2YXRB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxrB00
1RHZB 3JC22 1RH5B 2YXQB 2YXRB 3MP7B
chains in the Genus database with same CATH superfamily
1L4AB 1MKMA 1WMKA 3CXHE 1AJYA 5AVXB 2WQYC 2FKWB 1OW6A 3GG2A 3CCJP 1NTZG 1T8ZA 2WSFH 3GLMA 5CJ0A 1PPJE 3FX0A 2A45H 1YHQP 1EDLA 1NTMG 2M5AA 1KQLA 4ASVA 1VQMP 1GL2C 2Q9IA 1YYCA 5AVWB 1YITP 1KQFB 3A0HE 2AXTH 3H1KE 4AQRD 2QJPB 1K73Q 1L0LJ 4RJTA 1W2BO 2J5UA 2WPRA 2E5TA 2LR2A 1LTBC 4DT0A 2NPSA 4TT3H 1RE3A 1IZNB 4H44C 4YXDC 1LWUA 1VF5C 3CCLP 1OIPA 3OW2O 5H2FE 5KJ7C 2W90A 2OGUA 3II6A 2P1JA 1QGKB 2E5YA 2LKMA 2DW3A 1JUNA 3V2RA 1J1EB 2N1TD 3H25A 4ZNCA 3PTZA 4UB6H 3JC22 1EXIA 3NTNA 2A06E 1NTKK 5KLVK 2H89C 1EDKA 2JR8A 5DJUB 1S1CX 1PV3A 3JSVC 1EZVE 4GODA 1BDCA 1BGYG 1FZCA 3B5NB 1LTTC 3L75G 1Q90D 3EWKA 1YJ9P 3HTKA 2ZYAA 3CLQA 2N9YB 4N78E 1PGPA 1MFZA 3G6EP 2RN0A 1W5CE 2OTJP 1BCCE 2WSEJ 2QVAA 1Y47A 2KNCA 1M1JB 1AV1A 2Q6QA 1BE3G 1MUUA 1L0NJ 1GMJA 4I6MC 3VP8A 2YKQA 2JKVA 1BGYJ 1E79H 3Q3DA 1M90Q 2HYNA 2NPSC 2D2CC 1RE3C 1KILC 5APXA 1NTKG 1LWUC 3C8VA 5KLVG 4IL6H 3L71J 1L0LD 1NU1J 1TU3F 2K37A 2C9NY 1DEBA 1X9VA 4RO0A 1N7LA 4PJ0E 1NTZD 3RBZA 4GOFA 3SFDC 3GF7A 2JWAA 1FOSE 3I56P 4NPDA 5CCGA 1NTMD 2R3SA 4BWNA 1HVVA 5AVQB 4L74A 1FS0E 1KFMA 4H13D 2BCCJ 3RK3B 1LTJA 1VQLP 4XA4A 3B4SA 3L72J 4GIFA 2E76D 1FZCC 2UWJE 2OTKE 2K9JA 4C7RA 1KORA 1HTLC 1GW3A 1K8AQ 4L76A 2WMMA 1S3JA 2YO2A 3MGNA 3RL0C 3HE5A 2Y0EA 1ZR2A 3NMDA 1NO4A 3CMEP 2NZ2A 1FZBA 1URQB 4WY4B 1LTGC 1LT9B 3CX5E 1PGQA 4BRYB 3B71A 2Z4EA 3M0DA 3WUTA 2R5DA 4XE5B 3CCUP 3CWBJ 2FBWC 4DZOA 2ZYDA 1DH3A 3B8EB 3D6YA 1KB9E 3H1KJ 1OVUA 4IL6X 2OYOA 3H32A 1NYHA 1BGYD 2YMYA 3GHGA 3N7NA 3KZIH 2Q5UA 3L75D 2G8YA 5CMZA 2A06G 1GZLA 3RK2C 1LTSC 2Q3EA 1VQPP 4OGQC 1NU1D 1EZVG 2RMZA 1OFCX 5CCGC 3PRJA 3USSA 1SQVJ 1VQNP 3FWNA 1GTWA 4PV1D 1LTJC 4YXWH 2XV5A 3RGUA 4UB8E 4IFDK 2CK3H 2WPVB 2YO3A 1BCCG 3ABVC 3JCUH 3QWOC 1N2DC 3BRVB 5KAIH 1J2JB 3TNUA 1NTKD 1YI2P 2FXOA 1JY2N 4U3FE 2YMKA 2LXBA 3MTUE 5E79E 3MD0A 1YQ3C 1GL2B 2GUSA 1G2CB 3CXHD 4H0LC 3M0DC 5B66E 2H7HA 5AW5B 1ZN5A 3A2AA 1DIPA 1H0TA 3TK1A 2IX7C 1PPJD 4HB1A 3B5ND 2IDBA 4DCKA 2YKOA 1N8RQ 1CSBA 2GM4A 1FAVA 1GU4A 5APYA 1VF5B 1VQ6P 2O01J 3H1KD 4B86A 1KILE 1LP1B 1JY3O 1PZQA 1XTCC 2IZ0A 4ASWA 3LIDA 3A3YB 1Y9BA 2P10A 4JYCA 1CI6A 2WWWA 4L75A 2VRSA 1HWTC 3Q1MA 1RQVA 3IFMA 1KN7A 5GTHE 3SWKA 4TLFA 2V7QH 2KSEA 2C0WA 2OARA 3L70E 5AW1B 1L0NE 5KLIC 2A06D 3U1CA 4XFJA 2ZVNB 4Y99C 1EZVD 1L0LK 1KFNA 1T2KD 3L71E 4C7NA 2E74D 2P67A 4N78D 5EFWB 2N1TA 2NPSB 3M9HA 2WSCH 3H1LE 3OA7A 2D2CB 1KILB 4LLHA 1LWUB 2PRRA 1BCCD 1N7SD 4KT0J 1S9KE 1JY2O 1SQQE 1NAFA 5AVUB 2BCCE 3P7KA 3BVHA 2HPCB 1PP9J 3KYQA 3L72E 1K9MQ 2PAJA 