2YXRB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
molecule keywords Preprotein translocase subunit secY
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxrB00
3JC22 3MP7B 1RH5B 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH superfamily
1ZLLA 2WWWA 3JC22 3BCCJ 2D2CD 3BATA 3CWBG 3CXHE 4WY4D 1OX3A 3S4RA 4XFJA 3CCSP 1HBWA 4I7ZC 4RJTA 1JTHB 1CW5A 2WPQA 2K9YA 2NPSD 3GF3A 5AVZB 2FXPA 2YMYA 3N7NA 1P84I 1LNQA 3R2PA 1GU4A 3MUDC 3PJSK 4H44B 2KUBA 3TGUD 4GDOA 1XTGB 1YQ3C 1ZRTE 3L73D 3CI9A 4HB1A 2BEQD 2K3RA 5EFWB 5KLVE 3OW2O 1YIJP 5KLIC 2NRGA 3L70G 5K5GB 1HH0A 3MD0A 1NTKD 3BCCG 1X0TA 3SWYA 1JM0A 1RF1B 2FFDA 1L4AD 1GW3A 3Q5SA 1VQOP 2A45I 2WSCH 3D6YA 1NTMK 1QLED 1YHQP 3KDPB 1QGKB 5KLVG 1FZFA 3G9RA 5DJUB 2K1AA 2Q1KA 3IAOA 2GM4A 3EQ2A 1KFNA 1NTKK 1M57D 2R32A 3LW5J 1KC8Q 1T3UA 3VMZA 3H1JE 2WTYA 2A06D 3HE4B 4GIFA 4WY4B 1PGJA 3AE4C 1SQVG 1NTZD 4YPCA 1SVFA 2D2CB 2E42A 3CX5H 1KD1Q 3TDKA 2O01N 3H1LG 1OWAA 4EYYQ 4N78E 2QJKC 5KKZB 4I6MC 3TNUB 4HKZH 1U7JA 3GF7A 1PP9J 3L74G 1USEA 5CBNA 3HUSB 2WSEJ 1M8OB 1FJPA 2NPSA 3Q2YA 1NU1E 2ZFCA 1NTZK 4ASVA 2SPZA 3H1KJ 2Y9YA 4NPFX 2FY8A 1H0TB 1LWUB 1P84H 2XNDH 3II6A 1SQVJ 3L70E 3RL0g 3CWBD 5KLIB 2Q3IA 3K5BA 3NXSA 2O01J 5APYA 3B5NC 2YO2A 3H1LJ 5H2FE 2IZ0A 4GOEA 2OYIB 3D70A 1Q82Q 3OAKA 3PP5A 1RQUA 2KZIA 3B5NB 1EZVI 4PV1D 3U59A 3L74J 1GU5A 2N9YB 2M3BA 1N73A 2Z4EA 2W8ZA 1SQBD 2B89A 3L73G 4H13C 2NPSC 4AUWA 3AEGC 1FBMA 3E1IA 3HTKA 5E79H 3AEFC 1KILC 1NTMG 3H1ID 2OYHC 3VOPA 3G4SP 1OW8A 1FDIA 1G1JA 1NTKG 3BCCD 3FXDA 3CMEP 1NKZB 3NTNA 3MUDA 3FWLA 2RH0A 4JYCA 5B5EE 1RQVA 1VL2A 2BCCE 2IDBA 2N1TB 1Q90D 4I7ZB 3T97B 1NTZJ 4WB4A 1M56D 1L2PA 1VDFA 1A02J 3A0HH 2ITAA 1SQVK 2W6AA 2KOGA 1YITP 2OYHA 1J1DC 1AVYA 2BCCD 4WBAA 2O01H 2GUVA 2JKVA 1N2DC 1EDJA 1AFOA 4C7NB 2ZJSE 2OTLP 4L73A 3L72G 5BVZA 3SWFA 3CPWO 3D71A 1FZCB 2XKMA 1L0NE 2HG5D 3GW6A 1ZOYC 3MZWB 3Q3DA 1KB9E 2V7QH 2E76C 3WMM0 3I56P 2OQQA 3B5NA 1ZXGA 2FYUD 3A0BE 3CWBJ 3L75E 1W2BO 1SFCA 3G71P 1BGYG 2Y9ZA 2ZT9D 1S3JA 2AEFA 2QA4P 3VN0A 1KORA 1ZR2A 3ITKA 3N4XA 5KJ7A 1EQ7A 4H13D 1LWUA 3H1HJ 2LR2A 1NKNA 3A3YB 3L71G 3PHLA 4OVNF 4UB6H 5CHXA 1YJNP 1CZQA 5CCGC 4U3FE 1BE3E 1P84E 2P2UA 4C7RA 4LLHA 5TISH 3H32B 1VQ4P 1YJ9P 2HODB 2QM7A 5DJTB 1SFCC 1LTJC 1S4XA 1VF5B 2IYPA 2W83C 1IK9A 1KYOI 2FYZA 4HH2A 2E5YA 1S5LE 2RMZA 1NH4A 3CXHI 3L37A 4DJGA 4IFMA 3RGUA 5CCHD 3V2QA 3H1JG 4D6TJ 3V6IA 2I8DA 3HD7D 1S9KD 3PTZA 1SQBG 1R5LA 1N73C 1Z56A 2QG4A 3AE5C 4N78D 4PD4H 3MP7B 3P8CD 1SQQE 1RE4A 1NTMD 5APWA 2J58A 3M9HA 1VQKP 3CCLP 1T8ZA 1EDIA 5M1BA 2MJZA 2BCCJ 3M91A 3G6EP 1BE3J 3CCUP 5AW5B 2QJPC 4RESB 3RK2C 1L0NG 1SQXD 1H8AA 2JWDA 1IZNB 4IFDK 1HJBA 1SQBJ 1Q2NA 3VTPC 