2YXQB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxqB00
1RH5B 1RHZB 2YXRB 3JC22 2YXQB 3MP7B
chains in the Genus database with same CATH superfamily
3H1KD 3BCCG 3E1IA 1HH0A 4EOTA 1FZCB 1S72P 2P1JA 1L0NJ 1PGPA 2LXCB 4GDOA 3L72G 1GK4A 2NZ2A 1PGOA 5AW3B 1OMIA 1URQC 4I6MC 3T97A 4K35A 3G6EP 1NTKK 5CCGA 3H1JD 3AECC 1OFCX 2Q3IA 2AEJA 3L70J 5CJ0A 1PL5A 5EFWB 4N78E 1SQBK 1YTZI 3CCLP 3HD7A 1G2CA 1DX7A 3C9IA 2Y0DA 1CZQA 1IZNB 3CC7P 1EXJA 3RK3B 2FYUG 1J1EC 2G8YA 1ZLLA 3L74D 2KXPB 4JYBA 1K9MQ 4RESB 3AE2C 3L75G 3BRVB 2QEXP 3CX5I 4OGQB 2ZYGA 5APUA 3TGUE 2DW3A 1JMMA 1KB9I 4HH2A 4GOFA 2WSFH 1LNQA 1T8ZA 2LKMA 1RE3A 1NJIQ 5KKZC 3WUVA 1IFMA 2ITAA 1S9KD 1ZOYC 3CMAP 1NTZE 1OXZA 3B8EB 3AE9C 2PAJA 3P8CD 4N6JA 2YMKA 1BGYD 1LWUB 1OW7A 3O8ZA 2FFDA 1FZAA 3KHUA 5B5EH 1SQPE 1NU1G 4IOIH 1PPJG 5AW4B 2ZAEB 1H89A 1K73Q 1GW4A 4UB8H 1ZMEC 3KYQA 2E75D 2KSJA 4BRYB 2OTJP 3H1KJ 4EI2A 1FOSF 2P58A 2V4HA 2SPZA 3E1RA 1URQD 4XFJA 4DCKA 3CMEP 3KZIE 3H1HG 1PIXA 1FZCC 2WSCH 4IFFA 1JTHB 3AE1C 1X9VA 2JKVA 3H1JJ 2OYHB 3F5HA 1BCCG 5APVA 1L0LD 3VMXA 5KAIH 4EYYQ 1MV8A 3AE5C 1IK7A 1EZVD 1YJ9P 3S9OA 2K9JB 5B66E 2HYNA 2K1AA 3K5BA 1MFZA 2D2CB 1YITP 2IBZD 4YXWH 2V7QH 4Z1MH 5APYA 3A7OA 3L74J 4AUWA 2XNXA 1M8OB 3CXHD 4R4MA 3RK3C 2Q9IA 1DD4A 3A5TA 2IFNA 1SQVE 1Y8AA 1IFIA 3AE6C 1SQXD 2POHA 4D6TG 4PJ0E 2R3CA 5BU8B 4OGQC 4PV1D 4ZNCA 1VQ4P 5APSA 4KT0J 3F89A 1EC5A 2QJPB 1VL2A 1KC8Q 4L73A 2HG5D 3H1ID 1LTBC 4A7PA 4GT1A 2O01N 3TGUG 3M9HA 2CK3H 1BGYJ 1QGKB 3PJSK 1HF9A 5CBNA 4H13D 3M0DC 3HUSB 3Q2YA 4R4LA 1LWUC 5GTHE 1HJ0A 3MD0A 1KZUB 1PFIA 2R3SA 2A45G 1KV4A 1KB9E 1VQNP 2CPSA 2ZXXA 1SS1A 1WRGA 1BDDA 1Q82Q 1KN7A 1LTJB 1RHZB 5AVQB 5E79H 1OW8A 2A45H 3UIAA 3L35A 1IFPA 2C0WA 3CCRP 5APWA 3D70A 2FXPA 3RL0B 3L74G 3P7KA 1DEBA 2UWJE 3FX0A 1D7MA 2WPRA 3QH9A 1DD3A 3PHLA 4U7JA 1L0LJ 3IN6A 3D71A 3JSVC 3L4FA 1L4AC 2C9LY 3M06A 3EFGA 3OW2O 4PD4I 2KI7B 4XA4A 2Y9ZA 1ZN5A 5TJHA 5AW8B 1NKNA 1H0TA 2R32A 3RK3D 3BCCE 3KZIH 5AW5B 2HODA 2D2CC 3FXEA 3N4XA 3GG2A 3L72E 1AV1A 4RO0A 3A3YB 2KOGA 2KK7A 1IJDB 1NTZK 1NO4A 1NAFA 4OGQD 1KILA 1SQXJ 2VRSA 2W6AA 3H1LE 2Z4EA 1N2DC 3NFQA 1T3JA 3AE4C 1EDJA 3ITKA 1KYOD 3CPWO 5B66H 2M3BA 3HE5A 1KD1Q 3H1IJ 1NTMG 2WMMA 4DZOA 4QMAA 2QJPC 3MHVA 1KFNA 5CBOA 3M9BA 1VQ5P 3LIEA 2YKOA 3TDKA 3A0BH 3R4YA 4O9BA 2O01H 4I7ZB 1NAYA 3AEFC 3FWNA 3SFDC 3LIDA 2FYUE 1T2KC 3CCJP 2K37A 3HUSC 1IK9A 4KJMA 5AW1B 3L75E 4PJ0H 2HPCA 3W68A 3BRTB 2FYNC 1N86A 2WPQA 5TISH 1P84H 3GLMA 1KQLA 1JY3O 1FZBA 3VMYA 1CSBA 2Y0CA 2E5TA 3L71E 1YJNP 1QX8A 2BCCG 4C7RA 2FFDB 5B5EE 1FS0E 1N7SA 1GMJA 1N7LA 2QIWA 1KQSO 2KLUA 3BASA 1LTAC 1QVGO 3GHGC 1L0NE 3AEBC 1ZW0A 4GKGA 4UB8E 4I2LC 5GTHH 5KAFE 