5AW4B 3AE7C 3U1AA 3PP5A 2ZT9B 1JY2P 3MUDA 3CCMP 2QJKB 2G3AA 2W6JH 1N73B 1LJ2A 3OAKA 1L0LG 1NHLA 1UIIA 3G4SP 2O1KA 2KK7A 1NWQA 2ZXEB 3HTKB 4WBAA 5GTIH 3CMAP 2OQQA 2QE7H 2O3JA 2FY8A 3RL0B 3CWBE 3L36A 3KHUA 2J58A 2QM7A 2I1KA 5B66H 3BATA 2KLUA 1L0NK 2P58A 3IR9A 3AE9C 1YQ4C 4U3FJ 3VTPC 1ZMEC 2WVRA 3G3ZA 2N1TC 2R32A 4I7ZC 4WB4A 1NU1K 2E42A 1KYOE 3L74J 1AFOA 2WSFJ 4PD4E 3V6IA 2HODA 3KDPB 3V4WA 3AE6C 1SQVE 3CX5D 1GU5A 5APQA 5AVYB 3RK2B 1QL2A 1K04A 2RH0A 4OGQB 1LGHB 1S72P 5KAFH 2FYNB 1H8AA 1KB9D 3MUDC 1MV8A 5B5EH 3CX5I 1JM0A 1L0NG 2WSSH 2OYIB 2QEXP 5K5GB 1KC8Q 2WZ7A 2K9JB 1DD4A 3AEEC 3RK3E 4BXLA 4WWIA 3KXDA 2PFXA 3L71G 1EDJA 1NU1G 1KB9I 3LW5H 4ZKPA 2E75D 1BDDA 1FC2C 2RKLA 1ZXGA 2OTLP 1M7LA 3H1LG 1AQ5A 2WT7A 1KQSO 1BSHA 3H1IJ 3TF5A 1MZ9A 3L70J 4MN4C 4H0LB 1CW5A 2HR3A 4U7JA 1SQQG 2BCCG 3W67A 3L35A 3E7KA 2P2UA 5AW9B 3L72G 3RBXA 3O6QB 4H13C 4U3FD 1Z56A 3H32B 3AE1C 1NJIQ 1JTHB 2E76C 3GF3A 5KKZC 2NRGA 3H1LJ 1P84I 3FXEA 1S5LH 3E1RA 1SQVK 1PIXA 1EXJA 5AVSB 4EOTA 3NXSA 1SQQJ 2B89A 1HJBA 2KZIA 1SQBJ 1PPJG 3CXHH 4ZKUA 4IFFA 3CWBG 4EI2A 3EFGA 2FYUJ 1SFCA 3V2NA 1ZRTE 2D2CD 1KILD 2IZ1A 2A45I 3AECC 2K3RA 3HD7B 5C39A 3H1KG 4GOEA 4KJMA 3B5NA 2HFED 4HH2A 5KLIB 2IYOA 1M8OB 2XNDH 3A0HH 3MIWA 1GK6A 5BU5A 3D71A 1JY3N 4Y99B 1SQVG 2ZT9D 3L73E 1K05A 2FXPA 2QA4P 4JPZB 3V2QA 3VOPA 1L4AD 4PV1C 1J1DC 1HF9A 3L70D 1L0ND 3SWFA 2QJPC 1PP9E 4RKUJ 4LGDE 1A02F 1R5SA 5H2FH 3QH9A 3C9IA 1NKNA 3CC4P 3TSIA 1SQPJ 3L71D 2IBZI 2QSIA 3RL0D 1S5LX 1S4XA 2W8ZA 3TGUE 4OH8B 4IOIH 3CC7P 1AQTA 3H1LD 1FDOA 2QJYC 3WU2E 2BASA 1CI6B 1NOHA 2KUBA 1S9KD 3CI9A 2XDJA 1SFCC 2R44A 2KXPB 1SVFA 2FXMA 1QVFO 1SQQD 3VMAA 2PGDA 2AXCA 1JEKA 2BCCD 1QLED 3AEGC 3L4FA 1E5WA 1BSNA 1P84E 3L72D 4DOJA 5AW0B 4GKGA 1FE6A 4JYBA 5TJHA 3V2PA 1MFTA 4NPFX 3B5NC 3M06A 3EFFK 1OZHA 3CCVP 4EYYQ 1SLQA 1N7SA 4A7PA 2JDIH 4HKZH 3P8MC 3E1IA 1YTZI 3C1LA 2P7JA 1GD2E 3T97A 3L74E 4C7NB 1ZOYC 1M56D 2Y0CA 1JCDA 2I1JA 1LTIC 3P32A 4YPCA 2ZJSE 3WUUA 1SP4A 1FZAA 1G1IA 4I7ZB 1YJWP 1IK9A 4BRYA 3D70A 4D6TE 3CWBD 2H8PD 2QM8A 1ZP0C 3R4YA 3GHGC 4H44B 1VQ8P 1FZFA 4PJ0H 2AXTE 2B88A 2IPPA 4GDOA 2QG4A 1KD1Q 1OVRA 3OJAB 2AEJA 2W6BA 1U7MA 1ZLLA 3VMXA 1KZUB 2KS1A 1JMBA 4JBZA 4Y28J 1KYOD 1ZR4A 1T3UA 3BCCJ 4H0LD 4PD4D 1CZQA 1LNQA 1OMIA 2W83C 2GA1A 1FBMA 2C0XA 3H1HJ 1SQVD 1DD3A 1Q81Q 1AA0A 5CCHD 1T2KC 1JY3P 2E74C 5APSA 2JP3A 3GMAA 4DJGA 2ZAEB 2IBZE 3L73G 4UB6E 3H1IE 1KYOI 3HE4A 4PD4I 2XKMA 1IFNA 1RF1A 2M5AB 3LIEA 3VMYA 1N7SC 3CX5H 2AEMA 1PP9G 1IFJA 2YKPA 2O1JA 3CCRP 1GDTA 2CPBA 3RK3D 3WUVA 1DX7A 3M9BA 1PL5A 2WPSA 1KB9H 3F5HA 3BASA 1NGMB 4CPGA 4Z1MH 2IFMA 2YXRB 2KLVA 3L73J 4H13B 1AVYA 2HODB 2WITA 2V7QJ 3HD7D 1DEEG 