1KYOH 1RF1A 3ABVC 3GHGC 3B5ND 4PV1B 1VQ8P 4L76A 4W7YA 3HE5A 1H88A 2XU6A 2QSIA 2POHA 1IJDB 1KILD 1D7MA 1SQQJ 1YTZT 4L75A 1DEBA 5KJ7D 4OGQB 1GL2B 1QVFO 1RY3A 1PV3A 1RE3A 1BE3G 1SQXK 2O1JA 4IL6X 1S9KE 2FFDB 1OVUA 1N7SC 1YYCA 1DD4A 1JY3P 2WPVB 1LWUC 1NU1K 5AW9B 3RK2D 2RKLA 3C8VA 1FC2C 1KV4A 4YXWH 2G3AA 1BGYE 1BGYD 2JWAA 1T6AA 3IN6A 3KPEA 3M0DC 3AE1C 5BU8B 1T2KD 5APQA 3H25A 1OMIA 2ZYAA 4W80A 4EIJA 2YKOA 2N1TD 1MUUA 1FAVA 3E7KA 3L71D 3MTUE 5KTBA 4K35A 2ZXXA 3U1CA 1LTIC 3D6ZA 2IBZI 2I1KA 2KS1A 1JEKA 4KJMA 1SQBK 1EXIA 2H7HA 1QL2A 1PP9E 3GMAA 3P8MC 4PD4I 4DZOA 1Q7YQ 4ZNCA 1VQMP 2E75B 2PRRA 2Q5UA 3SWKA 4ZKPA 2FYUE 3RL0B 3V4QA 3SFDC 1LGHB 1CI6B 3H1JD 1SQQK 3M0DA 1H0TA 1N73B 3RK3B 5AW8B 1NJIQ 1FZEA 2QJYB 4MN4C 1KFMA 2QE7H 3WU2H 2KNCB 2YXRB 4I2LC 1GK6A 1HGVA 1SQXE 2CPSA 2O1KA 3RL0D 2P1JA 3BRVB 1ZR4A 1GD2E 3A0BH 1NOHA 1KILB 1L0LG 1GL2D 1IFDA 1PP9D 2AXCA 1RH5B 1VPCA 2FBWC 2M3EA 2WMMA 3KZIH 2ZT9C 3P8CE 4W7ZA 1URQC 3TNUA 2AXTH 2N9BA 2YKQA 4H13B 4U3FG 3P7KA 5AW0B 2P7JA 4YTPC 1SQQD 1KILA 3LW5H 1NHLA 1NAYA 1SQXG 3L71E 3M06A 4JYBA 1WMKA 4YXDC 1EXJA 4U7JA 1JY3N 5CMZA 3RK3C 2H88C 5AW7B 2JO1A 3BCCE 4H44D 2Z5HA 4KT0J 3G3ZA 2FYNC 3H6PA 2E74B 2KK7A 4NPEA 4Y99C 3WU2E 2WSFJ 2FYUK 1ZV8A 1NU1G 3H1IE 3KYQA 4RO0A 3SSUA 1FS0E 5KAFE 2Y0EA 4EOTA 1LT1A 5B5EH 2OYOA 1BE3D 1P84D 4JQ0D 4PJ0E 2W6BA 3QWOC 2C9NY 3S1KA 1HGZA 3L75D 1BDCA 2BASA 1HWTC 4OGQC 1MFZA 1FDMA 3ZDMA 1IC2A 4Y28J 3WUTA 1BCCG 3PLNA 5AVWB 1DH3A 3H1HE 2ZXEB 1KB9H 2ZVNB 2FYNB 4WY4C 5AVUB 5CCHC 5B66H 3OA7A 2KI7B 3GHGB 3H1JJ 3HUSC 4PD4E 2QJYC 4AYCA 4Z1MH 1YI2P 3CCEP 1KB9D 4H0LB 3C9IA 3CX5D 2HPCB 1NAFA 2PP6A 3CCMP 4DOJA 1HF9A 3L73J 2G8YA 1WT6A 5CBOA 2GA1A 3VP9A 1LJ2A 1NTME 1EC5A 2KS1B 2WZ7A 1PGQA 2E5TA 1PGPA 2J59M 5TISE 2Q3EA 1S2EA 2C9LY 1JMMA 2O3JA 1OXZA 1FZAA 1JCCA 2M0BA 1J1EC 3AE8C 1YBKA 3JSVC 2A06E 5AVYB 3Q5RA 2R3SA 3VMYA 1W5CE 3SFEC 1OW6A 2KLVA 1X8YA 1RHZB 5APUA 2HYNA 3AECC 4PD4D 2YIUB 1EDLA 1E79H 1FZBA 2YKPA 2HPCA 1X9VA 4U3FD 3H1HD 1IFNA 1X79B 1M1JC 1R8EA 1LT9A 2IBZG 2KP8A 1XTCC 3TGUG 1VQ6P 1M7LA 1X22A 4AQRD 1SQBE 2FXOA 2B88A 3C1LA 3HD7A 1UIIA 5APXA 5AVRB 1GK4A 2BEZF 2E74C 3EWKA 3KXDA 3L70D 3BASA 4PJ0H 2K37A 4H0LD 1JMBA 4B86A 5KLVD 1NU1D 1K9MQ 1PL5A 5GTIE 2RN0A 3AEDC 1LTTC 1RE3C 5AVXB 3H32A 3L73E 3M9QA 1M1JA 1FE6A 1HVVA 1VQ7P 1NTMJ 1VQNP 2OGUA 2YO3A 3TGUJ 1MV8A 2IYOA 1J1DB 3NFQA 5E79E 2Y0CA 4K3AA 2A06G 5TJHA 1KILE 2JEEA 4XA4A 3VMXA 4UB6E 4WWIA 5AVVB 5KLVK 2QM8A 1N7SD 2WPRA 3LIDA 2HR3A 3RL0C 5KAIH 2WQYC 1FZGA 1HUCA 1WRGA 3QH9A 2Q6QA 4UB8H 4GOFA 2DW3A 1NTZE 3A5TA 1PGOA 1YTZI 2K9JA 3V4WA 1U7MA 3BRTB 3O8ZA 3A0HE 2HODA 2QVAA 3P32A 3L75J 1RF0C 3EFFK 1PIXA 4HYTB 4N6JA 3L72J 2WPSA 