1HGZA 1SQXG 1M1KQ 1Q90D 1NU1E 1RQVA 1LP1A 5AVZB 2O3JA 1EDLA 3CX5H 3Q5PA 5KLVD 1KB9H 4C46A 2AEFA 5AVYB 1N73A 2H43A 2L5GB 1SQQJ 1IC2A 2KNCB 1VQPP 1LT9C 2D2CD 1SQVK 2YMYA 1RF0A 2E74B 3MUDA 4GIFA 4WY4A 1LT1A 4HYTB 3H1HE 1KILE 1DH3A 1K05A 3M0AA 3NTNA 3GMAA 2KZIA 1JOCA 5KJ7C 4N78D 1BCCE 5M1BA 5GTIE 2E75C 2LR2A 1QVFO 1YQ4C 5APQA 1RF1C 1MKMA 1YI2P 1FJPA 4ZKPA 3V2PA 1K04A 2KYVA 3AEEC 1NGMB 3VOPA 3H1LG 1OX3A 1RE4C 1T2KD 2ZXEB 3SWFA 1BSHA 2E5YA 3I5CA 3U1CA 4U3FG 4I7ZC 2JDIH 1P84I 2XDJA 3TNUB 1EXIA 3KPEA 3CCEP 3VTPC 2M0BA 5KTBA 2B9BA 4YPCA 3SWYA 1RE3C 1EZVI 1NOHA 2JEEA 1M1JC 1NTZD 2O1JA 4D6TE 2N1TB 3CWBJ 3L73G 1SQQG 1Y9BA 3MGNA 3H1KE 2IBZI 3WMM0 3RL0D 3Q1MA 1SQPD 2B87A 3CXHI 1PP9G 1URQA 3IF4A 4BWNA 2P2UA 1JY3N 4EDFA 4LC1A 4JYCA 3L71G 4DJGA 3H1JE 2WPVB 3V2NA 2Z5IA 5KLVJ 4WVZA 3HRNA 4PV1C 3R2PA 5E79E 1JY2O 3MTUE 3ABVC 1L0NG 3CLQA 2M5AA 3P32A 3N7NA 2C9NY 4MN4C 1AVYA 1SFCA 5AW7B 2IZ1A 3EWKA 3NMDA 1JMBA 1FZGA 3WU2E 5K5GB 1VQLP 2IYPA 3U1AA 4H13C 2IZ0A 4W7ZA 2RMZA 5KJ7D 2J58A 3C1LA 1KMIZ 2QJYB 3L70G 3L74E 3U59A 3G71P 1QLED 1S3JA 2M3EA 5KAFH 1S5LX 1GTWA 1LTSC 2PGDA 4IL6E 4WB4A 1A02J 1FOSE 2Y0EA 1R8EA 1GL2A 1LJ2A 3CCUP 3B5NB 1H0TB 3AEGC 2FYUK 3CWBG 2YXRB 1M7LA 2ZVOB 1S9KE 1M56D 2HODB 3O6QA 5AVWB 4LLHA 3HE4A 3H6PA 1EQ7A 2KLVA 5CCHA 1KILB 1ZP0C 2QJKB 1NKZB 3L36A 3P8CE 1MFTA 2A06D 3V4QA 1BE3D 3W67A 4IFDK 2RKLA 2KB7P 1J2JB 2ZYDA 1X79B 5GTIH 5CJ4A 2JWDA 2H8PD 4WWIA 1NTZJ 2NRGA 3P8MC 5AVTB 1L0NK 2OYIB 2MKVA 1QEXA 2YKQA 1TU3F 1WMKA 1GK6A 4PD4H 3A0BE 2N1TC 2IPPA 2Q1KA 5CHXA 1NU1K 3AE8C 1SQPJ 2ZVNB 1NTME 1FZCA 4XE5B 2JO1A 2NPSA 1CI6B 3H25A 3GF3A 1H8AA 4Y28J 1VF5B 3OJAB 1NTKD 5TISE 1P84E 1X0TA 1L0LE 3H1KG 1Q81Q 1KYOI 3IR9A 1OVVA 3I55P 2XV5A 1EZVE 1SQBD 2QVAA 2W27A 1FZFA 1W2EA 5KLIB 2E74D 1YBKA 1VDFA 3OA7A 2E76B 3H1JG 2IBZE 2BCCE 4L76A 1JCDA 2QM8A 2ZFCA 5APXA 2JJLA 1JY2N 4KHXA 3CXHE 3CX5E 4EIJA 1M90Q 2XKMA 2QJYC 2FKWB 2OYOA 1N73B 3BVHA 1J1DB 3D6ZA 1SQXE 3V5BA 1ZRTE 1FAVA 1PGJA 1FU1A 4WY4B 3VYIA 2WT7B 1USDA 3BCCD 3B5NC 4N3YB 3JCUE 1IFJA 2E42A 1Q86Q 5C39A 3WU2H 3H1IE 2Q7CA 1KQFB 1FBMA 3JC22 5H2FE 3M9QA 1HUCA 3VMAA 2AXTH 2FXMA 2OYHC 3M0DA 2FXOA 3Q3DA 2PFXA 1LTGC 1BE3J 2JP3A 2MJZA 1LWUA 1MUUA 4GOEA 4UB6E 5AVRB 4OH8B 1G1JA 4IL6H 2YNYA 1X22A 2O1KA 3CL3D 4AQRD 2N1TD 4WBAA 3T97B 2KS1A 1NWQA 2RH0A 3LW5J 3PLNA 1HBWA 1S1CX 2H7HA 1GU4A 4I1LA 2OYIC 1BGYG 4BRYA 3S4RA 2P7JA 3RBXA 2WWWA 3TSIA 4JPZB 3GW6A 2FYUD 2Z5HA 3SFEC 3PTZA 2WPSA 3HD7B 4H0LB 3RGUA 1G2CB 1DIPA 3L75D 1NTKJ 1JTHA 1AJYA 4U3FE 1EDIA 4JF7A 2WITA 1OVUA 1U7MA 1L4AA 1SQBJ 4JBZA 3B4SA 3TK1A 1DEEG 3CCMP 1UIXA 1VQ9P 3L73E 4IFMA 1SQQE 5KLIC 1L0LG 3RK3E 2WSEJ 1NYHA 3I56P 1GZLA 