1ZW0A 5CBOA 5KTBA 3V5BA 2E76B 1SQXJ 5KKZB 4HYTB 1SQBE 1VQOP 2YIUC 1PGOA 2WTYA 1URQD 4WY4D 5AW3B 2FYUE 1BE3E 2B87A 3WU2H 1W2EA 4UB8H 4HJGH 2W6AA 1KQGB 2O01N 1JOCA 3TGUJ 4I1LA 2GUVA 4U3FG 1LP1A 2FFDA 1FZCB 1IJDB 1R8EA 3L74G 1JB0J 3PLNA 1KV4A 1FDMA 5CBNA 3M91A 3SFEC 5APUA 4YTPC 2A45G 3M9QA 5DJTB 5E79H 5AW8B 1RF1C 1JNMA 1FOSF 2Q1KA 3G9RA 1T6AA 3H6PA 4D6TG 3AE4C 2KNCB 2WT7B 1R5LA 1Y8AA 1ZRTD 3CL3D 4RESB 3FGAD 1PFIA 2JWDA 1RHZB 1H88A 2KYVA 3PH0A 3AEBC 5L8RJ 1SQPE 4AUWA 4PV1B 1J1DB 3ZDMA 3EQ2A 1VQ7P 3IN6A 3AE8C 1IO4A 1IFIA 2KB7P 2JO1A 5AW6B 3CCQP 4D6TJ 3L73D 1KILA 5AVRB 1NTZJ 2K88A 3AEDC 1OW7A 2E75C 1SQQK 2OYHA 1GL2D 1SQXD 1SQBK 1T3JA 3I5CA 2IBZG 3H1IG 1NTMJ 3IAOA 1GK4A 3KZIE 1UIXA 2MJZA 2QJYB 1PP9D 2KOGA 3PJSK 1LTJB 2M0BA 1JO5A 3L70G 3D6ZA 2HPCA 3IF4A 2FYUK 2E43A 1USEA 3H1JE 2FFDC 3P8CE 1SFCB 4I2LC 2WSEH 1KTMA 1LTAC 3K5BA 1Q2NA 5GTHH 5M1BA 3HUSA 3TGUD 4H44D 1N73A 2XNXA 2K9YA 1L4AA 1VF5D 3HE5B 5AVTB 3Q5RA 5KJ7D 1VQKP 5APWA 2FYZA 3JCUE 4EIJA 2KIKA 1OX3A 4LC1A 5KAIE 3TYYA 3SSUA 2WPQA 1P84D 5TISE 1SQBG 1M1KQ 2QIWA 1A02J 1IFMA 2J59M 2FYUG 3ITKA 5CJ4A 2BEQD 4N6JA 3LW5J 3A5TA 1NH4A 3GHGB 1OVVA 1SQPK 3L75J 1RH5B 3L74D 4JQ0D 3BCCE 4M3LA 2W27A 2H88C 2XU6A 1FU1A 3H1HE 3F89A 2OYHC 1XTGB 1GW4A 3R2PA 1QEXA 4D6TD 4W80A 1X79B 3S4RA 3WMM0 1BE3J 3FWLA 1EC5A 3KPEA 1QL1A 1IFPA 1HGVA 2ZT9C 2NPSD 3HUSC 3MP7B 2QJKC 2E74B 3CD6P 1N73C 1M57D 3TNUB 2Q7CA 3VN0A 1Q7YQ 1L4AC 2OYIA 3RL0g 1NTKJ 1U57A 2L91A 5KLVJ 3PHLA 1JMMA 4IFMA 3Q2YA 3KQGA 1SQPG 1HGZA 2ZYGA 1N7SB 1VDFA 1EQ7A 3T97B 4W7YA 1RQUA 3W68A 4R4MA 3AE2C 4N3YB 1USDA 2IBZD 2M8RA 3H1ID 1KYOH 2R5BA 2Q3IA 1VQ4P 1H0TB 1M1JA 1SQXE 4PD4H 2ZFCA 3VMZA 2HG5D 1HBWA 3CC2P 4EDFA 1YTZT 2QRXA 3HRNA 5CCHA 4JF7A 5APTA 2LXCB 3H1JG 3O6QA 2Z5HA 5AW7B 2YIUB 4QMAA 2M3BA 2KS1B 1WRGA 1JTHA 3FXDA 3CCSP 2Y0DA 5CHXA 2Z5IA 1AVOA 1J1EC 1LT1A 2FYNC 3MZWB 2IFNA 1SQBD 4K3AA 1NVOA 2K1AA 1H89A 3AE5C 3A0BE 2HLOA 2OYIC 1FZEA 2FYUD 1BE3D 3H1JJ 1ZV8A 1YBKA 2Y9ZA 3HE4B 4WVZA 4R4LA 1HJ0A 1G1JA 3RK2D 1RF0A 1NAYA 3CPWO 2B9BA 1RF1B 3U59A 4OGQD 3HD7A 3G71P 1RY3A 1RE4A 4GT1A 5KLVD 5CCGD 5AVZB 5TISH 1YIJP 5GTIE 1L0LE 2SPZA 3BCCG 2O01H 5BU8B 1URQA 4WY4A 1M1JC 2L5GB 1JCCA 2N1TB 1LT9A 3H1HG 3CCEP 1SFCD 3NFQA 1NTZE 1OXZA 1D7MA 1SQXK 3MHVA 1EDIA 1BCCJ 5CCHC 1FJKA 2M3EA 2AEFA 1NTME 3SWYA 5BVZA 2POHA 1QVGO 1X8YA 3CXHI 2KSJA 3AEAC 2B87B 3S9OA 2E75B 1SQPD 1OWAA 2KZJA 4C46A 2V4HA 1U7JA 1S2EA 1PGJA 2FFDB 2PP6A 3RK3C 5KAFE 1X22A 1VPCA 2ZXXA 3A7OA 2C9LY 1OW8A 4K35A 2ZVOB 5B5EE 1HH0A 1RF0C 3VYIA 1SQXG 3HD7C 4NPEA 5AW2B 1RE4C 2Y9YA 4AYCA 2I8DA 3H1JD 2XZRA 3P8CD 1IK7A 1HUCA 3V4QA 1URQC 1L2PA 4WY4C 5APVA 1BGYE 1Q86Q 2ITAA 3O8ZA 