2YXQB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
b'TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxqB00
1RH5B 2YXRB 3MP7B 3JC22 1RHZB 2YXQB
chains in the Genus database with same CATH superfamily
2WSEH 1KZUB 4ZMDA 1VF5B 3TSIA 3R2PA 3K5BA 1S9KE 3LIEA 2WSFJ 1JO5A 1KYOI 1MFZA 2I8DA 3SWYA 2ZT9D 3CCMP 1M7LA 2J58A 4PD4E 1X0TA 2QJYC 5DJUB 4M3LA 1VQNP 5CHXA 1NTZD 3AE2C 4ZKUA 5AVVB 2G3AA 2L5GB 5AVYB 2ITAA 3L70J 3RK2C 4JBZA 1NKNA 1FZEA 3KDPB 3JC22 1UIIA 3F89A 1G2CA 1KC8Q 3SFDC 2WSFH 1P84E 4KT0J 1LWUB 3P7KA 2HODB 3AEBC 1E5WA 1QVGO 3KZIE 3RBZA 1H0TB 1CW5A 2Q5UA 3EWKA 3BRTB 1FZCA 1KQLA 4IFDK 4TLFA 5E79H 3H1KJ 1N73B 1PZQA 4I1LA 1IFMA 1J1EC 4RESB 2H8PD 3BCCG 1L4AB 1SFCB 4N3YB 1L0ND 3WUUA 1OX3A 2OYHA 2FYUG 4H0LB 1EZVD 3RL0g 1KILB 1U7MA 2LXBA 3A2AA 3H1HJ 1SQXJ 4JPZB 1X9VA 1PGQA 1R5LA 1FC2C 3S1KA 1PFIA 2H43A 1VQ4P 2ZT9C 2M3BA 3S9OA 3RL0D 2NPSA 4JQ0D 1NTZJ 1BE3D 5GTIE 3G9RA 2FFDC 2OYIA 3EQ2A 3W67A 2V7QJ 3PJSK 3JCUH 5TISE 3A0HH 3A5TA 3CCQP 1ZOYC 1VQLP 1PGPA 2B87B 3H1IG 2IFMA 1X22A 2K1AA 3L71J 4HYTB 3BCCE 2KXPB 1OXZA 4YXWH 4XA4A 1SQVJ 2GM4A 5KAFE 2IPPA 3D70A 3FX0A 2FYUE 3M9HA 1OFCX 1KQGB 5K5GB 2N1TA 5APQA 4K3AA 2YXRB 1GL2A 2K9JB 3MIWA 3PHLA 2NRGA 3AE5C 4U7JA 1RF1C 2QJYB 3TNUA 1L0NJ 4XE5B 1N7SA 2V7QH 1LTSC 4N78E 3VMAA 1KV4A 1DEEG 1MV8A 4L76A 3OJAB 2E74D 1FZFA 1BCCD 2A06D 1KB9I 5BU5A 1ZN5A 2FXPA 3H1IE 3RK2B 3UIAA 3F5HA 1RQUA 1OVVA 1R5SA 3HUSA 3ZDMA 2P10A 3RL0C 3CPWO 1HF9A 2ZXXA 3HE5B 3KHUA 3L73G 2KZJA 2YXQB 4YTPC 1RF0A 1S5LH 1KMIZ 5H2FH 1M56D 1NKZB 1L0LJ 2YKQA 1GTWA 1HBWA 1J1EB 3P8MC 1K04A 4HKZH 4WVZA 1TU3F 2E75C 4GIFA 3IN6A 5APXA 1NU1G 2XU6A 3Q3DA 3FWNA 5GTIH 1ZRTD 4IL6E 2B9BA 1GD2E 3S4RA 1LGHB 1SQQE 1EDKA 5KJ7A 2FBWC 4BWNA 2KS1B 3CWBG 2ZT9B 1KYOH 1OW8A 4UB8E 4H44D 4WY4D 2FFDB 3L73E 1AQ5A 1LT1A 3RBXA 1T6AA 2KSJA 1GW3A 1K05A 3FGAD 2YO3A 2E74C 3CMAP 1NAFA 3L72J 2NPSD 4HH2A 4ZNCA 1AVYA 3HD7C 1JY2P 3CX5D 2QM8A 1JY3O 2I1KA 1NU1E 2JO1A 5CCGD 1NU1K 3B5ND 5KLIC 2XNDH 3P32A 4Y99C 3AE1C 3CXHI 3ITKA 2O3JA 2GA1A 1NTMJ 4GDOA 4OWFA 3C8VA 3AE7C 5KLVG 3H1JJ 3CWBE 1FZAA 3MUDC 2AEJA 3L74G 1ZV8A 1RF1B 1LJ2A 3LIDA 4I6MC 3TDKA 1JNMA 4C46A 4ZKPA 4IFMA 2PGDA 2LXCB 5CCHA 4BRYA 3Q5PA 1H8AA 3NMDA 3KQGA 3HTKA 5AVUB 3WU2E 2E42A 1NGMB 2K9YA 2YMYA 3GLMA 5GTHE 4CPGA 1PIXA 2M5AB 1XTCC 1AV1A 1KILE 3KPEA 1PPJG 4DJGA 4GOEA 1T3UA 3HE4B 3U59A 1FDIA 2Q3EA 2D2CD 3CC4P 3RL0B 4H44C 1AJYA 1HH0A 4WY4C 3HRNA 4PD4I 3A7OA 2E76B 5B5EE 5KLVE 2FY8A 2XNXA 1Y9BA 3L74E 4WBAA 4IL6H 1S1CX 3VMYA 4Y28J 1RF1A 2E75B 5AVQB 5CCGC 2QM7A 1HWTC 3B5NC 2ZYGA 2G8YA 2M3EA 1EQ7A 2RN0A 3VYIA 4B86A 1PPJE 3AEDC 1RQVA 3BRVB 2P2UA 2ZVNB 3H1LD 2FYNC 2Q1KA 1LT9A 3B8EB 3MZWB 