1NU1D 1EZVG 1JY3P 1IFDA 1PP9E 1PPJD 3EQ2A 4W7YA 2P67A 3USSA 2L91A 2W6JH 1H88A 3B5ND 4TT3H 2IBZG 1SFCB 1J1DC 1KYOE 1VQ8P 3CCVP 1AQTA 1LTJC 3MUDC 2Q3EA 4K3AA 3PH0A 2K3RA 3RL0C 3H1HD 1KILD 3E7KA 4HB1A 2N9BA 2ZT9B 2B88A 4ASVA 3CXHH 1BCCD 3G4SP 1K8AQ 1GL2B 1S2EA 1GDTA 3HUSA 3L70E 1NTMK 1MZ9A 3H1IG 3O6QB 1AA0A 4JQ0D 2W83C 3CWBE 2IFMA 3JCUH 1LTTC 1L0LK 2FYUJ 5CCGC 1HGVA 2R5BA 2WSFJ 5H2FH 3GHGA 1Y47A 2YKPA 3L75J 3IFMA 1VF5D 3Q5SA 3OAKA 3IAOA 1BSNA 1GU5A 3HD7C 2RN0A 4UB6H 3MZWB 4D6TD 2AEMA 4M3LA 2H88C 4PD4E 1S5LH 1HWTC 3BATA 1HTLC 5KLVE 2GUSA 1QL1A 1LT9A 3H32A 2NPSB 1JM0A 2E76D 4OVNF 4ZMDA 1ZV8A 3TGUD 1SQXK 3QWOC 2GUVA 1X8YA 1YQ3C 1NU1J 1JUNA 1M57D 2KIKA 1S4XA 1BDCA 1YYCA 3FXDA 2HR3A 3CC2P 3EFFK 5KJ7A 2W6BA 3A0HE 4L74A 2WSCJ 1FDOA 4WY4D 3SWKA 3FWLA 1FDMA 1RF1A 1JO5A 1ZR4A 1A02F 3VP8A 1SFCC 4DT0A 1YJWP 1OW6A 2FFDC 2OQQA 3H1HJ 2JWAA 2Q5UA 3TYYA 3ZDMA 1AQ5A 1RE4A 2Q6QA 1RH5B 3L37A 4H44B 1BCCJ 1JY2P 2ZT9C 5AW0B 3TF5A 1T3UA 1XTGB 2H89C 2QSIA 2V7QJ 3Q5RA 1HVVA 4AYCA 1GL2C 2WSSH 1M1JA 4OWFA 1VPCA 1RY3A 3PP5A 5CCGD 1KYOH 2HFED 2E74C 3WUUA 2AXTE 5CCHC 5L8RJ 2CPBA 2QRXA 3B71A 3HD7D 4H0LD 4HKZH 1FZEA 4RKUJ 1W5CE 1Z56A 2J5UA 2FY8A 3HTKA 4D6TJ 1SQQK 2N9YB 2KS1B 1IO4A 5BVZA 2HLOA 4YXDC 1PZQA 3KQGA 2G3AA 1NTMD 1FJKA 4DOJA 3TGUJ 4C7NA 4NPEA 2KNCA 1SQVD 1VQOP 2I1JA 1BGYE 1USEA 1HJBA 2NPSC 2R5DA 4RJTA 3MP7B 1R5SA 3HE5B 1P84D 2FYZA 5KLVG 1L4AB 1YIJP 2BEQD 1KFMA 2YO2A 1VQ7P 2IX7C 1SFCD 2XZRA 3M91A 2Y9YA 2JR8A 2YXQB 1JEKA 1R5LA 1OVRA 3VP9A 2IDBA 4L75A 2BCCD 3CCQP 1VQKP 1VQ6P 1PGQA 1U7JA 2ZT9D 3V2RA 2HPCB 2OGUA 2ZJSE 3CX5D 3CI9A 1KB9D 1GL2D 2PRRA 2A06E 4H44C 1KORA 3RK2B 1ZRTD 2KUBA 1BE3E 1N7SB 3TNUA 3A0HH 4NPFX 5AW9B 2YIUB 1IFNA 3CD6P 5AVVB 2QG4A 2BASA 1LTIC 1L2PA 1SP4A 3VN0A 5CCHD 2N1TA 1SVFA 1KTMA 2J59M 1UIIA 1LP1B 1QL2A 1U57A 3WUTA 4ASWA 3RBZA 5KLVK 1ZXGA 4HJGH 3PRJA 1NTZG 2R44A 2FYNB 1NH4A 4LGDE 3G9RA 1NTKE 1Q2NA 4BXLA 3KXDA 2O01J 2OARA 1G1IA 4ZKUA 1JCCA 1NTMJ 3L72D 1SQPG 2K88A 2NPSD 2B89A 3NXSA 1SQBE 5DJTB 1SQVJ 3GHGB 1PV3A 2XNDH 3H1LD 1YHQP 1XTCC 1KILC 1LGHB 2QJKC 2C0XA 2WTYA 2KSEA 4U3FD 3V4WA 3II6A 4GODA 5DJUB 1S5LE 3AE3C 5AW2B 3RL0g 5CMZA 2OTKE 1LT9B 3V2QA 3H32B 3L73D 1SQQD 2QM7A 4TLFA 2BCCJ 3B5NA 1KQGB 4Y99B 1OZHA 5APTA 2W90A 4H44D 1PP9D 2QA4P 4YTPC 2OYHA 3MIWA 1VF5C 3GF7A 2E75B 4B86A 2P10A 2OTLP 3L71D 1RF1B 1YTZT 2WVRA 1FC2C 2QE7H 4NPDA 2B87B 3RK2C 3CCSP 2K9JA 3G3ZA 2LXBA 1SQPK 1N7SC 1URQB 5AW6B 1L0ND 3KDPB 2YIUC 1CW5A 2OYIA 1OIPA 2E76C 3AEAC 1SQVG 2WZ7A 1NVOA 2A06G 2GA1A 1N8RQ 1BE3G 2I1KA 2KP8A 2ZYAA 3L70D 2M5AB 1E5WA 1CI6A 5AVXB 1FE6A 1JB0J 1M1JB 1N73C 1W2BO 5BU5A 1GW3A 2AXCA 3BCCJ 2A45I 1SLQA 1RF0C 2WQYC 