1LT9C 3TGUG 1GL2A 3L75E 3AEFC 1G2CA 1IC2A 2KP8A 3L37A 2KI7B 2CPSA 1NU1E 4OVNF 1IFDA 2BEZF 3VP9A 4ZMDA 3M0AA 4KHXA 3Q5SA 3S1KA 1NTZK 1VQ9P 1KMIZ 1FJPA 3BRTB 4W7ZA 3I55P 1SS1A 1Q82Q 2YNYA 2H43A 2MKVA 1EZVI 1QX8A 1WT6A 4IL6E 4O9BA 1NTMK 2OYHB 5KJ7A 3Q5PA 1NKZB 1VL2A 2JJLA 3GW6A 2WSCJ 2YXQB 4L73A 3AE3C 1NTKE 1S5LE 2JEEA 1FZGA 3N4XA 5KLVE 2N9BA 1X0TA 5AVVB 1VQ5P 3A0BH 1P84H 3BCCD 1FDIA 3HUSB 2R3CA 3H1HD 1N86A 1YJNP 3UIAA 2IYPA 4OWFA 3TDKA
chains in the Genus database with same CATH topology
1RHZB 3JC22 1RH5B 2YXQB 2YXRB 3MP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHZ B;  3JC2 2;  1RH5 B;  2YXQ B;  2YXR B;  3MP7 B; 
#chains in the Genus database with same CATH topology
 1L4A B;  1MKM A;  1WMK A;  3CXH E;  1AJY A;  5AVX B;  2WQY C;  2FKW B;  1OW6 A;  3GG2 A;  3CCJ P;  1NTZ G;  1T8Z A;  2WSF H;  3GLM A;  5CJ0 A;  1PPJ E;  3FX0 A;  2A45 H;  1YHQ P;  1EDL A;  1NTM G;  2M5A A;  1KQL A;  4ASV A;  1VQM P;  1GL2 C;  2Q9I A;  1YYC A;  5AVW B;  1YIT P;  1KQF B;  3A0H E;  2AXT H;  3H1K E;  4AQR D;  2QJP B;  1K73 Q;  1L0L J;  4RJT A;  1W2B O;  2J5U A;  2WPR A;  2E5T A;  2LR2 A;  1LTB C;  4DT0 A;  2NPS A;  4TT3 H;  1RE3 A;  1IZN B;  4H44 C;  4YXD C;  1LWU A;  1VF5 C;  3CCL P;  1OIP A;  3OW2 O;  5H2F E;  5KJ7 C;  2W90 A;  2OGU A;  3II6 A;  2P1J A;  1QGK B;  2E5Y A;  2LKM A;  2DW3 A;  1JUN A;  3V2R A;  1J1E B;  2N1T D;  3H25 A;  4ZNC A;  3PTZ A;  4UB6 H;  3JC2 2;  1EXI A;  3NTN A;  2A06 E;  1NTK K;  5KLV K;  2H89 C;  1EDK A;  2JR8 A;  5DJU B;  1S1C X;  1PV3 A;  3JSV C;  1EZV E;  4GOD A;  1BDC A;  1BGY G;  1FZC A;  3B5N B;  1LTT C;  3L75 G;  1Q90 D;  3EWK A;  1YJ9 P;  3HTK A;  2ZYA A;  3CLQ A;  2N9Y B;  4N78 E;  1PGP A;  1MFZ A;  3G6E P;  2RN0 A;  1W5C E;  2OTJ P;  1BCC E;  2WSE J;  2QVA A;  1Y47 A;  2KNC A;  1M1J B;  1AV1 A;  2Q6Q A;  1BE3 G;  1MUU A;  1L0N J;  1GMJ A;  4I6M C;  3VP8 A;  2YKQ A;  2JKV A;  1BGY J;  1E79 H;  3Q3D A;  1M90 Q;  2HYN A;  2NPS C;  2D2C C;  1RE3 C;  1KIL C;  5APX A;  1NTK G;  1LWU C;  3C8V A;  5KLV G;  4IL6 H;  3L71 J;  1L0L D;  1NU1 J;  1TU3 F;  2K37 A;  2C9N Y;  1DEB A;  1X9V A;  4RO0 A;  1N7L A;  4PJ0 E;  1NTZ D;  3RBZ A;  4GOF A;  3SFD C;  3GF7 A;  2JWA A;  1FOS E;  3I56 P;  4NPD A;  5CCG A;  1NTM D;  2R3S A;  4BWN A;  1HVV A;  5AVQ B;  4L74 A;  1FS0 E;  1KFM A;  4H13 D;  2BCC J;  3RK3 B;  1LTJ A;  1VQL P;  4XA4 A;  3B4S A;  3L72 J;  4GIF A;  2E76 D;  1FZC C;  2UWJ E;  2OTK E;  2K9J A;  4C7R A;  1KOR A;  1HTL C;  1GW3 A;  1K8A Q;  4L76 A;  2WMM A;  1S3J A;  2YO2 A;  3MGN A;  3RL0 C;  3HE5 A;  2Y0E A;  1ZR2 A;  3NMD A;  1NO4 A;  3CME P;  2NZ2 A;  1FZB A;  1URQ B;  4WY4 