2YXRB

The plug domain of the secy protein stablizes the closed state of the translocation channel and maintains a membrane seal
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The plug domain of the SecY protein stabilizes the closed state of the translocation channel and maintains a membrane seal
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
molecule keywords Preprotein translocase subunit secY
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 2yxrB00
3JC22 1RH5B 2YXRB 3MP7B 1RHZB 2YXQB
chains in the Genus database with same CATH superfamily
1FZCC 4BWNA 3Q3DA 1KV4A 1IFJA 5KLIC 3BCCJ 1YJ9P 1Q7YQ 1L0ND 1BCCJ 1NU1E 2M8RA 2OARA 2LXCB 5AW9B 1FJKA 3HTKB 1L0LD 2KS1A 2W90A 2DW3A 2M3BA 1QL1A 1VF5D 2L5GB 2OQQA 3FWLA 1BE3J 3CC7P 4NPDA 1AQ5A 1NKZB 2IBZD 2POHA 4OGQD 5AW0B 2KZJA 1JTHB 1JY3N 4EIJA 5AW2B 3FXEA 3CPWO 1AQTA 4PV1C 4EOTA 1XTCC 1SQBJ 1L4AD 2QEXP 3QH9A 3NMDA 2WPRA 1FZGA 1A02F 3VMZA 2PP6A 2W6BA 2C0WA 5AW1B 1SQPE 3SWFA 1BE3G 1K05A 4N78D 1KB9I 1HUCA 1NTMG 5AVTB 3USSA 1QLED 2WT7A 5AVUB 2K9JB 2WSSH 3HE4B 2N1TC 1J2JB 2B87B 1J1DB 4N6JA 1RF0A 3TK1A 1KQGB 2UWJE 1FS0E 2ZT9B 2PAJA 1S2EA 1YJWP 1M1JB 1BGYD 1NTMK 1NTMD 2E5TA 1BCCD 3V2QA 2KNCA 3I55P 3MUDC 1KYOH 1NU1J 2ZAEB 1URQD 4Z1MH 5TISE 2NPSA 4BRYB 4HYTB 5AW8B 1KQSO 3WU2H 2KI7B 1IFNA 4TT3H 4L76A 4RJTA 5GTIE 2R5DA 3HUSA 1BCCE 2XDJA 4AQRD 1K73Q 1SFCD 2Z4EA 1LP1A 1RY3A 2LXBA 3H32B 1KILA 1NTMJ 3IF4A 1SQVG 1OMIA 4RO0A 1SQXK 3U1CA 1YITP 2QVAA 3CXHE 1MKMA 2A06D 3H1HG 4DCKA 3H1LD 2L91A 2M3EA 3ITKA 4YPCA 1H8AA 3LIDA 1QEXA 2W8ZA 4M3LA 2Q3IA 5C39A 2W83C 4UB8H 1YHQP 1X79B 3CWBG 1G1JA 3VOPA 2HPCA 3CXHI 1VQ6P 4JF7A 1KB9D 1MUUA 2WSFJ 1IJDB 3P32A 2IZ1A 5AW3B 3H1HD 2P67A 3SWKA 1ZXGA 2KB7P 2NPSC 1HVVA 1Q82Q 3RK2B 1N73A 4U3FD 1NHLA 3II6A 3KZIH 1DD3A 3BATA 4I1LA 3QWOC 4WY4C 4BXLA 3M0DC 1VF5C 4OH8B 1VQ5P 2Q3EA 2OYIB 5CMZA 3A0BH 1VQLP 1FOSE 2P2UA 5KJ7C 1NGMB 3V5BA 3B4SA 4U3FG 4OWFA 2QJKB 2Y9ZA 2OYHB 1M7LA 2H89C 2JO1A 1T6AA 2FXMA 2HG5D 2Z5HA 3AEFC 1KFMA 1S1CX 3VMXA 1JNMA 4ASVA 1LWUA 1DD4A 3L74J 1Z56A 3CXHH 4UB6E 2M5AB 5KLVJ 4C7NB 1FOSF 1VQOP 1CZQA 1LTJB 3L75D 5CCHC 1FZCB 1GMJA 2QE7H 3L72E 3C1LA 1VL2A 1OW6A 5CCGC 3H1KD 2GM4A 3CC2P 1S9KE 1PP9E 4I7ZC 3V4QA 2FYNB 1BE3E 3L73E 1LT9A 1PPJG 2RKLA 4L74A 5GTIH 3JSVC 1M90Q 3WU2E 2JKVA 1MFZA 5TISH 4U7JA 3SFDC 1URQB 3KYQA 1L0NE 3GLMA 3RK3C 2E76D 5AW5B 3CWBD 3E1IA 3RL0B 1NO4A 2N9YB 1CI6A 1L0NK 1JY2P 1PGQA 1ZRTE 1USEA 1YYCA 1L2PA 1RQUA 2WZ7A 3P8MC 1M57D 1S3JA 2YNYA 2KOGA 3CL3D 4MN4C 3NFQA 4WVZA 2CPSA 1SS1A 1FU1A 2NPSD 1RE3A 2QSIA 3BCCE 1PP9G 3F5HA 4JPZB 1RE4C 2XV5A 1LTAC 3GW6A 3L70G 1KILC 3RL0g 3V2RA 1NTZJ 2D2CC 1SQVK 3GHGC 3TNUA 2E5YA 3T97A 1N7SC 2BEZF 4D6TG 4H0LC 4K35A 