3U1AA 2HFED 1PP9J 1QLED 3SSUA 2QA4P 2E74B 1AFOA 3CXHE 1Y47A 4PV1D 1NTKJ 1BDCA 3RK3D 3SFEC 1JTHB 3AE3C 1KB9H 3E7KA 1NO4A 3HD7B 2RMZA 1W2EA 3NTNA 1VQKP 1VQMP 3M0DA 4C7RA 1VQ8P 1ZP0C 3VN0A 1N8RQ 5KLIB 3H1KD 2IFNA 1S9KD 5EFWB 2IBZD 4Y99B 1YQ4C 1RE4A 3CLQA 2RKLA 3USSA 2GUVA 1FOSE 2XKMA 4ASWA 2CPSA 1EDIA 4WWIA 1IK7A 3VMXA 1JY2N 3H1HD 1SQXD 1KQSO 3A0BH 3SWFA 1K9MQ 2R5DA 1NOHA 1LTJB 5APSA 1IJDB 1JY3P 3H1LJ 4JF7A 3FWLA 1WT6A 5B5EH 3T97A 2WSCJ 2KUBA 3OA7A 4DZOA 1BGYJ 2IYOA 2PFXA 3PTZA 3HD7A 5CCHD 3H6PA 4H44B 1M1KQ 4D6TG 1J2JB 1GK6A 3CCJP 4WY4B 2QE7H 1SQXK 1ZW0A 3V2NA 2PP6A 1URQD 3L71D 1EC5A 1NVOA 1JMMA 2OARA 2WMMA 3G4SP 1NTZK 1SQVD 1M1JC 1SQPD 4PV1C 1L0NG 2N9BA 3I5CA 1EZVG 3RK3C 1YJWP 2KNCB 2BASA 1RY3A 1G1JA 1OIPA 1CSBA 3II6A 3B5NB 5AW6B 1FZGA 2E5YA 2OYOA 3O8ZA 1BE3G 1LTJA 2WSCH 3TYYA 2JWAA 2KLVA 2OQQA 1SQVK 2IZ0A 3U1CA 2WVRA 2FYNB 3N7NA 4D6TE 3M9QA 2CK3H 3C1LA 4OGQD 3IFMA 5AVXB 2AXTE 1GU5A 3D71A 4XFJA 4LC1A 2JR8A 5KAIE 3QWOC 1DH3A 2Q9IA 1KYOD 1L0NK 1JB0J 1RE3A 1EZVE 1LWUA 1N86A 3MHVA 2HODA 2A45I 1H0TA 1LP1B 4AYCA 3CC2P 2HPCB 2KNCA 2FYUD 3L37A 1N73A 1L0LD 1YBKA 2N9YB 4DOJA 1PGJA 1FBMA 1YTZI 1BE3E 2KK7A 2AEMA 2C9NY 1URQC 3FXDA 2QRXA 1SQPJ 4PD4H 1L4AA 1SFCA 2Y0DA 2K3RA 2ZYDA 2KLUA 1FDMA 1KILA 2JP3A 1BCCG 2A06G 3CCVP 4TT3H 1T3JA 1OVUA 2KZIA 5C39A 5M1BA 1L0LK 3GHGC 2KIKA 1AVOA 2WWWA 2FXOA 3H1ID 3MP7B 1IK9A 1P84H 1H89A 1HJBA 2A45G 1HUCA 2KI7B 1OMIA 1LP1A 1HVVA 1Z56A 3KZIH 1JCDA 2B87A 1QX8A 4OGQC 3CX5I 3L72D 2QEXP 1DIPA 2JJLA 2BEQD 4PJ0E 3G71P 1EDJA 4QMAA 1M1JB 4PV1B 4UB6E 1BCCE 2A06E 5AW7B 1M90Q 3Q1MA 3RK3B 2K9JA 2FYUJ 1NTMD 2W83C 1USEA 3B4SA 2WTYA 3H1JD 4R4LA 2O01N 4ASVA 1DD3A 1YYCA 5BU8B 4JYCA 3IR9A 1SQQD 3AE6C 1UIXA 1JUNA 1R8EA 1NTMK 1YITP 5TISH 2Q6QA 1Q86Q 3E1RA 2ZVOB 1WRGA 5AW2B 3H1IJ 2BCCG 2H88C 3HE5A 3CCLP 1VQ5P 1ZRTE 3H25A 5KAFH 2Z5HA 3AE9C 3JSVC 1Q82Q 1FS0E 2WZ7A 1LTGC 2POHA 1DD4A 2H7HA 1DX7A 1JEKA 2YNYA 1YI2P 3TGUD 1BSHA 4AQRD 1ZMEC 3L35A 1IFPA 5AW8B 1S5LX 1URQB 4GT1A 1KB9D 2YO2A 1QL2A 1VQ7P 1FJPA 2P7JA 1ZR2A 1USDA 5TJHA 5KKZC 4W7YA 2KS1A 3GHGB 4YXDC 1Q81Q 3CX5E 4HB1A 2BCCE 2R3SA 2WITA 1L4AD 3O6QB 2N1TD 5KTBA 2FFDA 1W5CE 1SQQJ 1GL2D 1PP9D 1KILD 4RKUJ 4NPEA 1KQFB 2P67A 5AW5B 3WMM0 3SWKA 3CL3D 5AW1B 4L74A 1CI6B 1FZCC 3I55P 2W8ZA 3L73J 1OZHA 1NTKD 3KYQA 1KORA 2Z5IA 4H13D 5APYA 4OGQB 2VRSA 1N7SD 3H32B 5APUA 3AEAC 3CD6P 1G1IA 3CMEP 2OYHC 3PRJA 2IBZI 1PGOA 2WT7B 1QVFO 2KSEA 2Y0CA 2JDIH 1SQBD 2E5TA 2RH0A 3TGUJ 3M91A 1NTKK 1W2BO 3W68A 2NPSC 5B66E 2FXMA 2OYIC 3Q5SA 4UB8H 3L70G 3CWBJ 1U57A 3P8CE 2HR3A 2O1KA 3CCUP 4C7NB 1GMJA 2IDBA 1FU1A 3VTPC 3CCEP 3R4YA 2M5AA 2QJPC 3EFFK 2C0XA 2HG5D 3HE4A 1IFDA 3V2QA 4JYBA 