2YXQB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxqB00
3JC22 1RHZB 2YXQB 2YXRB 1RH5B 3MP7B
chains in the Genus database with same CATH superfamily
4IL6E 3H1LE 2K37A 2HFED 1T8ZA 3VP9A 1IO4A 2FYUK 2IYOA 1BCCG 3RBXA 2GUSA 5GTHH 1N7SC 3HTKB 5KAFE 3CX5H 2M3EA 2Q5UA 1KZUB 1ZRTD 1M1JC 4Y99C 2O1JA 2QVAA 3AE7C 3CCRP 1NTKD 1HUCA 2W6AA 2M8RA 1SQBE 3M9BA 1PV3A 3D6ZA 4K35A 1S5LH 1AFOA 1W5CE 3CL3D 1SS1A 1IZNB 2WMMA 4HYTB 3W68A 1L4AB 3U1CA 2HPCB 3A0BE 1GW3A 1MFZA 4GOEA 2WWWA 3G6EP 1KN7A 2A06D 1SP4A 3IN6A 2KSEA 5AW3B 2AEMA 3LW5J 2WSCH 2A45I 1Z56A 3L74D 2N1TB 1VQPP 1LT1A 1AA0A 2E75B 2IZ1A 4NPDA 2FXPA 1OWAA 1BGYD 1VPCA 1KQGB 2Y0CA 4KHXA 1PGPA 3H1JD 4D6TJ 2PP6A 3P8CD 2FYNB 3E7KA 1G2CA 4IFFA 4EDFA 4EI2A 2W90A 4GDOA 1MZ9A 2GA1A 1G1JA 2Y9ZA 2QIWA 1S3JA 3JC22 3KYQA 1NTMG 2B87B 1NU1G 2IBZI 1GU5A 1LTBC 1SQQJ 4WY4C 3EFFK 2R44A 4PD4H 4W80A 3HRNA 1BDCA 1JUNA 1KILD 3A0HH 1A02F 3L36A 1RE3A 2CPSA 3CC7P 2GM4A 4TLFA 3L73D 1VF5C 4DJGA 3RK3D 4H0LB 1KTMA 2JDIH 2K88A 3V6IA 3HD7A 2K1AA 5TISH 3L72J 1DX7A 1SQQE 1SQPJ 3HE4B 2IBZE 1RY3A 3VTPC 1PP9J 3L75G 4XFJA 5CCHA 2PAJA 3CC4P 2LR2A 2OYOA 3H1ID 1CW5A 2ZYGA 2E5TA 1LTJB 2JJLA 4OGQB 1OVUA 1LNQA 2WPQA 1K9MQ 3CMEP 3L70G 1NTKJ 1JCDA 4GOFA 3IAOA 1K05A 1YQ4C 1X0TA 1NTZD 1L4AD 2KIKA 1QLED 1SQPK 1ZLLA 2FYNC 3CWBJ 2O01H 3HD7B 5KAFH 3L75E 2XNDH 2KYVA 3CCJP 1S5LX 2V4HA 3TSIA 2N1TD 1P84D 1FZAA 1H88A 1OX3A 3L74J 1QEXA 1N7LA 2Y9YA 2SPZA 2ITAA 4YTPC 2N9YB 2P58A 1BGYJ 3CWBE 1QL1A 5KLVJ 1Q7YQ 1LTAC 4CPGA 1PIXA 3HE5A 2JWAA 3BCCG 2O1KA 1ZN5A 3HUSA 1NTKK 1PPJG 1L0NJ 1GL2C 5B66E 1YTZT 3FGAD 2RN0A 2Q9IA 1YHQP 1FJKA 3FWLA 3ZDMA 2KNCA 5E79H 3MUDA 1JMBA 3AE9C 3PLNA 3V2NA 3WUVA 5KLVE 3RL0g 3G4SP 1FDIA 2FBWC 2POHA 1XTGB 5CHXA 1L0NE 1HGVA 3M91A 3H1KD 4H0LD 3PTZA 2KLVA 1BE3J 1URQA 1YQ3C 3MD0A 3Q2YA 4UB6E 1GU4A 3P8MC 3PH0A 2YO3A 3CCMP 1EXIA 2FYZA 2OYIC 3MHVA 2WPRA 3CCVP 1KD1Q 1RH5B 4L74A 1IFIA 2XZRA 2YMYA 1BE3E 5AVTB 1FOSF 5KKZC 3HUSB 4U3FE 1RE3C 5AVQB 4O9BA 4GODA 4ASWA 4DT0A 3IR9A 4OGQD 4AYCA 2YIUC 2L5GB 1VQNP 1K73Q 2AXCA 2OTLP 2FFDA 1SFCB 3U1AA 2E43A 2IFMA 3H1HE 1JMMA 1FZCA 3R2PA 3TGUD 3FXDA 2OYHB 1KYOE 2D2CB 1NTZJ 2KI7B 5CCHC 2E76C 3RK2C 1S9KD 1URQB 3HD7D 1T2KD 2ZAEB 1NKNA 1P84I 1HJ0A 2QJKC 4AUWA 1CZQA 3R4YA 4GKGA 3L71E 5CCGA 3BASA 3CCQP 1SQBD 2E74B 2BCCD 2NPSB 3B5NA 3V5BA 1Y8AA 3WU2H 2Q6QA 1DH3A 3ABVC 3N4XA 4L75A 3M9QA 1BCCD 5AVUB 1KB9I 4KT0J 1J1EC 3NMDA 3FWNA 1NTZK 1EDLA 1FZCB 1HGZA 1HTLC 2Z4EA 1GK6A 3MTUE 2FYUG 1EXJA 1IJDB 5APTA 1SQXD 1FS0E 2AXTE 2MJZA 5KAIE 3SSUA 3O6QB 3H1KJ 4HH2A 1X79B 5GTIE 3HUSC 1KB9E 3CC2P 3HTKA 5B66H 5APVA 4KJMA 1KFNA 1AVOA 3H1LG 4H13B 3Q5RA 1LWUB 1RF0A 3B5NB 1YTZI 3MUDC 