3P8CE 3HUSC 2C9LY 4H13B 5DJTB 2Q7CA 1LNQA 1OWAA 2BCCJ 2QJYC 3AE7C 3U59A 3R4YA 3CD6P 1EZVD 3P7KA 3CI9A 2J5UA 2N1TD 3LIEA 3MUDA 1HH0A 2J59M 3S4RA 3N7NA 3KZIE 3IFMA 2RN0A 3CCEP 2I8DA 1SQVJ 1NTME 5KKZB 1BGYG 1N7SB 2ZYAA 1N8RQ 2IFNA 3K5BA 1DIPA 1RF0C 4PD4I 3C8VA 1S72P 1KC8Q 1JEKA 1PFIA 2MKVA 4ZKPA 2GUSA 2PRRA 4KHXA 1TU3F 1DEEG 4N78E 3H1LJ 1J1EB 1HTLC 1NTKK 1PPJD 2NRGA 4PJ0H 2AXTE 4K3AA 5APUA 1SVFA 3Q2YA 3CWBJ 2E74D 2V7QJ 1P84H 5CCGA 2O3JA 4LLHA 1AV1A 1BGYE 1N7LA 1FBMA 1OVVA 2KK7A 2QM8A 1L0LK 2WPVB 3GF3A 3H1LE 3L75G 5APSA 3G71P 1K04A 2FYUJ 2M0BA 2WSFH 2WWWA 3L71J 2AEJA 5KAIH 1WMKA 1LTIC 1YQ3C 1SQXD 4PD4H 1OZHA 1UIXA 3G9RA 1R5LA 1R8EA 2KLVA 4EI2A 3A2AA 5GTHE 2E43A 2KSJA 3L74D 5H2FE 2J58A 2B87A 3FGAD 3MD0A 4HB1A 3L75J 1X8YA 2OYIC 2IZ0A 1SQPK 3EWKA 1EDLA 4RESB 2IDBA 2YO2A 3KHUA 1HF9A 3CCVP 3G3ZA 3JCUE 1NU1G 3TGUE 1BSHA 2B89A 3CX5H 3D6ZA 3CX5D 4AYCA 1WT6A 5CBOA 2ZXXA 3N4XA 2OTJP 1EZVI 3H1IJ 2AXTH 3I5CA 4HKZH 3SFEC 1NTZK 1LT1A 2K88A 3B8EB 5APWA 3M91A 3TNUB 4OVNF 1NTZE 3HD7B 2AXCA 1OIPA 1PGOA 1U7MA 2Q1KA 1BDDA 2HODA 2XNDH 1QGKB 1BGYJ 2E76C 3GMAA 3H1HE 1USDA 5CJ0A 4PD4D 2KS1B 2LR2A 3AEBC 1AJYA 4W7ZA 1N2DC 2H7HA 1PIXA 2BCCG 3WUTA 4DT0A 1VQ9P 1EQ7A 1VPCA 1LWUB 3H25A 5H2FH 1JTHA 1LTBC 1GU5A 3CMEP 5GTHH 3RL0C 2I1KA 2ITAA 3L37A 3H1JE 2E75D 1IK9A 3L70J 2N1TA 2YKPA 1S5LH 2G8YA 3L73J 1LTGC 3L72J 3CCJP 1Q86Q 1RF1C 2WSCJ 4H0LD 1EC5A 2Q6QA 4Y28J 1PP9J 2O01J 2RH0A 1JMMA 2PGDA 3O6QA 1GZLA 1N73B 1BCCG 2O1JA 3LW5J 3H1ID 2B88A 2IYPA 1E5WA 2K37A 2KYVA 2WSEJ 3AEEC 1L4AA 1HJ0A 3BCCD 1JCDA 3H1KJ 4DZOA 3D71A 2OYHC 2IPPA 3AE5C 1SQBG 2H8PD 2ZXEB 1LJ2A 3M0DA 5AVXB 1S9KD 2WITA 3PRJA 2IYOA 5EFWB 4JYBA 3U1AA 1ZR4A 1JUNA 1M8OB 4IOIH 5CCGD 5AVQB 4HJGH 4BRYA 1Q2NA 3VMAA 1PV3A 4PV1D 1PL5A 1KYOI 3L72G 2WTYA 1SQQK 3CCQP 1LTJA 1W2EA 2G3AA 3BRTB 1SQBD 2XNXA 2OYIA 3VTPC 4D6TE 3ABVC 2D2CD 3EFFK 5KLVK 2E42A 1NAYA 2PFXA 4XA4A 1S5LE 5CJ4A 1SQPD 2FFDA 1UIIA 1NTKJ 1OW8A 3L4FA 3CX5I 4IL6H 5CCHD 2W6AA 3RK2C 5DJUB 3A3YB 4B86A 2E75B 3MTUE 1YI2P 2K9JA 3HE4A 1KQLA 1SFCA 1G2CA 3AE1C 2KLUA 3PHLA 4I2LC 1L0NJ 1NVOA 1ZOYC 3GG2A 3PH0A 2OGUA 3CC4P 3GHGA 3AE4C 3NTNA 4KT0J 2QG4A 2YMKA 2V7QH 1R5SA 1T3JA 4WY4B 4Y99B 2HPCB 5KJ7D 2QJPC 3AE6C 3B5ND 3L71G 2FYUK 3PP5A 4W7YA 2FFDC 2CPBA 3L36A 1RE3C 1Q90D 1H0TA 3R2PA 2N9BA 3IR9A 4WY4D 1SQQD 2Q9IA 1GD2E 1JOCA 1FZAA 3A0HH 3RK3E 3G6EP 1NOHA 2R3SA 1LTJC 1Y9BA 2QJYB 1ZV8A 3H1JJ 4JQ0D 2H43A 2K3RA 3UIAA 3KXDA 2IBZG 3WUVA 2LKMA 1P84I 3HD7D 2HR3A 3CXHD 1E79H 3AE3C 2K1AA 2ZJSE 4H13D 2XZRA 1IO4A 4KJMA 3H1HJ 2FYZA 5E79H 1GTWA 2K9YA 1GW4A 3HD7C 1L4AC 4UB6H 2FKWB 5E79E 1URQC 3BCCG 4YXWH 4IFMA 1P84D 1SQPJ 1JO5A 1AA0A 3AE2C 3PTZA 5K5GB 2O01N 1SQXJ 3CCRP 1GL2A 2QM7A 3KQGA 4HH2A 5AW7B 