3FWNA 3HD7C 2AEMA 2OYHB 3JCUE 1OW7A 1KQLA 2CPBA 2GUSA 2OTKE 2ZAEB 5AVTB 1L0NJ 2XV5A 1Y9BA 2N1TA 1G2CA 1SFCB 1VF5C 2OARA 1KYOD 1IFIA 4N3YB 3V2PA 4EI2A 1RF1C 3CWBE 1KMIZ 4GT1A 1NTKE 2L91A 2E74D 1USDA 2W90A 2XZRA 3AEAC 2M5AA 5KLVJ 3H1HG 3L71J 4UB8E 1MZ9A 2P58A 1GZLA 2IBZD 1VF5D 4D6TE 3VYIA 2B87A 4RKUJ 4CPGA 3WUUA 4OWFA 5APVA 2IZ1A 4BRYB 2AXTE 3H1IG 2KIKA 1JCDA 1NVOA 4WVZA 3H1KD 4TT3H 3TSIA 1Y8AA 1AVOA 3JCUH 5GTIH 1S72P 4EDFA 1JY3O 1KQGB 5L8RJ 1SQPE 2WSEH 3UIAA 2OTJP 1GL2A 1AQTA 3T97A 1N7SA 3F89A 2W6JH 4R4MA 1BSHA 3B8EB 3L74E 4NPDA 1G1IA 3RBZA 3TF5A 1NGMB 1VQ5P 5AW6B 2LXCB 1SQPK 2BCCG 2WITA 3O6QB 2QEXP 1NYHA 1GTWA 1KQFB 3H1KE 2E43A 1BSNA 2B87B 1EZVD 2E75D 2L5GB 3H1IJ 5CCGA 1U57A 1SQVE 3L70J 3L35A 1N86A 3L72D 5GTHE 2Q9IA 2KSJA 2FYUG 3V2RA 3MIWA 2YNYA 3H1LE 3FXEA 1OIPA 2IBZE 3RK3D 1DIPA 3KQGA 5CJ4A 2PGDA 1KZUB 4WY4A 1JY2O 1PPJD 4LC1A 1FJKA 2R3CA 2IX7C 3GLMA 3KZIE 3I55P 2R5DA 1SP4A 1RF0A 2WT7A 1GL2C 4M3LA 1KQSO 1VQLP 1JB0J 2E75C 4H44C 4IOIH 1FDOA 2HLOA 1LTJB 1M1JB 4IL6E 5APSA 2XNXA 1AA0A 3RK3E 1TU3F 3B4SA 1NTKJ 3AE2C 1JUNA 5AW3B 1JOCA 2K9JB 1L0NK 2AEJA 5AVQB 1SQPJ 1PZQA 3CXHD 4I1LA 3E1RA 1LTJA 2I1JA 2JP3A 3I5CA 3M0AA 1FOSE 3Q5PA 2IPPA 1LP1A 1RE4C 3CC7P 3FGAD 3U1AA 1QX8A 3F5HA 2V4HA 4OGQD 2C0WA 4O9BA 2QRXA 2OYIC 1IO4A 1JO5A 2H89C 3W67A 4GKGA 2FXMA 1KTMA 1LT9B 2YIUC 3AE7C 2KLUA 1LP1B 3H1KG 1L0ND 1W2EA 1YQ4C 2YMKA 3KHUA 2QIWA 1JY2N 2ZYGA 3IFMA 5KAFH 1N8RQ 3CCQP 1S1CX 1SQPG 4ZKUA 1BCCE 2QJPB 1T3JA 3Q1MA 1VQPP 1YJWP 1FZCA 1Y47A 2M8RA 3O6QA 4JF7A 1E5WA 2KYVA 4TLFA 4C7NA 3S9OA 4D6TD 1S5LX 3CXHH 2JR8A 4DCKA 1JY2P 2H8PD 2JJLA 1DD3A 1LT9C 4XE5B 2WT7B 2IFMA 2Z5IA 3LIEA 2ZVOB 1URQD 3M9BA 1EZVG 1K04A 1N7SB 1ZP0C 1KYOE 1OVRA 4U3FJ 1LTGC 2CK3H 4IFFA 2Y0DA 2VRSA 1FOSF 1K73Q 4A7PA 2ZYDA 3A7OA 1GMJA 1LTAC 2C0XA 5APTA 3PH0A 5C39A 2R44A 1Q81Q 1JTHA 3CCVP 1IK7A 4Y99B 5KAIE 1PPJG 1QL1A 5CJ0A 2PFXA 1NU1J 2UWJE 3AE6C 3FX0A 1IFPA 5AVSB 2M5AB 1ZW0A 3TYYA 1K8AQ 1VQ9P 3VMAA 1A02F 2WVRA 1PPJE 1KB9I 1G2CB 3AE3C 1ZRTD 4C46A 2OYIA 1J1EB 1JNMA 3L36A 2V7QJ 2E76B 1L0LE 4QMAA 1HJ0A 1N7LA 1BCCJ 2D2CC 2HFED 2LKMA 3RK2B 4ASWA 1H89A 1SLQA 1T2KC 1UIXA 3IF4A 3L72E 1FU1A 3GHGA 3HTKB 3W68A 3CC2P 3CX5E 1BGYJ 2IFNA 4H0LC 5AW2B 1EZVE 2KZJA 1L0LD 1PP9G 5AW4B 3CCJP 1HTLC 1URQB 2J5UA 1EDKA 3GG2A 4L74A 4PV1C 2Q7CA 5B66E 1L4AB 4JBZA 1NWQA 2H43A 3NMDA 4OH8B 3AEEC 1Q86Q 2XDJA 2WSCJ 1SQQG 2PAJA 5GTHH 3BVHA 1MKMA 2A45G 1LTSC 3MHVA 3CD6P 1URQA 4HJGH 1OZHA 1SQPD 1BDDA 1QVGO 1ZMEC 1J2JB 4LGDE 1AJYA 3OJAB 1K05A 2FYUJ 1L0LK 3R4YA 3CMAP 1M90Q 1KN7A 2WSSH 1S5LH 4D6TG 3B71A 3CL3D 4BRYA 1CI6A 5CCGD 2R5BA 2N1TC 5H2FH 2NPSB 3EFGA 4IL6H 1SFCD 5AW1B 3WUVA 1ZN5A 2B9BA 2W27A 