1LTGC 2QM8A 3S9OA 1SLQA 3V2PA 3Q3DA 3CXHH 1ZP0C 1CI6B 5B5EE 2E42A 2FYUE 1JY3P 1L4AA 4C46A 2HPCA 5AW6B 1FZBA 3BATA 3GF7A 3PJSK 1SFCD 2UWJE 2H7HA 1NTMD 3EFGA 1NU1D 2N1TA 2QJYC 1YITP 4N78D 1TU3F 3AEBC 3TGUJ 2D2CD 2G3AA 3KZIE 1URQD 2P10A 2GUVA 2WZ7A 4MN4C 4OWFA 1E79H 3PP5A 5C39A 1SQVK 1FZFA 1IK7A 2Q1KA 3H6PA 2E74D 2FFDC 1YJ9P 2NPSD 2J58A 1FZCC 2B87A 4LC1A 4ZMDA 1OW8A 3OAKA 1KYOH 3TNUB 1BCCJ 2W83C 3O8ZA 5AW7B 1FU1A 2A45G 2WSEJ 4GT1A 1T6AA 4HJGH 5AW9B 2KZJA 2WSFH 3MZWB 3CCSP 5CCGC 2N9BA 1S1CX 3G71P 1LT9A 3TK1A 3Q5SA 1AV1A 2V7QJ 3B5NC 5AVXB 3HE4A 3L70D 4WB4A 1DD3A 3BVHA 2YNYA 4RESB 1SQXJ 4YPCA 3H25A 1SQBK 5APWA 1SQQG 3VMAA 1KILC 1N73B 5CCGD 1LP1A 1JY3O 2IBZG 1M56D 1RF1A 3RK3C 4H13D 1KQSO 3P32A 4U7JA 1LTJA 1VL2A 3B5ND 3P7KA 1IFNA 1YYCA 3CXHD 3VMYA 4D6TE 2KB7P 3NFQA 1EDJA 1QVFO 1SQPG 3ITKA 3WUUA 1QVGO 3M0AA 1N2DC 2OARA 1RHZB 1PP9G 3BCCD 4BWNA 3C9IA 1KC8Q 4WVZA 1PPJD 4R4MA 1LT9B 3V2RA 5KTBA 2LXBA 1RF0C 2P7JA 1SQXK 4C7RA 2I1JA 2R32A 1NTMJ 1NGMB 5AW2B 1USDA 3CX5D 1Q2NA 4OVNF 5B5EH 4JPZB 1NTKG 3L72E 5APQA 1LP1B 4R4LA 4IFDK 1L4AC 1RF1B 1SQPE 2H88C 1RQVA 5AW4B 2OQQA 2QM7A 2KSJA 3KDPB 3E1IA 5CMZA 3CWBG 1JNMA 1NH4A 2C0WA 1PP9E 1M7LA 3MGNA 4ASVA 1ZR2A 2YKQA 2N1TC 1BSNA 1S2EA 2E75C 5AW5B 4DOJA 2A06G 2H8PD 1PGQA 2XDJA 4IL6H 2JWDA 2HLOA 3LIDA 1ZW0A 1EZVD 5APYA 2ZVNB 1NVOA 1ZRTE 2XV5A 1NTMK 1NU1K 1QGKB 5KLVG 3AEFC 1IC2A 1AQ5A 1NTKE 2E75D 1R5SA 1U7JA 2ZXXA 2C9LY 1L0NG 2FXOA 1N86A 4RKUJ 5TJHA 1L0LD 2K9JA 1VQ8P 2WITA 3H1JJ 5AW8B 3VMZA 4N3YB 1QX8A 1DIPA 2QSIA 1Q81Q 2QJPB 2A06E 3A0BH 3OW2O 1JM0A 1U7MA 3E1RA 1VDFA 4H0LC 4RJTA 2PFXA 3L74E 5KJ7D 3VYIA 4PD4D 3RBZA 4W7ZA 1X22A 1LT9C 1BGYE 1BE3G 3B8EB 1IK9A 3H1JE 4WBAA 4U3FG 1NAFA 1SFCA 3P8CE 3CMAP 3FXEA 1Y9BA 3Q1MA 5KLIB 2OYHA 4PV1B 4WWIA 3JSVC 1H0TB 2FKWB 3SWFA 3L73J 1OXZA 4DZOA 1AVYA 3BCCJ 1OIPA 3LW5H 3D6YA 3H1HG 1HJBA 4PJ0E 5APSA 3RL0B 1RF1C 1K04A 1LTJC 2LKMA 4OGQC 1VQMP 2K9JB 1PGOA 3KHUA 3LIEA 3GHGA 3CX5I 2A45H 1SQVD 4K3AA 2XU6A 2NPSA 1KILE 4NPEA 1OVRA 2M5AA 3C1LA 4C7NA 2P1JA 1LTTC 4UB8E 1SVFA 3L73E 1K8AQ 3RK3E 3L4FA 3F89A 3L71G 3W67A 3U59A 3A3YB 3M0DA 3VP8A 4EIJA 3H1IJ 3HD7C 1T2KC 1LGHB 2VRSA 1NTZG 2R5DA 5AW0B 2QA4P 4JYCA 3H1LD 2JKVA 2JR8A 5AVVB 1OW6A 1N7SA 1HF9A 1MFTA 5L8RJ 1EZVI 5H2FE 2M3BA 2QRXA 4DCKA 1JY2N 1R8EA 1LTSC 3H1IE 4I7ZB 2B89A 4IL6X 5CJ4A 2WSCJ 1FJPA 3O6QA 2QJPC 1DEBA 2ZXEB 2HR3A 1S5LE 3NTNA 3GHGB 1IFJA 1ZOYC 1JY2P 4LLHA 4B86A 1LWUA 2M5AB 2P2UA 4C7NB 1NTZE 1L0LJ 1JCCA 2R5BA 2Q3EA 2JO1A 1CI6A 2Q3IA 4PD4I 3CI9A 1P84E 2R3CA 2Z5HA 1PL5A 1EC5A 1N7SB 1NAYA 3C8VA 3H1KG 3QWOC 2KS1B 2H89C 3AEGC 3BRVB 1NYHA 3IF4A 1HH0A 1M1JB 4Y99B 4ZNCA 2HODB 3F5HA 4PV1D 2RKLA 