1J1EB 2BEZF 4WY4C 1RQUA 1E79H 3L72J 3CWBD 3SSUA 1ZR2A 2PP6A 1AVOA 3H1LJ 1VQMP 3LW5H 2I8DA 3D6YA 3A2AA 3AE7C 1NTKG 3HTKB 1WT6A 4U3FJ 2W8ZA 5KKZB 4IL6X 3V6IA 1L4AD 3AEDC 1NHLA 2IYOA 4PV1B 1T6AA 4PD4D 1SQBG 1PPJE 3HE4B 2K9YA 3VMZA 1OWAA 3S1KA 2E43A 1JNMA 2FBWC 3L73J 2KZJA 4W80A 4C7NB 2YO3A 5AVSB 1FDIA 1LTJA 1AFOA 4H13B 2WT7A 1GD2E 4Y99C 1Q7YQ 1PP9J 2M8RA 5KAIE 4H0LC 3CC4P 3L71J 2WSEH 3RK2D 2GM4A 2XU6A 1EDKA 3C8VA 1N7SD 3FGAD 4CPGA 5AVUB
chains in the Genus database with same CATH topology
1RH5B 1RHZB 2YXRB 3JC22 2YXQB 3MP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RH5 B;  1RHZ B;  2YXR B;  3JC2 2;  2YXQ B;  3MP7 B; 
#chains in the Genus database with same CATH topology
 3H1K D;  3BCC G;  3E1I A;  1HH0 A;  4EOT A;  1FZC B;  1S72 P;  2P1J A;  1L0N J;  1PGP A;  2LXC B;  4GDO A;  3L72 G;  1GK4 A;  2NZ2 A;  1PGO A;  5AW3 B;  1OMI A;  1URQ C;  4I6M C;  3T97 A;  4K35 A;  3G6E P;  1NTK K;  5CCG A;  3H1J D;  3AEC C;  1OFC X;  2Q3I A;  2AEJ A;  3L70 J;  5CJ0 A;  1PL5 A;  5EFW B;  4N78 E;  1SQB K;  1YTZ I;  3CCL P;  3HD7 A;  1G2C A;  1DX7 A;  3C9I A;  2Y0D A;  1CZQ A;  1IZN B;  3CC7 P;  1EXJ A;  3RK3 B;  2FYU G;  1J1E C;  2G8Y A;  1ZLL A;  3L74 D;  2KXP B;  4JYB A;  1K9M Q;  4RES B;  3AE2 C;  3L75 G;  3BRV B;  2QEX P;  3CX5 I;  4OGQ B;  2ZYG A;  5APU A;  3TGU E;  2DW3 A;  1JMM A;  1KB9 I;  4HH2 A;  4GOF A;  2WSF H;  1LNQ A;  1T8Z A;  2LKM A;  1RE3 A;  1NJI Q;  5KKZ C;  3WUV A;  1IFM A;  2ITA A;  1S9K D;  1ZOY C;  3CMA P;  1NTZ E;  1OXZ A;  3B8E B;  3AE9 C;  2PAJ A;  3P8C D;  4N6J A;  2YMK A;  1BGY D;  1LWU B;  1OW7 A;  3O8Z A;  2FFD A;  1FZA A;  3KHU A;  5B5E H;  1SQP E;  1NU1 G;  4IOI H;  1PPJ G;  5AW4 B;  2ZAE B;  1H89 A;  1K73 Q;  1GW4 A;  4UB8 H;  1ZME C;  3KYQ A;  2E75 D;  2KSJ A;  4BRY B;  2OTJ P;  3H1K J;  4EI2 A;  1FOS F;  2P58 A;  2V4H A;  2SPZ A;  3E1R A;  1URQ D;  4XFJ A;  4DCK A;  3CME P;  3KZI E;  3H1H G;  1PIX A;  1FZC C;  2WSC H;  4IFF A;  1JTH B;  3AE1 C;  1X9V A;  2JKV A;  3H1J J;  2OYH B;  3F5H A;  1BCC G;  5APV A;  1L0L D;  3VMX A;  5KAI H;  4EYY Q;  1MV8 A;  3AE5 C;  1IK7 A;  1EZV D;  1YJ9 P;  3S9O A;  2K9J B;  5B66 E;  2HYN A;  2K1A A;  3K5B A;  1MFZ A;  2D2C B;  1YIT P;  2IBZ D;  4YXW H;  2V7Q H;  4Z1M H;  5APY A;  3A7O A;  3L74 J;  4AUW A;  2XNX A;  1M8O B;  3CXH D;  4R4M A;  3RK3 C;  2Q9I A;  1DD4 A;  3A5T A;  2IFN A;  1SQV E;  1Y8A A;  1IFI A;  3AE6 C;  1SQX D;  2POH A;  4D6T G;  4PJ0 E;  2R3C A;  5BU8 B;  4OGQ C;  4PV1 D;  4ZNC A;  1VQ4 P;  5APS A;  4KT0 J;  3F89 A;  1EC5 A;  2QJP B;  1VL2 A;  1KC8 Q;  4L73 A;  2HG5 D;  3H1I D;  1LTB C;  4A7P A;  4GT1 A;  2O01 N;  