 4YB8A 2JCGA 2NUTA 3RFVA 4EGFA 2IXTA 4EA7A 4AJIA 3STUA 3MZ0A 1MO5A 2P79A 5DRYA 3RTDA 1V71A 3TLMA 5JQGB 4FR0A 1NRJB 5K6RA 4JODA 2YZNA 1P60A 2YYAA 3HVJA 3ICQB 4YC7A 3WNDA 2E82A 3ETCA 3PBKA 4C5BA 1K68A 1KI2A 2CD9A 1TW3A 3PF8A 4LUCA 3ON5A 4J0IA 1SZJG 3LPMA 3K1AB 4I6JA 2QM7A 4MGHA 1Y1KE 3VR2A 4BKOA 3PQFA 3IAFA 5TSDA 4YAGA 2XSZD 3PGMA 2PKRA 3NIDB 2DSTA 2ZTUA 3DFUA 1VHTA 5JH7B 2DH5A 1N9GB 2Y1WA 2WAMA 3JVUA 2XX3A 2JFUA 3L5KA 4CV3A 2IQIA 3BXOA 2G3YA 2X4DA 4XX1A 3NVMB 1SIOA 2XQIA 1ZVJA 3A14A 2AEFA 2PZ8A 3BXZA 1GTZA 1N2IA 3H4VA 4KZKA 5B1SA 3T94A 3KQVA 1QWOA 5TGDA 4Y2PA 3TPFA 4C88A 2ASEA 1K7FB 13PKA 2VSYA 1Z4KA 3CNLA 3H4IA 4NLLA 2J5RA 1T9CA 4TLBA 4RFSA 4HAVA 1N32B 1P1JA 4X8HA 4EPWA 5EIWA 2ZOSA 5AVUA 3CBGA 5EGSA 2L82A 2Q6LA 2R6CA 2AYYA 2G9UA 3RU2A 4YT4A 5DCYA 2H4FA 2QN6A 3CISA 4UHHA 1Q44A 4GO1A 3WKCA 4EEXA 1OWMA 1F2UA 4E1AA 1ZUNB 5H59A 4KH1A 1XQ1A 5FUQA 1O95A 2KW5A 3C24A 3CY6A 1OW3B 1PT5A 3IGFA 3HCPA 3MOGA 4K6OA 3IT2A 1IM2A 3KCNA 1EZZA 2O8DA 1QYVA 2ICAA 1WTAA 3A25A 1T0HB 2VJKA 4BLRA 3QX3A 5TX7A 5DHPA 1MG5A 2CHQA 3VZDA 2R8BA 1RRKA 2O07A 2BFDB 3D54D 4DA9A 3TH5A 2Y76A 3MWEB 4BVGA 5KREA 2OFWA 1I7DA 3QPDA 4J0JA 1M1ZA 1UK7A 1Y7PA 1HOTA 1PP4A 1ZL2A 4GLBA 5AK3A 5KX5A 4JP2A 1HV8A 4JXZA 3ITEA 5THKA 3U9LA 4B7UA 4EFMA 2QOEA 2ZUFA 1Y8CA 3ZWNA 5K0FA 1BDIA 1VYTA 1WXFA 3A7DA 3ASUA 2RGXA 3EVGA 2HNKA 1I33A 5AM3A 3OLYA 3BTUA 1ZCJA 2I0FA 1FNSA 4PHTA 4KPFC 2ENUA 1YMUA 1XZHA 2O7VA 3DEKA 3IH5A 3QU9A 5HHTA 3SZOA 3KR1A 2FA9A 2DAPA 3FE2A 1ADJA 1U0HC 2X15A 3ZHBA 2IX9A 4F46A 1UWKA 4CLRB 5D3MA 2BEJA 1V8BA 3SDSA 4I99A 4INZA 2FI1A 3INRA 5A5EA 4QQKA 4LPSA 5DGIA 3RAJA 5BORA 2C5LA 2WDPA 1W2WB 2Q5QA 4Z4GA 2ET6A 2H5LA 2QZZA 3H16A 4LF8B 1NVTA 3QE3A 2IOFA 3OPVA 1XLUA 1ZOPA 2Y68A 4MO9A 4Q12A 3E5NA 4ZZ2A 4Q6WA 1NVVQ 1Z5VA 4WZAB 1BQ3A 1RDFA 2HD4A 5ENZA 3L6RA 3RS5A 2IEGA 1QRTA 1P61B 3MUFA 2VC2B 4LZNA 2HFKA 4TXHA 1PVOA 2IY8A 4ZDKA 3AUJB 1R0SA 3GDOA 2QL9A 3FCCA 3ZZ0A 4L50A 1NYLA 3B8EA 3H11A 3QYPA 5KVSA 1PTJC 1SBYA 2AJLI 3BREA 1DOAA 4P32A 5ITVA 3DO8A 4IDNA 2I66A 4Q47A 4BVLA 3ILSA 4UAGA 1KEKA 1YBVA 4N18A 1UKBA 4ZDIA 2ZPUA 1FNNA 4V0SA 3ZYCA 4P31A 3MYYA 1YBMA 3C8MA 4AKEA 4HCJA 4GM1A 2JAWA 2UZIR 2VKQA 2VYFA 3IEPA 5TXGA 