3HUSA 4BWNA 4KHXA 1NO4A 1OVVA 4BXLA 3L75G 2KB7P 1OFCX 1LTBC 1QEXA 2KSEA 3CC4P 4R4LA 1MFTA 2E76D 3HRNA 1L4AA 1GDTA 3HD7B 3TGUE 1AQ5A 1R5SA 2K88A 2QJKB 5KKZC 2WSFH 5KJ7C 2JDIH 3HE4A 3IR9A 2KNCA 1SQVD 1NTZG 3PRJA 1BCCD 3MGNA 4DT0A 3USSA 3VP8A 3AEBC 3AE9C 1PFIA 1DX7A 1SS1A 3H1LD 3V5BA 5BU5A 3CCRP 2NZ2A 5CCHA 4JPZB 4GODA 1L0LJ 2FKWB 1GW4A 2YXQB 2MKVA 3CLQA 2P67A 1L4AC 2P10A 1IFMA 1DEEG 3L74D 3V2NA 4ZMDA 2ZT9B 3CX5I 1FZCC 1IFJA 2FFDC 1M1KQ 2KXPB 2LXBA 3RBXA 3HE5B 1AV1A 3L4FA 1SQXJ 1CSBA 2A45H 3A2AA 3TK1A
chains in the Genus database with same CATH topology
3JC22 3MP7B 1RH5B 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC2 2;  3MP7 B;  1RH5 B;  2YXR B;  2YXQ B;  1RHZ B; 
#chains in the Genus database with same CATH topology
 1ZLL A;  2WWW A;  3JC2 2;  3BCC J;  2D2C D;  3BAT A;  3CWB G;  3CXH E;  4WY4 D;  1OX3 A;  3S4R A;  4XFJ A;  3CCS P;  1HBW A;  4I7Z C;  4RJT A;  1JTH B;  1CW5 A;  2WPQ A;  2K9Y A;  2NPS D;  3GF3 A;  5AVZ B;  2FXP A;  2YMY A;  3N7N A;  1P84 I;  1LNQ A;  3R2P A;  1GU4 A;  3MUD C;  3PJS K;  4H44 B;  2KUB A;  3TGU D;  4GDO A;  1XTG B;  1YQ3 C;  1ZRT E;  3L73 D;  3CI9 A;  4HB1 A;  2BEQ D;  2K3R A;  5EFW B;  5KLV E;  3OW2 O;  1YIJ P;  5KLI C;  2NRG A;  3L70 G;  5K5G B;  1HH0 A;  3MD0 A;  1NTK D;  3BCC G;  1X0T A;  3SWY A;  1JM0 A;  1RF1 B;  2FFD A;  1L4A D;  1GW3 A;  3Q5S A;  1VQO P;  2A45 I;  2WSC H;  3D6Y A;  1NTM K;  1QLE D;  1YHQ P;  3KDP B;  1QGK B;  5KLV G;  1FZF A;  3G9R A;  5DJU B;  2K1A A;  2Q1K A;  3IAO A;  2GM4 A;  3EQ2 A;  1KFN A;  1NTK K;  1M57 D;  2R32 A;  3LW5 J;  1KC8 Q;  1T3U A;  3VMZ A;  3H1J E;  2WTY A;  2A06 D;  3HE4 B;  4GIF A;  4WY4 B;  1PGJ A;  3AE4 C;  1SQV G;  1NTZ D;  4YPC A;  1SVF A;  2D2C B;  2E42 A;  3CX5 H;  1KD1 Q;  3TDK A;  2O01 N;  3H1L G;  1OWA A;  4EYY Q;  4N78 E;  2QJK C;  5KKZ B;  4I6M C;  3TNU B;  4HKZ H;  1U7J A;  3GF7 A;  1PP9 J;  3L74 G;  1USE A;  5CBN A;  3HUS B;  2WSE J;  1M8O B;  1FJP A;  2NPS A;  3Q2Y A;  1NU1 E;  2ZFC A;  1NTZ K;  4ASV A;  2SPZ A;  3H1K J;  2Y9Y A;  4NPF X;  2FY8 A;  1H0T B;  1LWU B;  1P84 H;  2XND H;  3II6 A;  1SQV J;  3L70 E;  3RL0 g;  3CWB D;  5KLI B;  2Q3I A;  3K5B A;  3NXS A;  2O01 J;  5APY A;  3B5N C;  2YO2 A;  3H1L J;  5H2F E;  2IZ0 A;  4GOE A;  2OYI B;  3D70 A;  1Q82 Q;  3OAK A;  3PP5 A;  1RQU A;  2KZI A;  3B5N B;  1EZV I;  4PV1 D;  3U59 A;  3L74 J;  1GU5 A;  2N9Y B;  2M3B A;  1N73 A;  2Z4E A;  2W8Z A;  1SQB D;  2B89 A;  3L73 G;  4H13 C;  2NPS C;  4AUW A;  3AEG C;  1FBM A;  3E1I A;  3HTK A;  5E79 H;  3AEF C;  1KIL C;  1NTM G;  3H1I D;  2OYH C;  3VOP A;  3G4S P;  1OW8 A;  1FDI A;  1G1J A;  1NTK G;  3BCC D;  3FXD