3TGU G;  3M9H A;  2CK3 H;  1BGY J;  1QGK B;  3PJS K;  1HF9 A;  5CBN A;  4H13 D;  3M0D C;  3HUS B;  3Q2Y A;  4R4L A;  1LWU C;  5GTH E;  1HJ0 A;  3MD0 A;  1KZU B;  1PFI A;  2R3S A;  2A45 G;  1KV4 A;  1KB9 E;  1VQN P;  2CPS A;  2ZXX A;  1SS1 A;  1WRG A;  1BDD A;  1Q82 Q;  1KN7 A;  1LTJ B;  1RHZ B;  5AVQ B;  5E79 H;  1OW8 A;  2A45 H;  3UIA A;  3L35 A;  1IFP A;  2C0W A;  3CCR P;  5APW A;  3D70 A;  2FXP A;  3RL0 B;  3L74 G;  3P7K A;  1DEB A;  2UWJ E;  3FX0 A;  1D7M A;  2WPR A;  3QH9 A;  1DD3 A;  3PHL A;  4U7J A;  1L0L J;  3IN6 A;  3D71 A;  3JSV C;  3L4F A;  1L4A C;  2C9L Y;  3M06 A;  3EFG A;  3OW2 O;  4PD4 I;  2KI7 B;  4XA4 A;  2Y9Z A;  1ZN5 A;  5TJH A;  5AW8 B;  1NKN A;  1H0T A;  2R32 A;  3RK3 D;  3BCC E;  3KZI H;  5AW5 B;  2HOD A;  2D2C C;  3FXE A;  3N4X A;  3GG2 A;  3L72 E;  1AV1 A;  4RO0 A;  3A3Y B;  2KOG A;  2KK7 A;  1IJD B;  1NTZ K;  1NO4 A;  1NAF A;  4OGQ D;  1KIL A;  1SQX J;  2VRS A;  2W6A A;  3H1L E;  2Z4E A;  1N2D C;  3NFQ A;  1T3J A;  3AE4 C;  1EDJ A;  3ITK A;  1KYO D;  3CPW O;  5B66 H;  2M3B A;  3HE5 A;  1KD1 Q;  3H1I J;  1NTM G;  2WMM A;  4DZO A;  4QMA A;  2QJP C;  3MHV A;  1KFN A;  5CBO A;  3M9B A;  1VQ5 P;  3LIE A;  2YKO A;  3TDK A;  3A0B H;  3R4Y A;  4O9B A;  2O01 H;  4I7Z B;  1NAY A;  3AEF C;  3FWN A;  3SFD C;  3LID A;  2FYU E;  1T2K C;  3CCJ P;  2K37 A;  3HUS C;  1IK9 A;  4KJM A;  5AW1 B;  3L75 E;  4PJ0 H;  2HPC A;  3W68 A;  3BRT B;  2FYN C;  1N86 A;  2WPQ A;  5TIS H;  1P84 H;  3GLM A;  1KQL A;  1JY3 O;  1FZB A;  3VMY A;  1CSB A;  2Y0C A;  2E5T A;  3L71 E;  1YJN P;  1QX8 A;  2BCC G;  4C7R A;  2FFD B;  5B5E E;  1FS0 E;  1N7S A;  1GMJ A;  1N7L A;  2QIW A;  1KQS O;  2KLU A;  3BAS A;  1LTA C;  1QVG O;  3GHG C;  1L0N E;  3AEB C;  1ZW0 A;  4GKG A;  4UB8 E;  4I2L C;  5GTH H;  5KAF E;  1HGZ A;  1SQX G;  1M1K Q;  1Q90 D;  1NU1 E;  1RQV A;  1LP1 A;  5AVZ B;  2O3J A;  1EDL A;  3CX5 H;  3Q5P A;  5KLV D;  1KB9 H;  4C46 A;  2AEF A;  5AVY B;  1N73 A;  2H43 A;  2L5G B;  1SQQ J;  1IC2 A;  2KNC B;  1VQP P;  1LT9 C;  2D2C D;  1SQV K;  2YMY A;  1RF0 A;  2E74 B;  3MUD A;  4GIF A;  4WY4 A;  1LT1 A;  4HYT B;  3H1H E;  1KIL E;  1DH3 A;  1K05 A;  3M0A A;  3NTN A;  3GMA A;  2KZI A;  1JOC A;  5KJ7 C;  4N78 D;  1BCC E;  5M1B A;  5GTI E;  2E75 C;  2LR2 A;  1QVF O;  1YQ4 C;  5APQ A;  1RF1 C;  1MKM A;  1YI2 P;  1FJP A;  4ZKP A;  3V2P A;  1K04 A;  2KYV A;  3AEE C;  1NGM B;  3VOP A;  3H1L G;  1OX3 A;  1RE4 C;  1T2K D;  2ZXE B;  3SWF A;  1BSH A;  2E5Y A;  3I5C A;  3U1C A;  4U3F G;  4I7Z C;  2JDI H;  1P84 I;  2XDJ A;  3TNU B;  1EXI A;  3KPE A;  3CCE P;  3VTP C;  2M0B A;  5KTB A;  2B9B A;  4YPC A;  3SWY A;  1RE3 