1IOLA 1N2GA 1E77A 2NYRA 3IDSA 3V1NA 4MIEA 5T3YA 4YPFA 4D81A 3M4JA 3LCCA 1LQTA 1SXQA 3OFND 4URWR 5BUQA 2BVNA 2V9CA 1YZGA 4F6RB 1TKCA 3Q2OA 4RQBA 1Q14A 1K6MA 3NPMA 1LPNA 4WA7A 5K0LA 3RBVA 5DGTA 1ANKA 3L7NA 3ORRA 3U3ZA 2Q3MA 2QENA 3DE2X 3FLBA 3DDCA 2O06A 3ZDEA 3MXTA 2RGUA 2DR3A 3LPNA 2C4HA 4I3HA 3D6JA 3MTBA 4YRLA 3EGXA 4AY2A 3TO5A 2D4HA 3AM3A 3FSRA 2EKZA 2P90A 3Q8XB 3U37A 5J3JA 3D59A 1SCNE 2QTAA 3FFBA 3N39C 3SNHA 2ATCA 2BGLA 2XGSA 3AB8A 3BXEA 3FGNA 3PXBA 1E1RA 2I65A 3C5EA 2E89A 1C7IA 4YCAA 4JJ6A 1RXCA 4OBWA 3KQLA 2EJCA 5EXXA 1M8KA 2I2XB 3DGFC 2OBXA 1ORWA 5DTIA 3W9UA 2Q7DA 4OV6B 4NQRA 3DUWA 2Q5CA 4O1IA 3U3JA 5BYKA 2QW8A 4GE0A 2EBFX 5FWDA 5K6TA 1U0NA 4MVJP 5GZ6A 4B47A 2YWEA 1Z4IA 1Q11A 1UM8A 4BNTA 5A4IS 4D46A 2V1UA 2CLHB 2GAIA 1EI9A 1NOIA 2P4UA 2UVPA 3LVQE 4EO7A 4OVKA 1E89A 2G4LA 4S1WA 4NSNA 2DFPA 1I13A 4R8VA 4A36A 3C6YA 2JDIA 3ZPXA 1BVYF 2FY8A 3BE4A 2IBMA 2QGNA 3OCXA 3RC1A 1QGUB 2QTTA 5AVTA 4HR7A 1ULAA 3KEMA 3AFNA 4JBYA 5ECWA 4YJFB 4BO0A 3N28A 3KQWA 2CFOA 1DFHA 1WXQA 1WUTA 2HJWA 1VE3A 2VJDA 2ZIWB 3JRNA 3JW8A 5D7BA 4ARSA 4DMLA 4J43A 4QZVA 3DAYA 4RADA 4ZAYA 1MX5A 1TQ4A 4NJEA 4QPPA 2FR0A 3B89A 4DDKA 1JI3A 1I0IA 2Z4SA 4LPKA 2O1EA 2OHGA 1UDBA 3FOCA 5EEHA 3LRPA 4CV1A 3DXXA 5A6SA 2QX4A 4EH1A 4X8MA 5C4GB 1BMTA 2WF7A 3G2IA 3REQA 2OCAA 4CMIB 2F1RA 2H2HA 4D96A 4LC9A 2ORED 2CSXA 5IS2A 1PNOA 2OD9A 3P9XA 5FL3A 1N6KA 4D9BA 2ZAIA 4I4NA 4PLCA 5EKTA 4Q7QA 1Z35A 5JXHA 1K08A 1SUPA 1L1FA 3LM8A 4GOLD 3ZJ4A 1H4TA 3RRZA 3EGCA 5CA0B 5B64A 2JGJA 4KLZA 3QWAA 4WD3A 3UXMA 1SZPA 1NJSA 1NMYA 4ERXA 4AF6A 2IS2A 3T4EA 3BGVA 4JU8A 1KXZA 3QKWA 4FYPA 4MQBA 4R2KA 3TIFA 4DLNA 1J49A 1VI2A 4YHBA 3K6SA 3AY3A 3MMPA 1USKA 1OTYA 4V1CB 1U2QA 1IY9A 1BC5A 1EJBA 1IYZA 5IU6A 5EQJB 3AW8A 1HDYA 9MHTA 3ORYA 3DW3X 1GSHA 3HR4A 3T1NA 2XBLA 4LJKA 1AQIA 4QO7A 5AXDA 4CCWA 5C8YF 2PT5A 2A4KA 2EFJA 1IWPB 1Z9BA 2X1VA 3UJ6A 1H8ED 3HYCA 1KJZA 2QYOA 1HMYA 1JIIA 4ILEA 4CLDA 4LDJA 3KJIA 5U4QA 1MG0A 2XQVA 3GCZA 2GYWA 2I2DA 3C3MA 3LT1A 3OESA 2H1FA 4TSKA 3IUQA 5EZYA 3ZHZA 4EJMA 2PUBA 1EB9A 1V5WA 4DWJA 1UBLS 2Y4NA 1BRTA 1I14A 1D2AA 3H0EA 1SG9A 3TZKA 1TYCA 1XD2B 3FNHA 3L0DA 3TKLA 3K32A 4JGBA 4YS6A 5B6IA 3UAWA 5CM8B 3KK0A 3VJKA 3HLYA 