B;  1LTG C;  1LT9 B;  3CX5 E;  1PGQ A;  4BRY B;  3B71 A;  2Z4E A;  3M0D A;  3WUT A;  2R5D A;  4XE5 B;  3CCU P;  3CWB J;  2FBW C;  4DZO A;  2ZYD A;  1DH3 A;  3B8E B;  3D6Y A;  1KB9 E;  3H1K J;  1OVU A;  4IL6 X;  2OYO A;  3H32 A;  1NYH A;  1BGY D;  2YMY A;  3GHG A;  3N7N A;  3KZI H;  2Q5U A;  3L75 D;  2G8Y A;  5CMZ A;  2A06 G;  1GZL A;  3RK2 C;  1LTS C;  2Q3E A;  1VQP P;  4OGQ C;  1NU1 D;  1EZV G;  2RMZ A;  1OFC X;  5CCG C;  3PRJ A;  3USS A;  1SQV J;  1VQN P;  3FWN A;  1GTW A;  4PV1 D;  1LTJ C;  4YXW H;  2XV5 A;  3RGU A;  4UB8 E;  4IFD K;  2CK3 H;  2WPV B;  2YO3 A;  1BCC G;  3ABV C;  3JCU H;  3QWO C;  1N2D C;  3BRV B;  5KAI H;  1J2J B;  3TNU A;  1NTK D;  1YI2 P;  2FXO A;  1JY2 N;  4U3F E;  2YMK A;  2LXB A;  3MTU E;  5E79 E;  3MD0 A;  1YQ3 C;  1GL2 B;  2GUS A;  1G2C B;  3CXH D;  4H0L C;  3M0D C;  5B66 E;  2H7H A;  5AW5 B;  1ZN5 A;  3A2A A;  1DIP A;  1H0T A;  3TK1 A;  2IX7 C;  1PPJ D;  4HB1 A;  3B5N D;  2IDB A;  4DCK A;  2YKO A;  1N8R Q;  1CSB A;  2GM4 A;  1FAV A;  1GU4 A;  5APY A;  1VF5 B;  1VQ6 P;  2O01 J;  3H1K D;  4B86 A;  1KIL E;  1LP1 B;  1JY3 O;  1PZQ A;  1XTC C;  2IZ0 A;  4ASW A;  3LID A;  3A3Y B;  1Y9B A;  2P10 A;  4JYC A;  1CI6 A;  2WWW A;  4L75 A;  2VRS A;  1HWT C;  3Q1M A;  1RQV A;  3IFM A;  1KN7 A;  5GTH E;  3SWK A;  4TLF A;  2V7Q H;  2KSE A;  2C0W A;  2OAR A;  3L70 E;  5AW1 B;  1L0N E;  5KLI C;  2A06 D;  3U1C A;  4XFJ A;  2ZVN B;  4Y99 C;  1EZV D;  1L0L K;  1KFN A;  1T2K D;  3L71 E;  4C7N A;  2E74 D;  2P67 A;  4N78 D;  5EFW B;  2N1T A;  2NPS B;  3M9H A;  2WSC H;  3H1L E;  3OA7 A;  2D2C B;  1KIL B;  4LLH A;  1LWU B;  2PRR A;  1BCC D;  1N7S D;  4KT0 J;  1S9K E;  1JY2 O;  1SQQ E;  1NAF A;  5AVU B;  2BCC E;  3P7K A;  3BVH A;  2HPC B;  1PP9 J;  3KYQ A;  3L72 E;  1K9M Q;  2PAJ A;  5AW4 B;  3AE7 C;  3U1A A;  3PP5 A;  2ZT9 B;  1JY2 P;  3MUD A;  3CCM P;  2QJK B;  2G3A A;  2W6J H;  1N73 B;  1LJ2 A;  3OAK A;  1L0L G;  1NHL A;  1UII A;  3G4S P;  2O1K A;  2KK7 A;  1NWQ A;  2ZXE B;  3HTK B;  4WBA A;  5GTI H;  3CMA P;  2OQQ A;  2QE7 H;  2O3J A;  2FY8 A;  3RL0 B;  3CWB E;  3L36 A;  3KHU A;  2J58 A;  2QM7 A;  2I1K A;  5B66 H;  3BAT A;  2KLU A;  1L0N K;  2P58 A;  3IR9 A;  3AE9 C;  1YQ4 C;  4U3F J;  3VTP C;  1ZME C;  2WVR A;  3G3Z A;  2N1T C;  2R32 A;  4I7Z C;  4WB4 A;  1NU1 K;  2E42 A;  1KYO E;  3L74 J;  1AFO A;  2WSF J;  4PD4 E;  3V6I A;  2HOD A;  3KDP B;  3V4W A;  3AE6 C;  1SQV E;  3CX5 D;  1GU5 A;  5APQ A;  5AVY B;  3RK2 B;  1QL2 A;  1K04 A;  2RH0 A;  4OGQ B;  1LGH B;  1S72 P;  5KAF H;  2FYN B;  1H8A A;  1KB9 D;  3MUD C;  1MV8 A;  5B5E H;  3CX5 I;  1JM0 A;  1L0N G;  2WSS H;  2OYI B;  2QEX P;  5K5G B;  1KC8 Q;  2WZ7 A;  2K9J B;  1DD4 A;  3AEE C;  3RK3 E;  4BXL A;  4WWI A;  3KXD A;  2PFX A;  3L71 G;  1EDJ A;  1NU1 G;  1KB9 I;  3LW5 H;  4ZKP A;  2E75 D;  1BDD A;  1FC2 C;  2RKL A;  1ZXG A;  2OTL P;  1M7L A;  3H1L G;  1AQ5 A;  2WT7 A;  1KQS O;  1BSH A;  3H1I J;  3TF5 A;  1MZ9 A;  3L70 J;  4MN4 C;  4H0L B;  1CW5 A;  2HR3 A;  4U7J A;  1SQQ G;  2BCC G;  3W67 A;  3L35 A;  3E7K A;  2P2U A;  5AW9 B;  3L72 G;  3RBX A;  3O6Q B;  4H13 C;  4U3F D;  1Z56 A;  3H32 B;  3AE1 C;  1NJI Q;  1JTH B;  2E76 C;  3GF3 A;  5KKZ C;  2NRG A;  3H1L J;  1P84 I;  3FXE A;  1S5L H;  3E1R A;  1SQV K;  1PIX A;  1EXJ A;  5AVS B;  4EOT A;  3NXS A;  1SQQ J;  2B89 A;  1HJB A;  2KZI A;  1SQB J;  1PPJ G;  3CXH H;  4ZKU A;  4IFF A;  3CWB G;  4EI2 A;  3EFG A;  2FYU J;  1SFC A;  3V2N A;  1ZRT E;  2D2C D;  1KIL D;  2IZ1 A;  2A45 I;  3AEC C;  2K3R A;  3HD7 B;  5C39 A;  3H1K G;  4GOE A;  4KJM A;  3B5N A;  2HFE D;  4HH2 A;  5KLI B;  2IYO A;  1M8O B;  2XND H;  3A0H H;  3MIW A;  1GK6 A;  5BU5 A;  3D71 A;  1JY3 N;  4Y99 B;  1SQV G;  2ZT9 D;  3L73 E;  1K05 A;  2FXP A;  2QA4 P;  4JPZ B;  3V2Q A;  3VOP A;  1L4A D;  4PV1 C;  1J1D C;  1HF9 A;  3L70 D;  1L0N D;  3SWF A;  2QJP C;  1PP9 E;  4RKU J;  4LGD E;  1A02 F;  1R5S A;  5H2F H;  3QH9 A;  3C9I A;  1NKN A;  3CC4 P;  3TSI A;  1SQP J;  3L71 D;  2IBZ I;  2QSI A;  3RL0 D;  1S5L X;  1S4X A;  2W8Z A;  3TGU E;  4OH8 B;  4IOI H;  3CC7 P;  1AQT A;  3H1L D;  1FDO A;  2QJY C;  3WU2 E;  2BAS A;  1CI6 B;  1NOH A;  2KUB A;  1S9K D;  3CI9 A;  2XDJ A;  1SFC C;  2R44 A;  2KXP B;  1SVF A;  2FXM A;  1QVF O;  1SQQ D;  3VMA A;  2PGD A;  2AXC A;  1JEK A;  2BCC D;  1QLE D;  3AEG C;  3L4F A;  1E5W A;  1BSN A;  1P84 E;  3L72 D;  4DOJ A;  5AW0 B;  4GKG A;  1FE6 A;  4JYB A;  5TJH A;  3V2P A;  1MFT A;  4NPF X;  3B5N C;  3M06 A;  3EFF K;  1OZH A;  3CCV P;  4EYY Q;  1SLQ A;  1N7S A;  4A7P A;  2JDI H;  4HKZ H;  3P8M C;  3E1I A;  1YTZ I;  3C1L A;  2P7J A;  1GD2 E;  3T97 A;  3L74 E;  4C7N B;  1ZOY C;  1M56 D;  2Y0C A;  1JCD A;  2I1J A;  1LTI C;  3P32 A;  4YPC A;  2ZJS E;  3WUU A;  1SP4 A;  1FZA A;  1G1I A;  4I7Z B;  1YJW P;  1IK9 A;  4BRY A;  3D70 A;  4D6T E;  3CWB D;  2H8P D;  2QM8 A;  1ZP0 C;  3R4Y A;  3GHG C;  4H44 B;  1VQ8 P;  1FZF A;  4PJ0 H;  2AXT E;  2B88 A;  2IPP A;  4GDO A;  2QG4 A;  1KD1 Q;  1OVR A;  3OJA B;  2AEJ A;  2W6B A;  1U7M A;  1ZLL A;  3VMX A;  1KZU B;  2KS1 A;  1JMB A;  4JBZ A;  4Y28 J;  1KYO D;  1ZR4 A;  1T3U A;  3BCC J;  4H0L D;  4PD4 D;  1CZQ A;  1LNQ A;  1OMI A;  2W83 C;  2GA1 A;  1FBM A;  2C0X A;  3H1H J;  1SQV D;  1DD3 A;  1Q81 Q;  1AA0 A;  5CCH D;  1T2K C;  1JY3 P;  2E74 C;  5APS A;  