3H32A 1BGYD 4W80A 1PL5A 4AUWA 3N4XA 2C9LY 3L75D 2N1TC 2OTLP 2O01J 1GL2C 1LNQA 3H1KG 3B71A 2YIUC 2IBZG 1HJ0A 4U3FD 1HTLC 5KJ7D 2H89C 3M06A 1Y8AA 2Y9YA 3AE4C 2Z4EA 1YQ3C 4H13C 3IAOA 3GF3A 1DEBA 1N7SC 5KLVJ 3L70E 2D2CC 5AVRB 3H1HG 2ZFCA 3L74J 1SQXG 1AQTA 4MN4C 3GG2A 1SQBJ 5APWA 2KP8A 1EZVI 1NTZG 1YJ9P 1FZBA 3PH0A 3WU2H 3RK3E 4N6JA 5KKZB 3HUSC 5GTHH 2K88A 4PD4D 4L73A 2QG4A 1G2CB 2YKPA 2KOGA 2O01H 3JCUE 1D7MA 3NFQA 3H1KE 3V4QA 1RF0C 4EIJA 2IBZE 3A0HE 2E43A 4OVNF 3L71G 1FZCB 4EI2A 5BVZA 1SQVG 1RHZB 4HJGH 1SQPG 1VL2A 3CI9A 1JTHA 3LW5J 3H1HE 1T8ZA 3L75J 1SQXE 3NXSA 1P84D 2NZ2A 2OYHB 3V5BA 1VQPP 5B66H 1YHQP 1GZLA 4U3FJ 1N2DC 1X8YA 1SS1A 1NTZE 2ZYAA 3L4FA 3MGNA 5KJ7C 2YKOA 2WPRA 2KYVA 3MUDA 1HGZA 2NPSB 5AW9B 1NWQA 3WUTA 1YJNP 3V6IA 1KD1Q 2OYIB 2IYPA 2L91A 1OVRA 2LR2A 5CBOA 1EXJA 4IFFA 1JM0A 3VMZA 3IF4A 3L71E 3GF7A 2XZRA 4RJTA 2HYNA 4D6TD 1SQVE 2LKMA 1CZQA 1SQPE 1MZ9A 1OWAA 3CXHH 3LW5H 1SQPK 2QJPB 3BVHA 4BXLA 2ZAEB 1S3JA 1S5LE 4A7PA 4WY4A 2N1TB 1X79B 3EFGA 5H2FE 1HGVA 2ZJSE 2PRRA 1JY2O 2K37A 1GL2B 2W90A 1L0LG 1A02J 2YIUB 2M0BA 3KXDA 1L0NE 1Q2NA 4IOIH 3TNUB 4RO0A 3BCCD 1JCCA 4H13B 1NJIQ 1BSNA 1PV3A 1N7SB 5CJ4A 1QGKB 5CCHC 2D2CB 2R44A 5CCGA 2E76D 1LTAC 3B5NA 2FKWB 1KYOE 2Y0EA 5L8RJ 1VQ6P 3M0AA 3GMAA 3HUSB 2E75D 1SVFA 1VQ9P 1T2KD 4N78D 4OH8B 1L0LE 2AEFA 2FYUK 1NH4A 3L72G 2UWJE 4D6TJ 1OW6A 1IO4A 4GODA 5AVSB 2DW3A 2P1JA 1SLQA 2P58A 2B88A 1QL1A 1IC2A 5AW3B 5APTA 4KHXA 3V4WA 1GU4A 2Q3IA 2HPCA 1NTMG 1IFJA 1GK4A 5APVA 3H1JG 5CMZA 2OTJP 4DT0A 4O9BA 1KN7A 1JY3N 1KTMA 3V2RA 3BCCJ 3HD7D 1LT9C 1SQQG 1BE3J 2WSSH 1IFNA 3E1IA 2GUSA 3CCSP 4W7ZA 3BATA 1VF5D 1WMKA 3L72E 3VP8A 3FXEA 2OTKE 2V4HA 2E76C 1VQOP 1OW7A 2HLOA 3A3YB 2AXTH 3G6EP 3M9BA 1ZXGA 1SP4A 5KAIH 5CJ0A 1NHLA 3CCRP 3RGUA 3AEFC 4GOFA 2O1JA 3M0DC 1NTME 4NPFX 1H88A 2WQYC 3L73D 3OW2O 3D6ZA 2XV5A 3H1JE 1T2KC 1S72P 3MTUE 3TGUG 1EDLA 1YTZT 1RE4C 1LTTC 5CBNA 4I7ZC 3AE8C 2PAJA 1MUUA 1M1JA 2W6AA 2QJKC 2JEEA 1SQQK 4Z1MH 2JWDA 3QH9A 1NU1D 4BRYB 1VDFA 1L2PA 3PP5A 2QSIA 1BCCJ 1LTBC 3HTKB 1QEXA 1LTIC 3Q2YA 1JMBA 1K73Q 1PP9G 2I1JA 3CWBD 4LGDE 2J59M 1J1DC 1S2EA 1ZR4A 1YIJP 1N7LA 2BCCD 1JOCA 5AW0B 1FDOA 1M8OB 1KFMA 2OGUA 3TGUE 1ZLLA 1NTKG 2Y9ZA 1VF5C 2R3CA 3D6YA 1SFCD 1XTGB 2QIWA 4WB4A 1KB9E 2CPBA 2IX7C 4I2LC 4H0LD 4PJ0H 3OAKA 1FAVA 1MFTA 1M57D 1KFNA 4GKGA 1GDTA 1IZNB 2M8RA 2MKVA 4UB6H 1MKMA 1SQBG 4EDFA 1IFIA 2W6JH 1Q90D 4LLHA 2WPSA 3WUVA 2IZ1A 3BASA 1LTJC 2MJZA 1URQA 1K8AQ 1U7JA 5KLVD 2SPZA 1PP9E 2YMKA 3AEGC 1FOSF 4L75A 3L74D 1LT9B 2XDJA 1NU1J 3A0BE 3I56P 1FE6A 4K35A 1E79H 1NTKE 4EOTA 3TK1A 2A45H 3L36A 4EYYQ 1EXIA 3P8CD 3H1LG 3GW6A 3G3ZA 3GHGA 3AEEC 4DCKA 2WPVB 5AVZB 2JKVA 3CC7P 