3L70E 1YTZI 1VQNP 1FDMA 2Q5UA 1RF1A 1PGJA 1CW5A 3IAOA 4ZNCA 2WT7B 1MZ9A 2E76B 3RL0D 1KFNA 5AVWB 2FXPA 2H88C 1XTGB 4LC1A 2JR8A 1OVUA 4R4LA 1CI6B 4ASWA 3HE5A 4H0LB 3Q5SA 1NH4A 1NTZG 5B5EE 3M9HA 2KNCB 4GKGA 2BEQD 2R3CA 1QVGO 1OFCX 2WMMA 1S4XA 3O8ZA 1HJBA 3CX5E 2FYUG 3FXDA 3MP7B 3CCSP 5APXA 3JCUH 4NPEA 1FJPA 1OW7A 1Y47A 3TYYA 3M0AA 3H1JD 4I7ZB 4QMAA 3RGUA 4WB4A 1VQKP 3BASA 1GW3A 1LTSC 1JMBA 1RQVA 3B5NB 2JWDA 2HYNA 5B66H 5KKZC 3H1JG 3AECC 1OX3A 3L73D 5AW6B 5CCHA 2N1TB 3D70A 3H1IE 1KN7A 1KTMA 1J1EC 1IC2A 5KAFE 3L71D 3CLQA 1KYOD 1GK6A 2YMYA 2JWAA 2W27A 2A45G 4DOJA 5KAFH 1NWQA 2C9NY 1BDCA 1CSBA 1QX8A 4XE5B 3TF5A 1S5LX 4EYYQ 5KLIB 1YJNP 5KJ7A 1DH3A 4GOEA 2P10A 1K9MQ 2O1KA 2Y0EA 3L71E 4LGDE 5AVRB 2D2CB 2YKQA 3MHVA 3VYIA 1EXIA 3Q5RA 2A45I 4PJ0E 4H44B 5APVA 3TSIA 5BU5A 1GK4A 1VQ7P 2JEEA 3OA7A 3HUSB 4I6MC 2C0XA 3MZWB 2R44A 1URQA 2Z5IA 1IFDA 4EDFA 2KP8A 1KILE 2HFED 4N3YB 3FWNA 2IBZI 2GA1A 3P8CD 1OVRA 3H32A 1JY2N 4OGQC 1EZVE 1N73C 1RH5B 3GF7A 5KAIE 5BU8B 2QJPB 1KILD 4L75A 4C46A 4ZKUA 2FFDB 1MFTA 3TGUG 1JB0J 4WBAA 3KDPB 3SWYA 4ZMDA 1T8ZA 2JJLA 3B71A 1IFPA 1QL2A 2B9BA 3A0BE 2ZVNB 3F89A 2MJZA 3H1KG 4YTPC 4D6TD 1GL2D 3W67A 5TJHA 1JM0A 3ZDMA 3MGNA 3TGUJ 1SFCC 3NXSA 1SQQG 2I1JA 4GOFA 1PGPA 1ZR2A 2BCCE 1VQ8P 1KMIZ 1EXJA 1KB9H 2FYUD 3VMYA 2A06G 1M1KQ 3M06A 4H44D 2M5AA 5BVZA 1NTKE 2YIUC 3V6IA 1WRGA 1N7SA 1Y8AA 3CCMP 1L0NG 3PLNA 1AVOA 4RKUJ 1L4AB 1MV8A 4O9BA 1FZCA 3S9OA 3A7OA 3L72D 5KLVE 3L74G 4GIFA 2FYUE 2E75C 2P1JA 1YTZT 1NU1K 2WSCH 3A0HE 5CHXA 1NTKD 1L0LE 1SQQE 2O01H 1GL2C 2RMZA 2XKMA 5APTA 5AVZB 3H6PA 3M9QA 1SQPG 1YIJP 1KZUB 3HRNA 3WMM0 2Y9YA 4GODA 1K8AQ 1EDIA 1NYHA 1T3UA 2CK3H 1RHZB 2Y0DA 3EQ2A 3CWBE 1VQPP 2P7JA 3LW5H 1KD1Q 3OAKA 2FY8A 3H1IG 3HTKA 5APQA 1J1DC 1SLQA 2E74C 2HODB 3TGUD 4DJGA 1LT9C 1IK7A 2ZFCA 2GUVA 1ZN5A 2W6JH 2NPSB 1NJIQ 1H0TB 3CCUP 3AEAC 1L0LG 2BASA 2WQYC 4R4MA 3M9BA 5M1BA 1KQFB 4CPGA 1LTTC 1NTZD 3C9IA 3TDKA 1Q81Q 2FBWC 3B5NC 2IBZE 1P84E 1LP1B 1NKNA 1GU4A 3S1KA 1FDIA 3HE5B 1NAFA 1ZP0C 3GHGB 1LWUC 1LGHB 3PJSK 2ZYDA 2JDIH 3Q5PA 2YXRB 1LT9B 2QRXA 3AE9C 3L70D 2R32A 3OJAB 1G1IA 4GT1A 1HGVA 3RBZA 2KUBA 1BSNA 1FC2C 1FZEA 3JC22 3CCLP 4PV1B 4IFDK 1N86A 2FYNC 5B5EH 2QA4P 1M1JA 1U57A 1SP4A 2KIKA 5AVVB 2OTLP 3AE8C 3FX0A 1L0LJ 2OTKE 1QVFO 2KXPB 4H44C 5AVYB 2WSEH 1RE4A 3AEGC 1D7MA 3BRVB 3H1LG 1EZVG 1IFIA 2IFMA 2SPZA 1SQXG 1ZW0A 3O6QB 4IL6E 4W80A 3OW2O 1PPJE 1X9VA 4L73A 4WWIA 1KORA 2JP3A 2A45H 3T97B 1U7JA 1ZLLA 1G2CB 1OXZA 3IN6A 2ZT9C 4XFJA 1VQ4P 1M1JC 2HLOA 1FE6A 2QIWA 4TLFA 1T2KC 1ZMEC 3RK2D 2FXOA 3I56P 5B66E 2OYHA 3D6YA 1JY3P 1VF5B 2ZVOB 3BVHA 1FZBA 2KZIA 2Y0CA 3L35A 4JYCA 2YKOA 3CMAP 1KYOE 1EDJA 4NPFX 4AUWA 1DEBA 1N7SD 1NTKG 2NZ2A 1SQXE 2QJKC 2XU6A 