2I8DA 2R3SA 3VMXA 1D7MA 4HKZH 4QMAA 2FXMA 2KZIA 1L2PA 1L0LK 3RL0D 1FAVA 2NZ2A 1RE4A 2OTKE 2IX7C 3CCUP 2WVRA 3CPWO 1FDMA 4NPFX 2WQYC 1JY3N 5K5GB 2IDBA 1SFCC 1SQVJ 1WRGA 2W8ZA 2Q7CA 3H1KE 3A7OA 1AQTA 1CSBA 4JQ0D 2OYHC 1FZGA 2D2CC 1FBMA 1LTIC 1HWTC 3AEEC 3TNUA 1SQQD 4I7ZC 1URQC 3TGUG 3M06A 4ZKPA 1KORA 4PJ0H 4I6MC 1NO4A 1NOHA 2IBZD 4UB6H 2W6JH 1UIIA 1GZLA 4M3LA 1QL2A 1MV8A 1HBWA 1DD4A 1X8YA 2WPSA 4JBZA 1JY2O 1VQOP 4LGDE 2YXQB 1HVVA 2E74C 2NPSC 1MKMA 2O01J 1Y47A 1VQ4P 4UB8H 2Y0DA 1X9VA 5AVSB 4WY4B 3AE4C 2NRGA 2K9YA 3EQ2A 4EOTA 1GD2E 1PP9D 3B4SA 1M90Q 1N73A 1VQ9P 1LJ2A 1VF5B 4L76A 5CBOA 1SQBJ 3TGUE 5KJ7A 3VN0A 2BCCJ 2IPPA 2LXCB 3S1KA 5H2FH 3SWKA 3D70A 1S9KE 3L75D 1IFDA 4W7YA 1PFIA 2IZ0A 4XE5B 4D6TG 3T97B 3SWYA 3PRJA 2ZT9B 1N7SD 2KP8A 1SQXG 2BCCE 2O01N 1MUUA 3CWBD 3TF5A 4H13C 1LWUC 1XTCC 3TDKA 5CJ0A 2QG4A 2YMKA 2ZYDA 1GL2A 3AE6C 1JTHB 1BCCE 3CCEP 4JYBA 5EFWB 5E79E 4BRYB 4EYYQ 2YXRB 2PRRA 2IYPA 5KLVD 1AJYA 1P84H 3V4WA 5AVYB 2WPVB 4Y28J 1KQFB 1NJIQ 1L0ND 3L72G 3L37A 4YXWH 3JCUE 1SQXE 2WSSH 1YJNP 4H44B 1NHLA 1KFMA 1M1KQ 1E5WA 2AXTH 2L91A 3G3ZA 3WMM0 1KV4A 5BU5A 5KAIH 2OYIA 4A7PA 3PHLA 5GTIH 2PGDA 3OA7A 3CD6P 1KB9H 3AE3C 2BASA 1RE4C 1J1DB 5APUA 1WMKA 1A02J 1PZQA 4ZKUA 3QH9A 1GL2B 1BE3D 4U3FD 1NU1J 2JEEA 2E5YA 3CLQA 1H89A 2BEZF 3S4RA 3UIAA 4WY4D 3A2AA 1G2CB 3AEAC 4XA4A 3H1HD 2OTJP 5AVWB 1NTME 1VF5D 2CPBA 2YO2A 1NU1E 1YIJP 1OMIA 2ZT9C 1OW7A 3B71A 1KYOD 4N78E 2QEXP 1SQQK 2HYNA 1T3UA 3L75J 2OYIB 3L74G 2XNXA 3KZIH 3NXSA 2ZYAA 1GTWA 3CCLP 3L71D 5M1BA 1UIXA 2C0XA 1BGYG 1H0TA 5AW1B 3WU2E 3H1JG 2ZT9D 1N73C 5KKZB 3GW6A 3WUTA 3II6A 2I1KA 5KJ7C 3EWKA 2C9NY 2YIUB 1YJWP 1Q82Q 3GG2A 3L70J 5BVZA 2KLUA 2FY8A 3GLMA 2WTYA 4H44C 3I56P 1PGJA 1Q86Q 3GF3A 3AE5C 1WT6A 2B9BA 4AQRD 1DEEG 1NWQA 2Y0EA 2KK7A 3CXHI 2XKMA 2E76B 1KQLA 3RK2B 1FE6A 3G9RA 5CBNA 3I55P 1J1DC 3L70E 2B88A 3L73G 4Z1MH 3K5BA 2MKVA 2QJKB 2BEQD 2M0BA 3GMAA 4H44D 1IFPA 3Q5PA 1Q90D 4BXLA 1RQUA 4GIFA 1KB9D 2WSEH 4RO0A 1OVVA 1EDKA 5DJUB 4L73A 1USEA 2CK3H 3CXHE 1OZHA 2V7QH 3H32A 1GL2D 1J1EB 2RMZA 3H1IG 2JP3A 3JCUH 4U3FJ 2FYUD 2Z5IA 5KLVK 3BCCE 1S4XA 1JOCA 5AVZB 3V4QA 1IFMA 2RH0A 1PPJE 1L0NK 4I2LC 1KYOI 3HE5B 4IOIH 3H1HJ 2WT7A 1EZVG 3MP7B 2KUBA 3USSA 5GTHE 2HG5D 3A5TA 3CX5E 1GW4A 1NKZB 4I1LA 2KS1A 2AEFA 2J5UA 1FDOA 1M1JA 2DW3A 1J2JB 2YKPA 2KNCB 2HODA 4YXDC 3OJAB 4IFMA 1GDTA 2WSFJ 1L0LG 3AE1C 1FOSE 3L71J 1W2EA 1EQ7A 4OH8B 3H32B 4TT3H 2AEJA 2G8YA 3FX0A 3IFMA 2ZVOB 1VQLP 1JEKA 5APXA 4JF7A 1EZVE 2W27A 3VOPA 5AVRB 2ZFCA 2QJYB 5KLIC 3AE8C 4PV1C 1YI2P 1N8RQ 1M8OB 5CCHD 2WT7B 2E76D 1ZXGA 3RK2D 1EDIA 2OGUA 1ZMEC 1BDDA 1L0LE 3RL0C 1U57A 3AE2C 2O3JA 1KILA 3RGUA 1FZEA 2FFDB 