1BGYG 3O6QA 2BEZF 1RE3C 1PPJD 5KLVK 1LWUC 3L75G 1NYHA 2Q7CA 2KB7P 3AECC 1Q7YQ 2BCCJ 3ABVC 1CI6A 3MD0A 2FYZA 3Q5RA 2W27A 1SQBE 1A02F 4U3FG 1SQBK 1N73C 5AW4B 3V2PA 3PLNA 1S4XA 1P84I 3CXHD 2WSEJ 4I7ZB 2C0WA 1L4AC 1SFCC 3C9IA 2W6BA 1VPCA 4H0LC 1KILC 5E79E 2QJKB 2WT7A 4KJMA 3RK2D 2R5BA 2QVAA 1NAYA 3VOPA 5DJTB 3VP9A 4R4MA 3L70D 1GW4A 3H1LE 2AXCA 4YPCA 2WPQA 1BGYE 5AVWB 1BDDA 1RH5B 2R32A 3L75E 1AA0A 3CX5H 3T97B 5AVTB 1J1DB 4C7NA 4IL6X 4U3FE 1FJKA 2J5UA 3TF5A 2B89A 2ZXEB 4NPDA
chains in the Genus database with same CATH topology
1RH5B 2YXRB 3MP7B 3JC22 1RHZB 2YXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RH5 B;  2YXR B;  3MP7 B;  3JC2 2;  1RHZ B;  2YXQ B; 
#chains in the Genus database with same CATH topology
 2WSE H;  1KZU B;  4ZMD A;  1VF5 B;  3TSI A;  3R2P A;  3K5B A;  1S9K E;  3LIE A;  2WSF J;  1JO5 A;  1KYO I;  1MFZ A;  2I8D A;  3SWY A;  2ZT9 D;  3CCM P;  1M7L A;  2J58 A;  4PD4 E;  1X0T A;  2QJY C;  5DJU B;  4M3L A;  1VQN P;  5CHX A;  1NTZ D;  3AE2 C;  4ZKU A;  5AVV B;  2G3A A;  2L5G B;  5AVY B;  2ITA A;  3L70 J;  3RK2 C;  4JBZ A;  1NKN A;  1FZE A;  3KDP B;  3JC2 2;  1UII A;  3F89 A;  1G2C A;  1KC8 Q;  3SFD C;  2WSF H;  1P84 E;  4KT0 J;  1LWU B;  3P7K A;  2HOD B;  3AEB C;  1E5W A;  1QVG O;  3KZI E;  3RBZ A;  1H0T B;  1CW5 A;  2Q5U A;  3EWK A;  3BRT B;  1FZC A;  1KQL A;  4IFD K;  4TLF A;  5E79 H;  3H1K J;  1N73 B;  1PZQ A;  4I1L A;  1IFM A;  1J1E C;  4RES B;  2H8P D;  3BCC G;  1L4A B;  1SFC B;  4N3Y B;  1L0N D;  3WUU A;  1OX3 A;  2OYH A;  2FYU G;  4H0L B;  1EZV D;  3RL0 g;  1KIL B;  1U7M A;  2LXB A;  3A2A A;  3H1H J;  1SQX J;  4JPZ B;  1X9V A;  1PGQ A;  1R5L A;  1FC2 C;  3S1K A;  1PFI A;  2H43 A;  1VQ4 P;  2ZT9 C;  2M3B A;  3S9O A;  3RL0 D;  2NPS A;  4JQ0 D;  1NTZ J;  1BE3 D;  5GTI E;  3G9R A;  2FFD C;  2OYI A;  3EQ2 A;  3W67 A;  2V7Q J;  3PJS K;  3JCU H;  5TIS E;  3A0H H;  3A5T A;  3CCQ P;  1ZOY C;  1VQL P;  1PGP A;  2B87 B;  3H1I G;  2IFM A;  1X22 A;  2K1A A;  3L71 J;  4HYT B;  3BCC E;  2KXP B;  1OXZ A;  4YXW H;  4XA4 A;  1SQV J;  2GM4 A;  5KAF E;  2IPP A;  3D70 A;  3FX0 A;  2FYU E;  3M9H A;  1OFC X;  1KQG B;  5K5G B;  2N1T A;  5APQ A;  4K3A A;  2YXR B;  1GL2 A;  2K9J B;  3MIW A;  3PHL A;  2NRG A;  3AE5 C;  4U7J A;  1RF1 C;  2QJY B;  3TNU A;  1L0N J;  4XE5 B;  1N7S A;  2V7Q H;  1LTS C;  4N78 E;  3VMA A;  1KV4 A;  1DEE G;  1MV8 A;  4L76 A;  3OJA B;  2E74 D;  1FZF A;  1BCC D;  2A06 D;  1KB9 I;  5BU5 A;  1ZN5 A;  2FXP A;  3H1I E;  3RK2 B;  3UIA A;  3F5H A;  1RQU A;  1OVV A;  1R5S A;  3HUS A;  3ZDM A;  2P10 A;  3RL0 C;  3CPW O;  1HF9 A;  2ZXX A;  3HE5 B;  3KHU A;  3L73 G;  2KZJ A;  2YXQ B;  