4H13C 3V4WA 2A06E 1SQBE 1A02J 3SSUA 4U3FJ 4D6TJ 3V2PA 1FAVA 5AW4B 3L74E 3A5TA 1SQBK 1JCCA 2YO3A 3B5NA 4OGQB 3W68A 1PZQA 4IL6X 2AEFA 5AVSB 4WY4A 5CBNA 2P58A 2WPSA 3KPEA 2WVRA 2YXQB 3L73G 4A7PA 3V2NA 1KB9E 4JBZA 1EDKA 1SFCB 2OYOA 1SQQJ 2ZYGA 4Y99C 1AFOA 1HBWA 1HGZA 1GDTA 3HD7A 5L8RJ 4U3FE 3E1RA 1SQVE 1YBKA 2KSEA 5APYA 3RK3B 3H1KE 3VP9A 2R5BA 2YIUB 2ZT9D 1AVYA 1IZNB 3AEDC 1GL2B 3E7KA 2VRSA 3Q1MA 1BE3D 2WPQA 1FZFA 4PD4E 3RK3D 3MIWA 1H88A 4C7NA 1DX7A 1SQVD 1H89A 5KLVD 1VDFA 4IFFA 1W5CE 3VP8A 1KILB 1ZRTD 1FDOA 3VN0A 4YXDC 5KTBA 2AEMA 3L75E 2BCCD 3G4SP 1HWTC 1JY2O 2IX7C 3WUUA 3RBXA 5KLVG 1YQ4C 1X22A 2E74B 3EFGA 1M56D 4GDOA 4C7RA 1W2BO 2V4HA 1IFMA 1PP9D 1X0TA 1VQMP 1NU1D 1T2KD 1RF1B 1JY3O 4UB8E
chains in the Genus database with same CATH topology
3JC22 1RH5B 2YXRB 3MP7B 1RHZB 2YXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC2 2;  1RH5 B;  2YXR B;  3MP7 B;  1RHZ B;  2YXQ B; 
#chains in the Genus database with same CATH topology
 1FZC C;  4BWN A;  3Q3D A;  1KV4 A;  1IFJ A;  5KLI C;  3BCC J;  1YJ9 P;  1Q7Y Q;  1L0N D;  1BCC J;  1NU1 E;  2M8R A;  2OAR A;  2LXC B;  5AW9 B;  1FJK A;  3HTK B;  1L0L D;  2KS1 A;  2W90 A;  2DW3 A;  2M3B A;  1QL1 A;  1VF5 D;  2L5G B;  2OQQ A;  3FWL A;  1BE3 J;  3CC7 P;  4NPD A;  1AQ5 A;  1NKZ B;  2IBZ D;  2POH A;  4OGQ D;  5AW0 B;  2KZJ A;  1JTH B;  1JY3 N;  4EIJ A;  5AW2 B;  3FXE A;  3CPW O;  1AQT A;  4PV1 C;  4EOT A;  1XTC C;  1SQB J;  1L4A D;  2QEX P;  3QH9 A;  3NMD A;  2WPR A;  1FZG A;  1A02 F;  3VMZ A;  2PP6 A;  2W6B A;  2C0W A;  5AW1 B;  1SQP E;  3SWF A;  1BE3 G;  1K05 A;  4N78 D;  1KB9 I;  1HUC A;  1NTM G;  5AVT B;  3USS A;  1QLE D;  2WT7 A;  5AVU B;  2K9J B;  2WSS H;  3HE4 B;  2N1T C;  1J2J B;  2B87 B;  1J1D B;  4N6J A;  1RF0 A;  3TK1 A;  1KQG B;  2UWJ E;  1FS0 E;  2ZT9 B;  2PAJ A;  1S2E A;  1YJW P;  1M1J B;  1BGY D;  1NTM K;  1NTM D;  2E5T A;  1BCC D;  3V2Q A;  2KNC A;  3I55 P;  3MUD C;  1KYO H;  1NU1 J;  2ZAE B;  1URQ D;  4Z1M H;  5TIS E;  2NPS A;  4BRY B;  4HYT B;  5AW8 B;  1KQS O;  3WU2 H;  2KI7 B;  1IFN A;  4TT3 H;  4L76 A;  4RJT A;  5GTI E;  2R5D A;  3HUS A;  1BCC E;  2XDJ A;  4AQR D;  1K73 Q;  1SFC D;  2Z4E A;  1LP1 A;  1RY3 A;  2LXB A;  3H32 B;  1KIL A;  1NTM J;  3IF4 A;  1SQV G;  1OMI A;  4RO0 A;  1SQX K;  3U1C A;  1YIT P;  2QVA A;  3CXH E;  1MKM A;  2A06 D;  3H1H G;  4DCK A;  3H1L D;  2L91 A;  2M3E A;  3ITK A;  4YPC A;  1H8A A;  3LID A;  1QEX A;  2W8Z A;  4M3L A;  2Q3I A;  5C39 A;  2W83 C;  4UB8 H;  1YHQ P;  1X79 B;  3CWB G;  1G1J A;  3VOP A;  2HPC A;  3CXH I;  1VQ6 P;  4JF7 A;  1KB9 D;  1MUU A;  2WSF J;  1IJD B;  3P32 A;  2IZ1 A;  5AW3 B;  3H1H D;  2P67 A;  3SWK A;  1ZXG A;  2KB7 P;  2NPS C;  1HVV