4OHVA 4ZVVA 2AK2A 2JGFA 3ZLUA 3LCVB 3KJHA 3KT6A 1Y8QB 3SDBA 2WF9A 2MINA 4L0MA 3QVTA 3PB3A 4M36A 4MGIR 4UU0A 4DAEA 4LI0A 3ZGYA 4YMTA 1Y3DE 2YHIB 1WXEA 4KAJA 4DG5A 1L5HB 5IJWA 2G5TA 1UC5B 1E9BA 1EG7A 3PJEA 4J1TA 4C4SA 1POWA 4Y0NA 3SMVA 3QG1A 2E4WA 4EW2A 1ATZA 1HL3A 2JH3A 1C9DB 1QOQB 1UXGA 5TMBA 4B85A 1FTSA 4HDRB 2HSWA 2YY6A 1DKLA 2W2KA 3QLUA 2CEAA 1KVQA 4E12A 2CXTA 3RRYA 1ESCA 2XLBA 3RK1A 4EHFA 1SPXA 2ZROA 2FWJA 2JIQA 3DAHA 3ESAA 3NC4A 4FMDF 2C5GA 4HB2A 3V8BA 3WK9A 1XDZA 4XTCS 5A9RA 3N0VA 3R5XA 2XUJA 4AICA 1XPRA 1NQAO 5KS2A 1GITA 4RPIA 3WOHA 1FXUA 2Q7OE 2ZJ2A 3IUPA 4O2BF 3W8FA 3PXUA 1ZN9A 4A5SA 3OFVA 5JCZA 4CUKA 4FYYA 2C7QA 2XCOA 3AF0A 3OEEA 1AA6A 1RQ2A 4CQMB 4BXOB 5CNMA 4LJLA 5CIYA 1WW2A 5KYKA 1DWUA 3NGMA 3HDHA 3MTAA 4KE7A 2YC2C 4MVCA 3RB8A 2R8EA 2VKTA 3NUGA 2IEYA 3PTLA 1T3ZA 4GYYA 4QBKA 3NBQA 2G0AA 4I1VA 4IIUA 4BQEA 5F3RA 1V6AA 2G82A 2X3FA 4N49A 4MVJM 3GLHB 3K96A 2PS9A 5CFZA 1XLTA 3C39A 3EPRA 4BNJA 4PANA 4P7JA 1HF3A 1IH8A 1RMQA 2WM9B 4NV0A 2NUBA 5IC6A 3R8XA 1QIKA 1QR2A 3PC8C 3MG9A 4C01A 5IYZA 3ADDA 5DOVA 1QU2A 3KC2A 5CPFA 1KO5A 4N0QA 2VS1A 1QM5A 4HFNA 2GASA 4KNYA 1KH1A 3WY9A 1I1QB 4WESB 1I4WA 1Q7TA 3MWDB 2WIKA 1YBHA 5EXSA 4DQ0A 5D00A 1HQCA 1GKUB 2B92A 5HYVA 5JATA 5JMWA 2JCSA 4MV4A 3M6VA 1RI2A 4DJTA 4ZKDA 2VBGA 1YBFA 3D7KA 1U8UA 2VSXA 5AHWA 4NZPA 4LGYA 2W5UA 1D4AA 3DFZA 5G4KB 2P9YA 3BK2A 3F47A 1CJTC 2DTXA 4K9NA 1EGMB 1IHPA 4FNAA 4L6IA 4LKOA 3H97A 3KSUA 5LMZA 3S1LA 1ZR4A 1E9RA 1JJAA 4BRUA 2GBGA 3PNVA 1FOEB 1V7CA 3JYNA 3RAPR 4F9FA 1RE1A 2P3OA 3D7NA 2ZBQA 3HV2A 4B2IA 2WZCA 2PX8A 1Y8ZA 4RFLA 2UVPB 4TWRA 3UM9A 1PQ4A 4PSCA 3VPFA 1T5IA 5ESXA 1H3EA 3ZVMA 3EULA 3GD5A 4V0ME 1TO6A 1EVYA 4KN6A 4PPNA 4NZMA 5JXJA 4MOWA 2HIMA 1XEFA 3HY6A 5KKNB 4GPIB 4JXJA 1MT0A 5CP8A 4IPTA 1Y34E 3O4RA 2MSLA 2POCA 3AU8A 3QUBA 1P7PA 1JG7A 4ZVOA 2C97A 1F5NA 2IIPA 4YGYA 2V1XA 1NAIA 3WMXA 3FCAA 3TN7A 3ZBPA 4EF4A 1PZEA 2YMPA 1QV9A 1WAMA 3T3PB 3R5HA 1RAGA 1Z5OA 2XWPA 1TJ3A 2RBEA 1QGOA 2ZRDA 3AETA 5LN1A 4NHOA 2B8EA 5T7BA 4G67A 3RVMA 3RUAA 3FIUA 1PCXA 4LBZA 2ZANA 3CJTA 1M6VB 2X8BA 5GM1A 1M8PA 1J5PA 4U0JA 4Y2QA 3SICE 1J8DA 3KALA 3PR2B 3UOAB 5B4UA 3UBTA 4CT5A 2WF6A 4HL6A 1NHWA 2I4LA 1XTQA 2OEPA 3OQVA 2DF8A 