C;  1EZV I;  1NOH A;  2JEE A;  1M1J C;  1NTZ D;  2O1J A;  4D6T E;  2N1T B;  3CWB J;  3L73 G;  1SQQ G;  1Y9B A;  3MGN A;  3H1K E;  2IBZ I;  3WMM 0;  3RL0 D;  3Q1M A;  1SQP D;  2B87 A;  3CXH I;  1PP9 G;  1URQ A;  3IF4 A;  4BWN A;  2P2U A;  1JY3 N;  4EDF A;  4LC1 A;  4JYC A;  3L71 G;  4DJG A;  3H1J E;  2WPV B;  3V2N A;  2Z5I A;  5KLV J;  4WVZ A;  3HRN A;  4PV1 C;  3R2P A;  5E79 E;  1JY2 O;  3MTU E;  3ABV C;  1L0N G;  3CLQ A;  2M5A A;  3P32 A;  3N7N A;  2C9N Y;  4MN4 C;  1AVY A;  1SFC A;  5AW7 B;  2IZ1 A;  3EWK A;  3NMD A;  1JMB A;  1FZG A;  3WU2 E;  5K5G B;  1VQL P;  2IYP A;  3U1A A;  4H13 C;  2IZ0 A;  4W7Z A;  2RMZ A;  5KJ7 D;  2J58 A;  3C1L A;  1KMI Z;  2QJY B;  3L70 G;  3L74 E;  3U59 A;  3G71 P;  1QLE D;  1S3J A;  2M3E A;  5KAF H;  1S5L X;  1GTW A;  1LTS C;  2PGD A;  4IL6 E;  4WB4 A;  1A02 J;  1FOS E;  2Y0E A;  1R8E A;  1GL2 A;  1LJ2 A;  3CCU P;  3B5N B;  1H0T B;  3AEG C;  2FYU K;  3CWB G;  2YXR B;  1M7L A;  2ZVO B;  1S9K E;  1M56 D;  2HOD B;  3O6Q A;  5AVW B;  4LLH A;  3HE4 A;  3H6P A;  1EQ7 A;  2KLV A;  5CCH A;  1KIL B;  1ZP0 C;  2QJK B;  1NKZ B;  3L36 A;  3P8C E;  1MFT A;  2A06 D;  3V4Q A;  1BE3 D;  3W67 A;  4IFD K;  2RKL A;  2KB7 P;  1J2J B;  2ZYD A;  1X79 B;  5GTI H;  5CJ4 A;  2JWD A;  2H8P D;  4WWI A;  1NTZ J;  2NRG A;  3P8M C;  5AVT B;  1L0N K;  2OYI B;  2MKV A;  1QEX A;  2YKQ A;  1TU3 F;  1WMK A;  1GK6 A;  4PD4 H;  3A0B E;  2N1T C;  2IPP A;  2Q1K A;  5CHX A;  1NU1 K;  3AE8 C;  1SQP J;  2ZVN B;  1NTM E;  1FZC A;  4XE5 B;  2JO1 A;  2NPS A;  1CI6 B;  3H25 A;  3GF3 A;  1H8A A;  4Y28 J;  1VF5 B;  3OJA B;  1NTK D;  5TIS E;  1P84 E;  1X0T A;  1L0L E;  3H1K G;  1Q81 Q;  1KYO I;  3IR9 A;  1OVV A;  3I55 P;  2XV5 A;  1EZV E;  1SQB D;  2QVA A;  2W27 A;  1FZF A;  1W2E A;  5KLI B;  2E74 D;  1YBK A;  1VDF A;  3OA7 A;  2E76 B;  3H1J G;  2IBZ E;  2BCC E;  4L76 A;  1JCD A;  2QM8 A;  2ZFC A;  5APX A;  2JJL A;  1JY2 N;  4KHX A;  3CXH E;  3CX5 E;  4EIJ A;  1M90 Q;  2XKM A;  2QJY C;  2FKW B;  2OYO A;  1N73 B;  3BVH A;  1J1D B;  3D6Z A;  1SQX E;  3V5B A;  1ZRT E;  1FAV A;  1PGJ A;  1FU1 A;  4WY4 B;  3VYI A;  2WT7 B;  1USD A;  3BCC D;  3B5N C;  4N3Y B;  3JCU E;  1IFJ A;  2E42 A;  1Q86 Q;  5C39 A;  3WU2 H;  3H1I E;  2Q7C A;  1KQF B;  1FBM A;  3JC2 2;  5H2F E;  3M9Q A;  1HUC A;  3VMA A;  2AXT H;  2FXM A;  2OYH C;  3M0D A;  2FXO A;  3Q3D A;  2PFX A;  1LTG C;  1BE3 J;  2JP3 A;  2MJZ A;  1LWU A;  1MUU A;  4GOE A;  4UB6 E;  5AVR B;  4OH8 B;  1G1J A;  4IL6 H;  2YNY A;  1X22 A;  2O1K A;  3CL3 D;  4AQR D;  2N1T D;  4WBA A;  3T97 B;  2KS1 A;  1NWQ A;  2RH0 A;  3LW5 J;  3PLN A;  1HBW A;  1S1C X;  2H7H A;  1GU4 A;  