A;  1Q82 Q;  3RK2 B;  1N73 A;  4U3F D;  1NHL A;  3II6 A;  3KZI H;  1DD3 A;  3BAT A;  4I1L A;  3QWO C;  4WY4 C;  4BXL A;  3M0D C;  1VF5 C;  4OH8 B;  1VQ5 P;  2Q3E A;  2OYI B;  5CMZ A;  3A0B H;  1VQL P;  1FOS E;  2P2U A;  5KJ7 C;  1NGM B;  3V5B A;  3B4S A;  4U3F G;  4OWF A;  2QJK B;  2Y9Z A;  2OYH B;  1M7L A;  2H89 C;  2JO1 A;  1T6A A;  2FXM A;  2HG5 D;  2Z5H A;  3AEF C;  1KFM A;  1S1C X;  3VMX A;  1JNM A;  4ASV A;  1LWU A;  1DD4 A;  3L74 J;  1Z56 A;  3CXH H;  4UB6 E;  2M5A B;  5KLV J;  4C7N B;  1FOS F;  1VQO P;  1CZQ A;  1LTJ B;  3L75 D;  5CCH C;  1FZC B;  1GMJ A;  2QE7 H;  3L72 E;  3C1L A;  1VL2 A;  1OW6 A;  5CCG C;  3H1K D;  2GM4 A;  3CC2 P;  1S9K E;  1PP9 E;  4I7Z C;  3V4Q A;  2FYN B;  1BE3 E;  3L73 E;  1LT9 A;  1PPJ G;  2RKL A;  4L74 A;  5GTI H;  3JSV C;  1M90 Q;  3WU2 E;  2JKV A;  1MFZ A;  5TIS H;  4U7J A;  3SFD C;  1URQ B;  3KYQ A;  1L0N E;  3GLM A;  3RK3 C;  2E76 D;  5AW5 B;  3CWB D;  3E1I A;  3RL0 B;  1NO4 A;  2N9Y B;  1CI6 A;  1L0N K;  1JY2 P;  1PGQ A;  1ZRT E;  1USE A;  1YYC A;  1L2P A;  1RQU A;  2WZ7 A;  3P8M C;  1M57 D;  1S3J A;  2YNY A;  2KOG A;  3CL3 D;  4MN4 C;  3NFQ A;  4WVZ A;  2CPS A;  1SS1 A;  1FU1 A;  2NPS D;  1RE3 A;  2QSI A;  3BCC E;  1PP9 G;  3F5H A;  4JPZ B;  1RE4 C;  2XV5 A;  1LTA C;  3GW6 A;  3L70 G;  1KIL C;  3RL0 g;  3V2R A;  1NTZ J;  2D2C C;  1SQV K;  3GHG C;  3TNU A;  2E5Y A;  3T97 A;  1N7S C;  2BEZ F;  4D6T G;  4H0L C;  4K35 A;  3P8C E;  3HUS C;  2C9L Y;  4H13 B;  5DJT B;  2Q7C A;  1LNQ A;  1OWA A;  2BCC J;  2QJY C;  3AE7 C;  3U59 A;  3R4Y A;  3CD6 P;  1EZV D;  3P7K A;  3CI9 A;  2J5U A;  2N1T D;  3LIE A;  3MUD A;  1HH0 A;  2J59 M;  3S4R A;  3N7N A;  3KZI E;  3IFM A;  2RN0 A;  3CCE P;  2I8D A;  1SQV J;  1NTM E;  5KKZ B;  1BGY G;  1N7S B;  2ZYA A;  1N8R Q;  2IFN A;  3K5B A;  1DIP A;  1RF0 C;  4PD4 I;  3C8V A;  1S72 P;  1KC8 Q;  1JEK A;  1PFI A;  2MKV A;  4ZKP A;  2GUS A;  2PRR A;  4KHX A;  1TU3 F;  1DEE G;  4N78 E;  3H1L J;  1J1E B;  1HTL C;  1NTK K;  1PPJ D;  2NRG A;  4PJ0 H;  2AXT E;  4K3A A;  5APU A;  1SVF A;  3Q2Y A;  3CWB J;  2E74 D;  2V7Q J;  1P84 H;  5CCG A;  2O3J A;  4LLH A;  1AV1 A;  1BGY E;  1N7L A;  1FBM A;  1OVV A;  2KK7 A;  2QM8 A;  1L0L K;  2WPV B;  3GF3 A;  3H1L E;  3L75 G;  5APS A;  3G71 P;  1K04 A;  2FYU J;  2M0B A;  2WSF H;  2WWW A;  3L71 J;  2AEJ A;  5KAI H;  1WMK A;  1LTI C;  1YQ3 C;  1SQX D;  4PD4 H;  1OZH A;  1UIX A;  3G9R A;  1R5L A;  1R8E A;  2KLV A;  4EI2 A;  3A2A A;  5GTH E;  2E43 A;  2KSJ A;  3L74 D;  5H2F E;  2J58 A;  2B87 A;  3FGA D;  3MD0 A;  4HB1 A;  3L75 J;  1X8Y A;  2OYI C;  2IZ0 A;  1SQP K;  3EWK A;  1EDL A;  4RES B;  2IDB A;  2YO2 A;  3KHU A;  1HF9 A;  3CCV P;  3G3Z A;  3JCU