2YJ5A 5F7ZA 1P1HA 2PTGA 2AEMA 3CRZA 4XUGB 4CKZA 2YYSA 1RM5A 1G63A 2Q1UA 4GGOA 2NXCA 5FTMA 1L5ZA 2ADMA 3OT5A 3W06A 2IVZA 4F11A 1M2OA 4C2BA 3A4YA 5HM6A 3S44A 2F43B 5IKOA 5JNSA 1GV1A 4MX8A 3MHPA 4OKIA 4WN9B 4ZZ3A 4QD3A 2C5HA 1PR2A 1XT6A 3P1JA 4NRDA 3E1SA 1B3BA 2OORA 3OD1A 2PUFA 1Q2UA 3OQMA 1OLXB 4GYWA 3GCXA 3DHVA 2O1WA 2GN4A 2QE7A 4MCHA 1UXIA 3LPAA 1S8NA 4WKPA 4AG6A 3OE5A 2H1HA 1AK2A 2PXCA 3L7KA 4GVLA 3WV5A 1OZ0A 2I54A 4OXRA 3CF6R 5CAEA 1X7WA 4AIRA 2QMEA 1H6BA 2E1PA 3OFJA 1E3DA 3RJ9A 2W2XA 4EUFA 2IOQA 3LUAA 4HMQA 2FFHA 4DM4A 2O3RA 2JL1A 3IEUA 2OCDA 4RBNA 1T1GA 3MRTA 1QHIA 3FSEA 3ETDA 4L7VA 2Q3EA 2QNRA 4XCXA 3U7QA 1KK1A 3KLPX 3L0PA 3URMA 4FOOA 1UDRA 3NJRA 5TQ2B 1NFQA 1QIJA 3Q87B 4QNMA 5FI0B 4JHLA 3JYOA 1Z5PA 3SAJA 1RM4A 3N8DA 3P2YA 3F3KA 4BTEA 4KR7A 1WUKS 3ZR4B 3IVXA 1KO7A 2ZVDA 1W93A 4DCNA 3EGWA 4NBVA 4CHGA 1CIPA 3O8NA 4LE0A 2D1RA 1ZHOA 1GGHA 1OZGA 1CEQA 1SCUB 1S2IA 4RK0A 4N0EA 5HFNA 3AF5A 3LLSA 2HSJA 2DPYA 3IX7A 4JYBA 3O47A 3MBOA 3O1HB 5CUQA 3KQNA 5A4JA 1HNWB 1R4MA 5E8JA 2AKYA 1DAOA 2PXAA 2VUSA 1LDBA 4MV3A 5KOIA 4HDNB 4LJ7A 1NVUQ 2W00A 4JLKA 2QSJA 3DLCA 3JATA 1JWAB 3HWWA 1JBQA 3C5VA 5AW6A 4YJHB 4YYEA 4UM9D 3KAPA 2IYSA 2WWVD 2ZBVA 4OHZA 1Y3CE 4HGZA 4EG1A 2H1SA 2Q4OA 1C7EA 2DPXA 3T06B 3WYAA 4BC0A 1VHQA 4ETMA 4F91B 4PPGA 2RK4A 4X1IA 3TQCA 2Q1TA 1WZNA 1MABB 3AKYA 4FHZA 1HSZA 1BHJA 1N0WA 4FNMA 4V24A 2GZ1A 5D8DA 4CM5A 4DWOA 2JLXA 3PIIA 2R8OA 1L8AA 1TB4A 1WB5A 1ZS9A 2QRKA 2GJSA 2VP2A 3OKCA 2ZI4A 5KI6A 2HHCA 5HK8A 4D0LB 4XQ0A 3BSYA 3ES9A 3L8MA 1E1LA 1PU2A 2HC9A 2RSLA 2YS7A 4BKRA 4MRSA 5TEVA 1M2HA 2BMDA 3AUAA 4RVSA 1D1SA 3H17A 1TU3A 1G3UA 2ZKLA 2NO6A 4HXYA 1HC7A 4RZ2A 1GQOA 1HT3A 5DTRA 2ACEA 1ISGA 2PX0A 3USZA 4Z51A 1LX7A 4ZCLA 3G02A 3RU9A 1M1YB 2ACVA 2QU7A 4ZARA 3VTKA 1NNEA 3L40A 4Q9JA 1X3SA 2GZRA 1YCFA 2FW7A 2EBHX 3HN6A 4MUAA 4KSCA 2NTYC 3IBYA 3SEFA 3CUUA 4AURA 4HNTA 1SKMA 2BFFA 2H2FA 4OYLA 4CR7A 4ZI3A 1JHOA 3I0NA 4Z1OA 2Y77A 2OPBA 3EEYA 4LTDA 1LVUA 2YX1A 4R5HA 4BQPA 4RTRA 4RJ2A 3G8BA 4NOLA 3C6XA 5DM70 3ZDDA 2GLUA 1NOJA 4PO8A 4RSMA 1Z2OX 1SN7A 3ND8A 5EHIA 3LLUA 1ZIOA 5JS2A 3GRZA 1CE8A 2OHFA 1RBZA 3MMSA 1YOVB 4I2VA 3UAYA 3RT9A 1AD2A 1LNQA 2VTVA 3OZSA 1PJBA 3CLUC 3O91A 