A;  3CME P;  1NKZ B;  3NTN A;  3MUD A;  3FWL A;  2RH0 A;  4JYC A;  5B5E E;  1RQV A;  1VL2 A;  2BCC E;  2IDB A;  2N1T B;  1Q90 D;  4I7Z B;  3T97 B;  1NTZ J;  4WB4 A;  1M56 D;  1L2P A;  1VDF A;  1A02 J;  3A0H H;  2ITA A;  1SQV K;  2W6A A;  2KOG A;  1YIT P;  2OYH A;  1J1D C;  1AVY A;  2BCC D;  4WBA A;  2O01 H;  2GUV A;  2JKV A;  1N2D C;  1EDJ A;  1AFO A;  4C7N B;  2ZJS E;  2OTL P;  4L73 A;  3L72 G;  5BVZ A;  3SWF A;  3CPW O;  3D71 A;  1FZC B;  2XKM A;  1L0N E;  2HG5 D;  3GW6 A;  1ZOY C;  3MZW B;  3Q3D A;  1KB9 E;  2V7Q H;  2E76 C;  3WMM 0;  3I56 P;  2OQQ A;  3B5N A;  1ZXG A;  2FYU D;  3A0B E;  3CWB J;  3L75 E;  1W2B O;  1SFC A;  3G71 P;  1BGY G;  2Y9Z A;  2ZT9 D;  1S3J A;  2AEF A;  2QA4 P;  3VN0 A;  1KOR A;  1ZR2 A;  3ITK A;  3N4X A;  5KJ7 A;  1EQ7 A;  4H13 D;  1LWU A;  3H1H J;  2LR2 A;  1NKN A;  3A3Y B;  3L71 G;  3PHL A;  4OVN F;  4UB6 H;  5CHX A;  1YJN P;  1CZQ A;  5CCG C;  4U3F E;  1BE3 E;  1P84 E;  2P2U A;  4C7R A;  4LLH A;  5TIS H;  3H32 B;  1VQ4 P;  1YJ9 P;  2HOD B;  2QM7 A;  5DJT B;  1SFC C;  1LTJ C;  1S4X A;  1VF5 B;  2IYP A;  2W83 C;  1IK9 A;  1KYO I;  2FYZ A;  4HH2 A;  2E5Y A;  1S5L E;  2RMZ A;  1NH4 A;  3CXH I;  3L37 A;  4DJG A;  4IFM A;  3RGU A;  5CCH D;  3V2Q A;  3H1J G;  4D6T J;  3V6I A;  2I8D A;  3HD7 D;  1S9K D;  3PTZ A;  1SQB G;  1R5L A;  1N73 C;  1Z56 A;  2QG4 A;  3AE5 C;  4N78 D;  4PD4 H;  3MP7 B;  3P8C D;  1SQQ E;  1RE4 A;  1NTM D;  5APW A;  2J58 A;  3M9H A;  1VQK P;  3CCL P;  1T8Z A;  1EDI A;  5M1B A;  2MJZ A;  2BCC J;  3M91 A;  3G6E P;  1BE3 J;  3CCU P;  5AW5 B;  2QJP C;  4RES B;  3RK2 C;  1L0N G;  1SQX D;  1H8A A;  2JWD A;  1IZN B;  4IFD K;  1HJB A;  1SQB J;  1Q2N A;  3VTP C;  1KYO H;  1RF1 A;  3ABV C;  3GHG C;  3B5N D;  4PV1 B;  1VQ8 P;  4L76 A;  4W7Y A;  3HE5 A;  1H88 A;  2XU6 A;  2QSI A;  2POH A;  1IJD B;  1KIL D;  1D7M A;  1SQQ J;  1YTZ T;  4L75 A;  1DEB A;  5KJ7 D;  4OGQ B;  1GL2 B;  1QVF O;  1RY3 A;  1PV3 A;  1RE3 A;  1BE3 G;  1SQX K;  2O1J A;  4IL6 X;  1S9K E;  2FFD B;  1OVU A;  1N7S C;  1YYC A;  1DD4 A;  1JY3 P;  2WPV B;  1LWU C;  1NU1 K;  5AW9 B;  3RK2 D;  2RKL A;  3C8V A;  1FC2 C;  1KV4 A;  4YXW H;  2G3A A;  1BGY E;  1BGY D;  2JWA A;  1T6A A;  3IN6 A;  3KPE A;  3M0D C;  3AE1 C;  5BU8 B;  1T2K D;  5APQ A;  3H25 A;  1OMI A;  2ZYA A;  4W80 A;  4EIJ A;  2YKO A;  2N1T D;  1MUU A;  1FAV A;  3E7K A;  3L71 D;  3MTU E;  5KTB A;  4K35 A;  2ZXX A;  3U1C A;  1LTI C;  3D6Z A;  2IBZ I;  2I1K A;  2KS1 A;  1JEK A;  4KJM A;  1SQB K;  1EXI A;  2H7H A;  1QL2 A;  1PP9 E;  3GMA A;  3P8M C;  4PD4 I;  4DZO A;  1Q7Y Q;  4ZNC A;  1VQM P;  2E75 B;  2PRR A;  2Q5U A;  3SWK A;  4ZKP A;  2FYU E;  