4I1L A;  2OYI C;  1BGY G;  4BRY A;  3S4R A;  2P7J A;  3RBX A;  2WWW A;  3TSI A;  4JPZ B;  3GW6 A;  2FYU D;  2Z5H A;  3SFE C;  3PTZ A;  2WPS A;  3HD7 B;  4H0L B;  3RGU A;  1G2C B;  1DIP A;  3L75 D;  1NTK J;  1JTH A;  1AJY A;  4U3F E;  1EDI A;  4JF7 A;  2WIT A;  1OVU A;  1U7M A;  1L4A A;  1SQB J;  4JBZ A;  3B4S A;  3TK1 A;  1DEE G;  3CCM P;  1UIX A;  1VQ9 P;  3L73 E;  4IFM A;  1SQQ E;  5KLI C;  1L0L G;  3RK3 E;  2WSE J;  1NYH A;  3I56 P;  1GZL A;  1NU1 D;  1EZV G;  1JY3 P;  1IFD A;  1PP9 E;  1PPJ D;  3EQ2 A;  4W7Y A;  2P67 A;  3USS A;  2L91 A;  2W6J H;  1H88 A;  3B5N D;  4TT3 H;  2IBZ G;  1SFC B;  1J1D C;  1KYO E;  1VQ8 P;  3CCV P;  1AQT A;  1LTJ C;  3MUD C;  2Q3E A;  4K3A A;  3PH0 A;  2K3R A;  3RL0 C;  3H1H D;  1KIL D;  3E7K A;  4HB1 A;  2N9B A;  2ZT9 B;  2B88 A;  4ASV A;  3CXH H;  1BCC D;  3G4S P;  1K8A Q;  1GL2 B;  1S2E A;  1GDT A;  3HUS A;  3L70 E;  1NTM K;  1MZ9 A;  3H1I G;  3O6Q B;  1AA0 A;  4JQ0 D;  2W83 C;  3CWB E;  2IFM A;  3JCU H;  1LTT C;  1L0L K;  2FYU J;  5CCG C;  1HGV A;  2R5B A;  2WSF J;  5H2F H;  3GHG A;  1Y47 A;  2YKP A;  3L75 J;  3IFM A;  1VF5 D;  3Q5S A;  3OAK A;  3IAO A;  1BSN A;  1GU5 A;  3HD7 C;  2RN0 A;  4UB6 H;  3MZW B;  4D6T D;  2AEM A;  4M3L A;  2H88 C;  4PD4 E;  1S5L H;  1HWT C;  3BAT A;  1HTL C;  5KLV E;  2GUS A;  1QL1 A;  1LT9 A;  3H32 A;  2NPS B;  1JM0 A;  2E76 D;  4OVN F;  4ZMD A;  1ZV8 A;  3TGU D;  1SQX K;  3QWO C;  2GUV A;  1X8Y A;  1YQ3 C;  1NU1 J;  1JUN A;  1M57 D;  2KIK A;  1S4X A;  1BDC A;  1YYC A;  3FXD A;  2HR3 A;  3CC2 P;  3EFF K;  5KJ7 A;  2W6B A;  3A0H E;  4L74 A;  2WSC J;  1FDO A;  4WY4 D;  3SWK A;  3FWL A;  1FDM A;  1RF1 A;  1JO5 A;  1ZR4 A;  1A02 F;  3VP8 A;  1SFC C;  4DT0 A;  1YJW P;  1OW6 A;  2FFD C;  2OQQ A;  3H1H J;  2JWA A;  2Q5U A;  3TYY A;  3ZDM A;  1AQ5 A;  1RE4 A;  2Q6Q A;  1RH5 B;  3L37 A;  4H44 B;  1BCC J;  1JY2 P;  2ZT9 C;  5AW0 B;  3TF5 A;  1T3U A;  1XTG B;  2H89 C;  2QSI A;  2V7Q J;  3Q5R A;  1HVV A;  4AYC A;  1GL2 C;  2WSS H;  1M1J A;  4OWF A;  1VPC A;  1RY3 A;  3PP5 A;  5CCG D;  1KYO H;  2HFE D;  2E74 C;  3WUU A;  2AXT E;  5CCH C;  5L8R J;  2CPB A;  2QRX A;  3B71 A;  3HD7 D;  4H0L D;  4HKZ H;  1FZE A;  4RKU J;  1W5C E;  1Z56 A;  2J5U A;  2FY8 A;  3HTK A;  4D6T J;  1SQQ K;  2N9Y B;  2KS1 B;  1IO4 A;  5BVZ A;  2HLO A;  4YXD C;  1PZQ A;  3KQG A;  2G3A A;  1NTM D;  1FJK A;  4DOJ A;  3TGU J;  4C7N A;  4NPE A;  2KNC A;  1SQV D;  1VQO P;  2I1J A;  1BGY E;  1USE A;  1HJB A;  2NPS C;  2R5D A;  4RJT A;  3MP7 B;  1R5S A;  3HE5 B;  1P84 D;  2FYZ A;  5KLV G;  1L4A B;  1YIJ P;  2BEQ D;  1KFM A;  2YO2 A;  1VQ7 P;  2IX7 C;  1SFC D;  2XZR A;  3M91 