1PQYA 1C7JA 5KNLA 4R1TA 2XDAA 1RMYA 4GOXA 1AC5A 3K71B 4WY8A 4BJHB 1I0LA 3ZXXA 3WRXA 5HK9A 3VHLB 1M0SA 3VVBA 3JAMA 2O8CB 3TSYA 4DQKA 3M34A 1KE1A 3ABIA 1N3YA 1UWCA 2F67A 1C4KA 1EWYA 3PYMA 2FAXA 4YRPA 3WV4A 2F3UA 3ZV4A 4YFYA 4US2R 5K3SA 2X19A 2NTNA 2F2TA 1PJAA 1FFAA 1E2HA 3KVNA 3FHTA 3W2FA 1EVLA 3KWFA 4AX8A 4CYMA 4LZWA 2Q29A 4AS1A 1E8DA 5BNFA 4KAAA 2BV3A 2JFNA 1IZ8A 3VPXA 5K8LA 1TYDE 1K75A 1Z2CA 2R6HA 5LJIA 1WETA 4I2NA 1DJLA 3WIUA 1PUXA 2ZAMA 3B1JA 3WS7A 4B5KA 5LB2A 4QO8A 1EEXB 4JBGA 2FMTA 2PMKA 3K2BA 4BV2A 5DBEX 3W8EA 3RIMA 3IB3A 1ZYUA 4KR2A 1JAHA 5FNVF 1UBNA 2CXRA 1LF0A 1YE5A 2EKBA 1NNUA 3NTRA 2AMVA 3UAVA 3ED1A 4KGDA 4UMFA 4UEQA 1M2KA 3U81A 1UXOA 3FDZA 3R6TA 4DLZA 1UBEA 3KYCA 4OI0A 1P9RA 3GFPA 5KUTA 3NTLA 1SURA 3FFWA 3WRXC 3SF8A 1JEJA 1VLJA 5A2GA 3BGWA 3IEIA 1NGSA 1EWVA 5G1OA 2VLBA 1RHKA 4P93A 1QTIA 5G0TA 3NKLA 2RB4A 4FQ8A 1TYZA 2OCKA 5I9BA 4ZYVA 4A5OA 3U7FB 4AXBA 2RBKA 2JKVA 1WKVA 5JPIA 5T57A 1RJ9A 3Q4GA 4HP8A 1KFCB 5TEWA 2PBZA 2QQEA 3IKVA 2ZUSA 3AUFA 3CKMA 3Q10A 1PFVA 2LTAA 1Z7YA 3HJHA 2NVOA 2AOTA 4IIXA 1J21A 1UADA 4MIOA 4D02A 1F5SA 5IKPA 4LOKA 5CXUA 5ESRA 1ML3A 1ZG3A 2ZRBA 2EC5A 4EJSB 4R16A 4C7KA 1P2UA 3WLFA 3OZVA 5IBCA 4ZZ0A 1XN4A 2V6FA 3ETLA 4MHOA 1I7PA 5PNTA 2WI8A 3FYUA 1XJWA 3T8YA 1DEAA 4YCSA 3SBDA 1U0EA 4F3RA 1EP1B 4CFSA 3WQQA 2FH5B 4V0LA 4HQ6A 4TT3A 3R5KA 1BX1A 4RGQA 5IAGA 1W4LA 1ZUHA 2PG3A 2ZRAA 3ASVA 4MTLA 3E9DA 3NVDA 5EHZA 1SC9A 3NHUA 2P77A 3BHIA 2YDYA 1KJ8A 2RB5A 3AEKB 1M9NA 4GH5A 3AFIA 4HJXA 4L5IA 1XDSA 1A9ZA 2JIBA 3AOEC 1SCUA 3WSTA 1T35A 1CULC 2SHKA 4WBSA 3FZNA 2OV4A 1PGJA 4HY3A 4MA5A 2A14A 5KTKA 2AMLA 1Y8RB 2ZWVA 2JEYA 3JAKA 1HDEA 1VB3A 3DTTA 2Y0EA 2PR2A 2O57A 3S1AB 1DUSA 1GU1A 1E5XA 1IFXA 2HOQA 3QLVC 4RMGA 1C80A 2EJWA 4IP0A 5JRJA 1DEOA 1P0FA 1Z5NA 2ILVA 1Z6YA 1Y9EA 2HDHA 3ECAA 1P1IA 4J0FA 2LBPA 3B2NA 5DU2A 1NW3A 5CB4B 1KMNA 1MX1A 1I5OA 1KZYC 4NPCA 2QKYA 3VR1A 3A8TA 3ZWWA 3KQKA 3LZDA 2Y2VA 4YMGA 1KJYA 3MWJA 3Q98A 1DC8A 3R76A 2HIGA 5GOZA 5JXGA 5KIAA 1ZY2A 4QYIA 1NYTA 1V1JA 1IM8A 4XR4A 5AXAA 4CETA 1TRKA 2DPHA 4HDSB 1E1KA 3VAZA 2XH8A 3O2QB 1DAMA 1R00A 2R5WA 2ZT6A 1FUKA 2GNOA 3DP7A 3H8WA 3O94A 5DE3A 4Z54A 4EI8A 1QXSA 1JHPA 1HL7A 4GKVA 3U40A 1N0UA 