3KPEA 3L35A 2J59M 1G1IA 2K3RA 1VQKP 1SQVG 1ZV8A 1VQ7P 1W2BO 1BSHA 4PD4E 4WY4A 4D6TD 1T3JA 2KXPB 3A0HE 3KQGA 1YBKA 1KMIZ 1R5LA 1JB0J 1GK4A 5TISE 3D71A 3KXDA 2H43A 2FYUJ 3AEDC 1H8AA 1OFCX 1GMJA 3SFEC 3BRTB 1M57D 4HB1A 2KOGA 2YKOA 4N6JA 3T97A 3M9HA 2ZJSE 1SQVE 3TYYA 3MIWA 1KILB 3GHGC 3H1LJ 5BU8B 3SFDC 3RK3B 1VQ5P 3L72D 2QE7H 3AECC 1S72P 1SQPD 1FC2C 1SQBG 3I5CA 3V2QA 1JTHA 2P67A 5DJTB 2BCCG 1ZR4A 3M0DC 3N7NA 1VQ6P 2W6BA 4BRYA 2IFNA 1JO5A
chains in the Genus database with same CATH topology
3JC22 1RHZB 2YXQB 2YXRB 1RH5B 3MP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC2 2;  1RHZ B;  2YXQ B;  2YXR B;  1RH5 B;  3MP7 B; 
#chains in the Genus database with same CATH topology
 4IL6 E;  3H1L E;  2K37 A;  2HFE D;  1T8Z A;  3VP9 A;  1IO4 A;  2FYU K;  2IYO A;  1BCC G;  3RBX A;  2GUS A;  5GTH H;  1N7S C;  3HTK B;  5KAF E;  3CX5 H;  2M3E A;  2Q5U A;  1KZU B;  1ZRT D;  1M1J C;  4Y99 C;  2O1J A;  2QVA A;  3AE7 C;  3CCR P;  1NTK D;  1HUC A;  2W6A A;  2M8R A;  1SQB E;  3M9B A;  1PV3 A;  3D6Z A;  4K35 A;  1S5L H;  1AFO A;  1W5C E;  3CL3 D;  1SS1 A;  1IZN B;  2WMM A;  4HYT B;  3W68 A;  1L4A B;  3U1C A;  2HPC B;  3A0B E;  1GW3 A;  1MFZ A;  4GOE A;  2WWW A;  3G6E P;  1KN7 A;  2A06 D;  1SP4 A;  3IN6 A;  2KSE A;  5AW3 B;  2AEM A;  3LW5 J;  2WSC H;  2A45 I;  1Z56 A;  3L74 D;  2N1T B;  1VQP P;  1LT1 A;  1AA0 A;  2E75 B;  2IZ1 A;  4NPD A;  2FXP A;  1OWA A;  1BGY D;  1VPC A;  1KQG B;  2Y0C A;  4KHX A;  1PGP A;  3H1J D;  4D6T J;  2PP6 A;  3P8C D;  2FYN B;  3E7K A;  1G2C A;  4IFF A;  4EDF A;  4EI2 A;  2W90 A;  4GDO A;  1MZ9 A;  2GA1 A;  1G1J A;  2Y9Z A;  2QIW A;  1S3J A;  3JC2 2;  3KYQ A;  1NTM G;  2B87 B;  1NU1 G;  2IBZ I;  1GU5 A;  1LTB C;  1SQQ J;  4WY4 C;  3EFF K;  2R44 A;  4PD4 H;  4W80 A;  3HRN A;  1BDC A;  1JUN A;  1KIL D;  3A0H H;  1A02 F;  3L36 A;  1RE3 A;  2CPS A;  3CC7 P;  2GM4 A;  4TLF A;  3L73 D;  1VF5 C;  4DJG A;  3RK3 D;  4H0L B;  1KTM A;  2JDI H;  2K88 A;  3V6I A;  3HD7 A;  2K1A A;  5TIS H;  3L72 J;  1DX7 A;  1SQQ E;  1SQP J;  3HE4 B;  2IBZ E;  1RY3 A;  3VTP C;  1PP9 J;  3L75 G;  4XFJ A;  5CCH A;  2PAJ A;  3CC4 P;  2LR2 A;  2OYO A;  3H1I D;  1CW5 A;  2ZYG A;  2E5T A;  1LTJ B;  2JJL A;  4OGQ B;  1OVU A;  1LNQ A;  2WPQ A;  1K9M Q;  3CME P;  3L70 G;  1NTK J;  1JCD A;  4GOF A;  3IAO A;  1K05 A;  1YQ4 C;  1X0T A;  1NTZ D;  1L4A D;  2KIK A;  1QLE D;  1SQP K;  1ZLL A;  2FYN C;  3CWB J;  2O01 H;  3HD7 B;  5KAF H;  3L75 E;  2XND H;  2KYV A;  3CCJ P;  1S5L X;  2V4H A;  3TSI A;  2N1T D;  1P84 D;  1FZA A;  1H88 A;  1OX3 A;  3L74 J;  1QEX A;  1N7L A;  2Y9Y A;  2SPZ A;  2ITA A;  4YTP C;  2N9Y B;  2P58 A;  1BGY