3RL0 B;  3V4Q A;  3SFD C;  1LGH B;  1CI6 B;  3H1J D;  1SQQ K;  3M0D A;  1H0T A;  1N73 B;  3RK3 B;  5AW8 B;  1NJI Q;  1FZE A;  2QJY B;  4MN4 C;  1KFM A;  2QE7 H;  3WU2 H;  2KNC B;  2YXR B;  4I2L C;  1GK6 A;  1HGV A;  1SQX E;  2CPS A;  2O1K A;  3RL0 D;  2P1J A;  3BRV B;  1ZR4 A;  1GD2 E;  3A0B H;  1NOH A;  1KIL B;  1L0L G;  1GL2 D;  1IFD A;  1PP9 D;  2AXC A;  1RH5 B;  1VPC A;  2FBW C;  2M3E A;  2WMM A;  3KZI H;  2ZT9 C;  3P8C E;  4W7Z A;  1URQ C;  3TNU A;  2AXT H;  2N9B A;  2YKQ A;  4H13 B;  4U3F G;  3P7K A;  5AW0 B;  2P7J A;  4YTP C;  1SQQ D;  1KIL A;  3LW5 H;  1NHL A;  1NAY A;  1SQX G;  3L71 E;  3M06 A;  4JYB A;  1WMK A;  4YXD C;  1EXJ A;  4U7J A;  1JY3 N;  5CMZ A;  3RK3 C;  2H88 C;  5AW7 B;  2JO1 A;  3BCC E;  4H44 D;  2Z5H A;  4KT0 J;  3G3Z A;  2FYN C;  3H6P A;  2E74 B;  2KK7 A;  4NPE A;  4Y99 C;  3WU2 E;  2WSF J;  2FYU K;  1ZV8 A;  1NU1 G;  3H1I E;  3KYQ A;  4RO0 A;  3SSU A;  1FS0 E;  5KAF E;  2Y0E A;  4EOT A;  1LT1 A;  5B5E H;  2OYO A;  1BE3 D;  1P84 D;  4JQ0 D;  4PJ0 E;  2W6B A;  3QWO C;  2C9N Y;  3S1K A;  1HGZ A;  3L75 D;  1BDC A;  2BAS A;  1HWT C;  4OGQ C;  1MFZ A;  1FDM A;  3ZDM A;  1IC2 A;  4Y28 J;  3WUT A;  1BCC G;  3PLN A;  5AVW B;  1DH3 A;  3H1H E;  2ZXE B;  1KB9 H;  2ZVN B;  2FYN B;  4WY4 C;  5AVU B;  5CCH C;  5B66 H;  3OA7 A;  2KI7 B;  3GHG B;  3H1J J;  3HUS C;  4PD4 E;  2QJY C;  4AYC A;  4Z1M H;  1YI2 P;  3CCE P;  1KB9 D;  4H0L B;  3C9I A;  3CX5 D;  2HPC B;  1NAF A;  2PP6 A;  3CCM P;  4DOJ A;  1HF9 A;  3L73 J;  2G8Y A;  1WT6 A;  5CBO A;  2GA1 A;  3VP9 A;  1LJ2 A;  1NTM E;  1EC5 A;  2KS1 B;  2WZ7 A;  1PGQ A;  2E5T A;  1PGP A;  2J59 M;  5TIS E;  2Q3E A;  1S2E A;  2C9L Y;  1JMM A;  2O3J A;  1OXZ A;  1FZA A;  1JCC A;  2M0B A;  1J1E C;  3AE8 C;  1YBK A;  3JSV C;  2A06 E;  5AVY B;  3Q5R A;  2R3S A;  3VMY A;  1W5C E;  3SFE C;  1OW6 A;  2KLV A;  1X8Y A;  1RHZ B;  5APU A;  2HYN A;  3AEC C;  4PD4 D;  2YIU B;  1EDL A;  1E79 H;  1FZB A;  2YKP A;  2HPC A;  1X9V A;  4U3F D;  3H1H D;  1IFN A;  1X79 B;  1M1J C;  1R8E A;  1LT9 A;  2IBZ G;  2KP8 A;  1XTC C;  3TGU G;  1VQ6 P;  1M7L A;  1X22 A;  4AQR D;  1SQB E;  2FXO A;  2B88 A;  3C1L A;  3HD7 A;  1UII A;  5APX A;  5AVR B;  1GK4 A;  2BEZ F;  2E74 C;  3EWK A;  3KXD A;  3L70 D;  3BAS A;  4PJ0 H;  2K37 A;  4H0L D;  1JMB A;  4B86 A;  5KLV D;  1NU1 D;  1K9M Q;  1PL5 A;  5GTI E;  2RN0 A;  3AED C;  1LTT C;  1RE3 C;  5AVX B;  3H32 A;  3L73 E;  3M9Q A;  1M1J A;  1FE6 A;  1HVV A;  1VQ7 P;  1NTM J;  1VQN P;  2OGU A;  2YO3 A;  3TGU J;  1MV8 A;  2IYO A;  1J1D B;  3NFQ A;  5E79 E;  2Y0C A;  4K3A A;  2A06 G;  5TJH A;  1KIL E;  2JEE A;  4XA4 A;  3VMX A;  4UB6 E;  4WWI