3W04A 2GN1A 4O2BA 2WA1A 2ECQA 1ZFNA 3M2TA 1T2VA 1M1XB 2MMGA 3MHTA 5CDGA 2MDTA 1VE9A 2X4GA 1I5EA 1X6VA 5JYBA 4EG7A 3SS7X 4RJKA 4B4DA 2WOJA 3KAKA 4UZFA 4ZVQA 4X84A 1I3NA 5F1KA 1KYVA 3A3YA 2GBLA 3VAAA 3P94A 3LOUA 3DZCA 4O4LF 2BR3A 1KY5A 2UZAA 4Q93A 1Y4UA 1BE8A 1AZSC 1OWPA 3PITA 3FZGA 4DC0A 1NVBA 5GZ3A 2XZPA 2JIZA 2IZ7A 3WE7A 4RDXA 3ZE8A 5JS7A 2HNBA 4BLQA 3VR6H 2BGTA 2G08A 3EAQA 3FCSB 4WJLA 2XE7A 2CT8A 1T6BY 4BVKA 1GTJ1 4FB4A 4X63A 1JILA 1XWWA 2TYSB 2PWZA 4ZJPA 2VI5A 4LYFA 1LRKA 3PA8A 2ZRIA 4KWEA 1SWWA 2ZRQA 3DTNA 1T34A 4EA8A 4EW3A 3BZUA 1K9VF 3LUJA 1T6XA 3P2MA 4JVNA 1V1RB 1XCMA 2OD2A 4TTAA 2F3TA 3PPXA 3ND7A 4LSWA 4TYPA 2A30A 3UOGA 5KYUA 3ZWQA 3LUPA 3WJAA 4R81A 1VPTA 2GNAA 1JEDA 1Z06A 2PQMA 2Q5EA 2X6RA 1BG6A 4LY6A 5BQ5A 2PZMA 5TB5A 2PJZA 3TOZA 4C22A 1ATIA 2VIIA 4H1TA 2H65A 2YWHA 2VDLB 3EXG2 4LC0A 4OI4A 3QLTA 5TMEA 3D3WB 1DMRA 3ICEA 3RC9A 3A1NA 3GDWA 2ZVPX 4X7RA 1J4AA 2P9EA 3LQ2A 2OVFA 5HG0A 2OBNA 2GO7A 2LCQA 3ZE9A 4PBSA 1XYVA 3PQ8A 4JLNA 1U63A 1KVRA 4Q5IA 1JKMA 1GA4A 3PUZA 2ZW9A 5C8YA 4C08A 3E9ZA 1PNVA 5M29A 1DI0A 3R7BA 2UDPA 3KO8A 4J7XA 2HJVA 2CVHA 3DLHA 2ETXA 1LVGA 3VR3D 1LNZA 2OR3A 1C8BA 4I9FA 3OM1A 2NM0A 3KOOA 2PGXA 2VZ0A 3C3WA 2FCAA 2BBTA 2AR7A 4WESA 1ULUA 3DVRX 2GAFA 3ZJUA 2DLNA 1JGTA 3IDOA 4Y9DA 1W5EA 1QHHA 5KJ1A 3A0UA 3A1DA 4LMRA 1XEWX 3LP8A 1ESZA 2LGJA 2R68A 3OT1B 3IOCA 3AW9A 3O0TA 4V2UA 4GBMA 5FTKA 5TARA 3T9BA 2V6BA 4OQ4A 2PD4A 2HV9A 1YRWA 2BAGA 3QLUC 4KK4A 2PANA 4LOAA 3VC3A 3E7XA 2H1WA 1BH2A 4C5AA 1JPVA 5TE9A 5DNUA 3D4IA 3RVRA 1XRQA 1G2IA 2G63A 4G0XA 3W2IA 3HWSA 4XQCA 1Z18A 3G2QA 5CYPA 4F72A 1CPYA 1ZM2A 4E30A 2A3RA 2N47A 5DHUA 1FP4A 5LZ7A 3SCZA 3VO1A 3CPJB 1Q17A 5GINE 4F3KA 4RA6B 4YCNA 4KIJA 4IFIA 2H7YA 4QXOA 3OMLA 3LC0A 2H1LA 1SC3A 1MXHA 1I2MA 3I52A 3R09A 1EFRD 2VJOA 3VC1A 2CNNA 3IP5A 3O4GA 4KDCA 4REMA 4WCDA 4IDQA 3D4OA 3TMYA 5KTSA 2WWYA 4O4HF 4Y2RA 1UZLA 3ZE6A 3UB4A 4U4AA 4XDHA 3ZWBA 2EX1A 4JBXA 5KU1A 4PPFA 3H86A 2OFFA 4ARUA 3MGBA 4RGVA 4RPHA 5M3BA 1DIGA 1D5CA 4J0QA 2CVZA 1XVVA 2P0YA 4MRVA 1E1QA 5DBFA 1MC8A 1JLHA 3L8EA 2RC5A 1O2DA 4MJ3A 4C21A 2W6JA 5EJ5A 3K9BA 2WHEA 4KREA 5AD1A 1P3DA 2NADA 1NRXA 2IE8A 3WLIA 4Z9XA 4N54A 4N6NA 2VOEA 1Q7RA 2GJ8A 1Q21A 3PYXA 