J;  3CWB E;  1QL1 A;  5KLV J;  1Q7Y Q;  1LTA C;  4CPG A;  1PIX A;  3HE5 A;  2JWA A;  3BCC G;  2O1K A;  1ZN5 A;  3HUS A;  1NTK K;  1PPJ G;  1L0N J;  1GL2 C;  5B66 E;  1YTZ T;  3FGA D;  2RN0 A;  2Q9I A;  1YHQ P;  1FJK A;  3FWL A;  3ZDM A;  2KNC A;  5E79 H;  3MUD A;  1JMB A;  3AE9 C;  3PLN A;  3V2N A;  3WUV A;  5KLV E;  3RL0 g;  3G4S P;  1FDI A;  2FBW C;  2POH A;  1XTG B;  5CHX A;  1L0N E;  1HGV A;  3M91 A;  3H1K D;  4H0L D;  3PTZ A;  2KLV A;  1BE3 J;  1URQ A;  1YQ3 C;  3MD0 A;  3Q2Y A;  4UB6 E;  1GU4 A;  3P8M C;  3PH0 A;  2YO3 A;  3CCM P;  1EXI A;  2FYZ A;  2OYI C;  3MHV A;  2WPR A;  3CCV P;  1KD1 Q;  1RH5 B;  4L74 A;  1IFI A;  2XZR A;  2YMY A;  1BE3 E;  5AVT B;  1FOS F;  5KKZ C;  3HUS B;  4U3F E;  1RE3 C;  5AVQ B;  4O9B A;  4GOD A;  4ASW A;  4DT0 A;  3IR9 A;  4OGQ D;  4AYC A;  2YIU C;  2L5G B;  1VQN P;  1K73 Q;  2AXC A;  2OTL P;  2FFD A;  1SFC B;  3U1A A;  2E43 A;  2IFM A;  3H1H E;  1JMM A;  1FZC A;  3R2P A;  3TGU D;  3FXD A;  2OYH B;  1KYO E;  2D2C B;  1NTZ J;  2KI7 B;  5CCH C;  2E76 C;  3RK2 C;  1S9K D;  1URQ B;  3HD7 D;  1T2K D;  2ZAE B;  1NKN A;  1P84 I;  1HJ0 A;  2QJK C;  4AUW A;  1CZQ A;  3R4Y A;  4GKG A;  3L71 E;  5CCG A;  3BAS A;  3CCQ P;  1SQB D;  2E74 B;  2BCC D;  2NPS B;  3B5N A;  3V5B A;  1Y8A A;  3WU2 H;  2Q6Q A;  1DH3 A;  3ABV C;  3N4X A;  4L75 A;  3M9Q A;  1BCC D;  5AVU B;  1KB9 I;  4KT0 J;  1J1E C;  3NMD A;  3FWN A;  1NTZ K;  1EDL A;  1FZC B;  1HGZ A;  1HTL C;  2Z4E A;  1GK6 A;  3MTU E;  2FYU G;  1EXJ A;  1IJD B;  5APT A;  1SQX D;  1FS0 E;  2AXT E;  2MJZ A;  5KAI E;  3SSU A;  3O6Q B;  3H1K J;  4HH2 A;  1X79 B;  5GTI E;  3HUS C;  1KB9 E;  3CC2 P;  3HTK A;  5B66 H;  5APV A;  4KJM A;  1KFN A;  1AVO A;  3H1L G;  4H13 B;  3Q5R A;  1LWU B;  1RF0 A;  3B5N B;  1YTZ I;  3MUD C;  1LTG C;  2QM8 A;  3S9O A;  1SLQ A;  3V2P A;  3Q3D A;  3CXH H;  1ZP0 C;  1CI6 B;  5B5E E;  2E42 A;  2FYU E;  1JY3 P;  1L4A A;  4C46 A;  2HPC A;  5AW6 B;  1FZB A;  3BAT A;  3GF7 A;  3PJS K;  1SFC D;  2UWJ E;  2H7H A;  1NTM D;  3EFG A;  1NU1 D;  2N1T A;  2QJY C;  1YIT P;  4N78 D;  1TU3 F;  3AEB C;  3TGU J;  2D2C D;  2G3A A;  3KZI E;  1URQ D;  2P10 A;  2GUV A;  2WZ7 A;  4MN4 C;  4OWF A;  1E79 H;  3PP5 A;  5C39 A;  1SQV K;  1FZF A;  1IK7 A;  2Q1K A;  3H6P A;  2E74 D;  2FFD C;  1YJ9 P;  2NPS D;  2J58 A;  1FZC C;  2B87 A;  4LC1 A;  4ZMD A;  1OW8 A;  3OAK A;  1KYO H;  3TNU B;  1BCC J;  2W83 C;  3O8Z A;  5AW7 B;  1FU1 A;  2A45 G;  2WSE J;  4GT1 A;  1T6A A;  4HJG H;  5AW9 B;  2KZJ A;  2WSF H;  3MZW B;  3CCS P;  5CCG C;  2N9B A;  1S1C X;  3G71 P;  1LT9 A;  3TK1 A;  3Q5S A;  1AV1 A;  2V7Q J;  3B5N C;  5AVX B;  3HE4 A;  3L70 D;  4WB4 A;  1DD3 A;  3BVH A;  2YNY A;  4RES B;  1SQX J;  4YPC A;  3H25 A;  1SQB K;  5APW A;  1SQQ G;  3VMA A;  1KIL C;  1N73 B;  5CCG D;  1LP1 A;  1JY3 O;  2IBZ G;  1M56 D;  1RF1 A;  3RK3 C;  4H13 D;  1KQS O;  3P32 A;  4U7J A;  1LTJ A;  1VL2 A;  3B5N D;  3P7K A;  1IFN A;  1YYC A;  3CXH D;  3VMY A;  4D6T E;  2KB7 P;  3NFQ A;  1EDJ A;  1QVF O;  1SQP G;  3ITK A;  3WUU A;  1QVG O;  3M0A A;  1N2D C;  2OAR A;  1RHZ B;  1PP9 G;  3BCC D;  4BWN A;  3C9I A;  1KC8 Q;  4WVZ A;  1PPJ D;  4R4M A;  1LT9 B;  3V2R A;  5KTB A;  2LXB A;  1RF0 C;  2P7J A;  1SQX K;  4C7R A;  2I1J A;  2R32 A;  1NTM J;  1NGM B;  5AW2 B;  1USD A;  3CX5 D;  1Q2N A;  4OVN F;  5B5E H;  4JPZ B;  1NTK G;  3L72 E;  5APQ A;  1LP1 B;  4R4L A;  4IFD K;  1L4A C;  1RF1 B;  1SQP E;  2H88 C;  1RQV A;  5AW4 B;  2OQQ A;  2QM7 A;  2KSJ A;  3KDP B;  3E1I A;  5CMZ A;  3CWB G;  1JNM A;  1NH4 A;  2C0W A;  1PP9 E;  1M7L A;  3MGN A;  4ASV A;  1ZR2 A;  2YKQ A;  2N1T C;  1BSN A;  1S2E A;  2E75 C;  5AW5 B;  4DOJ A;  2A06 G;  2H8P D;  1PGQ A;  2XDJ A;  4IL6 H;  2JWD A;  2HLO A;  3LID A;  1ZW0 A;  1EZV D;  5APY A;  2ZVN B;  1NVO A;  1ZRT E;  2XV5 A;  1NTM K;  1NU1 K;  1QGK B;  5KLV G;  3AEF C;  1IC2 A;  1AQ5 A;  1NTK E;  2E75 D;  1R5S A;  1U7J A;  2ZXX A;  2C9L Y;  1L0N G;  2FXO A;  1N86 A;  4RKU J;  5TJH A;  1L0L D;  2K9J A;  1VQ8 P;  2WIT A;  3H1J J;  5AW8 B;  3VMZ A;  4N3Y B;  1QX8 A;  1DIP A;  2QSI A;  1Q81 Q;  2QJP B;  2A06 E;  3A0B H;  3OW2 O;  1JM0 A;  1U7M A;  3E1R A;  1VDF A;  4H0L C;  4RJT A;  2PFX A;  3L74 E;  5KJ7 D;  3VYI A;  4PD4 D;  3RBZ A;  4W7Z A;  1X22 A;  1LT9 C;  1BGY E;  1BE3 G;  3B8E B;  1IK9 A;  3H1J E;  4WBA A;  4U3F G;  1NAF A;  1SFC A;  3P8C E;  3CMA P;  3FXE A;  1Y9B A;  3Q1M A;  5KLI B;  2OYH A;  4PV1 B;  4WWI A;  3JSV C;  1H0T B;  2FKW B;  3SWF A;  3L73 J;  1OXZ A;  4DZO A;  1AVY A;  3BCC J;  1OIP A;  3LW5 H;  3D6Y A;  3H1H G;  1HJB A;  4PJ0 E;  5APS A;  3RL0 B;  1RF1 C;  1K04 A;  1LTJ C;  2LKM A;  4OGQ C;  1VQM P;  2K9J B;  1PGO A;  3KHU A;  3LIE A;  3GHG A;  3CX5 I;  2A45 H;  1SQV D;  4K3A A;  2XU6 A;  2NPS A;  1KIL E;  4NPE A;  1OVR A;  2M5A A;  3C1L A;  4C7N A;  2P1J A;  1LTT C;  4UB8 E;  1SVF A;  3L73 E;  1K8A Q;  3RK3 E;  3L4F A;  3F89 A;  3L71 G;  3W67 A;  3U59 A;  3A3Y B;  3M0D A;  3VP8 A;  4EIJ A;  3H1I J;  3HD7 C;  1T2K C;  1LGH B;  2VRS A;  1NTZ G;  2R5D A;  5AW0 B;  2QA4 P;  4JYC A;  3H1L D;  2JKV A;  2JR8 A;  5AVV B;  1OW6 A;  1N7S A;  1HF9 A;  1MFT A;  5L8R J;  1EZV I;  5H2F E;  2M3B A;  2QRX A;  4DCK A;  1JY2 N;  1R8E A;  1LTS C;  3H1I E;  4I7Z B;  2B89 A;  4IL6 X;  5CJ4 A;  2WSC J;  1FJP A;  3O6Q A;  