E;  1NU1 G;  3TGU E;  1BSH A;  2B89 A;  3CX5 H;  3D6Z A;  3CX5 D;  4AYC A;  1WT6 A;  5CBO A;  2ZXX A;  3N4X A;  2OTJ P;  1EZV I;  3H1I J;  2AXT H;  3I5C A;  4HKZ H;  3SFE C;  1NTZ K;  1LT1 A;  2K88 A;  3B8E B;  5APW A;  3M91 A;  3TNU B;  4OVN F;  1NTZ E;  3HD7 B;  2AXC A;  1OIP A;  1PGO A;  1U7M A;  2Q1K A;  1BDD A;  2HOD A;  2XND H;  1QGK B;  1BGY J;  2E76 C;  3GMA A;  3H1H E;  1USD A;  5CJ0 A;  4PD4 D;  2KS1 B;  2LR2 A;  3AEB C;  1AJY A;  4W7Z A;  1N2D C;  2H7H A;  1PIX A;  2BCC G;  3WUT A;  4DT0 A;  1VQ9 P;  1EQ7 A;  1VPC A;  1LWU B;  3H25 A;  5H2F H;  1JTH A;  1LTB C;  1GU5 A;  3CME P;  5GTH H;  3RL0 C;  2I1K A;  2ITA A;  3L37 A;  3H1J E;  2E75 D;  1IK9 A;  3L70 J;  2N1T A;  2YKP A;  1S5L H;  2G8Y A;  3L73 J;  1LTG C;  3L72 J;  3CCJ P;  1Q86 Q;  1RF1 C;  2WSC J;  4H0L D;  1EC5 A;  2Q6Q A;  4Y28 J;  1PP9 J;  2O01 J;  2RH0 A;  1JMM A;  2PGD A;  3O6Q A;  1GZL A;  1N73 B;  1BCC G;  2O1J A;  3LW5 J;  3H1I D;  2B88 A;  2IYP A;  1E5W A;  2K37 A;  2KYV A;  2WSE J;  3AEE C;  1L4A A;  1HJ0 A;  3BCC D;  1JCD A;  3H1K J;  4DZO A;  3D71 A;  2OYH C;  2IPP A;  3AE5 C;  1SQB G;  2H8P D;  2ZXE B;  1LJ2 A;  3M0D A;  5AVX B;  1S9K D;  2WIT A;  3PRJ A;  2IYO A;  5EFW B;  4JYB A;  3U1A A;  1ZR4 A;  1JUN A;  1M8O B;  4IOI H;  5CCG D;  5AVQ B;  4HJG H;  4BRY A;  1Q2N A;  3VMA A;  1PV3 A;  4PV1 D;  1PL5 A;  1KYO I;  3L72 G;  2WTY A;  1SQQ K;  3CCQ P;  1LTJ A;  1W2E A;  2G3A A;  3BRT B;  1SQB D;  2XNX A;  2OYI A;  3VTP C;  4D6T E;  3ABV C;  2D2C D;  3EFF K;  5KLV K;  2E42 A;  1NAY A;  2PFX A;  4XA4 A;  1S5L E;  5CJ4 A;  1SQP D;  2FFD A;  1UII A;  1NTK J;  1OW8 A;  3L4F A;  3CX5 I;  4IL6 H;  5CCH D;  2W6A A;  3RK2 C;  5DJU B;  3A3Y B;  4B86 A;  2E75 B;  3MTU E;  1YI2 P;  2K9J A;  3HE4 A;  1KQL A;  1SFC A;  1G2C A;  3AE1 C;  2KLU A;  3PHL A;  4I2L C;  1L0N J;  1NVO A;  1ZOY C;  3GG2 A;  3PH0 A;  2OGU A;  3CC4 P;  3GHG A;  3AE4 C;  3NTN A;  4KT0 J;  2QG4 A;  2YMK A;  2V7Q H;  1R5S A;  1T3J A;  4WY4 B;  4Y99 B;  2HPC B;  5KJ7 D;  2QJP C;  3AE6 C;  3B5N D;  3L71 G;  2FYU K;  3PP5 A;  4W7Y A;  2FFD C;  2CPB A;  3L36 A;  1RE3 C;  1Q90 D;  1H0T A;  3R2P A;  2N9B A;  3IR9 A;  4WY4 D;  1SQQ D;  2Q9I A;  1GD2 E;  1JOC A;  1FZA A;  3A0H H;  3RK3 E;  3G6E P;  1NOH A;  2R3S A;  1LTJ C;  1Y9B A;  2QJY B;  1ZV8 A;  3H1J J;  4JQ0 D;  2H43 A;  2K3R A;  3UIA A;  3KXD A;  2IBZ G;  3WUV A;  2LKM A;  1P84 I;  3HD7 D;  2HR3 A;  3CXH D;  1E79 H;  3AE3 C;  2K1A A;  2ZJS E;  4H13 D;  2XZR A;  1IO4 A;  4KJM A;  3H1H J;  2FYZ A;  5E79 H;  1GTW A;  2K9Y A;  1GW4 A;  3HD7 C;  1L4A C;  4UB6 H;  2FKW B;  5E79 E;  1URQ C;  3BCC G;  4YXW H;  4IFM A;  1P84 D;  1SQP J;  1JO5 A;  1AA0 A;  3AE2 