A;  2Y9Y A;  2JR8 A;  2YXQ B;  1JEK A;  1R5L A;  1OVR A;  3VP9 A;  2IDB A;  4L75 A;  2BCC D;  3CCQ P;  1VQK P;  1VQ6 P;  1PGQ A;  1U7J A;  2ZT9 D;  3V2R A;  2HPC B;  2OGU A;  2ZJS E;  3CX5 D;  3CI9 A;  1KB9 D;  1GL2 D;  2PRR A;  2A06 E;  4H44 C;  1KOR A;  3RK2 B;  1ZRT D;  2KUB A;  1BE3 E;  1N7S B;  3TNU A;  3A0H H;  4NPF X;  5AW9 B;  2YIU B;  1IFN A;  3CD6 P;  5AVV B;  2QG4 A;  2BAS A;  1LTI C;  1L2P A;  1SP4 A;  3VN0 A;  5CCH D;  2N1T A;  1SVF A;  1KTM A;  2J59 M;  1UII A;  1LP1 B;  1QL2 A;  1U57 A;  3WUT A;  4ASW A;  3RBZ A;  5KLV K;  1ZXG A;  4HJG H;  3PRJ A;  1NTZ G;  2R44 A;  2FYN B;  1NH4 A;  4LGD E;  3G9R A;  1NTK E;  1Q2N A;  4BXL A;  3KXD A;  2O01 J;  2OAR A;  1G1I A;  4ZKU A;  1JCC A;  1NTM J;  3L72 D;  1SQP G;  2K88 A;  2NPS D;  2B89 A;  3NXS A;  1SQB E;  5DJT B;  1SQV J;  3GHG B;  1PV3 A;  2XND H;  3H1L D;  1YHQ P;  1XTC C;  1KIL C;  1LGH B;  2QJK C;  2C0X A;  2WTY A;  2KSE A;  4U3F D;  3V4W A;  3II6 A;  4GOD A;  5DJU B;  1S5L E;  3AE3 C;  5AW2 B;  3RL0 g;  5CMZ A;  2OTK E;  1LT9 B;  3V2Q A;  3H32 B;  3L73 D;  1SQQ D;  2QM7 A;  4TLF A;  2BCC J;  3B5N A;  1KQG B;  4Y99 B;  1OZH A;  5APT A;  2W90 A;  4H44 D;  1PP9 D;  2QA4 P;  4YTP C;  2OYH A;  3MIW A;  1VF5 C;  3GF7 A;  2E75 B;  4B86 A;  2P10 A;  2OTL P;  3L71 D;  1RF1 B;  1YTZ T;  2WVR A;  1FC2 C;  2QE7 H;  4NPD A;  2B87 B;  3RK2 C;  3CCS P;  2K9J A;  3G3Z A;  2LXB A;  1SQP K;  1N7S C;  1URQ B;  5AW6 B;  1L0N D;  3KDP B;  2YIU C;  1CW5 A;  2OYI A;  1OIP A;  2E76 C;  3AEA C;  1SQV G;  2WZ7 A;  1NVO A;  2A06 G;  2GA1 A;  1N8R Q;  1BE3 G;  2I1K A;  2KP8 A;  2ZYA A;  3L70 D;  2M5A B;  1E5W A;  1CI6 A;  5AVX B;  1FE6 A;  1JB0 J;  1M1J B;  1N73 C;  1W2B O;  5BU5 A;  1GW3 A;  2AXC A;  3BCC J;  2A45 I;  1SLQ A;  1RF0 C;  2WQY C;  1J1E B;  2BEZ F;  4WY4 C;  1RQU A;  1E79 H;  3L72 J;  3CWB D;  3SSU A;  1ZR2 A;  2PP6 A;  1AVO A;  3H1L J;  1VQM P;  3LW5 H;  2I8D A;  3D6Y A;  3A2A A;  3AE7 C;  1NTK G;  3HTK B;  1WT6 A;  4U3F J;  2W8Z A;  5KKZ B;  4IL6 X;  3V6I A;  1L4A D;  3AED C;  1NHL A;  2IYO A;  4PV1 B;  1T6A A;  4PD4 D;  1SQB G;  1PPJ E;  3HE4 B;  2K9Y A;  3VMZ A;  1OWA A;  3S1K A;  2E43 A;  1JNM A;  2FBW C;  3L73 J;  2KZJ A;  4W80 A;  4C7N B;  2YO3 A;  5AVS B;  1FDI A;  1LTJ A;  1AFO A;  4H13 B;  2WT7 A;  1GD2 E;  4Y99 C;  1Q7Y Q;  1PP9 J;  2M8R A;  5KAI E;  4H0L C;  3CC4 P;  3L71 J;  2WSE H;  3RK2 D;  2GM4 A;  2XU6 A;  1EDK A;  3C8V A;  1N7S D;  3FGA D;  4CPG A;  5AVU B; 
#chains in the Genus database with same CATH homology
 1RH5 B;  1RHZ B;  2YXR B;  3JC2 2;  2YXQ B;  3MP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...