2QJP C;  1DEB A;  2ZXE B;  2HR3 A;  1S5L E;  3NTN A;  3GHG B;  1IFJ A;  1ZOY C;  1JY2 P;  4LLH A;  4B86 A;  1LWU A;  2M5A B;  2P2U A;  4C7N B;  1NTZ E;  1L0L J;  1JCC A;  2R5B A;  2Q3E A;  2JO1 A;  1CI6 A;  2Q3I A;  4PD4 I;  3CI9 A;  1P84 E;  2R3C A;  2Z5H A;  1PL5 A;  1EC5 A;  1N7S B;  1NAY A;  3C8V A;  3H1K G;  3QWO C;  2KS1 B;  2H89 C;  3AEG C;  3BRV B;  1NYH A;  3IF4 A;  1HH0 A;  1M1J B;  4Y99 B;  4ZNC A;  2HOD B;  3F5H A;  4PV1 D;  2RKL A;  2I8D A;  2R3S A;  3VMX A;  1D7M A;  4HKZ H;  4QMA A;  2FXM A;  2KZI A;  1L2P A;  1L0L K;  3RL0 D;  1FAV A;  2NZ2 A;  1RE4 A;  2OTK E;  2IX7 C;  3CCU P;  2WVR A;  3CPW O;  1FDM A;  4NPF X;  2WQY C;  1JY3 N;  5K5G B;  2IDB A;  1SFC C;  1SQV J;  1WRG A;  2W8Z A;  2Q7C A;  3H1K E;  3A7O A;  1AQT A;  1CSB A;  4JQ0 D;  2OYH C;  1FZG A;  2D2C C;  1FBM A;  1LTI C;  1HWT C;  3AEE C;  3TNU A;  1SQQ D;  4I7Z C;  1URQ C;  3TGU G;  3M06 A;  4ZKP A;  1KOR A;  4PJ0 H;  4I6M C;  1NO4 A;  1NOH A;  2IBZ D;  4UB6 H;  2W6J H;  1UII A;  1GZL A;  4M3L A;  1QL2 A;  1MV8 A;  1HBW A;  1DD4 A;  1X8Y A;  2WPS A;  4JBZ A;  1JY2 O;  1VQO P;  4LGD E;  2YXQ B;  1HVV A;  2E74 C;  2NPS C;  1MKM A;  2O01 J;  1Y47 A;  1VQ4 P;  4UB8 H;  2Y0D A;  1X9V A;  5AVS B;  4WY4 B;  3AE4 C;  2NRG A;  2K9Y A;  3EQ2 A;  4EOT A;  1GD2 E;  1PP9 D;  3B4S A;  1M90 Q;  1N73 A;  1VQ9 P;  1LJ2 A;  1VF5 B;  4L76 A;  5CBO A;  1SQB J;  3TGU E;  5KJ7 A;  3VN0 A;  2BCC J;  2IPP A;  2LXC B;  3S1K A;  5H2F H;  3SWK A;  3D70 A;  1S9K E;  3L75 D;  1IFD A;  4W7Y A;  1PFI A;  2IZ0 A;  4XE5 B;  4D6T G;  3T97 B;  3SWY A;  3PRJ A;  2ZT9 B;  1N7S D;  2KP8 A;  1SQX G;  2BCC E;  2O01 N;  1MUU A;  3CWB D;  3TF5 A;  4H13 C;  1LWU C;  1XTC C;  3TDK A;  5CJ0 A;  2QG4 A;  2YMK A;  2ZYD A;  1GL2 A;  3AE6 C;  1JTH B;  1BCC E;  3CCE P;  4JYB A;  5EFW B;  5E79 E;  4BRY B;  4EYY Q;  2YXR B;  2PRR A;  2IYP A;  5KLV D;  1AJY A;  1P84 H;  3V4W A;  5AVY B;  2WPV B;  4Y28 J;  1KQF B;  1NJI Q;  1L0N D;  3L72 G;  3L37 A;  4YXW H;  3JCU E;  1SQX E;  2WSS H;  1YJN P;  4H44 B;  1NHL A;  1KFM A;  1M1K Q;  1E5W A;  2AXT H;  2L91 A;  3G3Z A;  3WMM 0;  1KV4 A;  5BU5 A;  5KAI H;  2OYI A;  4A7P A;  3PHL A;  5GTI H;  2PGD A;  3OA7 A;  3CD6 P;  1KB9 H;  3AE3 C;  2BAS A;  1RE4 C;  1J1D B;  5APU A;  1WMK A;  1A02 J;  1PZQ A;  4ZKU A;  3QH9 A;  1GL2 B;  1BE3 D;  4U3F D;  1NU1 J;  2JEE A;  2E5Y A;  3CLQ A;  1H89 A;  2BEZ F;  3S4R A;  3UIA A;  4WY4 D;  3A2A A;  1G2C B;  3AEA C;  4XA4 A;  3H1H D;  2OTJ P;  5AVW B;  1NTM E;  1VF5 D;  2CPB A;  2YO2 A;  1NU1 E;  1YIJ P;  1OMI A;  2ZT9 C;  1OW7 A;  3B71 A;  1KYO D;  4N78 E;  2QEX P;  1SQQ K;  2HYN A;  1T3U