3A31A 4BO2A 1H22A 3CLSD 3K4HA 5KC9A 7REQA 1SQ0A 4NV1A 4KFRA 5JRZA 4TL7A 5K8UA 1L5OA 1ZZEA 3FD8A 2OZKA 4RU1A 4G8BA 3B6JA 3F6BX 4IOMA 4ALLA 4IICA 4ND7A 2RGNC 4AZ0A 3NHYA 3CWQA 3UMFA 1UUFA 3K73O 3WZLA 3L1UA 5LWHA 3MOSA 1GTG1 2CDNA 4OXKA 2OA0A 4XB2A 3MIIA 2X8JB 4BFSA 4CQMA 4LJRA 4C9BA 2IIVA 4DF3A 4X1KB 1A9YA 4R6XA 2WIBA 3CNOA 3KQSA 3DTVA 2SICE 1CUGA 4C2TA 1MZPA 5B53A 2PS0A 1ZUD1 3IELA 2YZKA 1GRNA 3CS3A 1H1LA 2YN0A 3QXJA 2HWWA 4L5JA 5SY9A 1EFCA 5CVVA 3AJAA 5F2KA 2PUAA 1WXGA 1QDEA 1E8NA 2BI4A 3FTCA 3PCXA 1IUNA 1Y3FE 2GOYA 3BWMA 3ONWA 4U8GA 1JEQA 1WCIA 4ZO6A 5ALDA 5I7VA 5ALFA 5AYVA 1Q50A 1U0BB 4J0GA 1XJ0A 1YL7A 3OLZA 1W5FA 4DDHA 4E5SA 1T36A 2GHIA 3WWPA 2XQKA 4DJ5X 1YRQA 3WB9A 4HVTA 3RJMA 4ND5A 1XCLA 2Y8EA 4IMPA 4V1CA 1G8FA 5A02A 2CXXA 4BHTA 3IMKA 2OPHA 3K0KA 2B2NA 4LDPA 2AFIA 3G68A 4JT8A 4D4HA 1A4IA 4ZO4A 5FNVB 4Q7JB 4A0SA 4CR8A 4BVBA 2W0SA 1CS0B 4GRIA 4HVAA 2BJHA 5AKKA 1LSOA 5EFZA 3ZNOA 4KXMA 3TE6A 2WIJA 1WMEA 2NSYA 3W5HA 5JSQA 3RTEA 3PD1A 4DSTA 5COAA 2BISA 1LWOA 3ME5A 3OZWA 1GOTA 3O73A 1ZD4A 1TMKA 1XTIA 2HZBA 3DDUA 4BFUA 5FPTA 3MRXA 4CQNA 1TCBA 5I6DA 3BRWA 1Z8HA 3I45A 5JCXA 1XZGA 2Y1OA 1OAKA 4RVNA 1IOZA 1Z4LA 1QE3A 4V0KA 3T5AA 2HCTA 1GPH1 3HZOA 4J16A 5KINB 3E05A 5F2NA 1ORIA 1ITZA 5EWJB 5KTRA 5ALNA 4QU9A 1YUNA 2BFPA 2EEZA 4JUDX 1Z15A 1GGEA 1MU0A 4WZBB 3SKVA 1CY0A 2BEKA 2H06A 4EUHA 2EAUA 3A9RA 7AT1A 3WL3A 1JHMA 4FR5A 4W63A 1YB2A 4RVOA 3TE7A 4YRJA 4JLOA 5DNAA 1PQWA 3N7AA 4LCBA 3WSWA 3F9IA 4FWIB 1EAMA 4ZOBA 3H1TA 5KSWB 3ENQA 3H4TA 1SJ9A 4MB6A 4MLCA 1RBMA 3ZZ1A 1Z3CA 1KBZA 4ISCA 4Y0VA 1W0JD 3ST7A 5FEUA 1OBCA 4RIIA 1TA9A 4JUBA 4B6SA 3M5PA 3FOAA 4ZVUA 3B78A 4MYSA 5LQAA 1S9HA 3NH9A 3QVXA 5FXMA 1DV2A 4HNAA 4CM7A 5H9WA 3SQLA 3TVYA 3MT9A 4U9UA 4YT8A 1SXJC 1J25A 1X2BA 1SU7A 4IXMA 4KPUB 1VA4A 1EAYA 1RS0A 3RGGA 3IMGA 4BZQA 1CQIB 4OBEA 5IM5A 3B82A 3HTXA 3PU6A 2SKEA 3Q3IA 2RGWA 4QUDA 4IHJA 5BWBA 4RPGA 1YJ5A 2OMEA 2JJ2A 4NBKA 4PYRA 1JS1X 3SG0A 2I4TA 4OD0A 5DH9A 1S3FA 2WKPA 4MUKA 3EJ6A 1JBEA 1IBSA 3I9FA 1EB8A 3LL7A 2Z5VA 4PNHA 2QAJA 1DXYA 2C83A 3V8NA 4Y9RA 1SU4A 1P7ZA 4BZXA 3ZWXA 4QLAA 2Z1DA 2PUDA 4O6VA 1RI1A 2YH2A 2Q9AA 4HQNA 4H4DA 1VI6A 4IF4A 3ROPA 2GPYA 2GO1A 2X7JA 1CC1S 3JQBA 