4YTP C;  1RF0 A;  1S5L H;  1KMI Z;  5H2F H;  1M56 D;  1NKZ B;  1L0L J;  2YKQ A;  1GTW A;  1HBW A;  1J1E B;  3P8M C;  1K04 A;  4HKZ H;  4WVZ A;  1TU3 F;  2E75 C;  4GIF A;  3IN6 A;  5APX A;  1NU1 G;  2XU6 A;  3Q3D A;  3FWN A;  5GTI H;  1ZRT D;  4IL6 E;  2B9B A;  1GD2 E;  3S4R A;  1LGH B;  1SQQ E;  1EDK A;  5KJ7 A;  2FBW C;  4BWN A;  2KS1 B;  3CWB G;  2ZT9 B;  1KYO H;  1OW8 A;  4UB8 E;  4H44 D;  4WY4 D;  2FFD B;  3L73 E;  1AQ5 A;  1LT1 A;  3RBX A;  1T6A A;  2KSJ A;  1GW3 A;  1K05 A;  3FGA D;  2YO3 A;  2E74 C;  3CMA P;  1NAF A;  3L72 J;  2NPS D;  4HH2 A;  4ZNC A;  1AVY A;  3HD7 C;  1JY2 P;  3CX5 D;  2QM8 A;  1JY3 O;  2I1K A;  1NU1 E;  2JO1 A;  5CCG D;  1NU1 K;  3B5N D;  5KLI C;  2XND H;  3P32 A;  4Y99 C;  3AE1 C;  3CXH I;  3ITK A;  2O3J A;  2GA1 A;  1NTM J;  4GDO A;  4OWF A;  3C8V A;  3AE7 C;  5KLV G;  3H1J J;  3CWB E;  1FZA A;  3MUD C;  2AEJ A;  3L74 G;  1ZV8 A;  1RF1 B;  1LJ2 A;  3LID A;  4I6M C;  3TDK A;  1JNM A;  4C46 A;  4ZKP A;  4IFM A;  2PGD A;  2LXC B;  5CCH A;  4BRY A;  3Q5P A;  1H8A A;  3NMD A;  3KQG A;  3HTK A;  5AVU B;  3WU2 E;  2E42 A;  1NGM B;  2K9Y A;  2YMY A;  3GLM A;  5GTH E;  4CPG A;  1PIX A;  2M5A B;  1XTC C;  1AV1 A;  1KIL E;  3KPE A;  1PPJ G;  4DJG A;  4GOE A;  1T3U A;  3HE4 B;  3U59 A;  1FDI A;  2Q3E A;  2D2C D;  3CC4 P;  3RL0 B;  4H44 C;  1AJY A;  1HH0 A;  4WY4 C;  3HRN A;  4PD4 I;  3A7O A;  2E76 B;  5B5E E;  5KLV E;  2FY8 A;  2XNX A;  1Y9B A;  3L74 E;  4WBA A;  4IL6 H;  1S1C X;  3VMY A;  4Y28 J;  1RF1 A;  2E75 B;  5AVQ B;  5CCG C;  2QM7 A;  1HWT C;  3B5N C;  2ZYG A;  2G8Y A;  2M3E A;  1EQ7 A;  2RN0 A;  3VYI A;  4B86 A;  1PPJ E;  3AED C;  1RQV A;  3BRV B;  2P2U A;  2ZVN B;  3H1L D;  2FYN C;  2Q1K A;  1LT9 A;  3B8E B;  3MZW B;  3U1A A;  2HFE D;  1PP9 J;  1QLE D;  3SSU A;  2QA4 P;  2E74 B;  1AFO A;  3CXH E;  1Y47 A;  4PV1 D;  1NTK J;  1BDC A;  3RK3 D;  3SFE C;  1JTH B;  3AE3 C;  1KB9 H;  3E7K A;  1NO4 A;  3HD7 B;  2RMZ A;  1W2E A;  3NTN A;  1VQK P;  1VQM P;  3M0D A;  4C7R A;  1VQ8 P;  1ZP0 C;  3VN0 A;  1N8R Q;  5KLI B;  3H1K D;  2IFN A;  1S9K D;  5EFW B;  2IBZ D;  4Y99 B;  1YQ4 C;  1RE4 A;  3CLQ A;  2RKL A;  3USS A;  2GUV A;  1FOS E;  2XKM A;  4ASW A;  2CPS A;  1EDI A;  4WWI A;  1IK7 A;  3VMX A;  1JY2 N;  3H1H D;  1SQX D;  1KQS O;  3A0B H;  3SWF A;  1K9M Q;  2R5D A;  1NOH A;  1LTJ B;  5APS A;  1IJD B;  1JY3 P;  3H1L J;  4JF7 A;  3FWL A;  1WT6 A;  5B5E H;  3T97 A;  2WSC J;  2KUB A;  3OA7 A;  4DZO A;  1BGY J;  2IYO A;  2PFX A;  3PTZ A;  3HD7 A;  5CCH D;  3H6P A;  4H44 B;  1M1K Q;  4D6T G;  1J2J B;  1GK6 A;  3CCJ P;  4WY4 B;  2QE7 H;  1SQX K;  1ZW0 A;  3V2N A;  2PP6 A;  1URQ D;  