2JP3 A;  3GMA A;  4DJG A;  2ZAE B;  2IBZ E;  3L73 G;  4UB6 E;  3H1I E;  1KYO I;  3HE4 A;  4PD4 I;  2XKM A;  1IFN A;  1RF1 A;  2M5A B;  3LIE A;  3VMY A;  1N7S C;  3CX5 H;  2AEM A;  1PP9 G;  1IFJ A;  2YKP A;  2O1J A;  3CCR P;  1GDT A;  2CPB A;  3RK3 D;  3WUV A;  1DX7 A;  3M9B A;  1PL5 A;  2WPS A;  1KB9 H;  3F5H A;  3BAS A;  1NGM B;  4CPG A;  4Z1M H;  2IFM A;  2YXR B;  2KLV A;  3L73 J;  4H13 B;  1AVY A;  2HOD B;  2WIT A;  2V7Q J;  3HD7 D;  1DEE G;  1ZW0 A;  5CBO A;  5KTB A;  3V5B A;  2E76 B;  1SQX J;  5KKZ B;  4HYT B;  1SQB E;  1VQO P;  2YIU C;  1PGO A;  2WTY A;  1URQ D;  4WY4 D;  5AW3 B;  2FYU E;  1BE3 E;  2B87 A;  3WU2 H;  1W2E A;  4UB8 H;  4HJG H;  2W6A A;  1KQG B;  2O01 N;  1JOC A;  3TGU J;  4I1L A;  2GUV A;  4U3F G;  1LP1 A;  2FFD A;  1FZC B;  1IJD B;  1R8E A;  3L74 G;  1JB0 J;  3PLN A;  1KV4 A;  1FDM A;  5CBN A;  3M91 A;  3SFE C;  5APU A;  4YTP C;  2A45 G;  3M9Q A;  5DJT B;  5E79 H;  5AW8 B;  1RF1 C;  1JNM A;  1FOS F;  2Q1K A;  3G9R A;  1T6A A;  3H6P A;  4D6T G;  3AE4 C;  2KNC B;  2WT7 B;  1R5L A;  1Y8A A;  1ZRT D;  3CL3 D;  4RES B;  3FGA D;  1PFI A;  2JWD A;  1RHZ B;  1H88 A;  2KYV A;  3PH0 A;  3AEB C;  5L8R J;  1SQP E;  4AUW A;  4PV1 B;  1J1D B;  3ZDM A;  3EQ2 A;  1VQ7 P;  3IN6 A;  3AE8 C;  1IO4 A;  1IFI A;  2KB7 P;  2JO1 A;  5AW6 B;  3CCQ P;  4D6T J;  3L73 D;  1KIL A;  5AVR B;  1NTZ J;  2K88 A;  3AED C;  1OW7 A;  2E75 C;  1SQQ K;  2OYH A;  1GL2 D;  1SQX D;  1SQB K;  1T3J A;  3I5C A;  2IBZ G;  3H1I G;  1NTM J;  3IAO A;  1GK4 A;  3KZI E;  1UIX A;  2MJZ A;  2QJY B;  1PP9 D;  2KOG A;  3PJS K;  1LTJ B;  2M0B A;  1JO5 A;  3L70 G;  3D6Z A;  2HPC A;  3IF4 A;  2FYU K;  2E43 A;  1USE A;  3H1J E;  2FFD C;  3P8C E;  1SFC B;  4I2L C;  2WSE H;  1KTM A;  1LTA C;  3K5B A;  1Q2N A;  5GTH H;  5M1B A;  3HUS A;  3TGU D;  4H44 D;  1N73 A;  2XNX A;  2K9Y A;  1L4A A;  1VF5 D;  3HE5 B;  5AVT B;  3Q5R A;  5KJ7 D;  1VQK P;  5APW A;  2FYZ A;  3JCU E;  4EIJ A;  2KIK A;  1OX3 A;  4LC1 A;  5KAI E;  3TYY A;  3SSU A;  2WPQ A;  1P84 D;  5TIS E;  1SQB G;  1M1K Q;  2QIW A;  1A02 J;  1IFM A;  2J59 M;  2FYU G;  3ITK A;  5CJ4 A;  2BEQ D;  4N6J A;  3LW5 J;  3A5T A;  1NH4 A;  3GHG B;  1OVV A;  1SQP K;  3L75 J;  1RH5 B;  3L74 D;  4JQ0 D;  3BCC E;  4M3L A;  2W27 A;  2H88 C;  2XU6 A;  1FU1 A;  3H1H E;  3F89 A;  2OYH C;  1XTG B;  1GW4 A;  3R2P A;  1QEX A;  4D6T D;  4W80 A;  1X79 B;  3S4R A;  3WMM 0;  1BE3 J;  3FWL A;  1EC5 A;  3KPE A;  1QL1 A;  1IFP A;  1HGV A;  2ZT9 C;  2NPS D;  3HUS C;  3MP7 B;  2QJK C;  2E74 B;  3CD6 P;  1N73 C;  1M57 D;  3TNU B;  2Q7C A;  3VN0 A;  1Q7Y Q;  1L4A C;  2OYI A;  3RL0 g;  1NTK J;  1U57 A;  2L91 