A;  5AVV B;  5KLV K;  2QM8 A;  1N7S D;  2WPR A;  3LID A;  2HR3 A;  3RL0 C;  5KAI H;  2WQY C;  1FZG A;  1HUC A;  1WRG A;  3QH9 A;  2Q6Q A;  4UB8 H;  4GOF A;  2DW3 A;  1NTZ E;  3A5T A;  1PGO A;  1YTZ I;  2K9J A;  3V4W A;  1U7M A;  3BRT B;  3O8Z A;  3A0H E;  2HOD A;  2QVA A;  3P32 A;  3L75 J;  1RF0 C;  3EFF K;  1PIX A;  4HYT B;  4N6J A;  3L72 J;  2WPS A;  3FWN A;  3HD7 C;  2AEM A;  2OYH B;  3JCU E;  1OW7 A;  1KQL A;  2CPB A;  2GUS A;  2OTK E;  2ZAE B;  5AVT B;  1L0N J;  2XV5 A;  1Y9B A;  2N1T A;  1G2C A;  1SFC B;  1VF5 C;  2OAR A;  1KYO D;  1IFI A;  4N3Y B;  3V2P A;  4EI2 A;  1RF1 C;  3CWB E;  1KMI Z;  4GT1 A;  1NTK E;  2L91 A;  2E74 D;  1USD A;  2W90 A;  2XZR A;  3AEA C;  2M5A A;  5KLV J;  3H1H G;  3L71 J;  4UB8 E;  1MZ9 A;  2P58 A;  1GZL A;  2IBZ D;  1VF5 D;  4D6T E;  3VYI A;  2B87 A;  4RKU J;  4CPG A;  3WUU A;  4OWF A;  5APV A;  2IZ1 A;  4BRY B;  2AXT E;  3H1I G;  2KIK A;  1JCD A;  1NVO A;  4WVZ A;  3H1K D;  4TT3 H;  3TSI A;  1Y8A A;  1AVO A;  3JCU H;  5GTI H;  1S72 P;  4EDF A;  1JY3 O;  1KQG B;  5L8R J;  1SQP E;  2WSE H;  3UIA A;  2OTJ P;  1GL2 A;  1AQT A;  3T97 A;  1N7S A;  3F89 A;  2W6J H;  4R4M A;  1BSH A;  3B8E B;  3L74 E;  4NPD A;  1G1I A;  3RBZ A;  3TF5 A;  1NGM B;  1VQ5 P;  5AW6 B;  2LXC B;  1SQP K;  2BCC G;  2WIT A;  3O6Q B;  2QEX P;  1NYH A;  1GTW A;  1KQF B;  3H1K E;  2E43 A;  1BSN A;  2B87 B;  1EZV D;  2E75 D;  2L5G B;  3H1I J;  5CCG A;  1U57 A;  1SQV E;  3L70 J;  3L35 A;  1N86 A;  3L72 D;  5GTH E;  2Q9I A;  2KSJ A;  2FYU G;  3V2R A;  3MIW A;  2YNY A;  3H1L E;  3FXE A;  1OIP A;  2IBZ E;  3RK3 D;  1DIP A;  3KQG A;  5CJ4 A;  2PGD A;  1KZU B;  4WY4 A;  1JY2 O;  1PPJ D;  4LC1 A;  1FJK A;  2R3C A;  2IX7 C;  3GLM A;  3KZI E;  3I55 P;  2R5D A;  1SP4 A;  1RF0 A;  2WT7 A;  1GL2 C;  4M3L A;  1KQS O;  1VQL P;  1JB0 J;  2E75 C;  4H44 C;  4IOI H;  1FDO A;  2HLO A;  1LTJ B;  1M1J B;  4IL6 E;  5APS A;  2XNX A;  1AA0 A;  3RK3 E;  1TU3 F;  3B4S A;  1NTK J;  3AE2 C;  1JUN A;  5AW3 B;  1JOC A;  2K9J B;  1L0N K;  2AEJ A;  5AVQ B;  1SQP J;  1PZQ A;  3CXH D;  4I1L A;  3E1R A;  1LTJ A;  2I1J A;  2JP3 A;  3I5C A;  3M0A A;  1FOS E;  3Q5P A;  2IPP A;  1LP1 A;  1RE4 C;  3CC7 P;  3FGA D;  3U1A A;  1QX8 A;  3F5H A;  2V4H A;  4OGQ D;  2C0W A;  4O9B A;  2QRX A;  2OYI C;  1IO4 A;  1JO5 A;  2H89 C;  3W67 A;  4GKG A;  2FXM A;  1KTM A;  1LT9 B;  2YIU C;  3AE7 C;  2KLU A;  1LP1 B;  3H1K G;  1L0N D;  1W2E A;  1YQ4 C;  2YMK A;  3KHU A;  2QIW A;  1JY2 N;  2ZYG A;  3IFM A;  5KAF H;  1N8R Q;  3CCQ P;  1S1C X;  1SQP G;  4ZKU A;  1BCC E;  2QJP B;  1T3J A;  3Q1M A;  1VQP P;  1YJW P;  1FZC A;  1Y47 A;  2M8R A;  3O6Q A;  4JF7 A;  