C;  3PTZ A;  5K5G B;  2O01 N;  1SQX J;  3CCR P;  1GL2 A;  2QM7 A;  3KQG A;  4HH2 A;  5AW7 B;  3L70 E;  1YTZ I;  1VQN P;  1FDM A;  2Q5U A;  1RF1 A;  1PGJ A;  1CW5 A;  3IAO A;  4ZNC A;  2WT7 B;  1MZ9 A;  2E76 B;  3RL0 D;  1KFN A;  5AVW B;  2FXP A;  2H88 C;  1XTG B;  4LC1 A;  2JR8 A;  1OVU A;  4R4L A;  1CI6 B;  4ASW A;  3HE5 A;  4H0L B;  3Q5S A;  1NH4 A;  1NTZ G;  5B5E E;  3M9H A;  2KNC B;  4GKG A;  2BEQ D;  2R3C A;  1QVG O;  1OFC X;  2WMM A;  1S4X A;  3O8Z A;  1HJB A;  3CX5 E;  2FYU G;  3FXD A;  3MP7 B;  3CCS P;  5APX A;  3JCU H;  4NPE A;  1FJP A;  1OW7 A;  1Y47 A;  3TYY A;  3M0A A;  3H1J D;  4I7Z B;  4QMA A;  3RGU A;  4WB4 A;  1VQK P;  3BAS A;  1GW3 A;  1LTS C;  1JMB A;  1RQV A;  3B5N B;  2JWD A;  2HYN A;  5B66 H;  5KKZ C;  3H1J G;  3AEC C;  1OX3 A;  3L73 D;  5AW6 B;  5CCH A;  2N1T B;  3D70 A;  3H1I E;  1KN7 A;  1KTM A;  1J1E C;  1IC2 A;  5KAF E;  3L71 D;  3CLQ A;  1KYO D;  1GK6 A;  2YMY A;  2JWA A;  2W27 A;  2A45 G;  4DOJ A;  5KAF H;  1NWQ A;  2C9N Y;  1BDC A;  1CSB A;  1QX8 A;  4XE5 B;  3TF5 A;  1S5L X;  4EYY Q;  5KLI B;  1YJN P;  5KJ7 A;  1DH3 A;  4GOE A;  2P10 A;  1K9M Q;  2O1K A;  2Y0E A;  3L71 E;  4LGD E;  5AVR B;  2D2C B;  2YKQ A;  3MHV A;  3VYI A;  1EXI A;  3Q5R A;  2A45 I;  4PJ0 E;  4H44 B;  5APV A;  3TSI A;  5BU5 A;  1GK4 A;  1VQ7 P;  2JEE A;  3OA7 A;  3HUS B;  4I6M C;  2C0X A;  3MZW B;  2R44 A;  1URQ A;  2Z5I A;  1IFD A;  4EDF A;  2KP8 A;  1KIL E;  2HFE D;  4N3Y B;  3FWN A;  2IBZ I;  2GA1 A;  3P8C D;  1OVR A;  3H32 A;  1JY2 N;  4OGQ C;  1EZV E;  1N73 C;  1RH5 B;  3GF7 A;  5KAI E;  5BU8 B;  2QJP B;  1KIL D;  4L75 A;  4C46 A;  4ZKU A;  2FFD B;  1MFT A;  3TGU G;  1JB0 J;  4WBA A;  3KDP B;  3SWY A;  4ZMD A;  1T8Z A;  2JJL A;  3B71 A;  1IFP A;  1QL2 A;  2B9B A;  3A0B E;  2ZVN B;  3F89 A;  2MJZ A;  3H1K G;  4YTP C;  4D6T D;  1GL2 D;  3W67 A;  5TJH A;  1JM0 A;  3ZDM A;  3MGN A;  3TGU J;  1SFC C;  3NXS A;  1SQQ G;  2I1J A;  4GOF A;  1PGP A;  1ZR2 A;  2BCC E;  1VQ8 P;  1KMI Z;  1EXJ A;  1KB9 H;  2FYU D;  3VMY A;  2A06 G;  1M1K Q;  3M06 A;  4H44 D;  2M5A A;  5BVZ A;  1NTK E;  2YIU C;  3V6I A;  1WRG A;  1N7S A;  1Y8A A;  3CCM P;  1L0N G;  3PLN A;  1AVO A;  4RKU J;  1L4A B;  1MV8 A;  4O9B A;  1FZC A;  3S9O A;  3A7O A;  3L72 D;  5KLV E;  3L74 G;  4GIF A;  2FYU E;  2E75 C;  2P1J A;  1YTZ T;  1NU1 K;  2WSC H;  3A0H E;  5CHX A;  1NTK D;  1L0L E;  1SQQ E;  2O01 H;  1GL2 C;  2RMZ A;  2XKM A;  5APT A;  5AVZ B;  3H6P A;  3M9Q A;  1SQP G;  1YIJ P;  1KZU B;  3HRN A;  3WMM 0;  2Y9Y A;  4GOD A;  1K8A Q;  1EDI A;  1NYH A;  1T3U A;  2CK3 H;  1RHZ B;  2Y0D A;  3EQ2 A;  3CWB E;  1VQP P;  2P7J A;  3LW5 H;  1KD1 Q;  3OAK A;  2FY8 A;  3H1I G;  3HTK A;  5APQ A;  1J1D C;  1SLQ A;  2E74 C;  2HOD B;  3TGU D;  4DJG A;  1LT9 C;  1IK7 A;  2ZFC A;  2GUV A;  1ZN5 A;  2W6J H;  2NPS B;  1NJI Q;  1H0T B;  3CCU P;  3AEA C;  1L0L G;  2BAS A;  2WQY C;  4R4M A;  3M9B A;  5M1B A;  1KQF B;  4CPG A;  1LTT C;  1NTZ D;  3C9I A;  3TDK A;  1Q81 Q;  2FBW C;  3B5N C;  2IBZ E;  1P84 E;  1LP1 B;  1NKN A;  1GU4 A;  3S1K A;  1FDI A;  3HE5 B;  1NAF A;  1ZP0 C;  3GHG B;  1LWU C;  1LGH B;  3PJS K;  2ZYD A;  2JDI H;  3Q5P A;  2YXR B;  1LT9 B;  2QRX A;  3AE9 C;  3L70 D;  2R32 A;  3OJA B;  1G1I A;  4GT1 A;  1HGV A;  3RBZ A;  2KUB A;  1BSN A;  1FC2 C;  1FZE A;  3JC2 2;  3CCL P;  4PV1 B;  4IFD K;  1N86 A;  2FYN C;  5B5E H;  2QA4 P;  1M1J A;  1U57 A;  1SP4 A;  2KIK A;  5AVV B;  2OTL P;  3AE8 C;  3FX0 A;  1L0L J;  2OTK E;  1QVF O;  2KXP B;  4H44 C;  5AVY B;  2WSE H;  1RE4 A;  3AEG C;  1D7M A;  3BRV B;  3H1L G;  1EZV G;  1IFI A;  2IFM A;  2SPZ A;  1SQX G;  1ZW0 A;  3O6Q B;  4IL6 E;  4W80 A;  3OW2 O;  1PPJ E;  1X9V A;  4L73 A;  4WWI A;  1KOR A;  2JP3 A;  2A45 H;  3T97 B;  1U7J A;  1ZLL A;  1G2C B;  1OXZ A;  3IN6 A;  2ZT9 C;  4XFJ A;  1VQ4 P;  1M1J C;  2HLO A;  1FE6 A;  2QIW A;  4TLF A;  1T2K C;  1ZME C;  3RK2 D;  2FXO A;  3I56 P;  5B66 E;  2OYH A;  3D6Y A;  1JY3 P;  1VF5 B;  2ZVO B;  3BVH A;  1FZB A;  2KZI A;  2Y0C A;  3L35 A;  4JYC A;  2YKO A;  3CMA P;  1KYO E;  1EDJ A;  4NPF X;  4AUW A;  1DEB A;  1N7S D;  1NTK G;  2NZ2 A;  1SQX E;  2QJK C;  2XU6 A;  4H13 C;  3V4W A;  2A06 E;  1SQB E;  1A02 J;  3SSU A;  4U3F J;  4D6T J;  3V2P A;  1FAV A;  5AW4 B;  3L74 E;  3A5T A;  1SQB K;  1JCC A;  2YO3 A;  3B5N A;  4OGQ B;  3W68 A;  1PZQ A;  4IL6 X;  2AEF A;  5AVS B;  4WY4 A;  5CBN A;  2P58 A;  2WPS A;  3KPE A;  2WVR A;  2YXQ B;  3L73 G;  4A7P A;  3V2N A;  1KB9 E;  4JBZ A;  1EDK A;  1SFC B;  2OYO A;  1SQQ J;  2ZYG A;  4Y99 C;  1AFO A;  1HBW A;  1HGZ A;  1GDT A;  3HD7 A;  5L8R J;  4U3F E;  3E1R A;  1SQV E;  1YBK A;  2KSE A;  5APY A;  3RK3 B;  3H1K E;  3VP9 A;  2R5B A;  2YIU B;  2ZT9 D;  1AVY A;  1IZN B;  3AED C;  1GL2 B;  3E7K A;  2VRS A;  3Q1M A;  1BE3 D;  2WPQ A;  1FZF A;  4PD4 E;  3RK3 D;  3MIW A;  1H88 A;  4C7N A;  1DX7 A;  1SQV D;  1H89 A;  5KLV D;  1VDF A;  4IFF A;  1W5C E;  3VP8 A;  1KIL B;  1ZRT D;  1FDO A;  3VN0 A;  4YXD C;  5KTB A;  2AEM A;  3L75 E;  2BCC D;  3G4S P;  1HWT C;  1JY2 O;  2IX7 C;  3WUU A;  3RBX A;  5KLV G;  1YQ4 C;  1X22 A;  2E74 B;  3EFG A;  1M56 D;  4GDO A;  4C7R A;  1W2B O;  2V4H A;  1IFM A;  1PP9 D;  1X0T A;  1VQM P;  1NU1 D;  1T2K D;  1RF1 B;  1JY3 O;  4UB8 E; 
#chains in the Genus database with same CATH homology
 3JC2 2;  1RH5 B;  2YXR B;  3MP7 B;  1RHZ B;  2YXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...