A;  5KLV J;  3PHL A;  1JMM A;  4IFM A;  3Q2Y A;  3KQG A;  1SQP G;  1HGZ A;  2ZYG A;  1N7S B;  1VDF A;  1EQ7 A;  3T97 B;  4W7Y A;  1RQU A;  3W68 A;  4R4M A;  3AE2 C;  4N3Y B;  1USD A;  2IBZ D;  2M8R A;  3H1I D;  1KYO H;  2R5B A;  2Q3I A;  1VQ4 P;  1H0T B;  1M1J A;  1SQX E;  4PD4 H;  2ZFC A;  3VMZ A;  2HG5 D;  1HBW A;  3CC2 P;  4EDF A;  1YTZ T;  2QRX A;  3HRN A;  5CCH A;  4JF7 A;  5APT A;  2LXC B;  3H1J G;  3O6Q A;  2Z5H A;  5AW7 B;  2YIU B;  4QMA A;  2M3B A;  2KS1 B;  1WRG A;  1JTH A;  3FXD A;  3CCS P;  2Y0D A;  5CHX A;  2Z5I A;  1AVO A;  1J1E C;  1LT1 A;  2FYN C;  3MZW B;  2IFN A;  1SQB D;  4K3A A;  1NVO A;  2K1A A;  1H89 A;  3AE5 C;  3A0B E;  2HLO A;  2OYI C;  1FZE A;  2FYU D;  1BE3 D;  3H1J J;  1ZV8 A;  1YBK A;  2Y9Z A;  3HE4 B;  4WVZ A;  4R4L A;  1HJ0 A;  1G1J A;  3RK2 D;  1RF0 A;  1NAY A;  3CPW O;  2B9B A;  1RF1 B;  3U59 A;  4OGQ D;  3HD7 A;  3G71 P;  1RY3 A;  1RE4 A;  4GT1 A;  5KLV D;  5CCG D;  5AVZ B;  5TIS H;  1YIJ P;  5GTI E;  1L0L E;  2SPZ A;  3BCC G;  2O01 H;  5BU8 B;  1URQ A;  4WY4 A;  1M1J C;  2L5G B;  1JCC A;  2N1T B;  1LT9 A;  3H1H G;  3CCE P;  1SFC D;  3NFQ A;  1NTZ E;  1OXZ A;  1D7M A;  1SQX K;  3MHV A;  1EDI A;  1BCC J;  5CCH C;  1FJK A;  2M3E A;  2AEF A;  1NTM E;  3SWY A;  5BVZ A;  2POH A;  1QVG O;  1X8Y A;  3CXH I;  2KSJ A;  3AEA C;  2B87 B;  3S9O A;  2E75 B;  1SQP D;  1OWA A;  2KZJ A;  4C46 A;  2V4H A;  1U7J A;  1S2E A;  1PGJ A;  2FFD B;  2PP6 A;  3RK3 C;  5KAF E;  1X22 A;  1VPC A;  2ZXX A;  3A7O A;  2C9L Y;  1OW8 A;  4K35 A;  2ZVO B;  5B5E E;  1HH0 A;  1RF0 C;  3VYI A;  1SQX G;  3HD7 C;  4NPE A;  5AW2 B;  1RE4 C;  2Y9Y A;  4AYC A;  2I8D A;  3H1J D;  2XZR A;  3P8C D;  1IK7 A;  1HUC A;  3V4Q A;  1URQ C;  1L2P A;  4WY4 C;  5APV A;  1BGY E;  1Q86 Q;  2ITA A;  3O8Z A;  1LT9 C;  3TGU G;  1GL2 A;  3L75 E;  3AEF C;  1G2C A;  1IC2 A;  2KP8 A;  3L37 A;  2KI7 B;  2CPS A;  1NU1 E;  4OVN F;  1IFD A;  2BEZ F;  3VP9 A;  4ZMD A;  3M0A A;  4KHX A;  3Q5S A;  3S1K A;  1NTZ K;  1VQ9 P;  1KMI Z;  1FJP A;  3BRT B;  4W7Z A;  3I55 P;  1SS1 A;  1Q82 Q;  2YNY A;  2H43 A;  2MKV A;  1EZV I;  1QX8 A;  1WT6 A;  4IL6 E;  4O9B A;  1NTM K;  2OYH B;  5KJ7 A;  3Q5P A;  1NKZ B;  1VL2 A;  2JJL A;  3GW6 A;  2WSC J;  2YXQ B;  4L73 A;  3AE3 C;  1NTK E;  1S5L E;  2JEE A;  1FZG A;  3N4X A;  5KLV E;  2N9B A;  1X0T A;  5AVV B;  1VQ5 P;  3A0B H;  1P84 H;  3BCC D;  1FDI A;  3HUS B;  2R3C A;  3H1H D;  1N86 A;  1YJN P;  3UIA A;  2IYP A;  4OWF A;  3TDK A; 
#chains in the Genus database with same CATH homology
 1RHZ B;  3JC2 2;  1RH5 B;  2YXQ B;  2YXR B;  3MP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...