1E5W A;  2KYV A;  4TLF A;  4C7N A;  3S9O A;  4D6T D;  1S5L X;  3CXH H;  2JR8 A;  4DCK A;  1JY2 P;  2H8P D;  2JJL A;  1DD3 A;  1LT9 C;  4XE5 B;  2WT7 B;  2IFM A;  2Z5I A;  3LIE A;  2ZVO B;  1URQ D;  3M9B A;  1EZV G;  1K04 A;  1N7S B;  1ZP0 C;  1KYO E;  1OVR A;  4U3F J;  1LTG C;  2CK3 H;  4IFF A;  2Y0D A;  2VRS A;  1FOS F;  1K73 Q;  4A7P A;  2ZYD A;  3A7O A;  1GMJ A;  1LTA C;  2C0X A;  5APT A;  3PH0 A;  5C39 A;  2R44 A;  1Q81 Q;  1JTH A;  3CCV P;  1IK7 A;  4Y99 B;  5KAI E;  1PPJ G;  1QL1 A;  5CJ0 A;  2PFX A;  1NU1 J;  2UWJ E;  3AE6 C;  3FX0 A;  1IFP A;  5AVS B;  2M5A B;  1ZW0 A;  3TYY A;  1K8A Q;  1VQ9 P;  3VMA A;  1A02 F;  2WVR A;  1PPJ E;  1KB9 I;  1G2C B;  3AE3 C;  1ZRT D;  4C46 A;  2OYI A;  1J1E B;  1JNM A;  3L36 A;  2V7Q J;  2E76 B;  1L0L E;  4QMA A;  1HJ0 A;  1N7L A;  1BCC J;  2D2C C;  2HFE D;  2LKM A;  3RK2 B;  4ASW A;  1H89 A;  1SLQ A;  1T2K C;  1UIX A;  3IF4 A;  3L72 E;  1FU1 A;  3GHG A;  3HTK B;  3W68 A;  3CC2 P;  3CX5 E;  1BGY J;  2IFN A;  4H0L C;  5AW2 B;  1EZV E;  2KZJ A;  1L0L D;  1PP9 G;  5AW4 B;  3CCJ P;  1HTL C;  1URQ B;  2J5U A;  1EDK A;  3GG2 A;  4L74 A;  4PV1 C;  2Q7C A;  5B66 E;  1L4A B;  4JBZ A;  1NWQ A;  2H43 A;  3NMD A;  4OH8 B;  3AEE C;  1Q86 Q;  2XDJ A;  2WSC J;  1SQQ G;  2PAJ A;  5GTH H;  3BVH A;  1MKM A;  2A45 G;  1LTS C;  3MHV A;  3CD6 P;  1URQ A;  4HJG H;  1OZH A;  1SQP D;  1BDD A;  1QVG O;  1ZME C;  1J2J B;  4LGD E;  1AJY A;  3OJA B;  1K05 A;  2FYU J;  1L0L K;  3R4Y A;  3CMA P;  1M90 Q;  1KN7 A;  2WSS H;  1S5L H;  4D6T G;  3B71 A;  3CL3 D;  4BRY A;  1CI6 A;  5CCG D;  2R5B A;  2N1T C;  5H2F H;  2NPS B;  3EFG A;  4IL6 H;  1SFC D;  5AW1 B;  3WUV A;  1ZN5 A;  2B9B A;  2W27 A;  3HUS A;  4BWN A;  4KHX A;  1NO4 A;  1OVV A;  4BXL A;  3L75 G;  2KB7 P;  1OFC X;  1LTB C;  1QEX A;  2KSE A;  3CC4 P;  4R4L A;  1MFT A;  2E76 D;  3HRN A;  1L4A A;  1GDT A;  3HD7 B;  3TGU E;  1AQ5 A;  1R5S A;  2K88 A;  2QJK B;  5KKZ C;  2WSF H;  5KJ7 C;  2JDI H;  3HE4 A;  3IR9 A;  2KNC A;  1SQV D;  1NTZ G;  3PRJ A;  1BCC D;  3MGN A;  4DT0 A;  3USS A;  3VP8 A;  3AEB C;  3AE9 C;  1PFI A;  1DX7 A;  1SS1 A;  3H1L D;  3V5B A;  5BU5 A;  3CCR P;  2NZ2 A;  5CCH A;  4JPZ B;  4GOD A;  1L0L J;  2FKW B;  1GW4 A;  2YXQ B;  2MKV A;  3CLQ A;  2P67 A;  1L4A C;  2P10 A;  1IFM A;  1DEE G;  3L74 D;  3V2N A;  4ZMD A;  2ZT9 B;  3CX5 I;  1FZC C;  1IFJ A;  2FFD C;  1M1K Q;  2KXP B;  2LXB A;  3RBX A;  3HE5 B;  1AV1 A;  3L4F A;  1SQX J;  1CSB A;  2A45 H;  3A2A A;  3TK1 A; 
#chains in the Genus database with same CATH homology
 3JC2 2;  3MP7 B;  1RH5 B;  2YXR B;  2YXQ B;  1RHZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...