3L71 D;  1EC5 A;  1NVO A;  1JMM A;  2OAR A;  2WMM A;  3G4S P;  1NTZ K;  1SQV D;  1M1J C;  1SQP D;  4PV1 C;  1L0N G;  2N9B A;  3I5C A;  1EZV G;  3RK3 C;  1YJW P;  2KNC B;  2BAS A;  1RY3 A;  1G1J A;  1OIP A;  1CSB A;  3II6 A;  3B5N B;  5AW6 B;  1FZG A;  2E5Y A;  2OYO A;  3O8Z A;  1BE3 G;  1LTJ A;  2WSC H;  3TYY A;  2JWA A;  2KLV A;  2OQQ A;  1SQV K;  2IZ0 A;  3U1C A;  2WVR A;  2FYN B;  3N7N A;  4D6T E;  3M9Q A;  2CK3 H;  3C1L A;  4OGQ D;  3IFM A;  5AVX B;  2AXT E;  1GU5 A;  3D71 A;  4XFJ A;  4LC1 A;  2JR8 A;  5KAI E;  3QWO C;  1DH3 A;  2Q9I A;  1KYO D;  1L0N K;  1JB0 J;  1RE3 A;  1EZV E;  1LWU A;  1N86 A;  3MHV A;  2HOD A;  2A45 I;  1H0T A;  1LP1 B;  4AYC A;  3CC2 P;  2HPC B;  2KNC A;  2FYU D;  3L37 A;  1N73 A;  1L0L D;  1YBK A;  2N9Y B;  4DOJ A;  1PGJ A;  1FBM A;  1YTZ I;  1BE3 E;  2KK7 A;  2AEM A;  2C9N Y;  1URQ C;  3FXD A;  2QRX A;  1SQP J;  4PD4 H;  1L4A A;  1SFC A;  2Y0D A;  2K3R A;  2ZYD A;  2KLU A;  1FDM A;  1KIL A;  2JP3 A;  1BCC G;  2A06 G;  3CCV P;  4TT3 H;  1T3J A;  1OVU A;  2KZI A;  5C39 A;  5M1B A;  1L0L K;  3GHG C;  2KIK A;  1AVO A;  2WWW A;  2FXO A;  3H1I D;  3MP7 B;  1IK9 A;  1P84 H;  1H89 A;  1HJB A;  2A45 G;  1HUC A;  2KI7 B;  1OMI A;  1LP1 A;  1HVV A;  1Z56 A;  3KZI H;  1JCD A;  2B87 A;  1QX8 A;  4OGQ C;  3CX5 I;  3L72 D;  2QEX P;  1DIP A;  2JJL A;  2BEQ D;  4PJ0 E;  3G71 P;  1EDJ A;  4QMA A;  1M1J B;  4PV1 B;  4UB6 E;  1BCC E;  2A06 E;  5AW7 B;  1M90 Q;  3Q1M A;  3RK3 B;  2K9J A;  2FYU J;  1NTM D;  2W83 C;  1USE A;  3B4S A;  2WTY A;  3H1J D;  4R4L A;  2O01 N;  4ASV A;  1DD3 A;  1YYC A;  5BU8 B;  4JYC A;  3IR9 A;  1SQQ D;  3AE6 C;  1UIX A;  1JUN A;  1R8E A;  1NTM K;  1YIT P;  5TIS H;  2Q6Q A;  1Q86 Q;  3E1R A;  2ZVO B;  1WRG A;  5AW2 B;  3H1I J;  2BCC G;  2H88 C;  3HE5 A;  3CCL P;  1VQ5 P;  1ZRT E;  3H25 A;  5KAF H;  2Z5H A;  3AE9 C;  3JSV C;  1Q82 Q;  1FS0 E;  2WZ7 A;  1LTG C;  2POH A;  1DD4 A;  2H7H A;  1DX7 A;  1JEK A;  2YNY A;  1YI2 P;  3TGU D;  1BSH A;  4AQR D;  1ZME C;  3L35 A;  1IFP A;  5AW8 B;  1S5L X;  1URQ B;  4GT1 A;  1KB9 D;  2YO2 A;  1QL2 A;  1VQ7 P;  1FJP A;  2P7J A;  1ZR2 A;  1USD A;  5TJH A;  5KKZ C;  4W7Y A;  2KS1 A;  3GHG B;  4YXD C;  1Q81 Q;  3CX5 E;  4HB1 A;  2BCC E;  2R3S A;  2WIT A;  1L4A D;  3O6Q B;  2N1T D;  5KTB A;  2FFD A;  1W5C E;  1SQQ J;  1GL2 D;  1PP9 D;  1KIL D;  4RKU J;  4NPE A;  1KQF B;  2P67 A;  5AW5 B;  3WMM 0;  3SWK A;  3CL3 D;  5AW1 B;  4L74 A;  1CI6 B;  1FZC C;  3I55 P;  2W8Z A;  3L73 J;  1OZH A;  1NTK D;  3KYQ A;  1KOR A;  2Z5I A;  4H13 D;  5APY A;  4OGQ B;  2VRS A;  1N7S D;  3H32 B;  5APU A;  3AEA C;  3CD6 P;  1G1I A;  3CME P;  2OYH C;  3PRJ A;  2IBZ I;  1PGO A;  2WT7 B;  1QVF O;  2KSE A;  2Y0C A;  2JDI H;  1SQB D;  2E5T A;  2RH0 A;  3TGU J;  3M91 A;  1NTK K;  1W2B O;  3W68 A;  2NPS C;  5B66 E;  2FXM A;  2OYI C;  3Q5S A;  4UB8 H;  3L70 G;  3CWB J;  1U57 A;  3P8C E;  2HR3 A;  2O1K A;  3CCU P;  4C7N B;  1GMJ A;  2IDB A;  1FU1 A;  3VTP C;  3CCE P;  3R4Y A;  2M5A A;  2QJP C;  3EFF K;  2C0X A;  2HG5 D;  3HE4 A;  1IFD A;  3V2Q A;  4JYB A;  3H32 A;  1BGY D;  4W80 A;  1PL5 A;  4AUW A;  3N4X A;  2C9L Y;  3L75 D;  2N1T C;  2OTL P;  2O01 J;  1GL2 C;  1LNQ A;  3H1K G;  3B71 A;  2YIU C;  2IBZ G;  1HJ0 A;  4U3F D;  1HTL C;  5KJ7 D;  2H89 C;  3M06 A;  1Y8A A;  2Y9Y A;  3AE4 C;  2Z4E A;  1YQ3 C;  4H13 C;  3IAO A;  3GF3 A;  1DEB A;  1N7S C;  5KLV J;  3L70 E;  2D2C C;  5AVR B;  3H1H G;  2ZFC A;  3L74 J;  1SQX G;  1AQT A;  4MN4 C;  3GG2 A;  1SQB J;  5APW A;  2KP8 A;  1EZV I;  1NTZ G;  1YJ9 P;  1FZB A;  3PH0 A;  3WU2 H;  3RK3 E;  4N6J A;  5KKZ B;  3HUS C;  5GTH H;  2K88 A;  4PD4 D;  4L73 A;  2QG4 A;  1G2C B;  2YKP A;  2KOG A;  2O01 H;  3JCU E;  1D7M A;  3NFQ A;  3H1K E;  3V4Q A;  1RF0 C;  4EIJ A;  2IBZ E;  3A0H E;  2E43 A;  4OVN F;  3L71 G;  1FZC B;  4EI2 A;  5BVZ A;  1SQV G;  1RHZ B;  4HJG H;  1SQP G;  1VL2 A;  3CI9 A;  1JTH A;  3LW5 J;  3H1H E;  1T8Z A;  3L75 J;  1SQX E;  3NXS A;  1P84 D;  2NZ2 A;  2OYH B;  3V5B A;  1VQP P;  5B66 H;  1YHQ P;  1GZL A;  4U3F J;  1N2D C;  1X8Y A;  1SS1 A;  1NTZ E;  2ZYA A;  3L4F A;  3MGN A;  5KJ7 C;  2YKO A;  2WPR A;  2KYV A;  3MUD A;  1HGZ A;  2NPS B;  5AW9 B;  1NWQ A;  3WUT A;  1YJN P;  3V6I A;  1KD1 Q;  2OYI B;  2IYP A;  2L91 A;  1OVR A;  2LR2 A;  5CBO A;  1EXJ A;  4IFF A;  1JM0 A;  3VMZ A;  3IF4 A;  3L71 E;  3GF7 A;  2XZR A;  4RJT A;  2HYN A;  4D6T D;  1SQV E;  2LKM A;  1CZQ A;  1SQP E;  1MZ9 A;  1OWA A;  3CXH H;  3LW5 H;  1SQP K;  2QJP B;  3BVH A;  4BXL A;  2ZAE B;  1S3J A;  1S5L E;  4A7P A;  4WY4 A;  2N1T B;  1X79 B;  3EFG A;  5H2F E;  1HGV A;  2ZJS E;  2PRR A;  1JY2 O;  2K37 A;  1GL2 B;  2W90 A;  1L0L G;  1A02 J;  2YIU B;  2M0B A;  3KXD A;  1L0N E;  1Q2N A;  4IOI H;  3TNU B;  4RO0 A;  3BCC D;  1JCC A;  4H13 B;  1NJI Q;  1BSN A;  1PV3 A;  1N7S B;  5CJ4 A;  1QGK B;  5CCH C;  2D2C B;  2R44 A;  5CCG A;  2E76 D;  1LTA C;  3B5N A;  2FKW B;  1KYO E;  2Y0E A;  5L8R J;  1VQ6 P;  3M0A A;  3GMA A;  3HUS B;  2E75 D;  1SVF A;  1VQ9 P;  1T2K D;  4N78 D;  4OH8 B;  1L0L E;  2AEF A;  2FYU K;  1NH4 A;  3L72 G;  2UWJ E;  4D6T J;  1OW6 A;  1IO4 A;  4GOD A;  5AVS B;  2DW3 A;  2P1J A;  1SLQ A;  2P58 A;  2B88 A;  1QL1 A;  1IC2 A;  5AW3 B;  5APT A;  4KHX A;  3V4W A;  1GU4 A;  2Q3I A;  2HPC A;  1NTM G;  1IFJ A;  1GK4 A;  5APV A;  3H1J