A;  3L75 J;  2OYI B;  3L74 G;  2XNX A;  3KZI H;  3NXS A;  2ZYA A;  1GTW A;  3CCL P;  3L71 D;  5M1B A;  1UIX A;  2C0X A;  1BGY G;  1H0T A;  5AW1 B;  3WU2 E;  3H1J G;  2ZT9 D;  1N73 C;  5KKZ B;  3GW6 A;  3WUT A;  3II6 A;  2I1K A;  5KJ7 C;  3EWK A;  2C9N Y;  2YIU B;  1YJW P;  1Q82 Q;  3GG2 A;  3L70 J;  5BVZ A;  2KLU A;  2FY8 A;  3GLM A;  2WTY A;  4H44 C;  3I56 P;  1PGJ A;  1Q86 Q;  3GF3 A;  3AE5 C;  1WT6 A;  2B9B A;  4AQR D;  1DEE G;  1NWQ A;  2Y0E A;  2KK7 A;  3CXH I;  2XKM A;  2E76 B;  1KQL A;  3RK2 B;  1FE6 A;  3G9R A;  5CBN A;  3I55 P;  1J1D C;  3L70 E;  2B88 A;  3L73 G;  4Z1M H;  3K5B A;  2MKV A;  2QJK B;  2BEQ D;  2M0B A;  3GMA A;  4H44 D;  1IFP A;  3Q5P A;  1Q90 D;  4BXL A;  1RQU A;  4GIF A;  1KB9 D;  2WSE H;  4RO0 A;  1OVV A;  1EDK A;  5DJU B;  4L73 A;  1USE A;  2CK3 H;  3CXH E;  1OZH A;  2V7Q H;  3H32 A;  1GL2 D;  1J1E B;  2RMZ A;  3H1I G;  2JP3 A;  3JCU H;  4U3F J;  2FYU D;  2Z5I A;  5KLV K;  3BCC E;  1S4X A;  1JOC A;  5AVZ B;  3V4Q A;  1IFM A;  2RH0 A;  1PPJ E;  1L0N K;  4I2L C;  1KYO I;  3HE5 B;  4IOI H;  3H1H J;  2WT7 A;  1EZV G;  3MP7 B;  2KUB A;  3USS A;  5GTH E;  2HG5 D;  3A5T A;  3CX5 E;  1GW4 A;  1NKZ B;  4I1L A;  2KS1 A;  2AEF A;  2J5U A;  1FDO A;  1M1J A;  2DW3 A;  1J2J B;  2YKP A;  2KNC B;  2HOD A;  4YXD C;  3OJA B;  4IFM A;  1GDT A;  2WSF J;  1L0L G;  3AE1 C;  1FOS E;  3L71 J;  1W2E A;  1EQ7 A;  4OH8 B;  3H32 B;  4TT3 H;  2AEJ A;  2G8Y A;  3FX0 A;  3IFM A;  2ZVO B;  1VQL P;  1JEK A;  5APX A;  4JF7 A;  1EZV E;  2W27 A;  3VOP A;  5AVR B;  2ZFC A;  2QJY B;  5KLI C;  3AE8 C;  4PV1 C;  1YI2 P;  1N8R Q;  1M8O B;  5CCH D;  2WT7 B;  2E76 D;  1ZXG A;  3RK2 D;  1EDI A;  2OGU A;  1ZME C;  1BDD A;  1L0L E;  3RL0 C;  1U57 A;  3AE2 C;  2O3J A;  1KIL A;  3RGU A;  1FZE A;  2FFD B;  3KPE A;  3L35 A;  2J59 M;  1G1I A;  2K3R A;  1VQK P;  1SQV G;  1ZV8 A;  1VQ7 P;  1W2B O;  1BSH A;  4PD4 E;  4WY4 A;  4D6T D;  1T3J A;  2KXP B;  3A0H E;  3KQG A;  1YBK A;  1KMI Z;  1R5L A;  1JB0 J;  1GK4 A;  5TIS E;  3D71 A;  3KXD A;  2H43 A;  2FYU J;  3AED C;  1H8A A;  1OFC X;  1GMJ A;  3SFE C;  3BRT B;  1M57 D;  4HB1 A;  2KOG A;  2YKO A;  4N6J A;  3T97 A;  3M9H A;  2ZJS E;  1SQV E;  3TYY A;  3MIW A;  1KIL B;  3GHG C;  3H1L J;  5BU8 B;  3SFD C;  3RK3 B;  1VQ5 P;  3L72 D;  2QE7 H;  3AEC C;  1S72 P;  1SQP D;  1FC2 C;  1SQB G;  3I5C A;  3V2Q A;  1JTH A;  2P67 A;  5DJT B;  2BCC G;  1ZR4 A;  3M0D C;  3N7N A;  1VQ6 P;  2W6B A;  4BRY A;  2IFN A;  1JO5 A; 
#chains in the Genus database with same CATH homology
 3JC2 2;  1RHZ B;  2YXQ B;  2YXR B;  1RH5 B;  3MP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...