2G04A 3Q3GE 5I9MA 3WDMA 3M33A 5JYEA 2XB2A 3U62A 1DBPA 1YDWA 2PLNA 4WACA 4DADA 1O0CA 1QWSA 4MA0A 2YHIA 3IV6A 2P6RA 2O5RA 1QZXA 3PXCX 4UCFA 3WLHA 1SR8A 2RHDA 4RVFA 4RKWA 2WJHA 3AR4A 3SX0A 3S6JA 3C6ZA 5LP6B 1CIJA 2OV2A 1SUBA 3GWGA 3HJBA 3LQQA 2SKCA 1N5MA 4GX2A 1VL5A 3DMHA 3AOEA 3BVPA 1L5YA 5FPHA 4BNMA 9ATCA 1QMGA 3D7MA 2R66A 4PC2A 1JX6A 2CJWB 5GJVC 1QCCA 1CEEA 3NAQA 5DGHA 3I8OA 1JXQA 3C5CA 3NHPA 4Z2AA 1OH7A 4PGGA 5EERA 4ZREA 3F6RA 1XQ9A 4EFKA 3N76A 1TKRA 2G9NA 4AVYA 5LA6F 2UXDB 1U7ZA 4H31A 2BJWA 1FMJA 2PU5A 3NHMA 5C1IA 3DZKA 2AHRA 3FB4A 2R2AA 1YC5A 2AGVA 5JASA 3HKEB 4F1KA 1XDWA 3EXAA 4OUDA 4P7GA 1SRQA 5JO0A 8OHMA 5HCIA 3KWLA 2HU2A 1UPAA 3FIJA 3GZJA 2A5LA 2F8MA 1SUDA 4DR3B 4L3WA 4X5OA 4BNFA 1E3MA 4TL9A 2V98A 1D4FA 4MR7A 1TXGA 1FU7A 4MAFA 1W4RA 4ZV7A 5AVKA 4K0KB 2RONA 1KI6B 2GPNA 3C3XA 3W4KA 1U3UA 3QKSA 1R4NB 2ZI3A 2XQFA 4C0LA 3WL6A 3D3EA 4OBBA 4MQ5A 1VLHA 4F04A 2BIFA 1E60A 2RHWA 2QN8A 4M49A 1JJBA 1KETA 1QX3A 3IJPA 3R4VA 3I2JA 1V47A 4TZ6A 3NJ4A 1SIBE 1EA5A 2BDTA 3SWWA 2BGNA 4E2XA 4NZNA 1RBQA 1Y1RA 1XQVA 4D3FA 5JTTA 4KUGA 4NK5A 4CODB 4MI1A 4OKNA 2V65A 4FMBB 4GZ6A 5EP4A 1X7ZB 4KO8A 3DE0X 4DV7B 2B1RA 4GPTA 2ZQZA 1T3SA 1UEIA 1QHYA 3GA0A 3MJRA 3SR4A 3ZHYA 1Q1BA 4RD4A 4CMKA 4I08A 1HT0A 1O96A 1Q0UA 3C98A 1EG2A 1G41A 3G85A 3BMNB 3UWDA 5AT1A 2ERYA 4UARA 5FQNA 4YJFA 3B6MA 4LHYA 1AK1A 2I9PA 2WU8A 2UYHA 3PC3A 3OF5A 3T1QA 3WG9A 1G6HA 1ZH2A 2IHUA 2XIJA 2Z4RA 5AICA 1KFJB 1Z88A 3HPQA 3WHIA 1E3QA 3CW8X 3EG5A 1NG9A 4TV9F 2JHFA 4JI5B 5K8JB 2J0UB 3R9XA 5E6UA 3T54A 3CYFA 4YJKA 1LB1B 3KE8A 4PZLA 4B31A 4B3TB 4YAEA 1CJBA 2AQ8A 2WE7A 3H99A 5CW1A 3M3DA 3EHDA 5LU9A 3I6MA 3Q8MA 5AVJA 3MQ2A 1WLYA 3H5RA 4YJ3A 1QVZA 4ZQEA 4G25A 3GHYA 4UJ3A 3ICVA 1T4GA 1NF2A 1TU4A 4P86A 4Q4CA 1RXEA 1B16A 2D13A 3IOEA 3O2SB 4WFQA 1VB5A 3OTWA 4HN2A 2YJGA 4JUCA 5HQTA 2F1HA 2IBTA 2C07A 3L49A 2FW9A 4PGHA 5CDUA 1D1QA 2C57A 3P2OA 4PVDA 3HB5X 4KQGA 3X1MA 4UTZA 4M76B 3QEJA 4FHEA 3E84A 1CUFA 4RIGA 4RCYA 4YROA 1NLZA 4WNIA 3IBCA 3GJ4A 2AEEA 3IUNA 1IG0A 3Q0IA 4JA0A 4OG2A 5DHAA 3LK6A 1K8YB 2ZYGA 5IKXA 4PYLA 1TTPB 1DKRA 3VNVA 4PX9A 3BMXA 4QC2A 4E7PA 4B33A 3P9PA 5DT2A 4RNCA 3DOCA 4TTQA 5HZKA 3UGKA 5LQJA 3VHXA 5JAHA 4YIKA 1JIJA </