G;  5CMZ A;  2OTJ P;  4DT0 A;  4O9B A;  1KN7 A;  1JY3 N;  1KTM A;  3V2R A;  3BCC J;  3HD7 D;  1LT9 C;  1SQQ G;  1BE3 J;  2WSS H;  1IFN A;  3E1I A;  2GUS A;  3CCS P;  4W7Z A;  3BAT A;  1VF5 D;  1WMK A;  3L72 E;  3VP8 A;  3FXE A;  2OTK E;  2V4H A;  2E76 C;  1VQO P;  1OW7 A;  2HLO A;  3A3Y B;  2AXT H;  3G6E P;  3M9B A;  1ZXG A;  1SP4 A;  5KAI H;  5CJ0 A;  1NHL A;  3CCR P;  3RGU A;  3AEF C;  4GOF A;  2O1J A;  3M0D C;  1NTM E;  4NPF X;  1H88 A;  2WQY C;  3L73 D;  3OW2 O;  3D6Z A;  2XV5 A;  3H1J E;  1T2K C;  1S72 P;  3MTU E;  3TGU G;  1EDL A;  1YTZ T;  1RE4 C;  1LTT C;  5CBN A;  4I7Z C;  3AE8 C;  2PAJ A;  1MUU A;  1M1J A;  2W6A A;  2QJK C;  2JEE A;  1SQQ K;  4Z1M H;  2JWD A;  3QH9 A;  1NU1 D;  4BRY B;  1VDF A;  1L2P A;  3PP5 A;  2QSI A;  1BCC J;  1LTB C;  3HTK B;  1QEX A;  1LTI C;  3Q2Y A;  1JMB A;  1K73 Q;  1PP9 G;  2I1J A;  3CWB D;  4LGD E;  2J59 M;  1J1D C;  1S2E A;  1ZR4 A;  1YIJ P;  1N7L A;  2BCC D;  1JOC A;  5AW0 B;  1FDO A;  1M8O B;  1KFM A;  2OGU A;  3TGU E;  1ZLL A;  1NTK G;  2Y9Z A;  1VF5 C;  2R3C A;  3D6Y A;  1SFC D;  1XTG B;  2QIW A;  4WB4 A;  1KB9 E;  2CPB A;  2IX7 C;  4I2L C;  4H0L D;  4PJ0 H;  3OAK A;  1FAV A;  1MFT A;  1M57 D;  1KFN A;  4GKG A;  1GDT A;  1IZN B;  2M8R A;  2MKV A;  4UB6 H;  1MKM A;  1SQB G;  4EDF A;  1IFI A;  2W6J H;  1Q90 D;  4LLH A;  2WPS A;  3WUV A;  2IZ1 A;  3BAS A;  1LTJ C;  2MJZ A;  1URQ A;  1K8A Q;  1U7J A;  5KLV D;  2SPZ A;  1PP9 E;  2YMK A;  3AEG C;  1FOS F;  4L75 A;  3L74 D;  1LT9 B;  2XDJ A;  1NU1 J;  3A0B E;  3I56 P;  1FE6 A;  4K35 A;  1E79 H;  1NTK E;  4EOT A;  3TK1 A;  2A45 H;  3L36 A;  4EYY Q;  1EXI A;  3P8C D;  3H1L G;  3GW6 A;  3G3Z A;  3GHG A;  3AEE C;  4DCK A;  2WPV B;  5AVZ B;  2JKV A;  3CC7 P;  1BGY G;  3O6Q A;  2BEZ F;  1RE3 C;  1PPJ D;  5KLV K;  1LWU C;  3L75 G;  1NYH A;  2Q7C A;  2KB7 P;  3AEC C;  1Q7Y Q;  2BCC J;  3ABV C;  1CI6 A;  3MD0 A;  2FYZ A;  3Q5R A;  2W27 A;  1SQB E;  1A02 F;  4U3F G;  1SQB K;  1N73 C;  5AW4 B;  3V2P A;  3PLN A;  1S4X A;  1P84 I;  3CXH D;  2WSE J;  4I7Z B;  2C0W A;  1L4A C;  1SFC C;  3C9I A;  2W6B A;  1VPC A;  4H0L C;  1KIL C;  5E79 E;  2QJK B;  2WT7 A;  4KJM A;  3RK2 D;  2R5B A;  2QVA A;  1NAY A;  3VOP A;  5DJT B;  3VP9 A;  4R4M A;  3L70 D;  1GW4 A;  3H1L E;  2AXC A;  4YPC A;  2WPQ A;  1BGY E;  5AVW B;  1BDD A;  1RH5 B;  2R32 A;  3L75 E;  1AA0 A;  3CX5 H;  3T97 B;  5AVT B;  1J1D B;  4C7N A;  4IL6 X;  4U3F E;  1FJK A;  2J5U A;  3TF5 A;  2B89 A;  2ZXE B;  4NPD A; 
#chains in the Genus database with same CATH homology
 1RH5 B;  2YXR B;  3MP7 B;  3JC2 2;  1RHZ B;  2YXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...